4MQ3A

The 1.1 angstrom structure of catalytic core domain of fiv integrase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
129
structure length
129
Chain Sequence
MGIWQMDCTHFDGKIILVGIHVESGYIWAQIISQETADCTVKAVLQLLSAHNVTELQTDNGPNFKNQKMEGVLNYMGVKHKFGIPGNPQSQALVENVNHTLKVWIQKFLPETTSLDNALSLAVHSLNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Identification of phe187 as a crucial dimerization determinant facilitates crystallization of a monomeric retroviral integrase core domain.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 43
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mq3A00
3V9SA 1NKEA 4CK2A 1VSEA 5C24A 3HPGA 4BDZA 4CJRA 1QQCA 4OPJA 4CIGA 2LSNA 3L2VA 2I5JA 1SV5A 1RT5A 2Z1GA 2EHGA 3SV4A 2BDPA 4KI6A 3ZSQA 4BE0A 1SUQA 4OJRA 3DMJA 4DF8A 2Y1JA 2VG6A 3DLHA 4FJMA 3QINA 4B9VA 1T03A 4CFBA 5SWMA 3CFRA 3PY8A 4I7FA 3SJJA 1L5UA 4NCGA 3SUOA 2P5OA 1T8EA 3ZT2A 3RRHA 3ALYA 4DSLA 1A5VA 1NK0A 3T1AA 2RKIA 1EXQA 3ITHA 4NYNA 3T19A 4FJ7A 1JLQA 1TKTA 4AHCA 4CHZA 2YKMA 3NGIA 1L3VA 4PWDA 2Y1IA 4HTUA 3NCIA 2AJQA 2FBYA 4CGHA 4DS4A 1Z26A 2KFZA 1C1BA 4CF0A 1WNSA 3ZSRA 3KK2A 1SL2A 1NK5A 3O4NA 1QSLA 4OGCA 1RT7A 2JLEA 1BL3A 2IAJA 4B8CA 3I0RA 5J1EA 3OVNA 4DFKA 1NK8A 1SKRA 2HHUA 4DTUA 4FCYA 1HRHA 1NK4A 3S3NA 3KKRA 2X6NA 3OYKA 2E6LA 2GBZA 3EY1A 4F3TA 3K5MA 4CK1A 1RTJA 3OS1A 2HHWA 3AV9A 1TK8A 3VQAA 4IDKA 1J5OA 3D45A 5CYQA 2G8VA 4Z4GA 4I2QA 4KV8A 4Q5VA 2ZD1A 1NJWA 2G8IA 3QNNA 2Z1HA 4OKKA 3D0PA 3TAEA 1C0UA 1WAJA 1ASVA 1BQMA 1U4BA 1MU2A 2IS3A 4FK0A 1S6PA 3EYZA 1LWFA 1XWLA 2YHBA 3ZT3A 3VQ8A 3OS0A 4FZXC 4OLAA 3DLKA 4RW9A 3KLIA 4DSJA 4PQUA 3NAEA 4LD0A 2XRIA 3ZSZA 3NBPA 1WSGA 2B6AA 3K5LA 3MXIA 4I9QA 4FYDA 3HL8A 4W5OA 5KGWA 3MXMA 1ASWA 1BCOA 1BCMA 1NJYA 4FJGA 1U04A 3L2UA 4QAGA 1TL3A 4O4GA 3KLFA 5J2PA 1LWCA 3QESA 4CECA 2YHAA 4EP4A 3LP2A 4DSKA 4GW6A 3B6PA 3NE6A 1CZBA 1WAFA 4LSNA 4O44A 4BWMA 4CEOA 3LZJA 4M3WA 4EP5A 3DRSA 3MXJA 4IFYA 3RMCA 3CFOA 2OYQA 3SUPA 4DF4A 3QIOA 1WSIA 1KSPA 4M3XA 1LAVA 4RW6A 3OS2A 4FLVA 3O3FA 3KD5E 1HYVA 3PUFA 3VQ9A 1ZBUA 3DLGA 3AO5A 5DK5A 3LWLA 3M8PA 1D5AA 4CIFA 3K58A 4F8RA 3O3GA 4FW2A 4CEFA 1QSSA 1UAXA 3IS9A 4DQQA 3PV8A 1R0AA 4KHQA 4DFJA 3VA3A 5HP1A 1N6QA 3P5JA 3L3VA 1RT3A 4CJEA 1HYZA 4CHPA 1J9AA 4RW7A 3WNFA 3RMDA 4FK4A 3VQBA 4CHOA 3KLGA 3DI6A 4ZTJA 4CJUA 4FZZA 3RR7A 1F21A 3CFPA 2YNIA 5HRNA 1TL1A 2XY8A 4B8AB 1NKBA 3L2QA 3HM9A 4B9NA 1WSFA 4KHWA 1JLGA 3IG1A 5D3GA 4M42A 4FLZA 3SQ0A 4E7IA 4CFDA 3IAYA 3NH1A 3S3OA 4E3SA 3THVA 1LW0A 1RBRA 4CGJA 1NK7A 4FXDA 3AO2A 4W5RA 1HNVA 1QE1A 4DTSA 4Z4IA 2ATQA 1GOCA 1KFSA 2QXFA 4DMNA 4L8RB 3AVKA 2XHBA 2EX3A 4O5BA 1C1AA 1I39A 3TAPA 3OYBA 4KHNA 1HYSA 1HQUA 3AO4A 5K14A 3OYIA 3WNGA 3UIQA 5C25A 3LPTA 1RBSA 3QEPA 4QOZB 4B08A 4DTXA 1WLJA 4Z0UA 1ZBLA 3ZT0A 3V9UA 5I3UA 2NUBA 3C6UA 4G1QA 1X9SA 4K8ZA 4E7HA 2KW4A 4KRFA 1NOZA 1XI1A 4QCLA 1REVA 3CM5A 1TV6A 3LANA 1LW2A 3TAGA 3K5OA 3QLHA 3TARA 4YNQA 4UQGA 3NFAA 1Q8IA 3AVNA 4FJIA 4K8XA 3FFIA 5C42A 4YFUA 4CGGA 3V6DA 3K2PA 3VQDA 4CF8A 4HVJA 1WSJA 3HVRA 1B9DA 2B5JA 3OYFA 3AVGA 1SL0A 3KTQA 2PY5A 2FBXA 3VQQA 4BE1A 1J54A 1HQEA 3SPZA 1FKOA 2XY7A 1QSYA 2HVHA 1JL2A 3K57A 2D0BA 3DLEA 4RW8A 1VSLA 3V1RA 4MQ3A 1LV5A 3SV3A 4CEDA 2WOMA 4FK2A 3OY9A 3DLRA 1BIZA 4CJ3A 2YNHA 1NK6A 3AVBA 4M3ZA 4H8KA 3L3UA 5JS1A 1QHTA 4LH4A 4DWIA 3TAFA 1S1TA 2Q3SA 3K5NA 3L2WA 1XHZA 3LZIA 3OJSA 2F96A 1UOCA 3SYZA 1VK0A 4Z4FA 3V9ZA 2KFNA 4C8NA 3V81A 4W5TA 1JXBA 3PX6A 2OZMA 3WNHA 3ZSVA 4ICLA 1WSHA 1K6YA 1C6VA 3CYMA 4CJPA 3OYDA 3AVMA 1CLQA 2P51A 3A2FA 2OZSA 1EX4A 2GV9A 1LAWA 3ZSWA 3L2RA 3DOKA 3QEWA 3HJFA 3NHGA 3NF9A 3OYMA 4FJ8A 2B4JA 2HNYA 4GVMA 3AA3A 2QK9A 3LP3A 4FM2A 1S6QA 3AO3A 5KTQA 1RDBA 2XO7A 4BE2A 3SZ2A 4AHTA 5KRTA 3ZSYA 2YV0X 4F2SA 3VQ7A 1YVUA 3AVFA 3JYTA 1VSMA 3G10A 4O55A 1RTHA 2X78A 4CGFA 3MEGA 4W5QA 4B9TA 2HW3A 1ZBHA 4FLUA 1I3AA 3SNNA 1CXQA 2G8HA 1NK9A 4LH5A 4J2EA 5HBMA 4IKFA 4B9LA 4GMJB 3ASMA 4AHRA 5T7BA 3NGZA 3VN5A 1YTUA 3HVTA 1RBTA 4KO0A 4OVLA 3V9XA 4B3OA 2DFEA 4JS5A 4PY5A 2W42A 4C8LA 2IDOA 3WNEA 1ZBIA 4OLBA 1KTQA 2X74A 3EZ5A 3AA5X 4F4KA 1DTTA 1L3TA 1D8YA 1Z25A 4AHUA 4FJNA 2GUIA 2ETJA 2OPRA 3O4QA 5CZ1A 3OYAA 3HSTB 2Z1IA 2XY6A 3M8SA 3T3FA 3OYEA 1VRUA 3KJVA 4DQSA 5J2MA 3LP0A 1RDDA 1JLEA 2RF2A 3QIPA 1RT6A 3U3GA 1KLMA 4CEQA 4DTJA 4O0IA 4KAZA 1BI4A 5DMRA 1N5YA 3MEEA 4DQIA 2P1JA 1QS4A 2HNDA 4FLXA 4CJ4A 3RMAA 1VSHA 4DTOA 4CF1A 4BDPA 1S1XA 1NKCA 1RDCA 4DSFA 4HCBA 3SUQA 3P83D 2FC0A 4ZTFA 2OA8A 2D0CA 3G0ZA 4FVMA 1SKSA 4TSXA 2HVIA 3ISNC 2G8FA 1UA0A 3VQEA 1VSFA 2ZE2A 3HP9A 4IBNA 3ZCMA 3LAMA 3LPUA 4CEZA 4N5SA 2KTQA 3QO9A 5CYMA 1QTMA 3S3MA 2OPPA 2HHSA 4CEEA 1NJXA 4M45A 4O0JA 5J2NA 5FRMA 2RPIA 4JS4A 1KVAA 3OYGA 1GOBA 4KTZA 3LDSA 2F8SA 3SPYA 1ITGA 4CK3A 1JLBA 3VA0A 2HMIA 4PA1A 3V1QA 3AVJA 3ZSOA 1S9GA 4JRQA 3QEVA 3KK1A 4JLHA 1JLCA 1FK9A 5J2QA 5CZ2A 2JGUA 4R5PA 4M3UA 2F8TA 3C95A 4Z4HA 1NJZA 1HMVA 3DOLA 3NF8A 4Z4CA 4HUEA 1SKWA 3PX4A 2QKKA 4IFVA 3SCXA 3SQ2A 2A1SA 3AVAA 3KKSA 1KCFA 1YT3A 2DFHA 4E19A 4DS5A 1IH7A 3KLHA 3DLBA 1TAUA 3AA2A 4FJKA 4LY7A 1HNIA 3M8QA 5KGXA 4E1MA 3LWMA 3QEXA 3ULDA 4FJJA 3DRRA 3HT3A 1XC9A 3OYCA 4DLEA 3TI0A 4C8MA 2HHTA 3V9WA 1VSKA 4DFPA 2ITGA 1RDAA 4IG0A 1S1VA 4FZYA 3BDPA 2OPQA 1X9WA 2YKNA 2G8KA 1C0MA 4F2RA 2HHXA 3RWUA 3AVCA 1X1PA 4KREA 3ZT4A 1VSJA 4CJQA 3RMBA 4OKEA 4LSLA 4CGIA 3MAQA 4DFMA 1D9FA 3O3HA 1KLNA 4HCCA 1A5XA 5HLFA 4ZHRA 4RW4A 1X9MA 3AVLA 4KTQA 4OPKA 4OGEA 1TK5A 1JLFA 5EU7A 4BACA 1RT1A 1RILA 4KFBA 4DSEA 4FJXA 4HHTA 3TAQA 2A1RA 3JSMA 3K59A 2DFFA 4E7LA 1LWEA 1Y97A 1W9HA 4BDYA 1RCHA 5FROA 2KQ2A 1JLAA 1A5WA 2BANA 3PO5A 1ASUA 4E89A 3QEIA 1DLOA 3NH0A 1RNHA 3VQ6A 5HRRA 1RTDA 4CJKA 4HUFA 4DU4A 2XY5A 3AO1A 3V1OA 2O4IA 3TANA 1DTQA 1TKXA 3TAMA 4C8OA 4CESA 1EKEA 1BISA 2VG5A 4BWJA 4N76A 4AH9A 4CE9A 5FRNA 2G8UA 4E7KA 2HB5A 4I2PA 4HUGA 4NCBA 2HNZA 2VWJA 3QETA 1D9DA 3U3YA 4CHYA 3TABA 4FM1A 3SQ4A 1CZ9A 3ZSXA 1L3SA 4AHSA 3OJUA 4CJLA 2VWKA 3SQ1A 3I8DA 4N47A 3OYLA 2IOCA 4M3RA 3NGYA 4FLWA 1S9EA 4DQRA 2HHVA 4CEBA 1BIUA 1RBVA 4CEAA 4CF9A 4KB1A 2KZMA 1BI4B 2E4LA 3LP1A 4CFCA 1Q9YA 4Q0BA 3OYNA 1KFDA 4JRPA 1FXXA 4CGDA 1T7PA 3LALA 4E7JA 5KRSA 3I0SA 3DM2A 4DTMA 3V4IA 3MECA 4B9MA 3HPHA 3PO4A 1RT4A 1U49A 1GOAA 1BHLA 2DTUA 4DTPA 2YNGA 4IG3A 4Z4EA 3TR8A 1IKYA 4DQPA 4ELVA 3LAKA 1NOYA 4M3TA 3U6FA 4CHQA 1C0TA 1HJRA 4FLTA 4KHYA 4XIUA 1WSEA 3IRXA 4E0DA 4I9LA 2PZSA 4ID1A 2IGIA 1IO2A 4MFBA 3SI6A 2DY4A 1G15A 4NCAA 1BGXT 1T05A 3KLEA 2YNFA 3NDKA 3M8RA 5I42A 2FBTA 2O4GA 2E6MA 3HXMA 1TVRA 4FLYA 4CJTA 1RBUA 1YTAA 1ZBFA 1C1CA 3KD1E 4KPYA 2FBVA 3OYJA 2PYJA 4CIEA 4CHNA 4DLGA 4ELUA 2X6SA 4KB0A 5E41A 3L8BA 2ZQBA 1BQNA 1RT2A 1SL1A 1B9FA 4CJWA 1IKVA 4KI4A 3P1GA 4ELTA 4DTRA 4M41A 4Y1CA 4CF2A 3KK3A 4DU1A 3AVHA 3H08A 4FW1A 1Q9XA 4EZ6A 2RN2A 4J2AA 3QERA 1KVBA 1TGOA 3AVIA 5HRSA 2P5GA 3F73A 4EZ9A 3E01A 4B9UA 2PYLA 1VSIA 1HPZA 4CFAA 1TAQA 4AHVA 4DU3A 3PX0A 1KVCA 1S5JA 3AA4A 3HYFA 1IKWA 4WE1A 5KI6A 4DTNA 3RR8A 2BGGA 3NF6A 1EETA 4AILC 4KHUA 1TK0A 3CG7A 5SZTA 2WONA 4CCHA 4FJ9A 4J2BA 4DG1A 3DRPA 1JKHA 1IG9A 3C94A 3SUNA 3VQ4A 3ZT1A 3CQ8A 1UA1A 5HRPA 2R7YA 1U47A 1L3UA 2KZZA 3MEDA 1S1UA 2VG7A 4CJVA 4F3OA 1XHXA 1W0HA 5CY4A 3VQCA 3OYHA 1TKDA 3F9KA 4N41A 2HHQA 4FJLA 1FKPA 2D0AA 4H4OA 2OPSA 2BE2A 4CJSA 4Y1DA 5HROA 3RRGA 3QNOA 4N56A 4NYFA 1O1WA 1U48A 4PUOA 4E1NA 3HO1A 4H4MA 3C6TA 1RTIA 1UWBA 1WN7A 1VRTA 4DSIA 3S9HA 1JXEA 4OKJA 4CJFA 4C8KA 2QKBA 1CXUA 4KTWA 2Z1JA 3TWHA 3VQPA 1IKXA 3HP6A 4CJ5A 3HPOA 1KRPA 5JS2A 3KIOA 3RTVA 1TKZA 3B6OA 1B92A 4W5NA 1VSDA 2D5RA 3BGRA 1S1WA 3DYAA 4ID5A 1ZYQA 2G8WA 4B9SA 1J53A 4J2DA 3NH2A 5FDLA 1JL1A 4FM0A 4KKOA 3HK2A 2IC3A 3VQ5A 1EP4A 4RG8A 1U45A 3CM6A 4FJHA 4FJ5A 4M3YA 4KHSA 4CERA 3NF7A
chains in the Genus database with same CATH superfamily
4CK2A 5C24A 3HPGA 4L3QA 4OPJA 4CIGA 3L2VA 4BRDA 4UY8O 2PBDA 2EHGA 4BRGA 3ZSQA 3TTDA 1SUQA 2Y1JA 2VG6A 4FJMA 1T03A 3CFRA 4BRIA 3VESA 3C6AA 3RRHA 2RKIA 3ITHA 2V7ZA 1L3VA 2YKMA 3ZETA 1KAXA 4HTUA 1C1BA 1WNSA 2CGJA 4K42A 1BL3A 2IAJA 3O08A 1HRHA 3BZCA 1V4TA 2E6LA 3EY1A 3CMEN 3O6WA 4RTFD 3UKRB 4CK1A 5AQWA 1EWRA 2ZJQL 1N8RO 5CYQA 3R1XA 5CE3A 4M7YA 1VQ4N 2ZD1A 1NJWA 2G8IA 3QNNA 4WCEL 3TAEA 1U4BA 1MU2A 4FK0A 1LWFA 3RSEB 3J8AA 3DLKA 1YITN 4BR4A 2O8BB 4PQUA 4FYDA 2P9UA 1FW6A 5KGWA 2P9NB 1BCOA 3THYA 5KQDA 5AQPA 1TL3A 3I8BA 2YHAA 1NGDA 4ISFA 1CZBA 1Q86O 3FE1A 3SK3A 4M3WA 1P8ZA 3CFOA 1KSPA 4RW6A 4ILJA 4BRQA 3KD5E 2A5XA 3VQ9A 3DLGA 3LWLA 3M8PA 4F8RA 3ZLJA 1EQYA 3A5OC 4JD2A 3OTOK 5HP1A 2O8CA 3K9KA 1HYZA 4JI1K 4R79A 3WNFA 3RMDA 3VQBA 4JKCA 3OBWA 3KLGA 5C10A 4GV6A 1HUXA 3FZMA 5AQVA 3AAPA 4B8AB 1NKBA 3L2QA 5M1OA 4BQZA 2QXLA 4B3MK 3P39A 2P9KA 4NO7A 1RBRA 2E2PA 3O80A 4DTSA 2ATQA 3WXMB 2XHBA 4O5BA 1C1AA 3MCPA 3WNGA 3UIQA 2CH5A 4QOZB 4B08A 4Z0UA 2J4RA 3IUCA 2NUBA 3C6UA 4G1QA 1Y64A 4K8ZA 4BR2A 3EEQA 3CM5A 1LW2A 4BRHA 3TARA 4IEIA 4CI6A 5C42A 3LDQA 4YOYA 3VQDA 4CF8A 1WSJA 3CCJN 3KTQA 2E1ZA 5BR9A 5M1PA 3DXKA 4IZ9A 3DLEA 4MQ3A 4O8KA 4CEDA 2WOMA 1YJNN 3DLRA 5JS1A 3CQXA 3OBYA 2Q3SA 3R6MA 4YOTA 3SYZA 4OPHA 1XHZA 4B3RK 3V81A 1Q7YO 2OZMA 2QWLA 3ZSVA 1HR0K 4ICLA 1K6YA 3OYDA 5B8HA 3AVMA 1MWMA 2GV9A 3QEWA 4FJ8A 4H0OA 3LP3A 1S6QA 5KTQA 2AA4A 5KRTA 3ZSYA 2YV0X 4DUZK 1YVUA 3AVFA 3K9JA 1VSMA 2HW3A 3MEGA 3VEOA 1N33K 1ZBHA 1Z6RA 4J2EA 4IKFA 4ISGA 4B9LA 1W2BM 4GMJB 5T7BA 3CCVN 4GKKK 3VN5A 1YTUA 3V9XA 1K73O 4B3OA 4JK9A 4XH1A 1IG8A 1QQNA 3ULEB 1BOTO 1KTQA 5BREA 4F4KA 1RDWX 3TU5A 2O8EA 4FJNA 2WFBA 4AQYK 3FLCO 3A5NC 5EVZA 3OYEA 5J2MA 3VEZA 1GLAG 1RT6A 3J7ZO 1KLMA 4CEQA 4BVPA 3UKRA 3MEEA 4H5WA 4LF8K 4DTOA 4MDBA 4BGAA 2FLOA 1T44A 2FC0A 1SKSA 3PSIA 3RSEA 1VSFA 4IBNA 4DV6K 3ATUA 2KTQA 1XUPO 2GWKA 2OPPA 2HHSA 1NJXA 4HTLA 4M45A 3KWGA 2P9NA 4JS4A 2IVOA 3MWTA 1YF5L 5C12A 4JK8A 3L6QA 4JKDA 3CC4N 1S9GA 3QEVA 1JLCA 3FFKB 2YJFA 3DOLA 3L0QA 1QVGM 3NF8A 1SKWA 5EX5A 1YT3A 4DS5A 1IH7A 3GDQA 3LM2A 3THWB 3AA2A 1GLLO 1HNIA 3QEXA 4FJJA 3QICA 3CCQN 1XC9A 2HHTA 1U2VA 3HBTA 2ITGA 3RWUA 4KREA 4CJQA 4CGIA 1KLNA 4LFAK 4ZHRA 3AVLA 2UYTA 4BACA 2O8FA 3BY5A 1LOTB 3THXB 2D0OA 2DFFA 1Y97A 3JS6A 5ADXA 4DR3K 5FROA 1JLAA 1A5WA 3U9ZA 3PO5A 2QWPA 4E89A 3WEEA 1DLOA 2ASMA 2JWKA 2P9SB 3NH0A 3WXJA 3TANA 3TAMA 4C8OA 2VG5A 1ATNA 4AH9A 2P9LA 5FRNA 1MA9B 4E7KA 2HB5A 1R59O 4FWKA 1FJGK 4AHSA 2I7PA 2I7NA 2BUPA 1NGFA 4XH4A 3I8DA 2IOCA 2BTFA 4O8UA 3NGYA 2QA4N 1HNZK 2GX9A 1BIUA 2WTUA 2KZMA 3LP1A 4CGDA 3LALA 1W7AA 4WYBA 3I0SA 5E84A 3MECA 3PO4A 1XC3A 1U49A 3FZKA 1BHLA 4YHHK 1JCGA 4JV5K 3T1YK 1DKGD 3I55N 4CHQA 1WSEA 1WBBA 4E0DA 4BRPA 2IGIA 4MFBA 4CZJA 4NCAA 4LFBK 3VMFB 5I42A 2O4GA 4FLYA 4QS9A 1C1CA 4JEPA 4KH4A 3OYJA 2PYJA 4CIEA 4CHNA 4ELUA 4KB0A 5AQIA 4BRMA 3C7NB 4IOAL 4DTRA 4M41A 4DU1A 5KPTA 4J2AA 4EZ6A 2UU9K 3QERA 1C0GA 4CJ7A 3E01A 3LM9A 1NJIO 3LDPA 3U8XA 1VSIA 1HPZA 3PX0A 1S5JA 2YJEA 2QEXN 4IOCL 1YI2N 3CG7A 2GEMA 4KBOA 1TK0A 2IVPA 3C65A 5M1KA 5CR4A 4CBWA 5EXWA 1UA1A 1U47A 5HRPA 3MEDA 4JI4K 4CJVA 1XHXA 1W0HA 3VQCA 5GAHP 3F9KA 1HKBA 4BRNA 4H4OA 1BG3A 2V51B 3QNOA 4PUOA 4BRLA 2P9PB 2E20A 3AARA 1RTIA 1NGHA 1WN7A 3S9HA 1JXEA 4OKJA 4CJFA 2QTDA 2ZJRL 2QKBA 1VQ6N 1CXUA 2Z1JA 4A2AA 3VQPA 1IKXA 3OW2M 1Q82O 1KRPA 3KIOA 3B6OA 4W5NA 1BWFO 3DYAA 3J80O 4B9SA 3T69A 4J2DA 3NH2A 4KKOA 1EP4A 4RG8A 3EE9A 4KHSA 2QWQA 4IFEA 2E2OA 3NF7A 4B1VA 3GBTA 1QQCA 2P9IB 2LSNA 1SV5A 1Q18A 5TKWA 1RT5A 3SV4A 3SAFA 4BE0A 4OJRA 4DF8A 3DXMB 3DLHA 3VTHA 4B9VA 4CFBA 5SWMA 1N32K 5AQUA 3O1WA 4IXCA 1D4XA 2P5OA 1A5VA 1NK0A 3T1AA 4AM7A 4IDHA 1EXQA 4H5VA 1TKTA 4CHZA 1YHQN 3NGIA 2Y1IA 4BG8A 5EY4A 3NCIA 2FBYA 4DS4A 2AJQA 3THWA 4DKWA 4A62A 4CF0A 4H0VB 1SL2A 3O4NA 1SKRA 2EWSA 5ADXH 3L4QA 4NXMK 3S3NA 3KKRA 2VWBA 1HX1A 2WC9A 1J5OA 2UXDK 2G8VA 3SAGA 2Z1HA 4OKKA 1C0UA 1ASVA 1BQMA 4H0YB 4B1XB 3ZT3A 2YHBA 2RHKA 4FPAA 4DSJA 4PL7A 4LD0A 2XRIA 3ZSZA 1WSGA 2B6AA 3J7YP 3HL8A 4ILGB 4BROA 1NJYA 1ASWA 4FJGA 1U04A 3L2UA 4BR7A 5J2PA 4CECA 3LP2A 4I6MA 3B6PA 3CMAN 2UUBK 1WAFA 4CEOA 4NLBA 4EP5A 5AQRA 4IFYA 3RMCA 2OYQA 4DF4A 3QIOA 3O3FA 4CZHA 1D5AA 4CIFA 3K58A 2V52B 3O3GA 4FW2A 4CEFA 4DFJA 4LF4K 4CD1A 5BPMA 2KKZA 1RT3A 1VQ9N 4FK4A 4CHOA 3DI6A 1TUYA 5HRNA 3VF4A 2WUSA 4CD3A 2OANA 4B9NA 4F9OA 4KHWA 5GADP 2NRWA 3WXKA 5D3GA 3SQ0A 3IAYA 3S3OA 4E3SA 3THVA 4CGJA 1NM1A 1NK7A 4FXDA 3UE5A 1HNVA 1VQLN 1KFSA 3SBGA 4DMNA 1NGAA 3S41A 1HNWK 4X64K 3VF6A 3AO4A 1RBSA 3GL1A 2YHYA 3QDKA 1ZBLA 3ZT0A 2QI2A 3V9UA 4HWIA 5IT9O 3TTCA 4KRFA 4XH5A 3LANA 3TAGA 5AZIA 4B1YB 3QLHA 4YNQA 1ATRA 3NFAA 3AVNA 5AQQA 3VEVA 4K8XA 3FFIA 5TKYA 4MLEA 2NRVA 3H46O 3K2PA 4RCHA 4HVJA 3V6DA 2B5JA 1XQSC 1SL0A 1YVNA 1J54A 2XY7A 1JL2A 2IVNA 4CZGA 3V1RA 3FZFA 3D2EB 2ZGYA 4C1NK 4WF9L 4FWQA 1NK6A 3AVBA 3VF2A 1N34K 1S1TA 1BUPA 1ZC6A 4Z4FA 1UOCA 4C8NA 1JXBA 2E5LK 4CJPA 1CLQA 3A2FA 5AZJB 4FVUA 1EX4A 3NHGA 4JKEA 5GIPA 2E8AA 4FM2A 3AO3A 2XO7A 4AHTA 4F2SA 1I94K 4O55A 2X78A 4W5QA 5GAEP 2NZTA 4K43A 4XEIA 4FLUA 1I3AA 1ESVA 3ZEUA 4LH5A 1NK9A 5HBMA 3ZX3A 4MLHA 4BR0A 3O8MA 3HVTA 4OVLA 4EHUA 1ZBIA 2X74A 3AA5X 1D8YA 2OTJN 2GUIA 1IBKK 3HSTB 2XY6A 3CPEA 4JHDB 3T3FA 2OTLN 1RDDA 2CGKA 3M1FA 3EE8A 3MX5A 2RF2A 3CJCA 3QIPA 2UXCK 4KAZA 1BI4A 1N5YA 5LL6Z 1OH5A 2P1JA 1QS4A 3CPWM 5JMVA 4FWSA 3RMAA 3O9RA 1VSHA 4DSFA 3SUQA 2O8DB 3C0BA 2D0CA 3G0ZA 1EWQA 3ISNC 4JKGB 2G8FA 4FJ9A 1ILYA 2NRRA 3HP9A 4CEZA 4YOXA 2HHHK 4N5SA 2VGMA 2NRXA 4O0JA 3VGMA 4CZFA 2RPIA 5J2NA 3MN6A 1X3NA 3NMUA 1GOBA 2NRZA 1ITGA 4CK3A 3VA0A 4O5FA 3V1QA 3P38A 5KPZA 3AVJA 4MO4A 3WT0A 4JRQA 3O4WA 5CZ2A 2ZF5O 4Z4HA 1HMVA 4GY2B 5BN8A 3M3ZA 5FPNA 3PX4A 1TYQA 2A1SA 2NRTA 3KKSA 1KCFA 4E19A 2DFHA 4CZEA 3KLHA 3BEXA 1TAUA 4FJKA 4LY7A 3M8QA 4DV5K 4E1MA 3OYCA 3E9OA 3V9WA 1VSKA 5LMNK 1K8KA 2ZWHA 4IG0A 3BDPA 5FPDA 3KZBA 1BA0A 1X1PA 3ZT4A 3AGRA 3QFUA 4LSLA 4OKEA 4DQ8A 3MAQA 4DFMA 4HCCA 3R3LA 1RDUA 1OVQA 1NWKA 4H5TA 4OGEA 1TK5A 1JLFA 1IBLK 1RT1A 1RILA 4KFBA 4FJXA 3JSMA 3K59A 4GNIA 4E7LA 4CW7B 4DV4K 1W9HA 3UKUA 4IWVA 4BDYA 1RCHA 3LDOA 4IO8A 3QEIA 3ZX2A 4HUFA 2XY5A 3V1OA 1OKJA 2HBJA 3H6EA 3CQYA 1EKEA 1BISA 3MX2A 4BWJA 4JKBA 3SMPA 4CE9A 4I2PA 4NCBA 2VWJA 3U3YA 1L3SA 4U67L 2HBMA 4CJLA 1VQ7N 4H5NA 2UUAK 4M3RA 4FLWA 1S9EA 3TSQA 2HHVA 4CEBA 1RBVA 4CEAA 2E4LA 4JI6K 1Q9YA 1OH8A 1KFDA 4PHTX 3LL3A 4QS7A 3KK7A 4DTMA 3HPHA 3D2EA 1E4FT 2DTUA 3BF1A 5F1XA 5DM6L 1IKYA 3J81O 1C0TA 4FLTA 4AF1A 1QVFM 3IRXA 5AJ3K 2PZSA 2Q0RA 4ID1A 4BREA 4WFAL 3VERA 1T05A 4G9ZA 2YNFA 5JLFA 2E6MA 3M6GA 3HXMA 4H03B 1RBUA 1YTAA 1ZBFA 4OX9K 4JI5K 4M63C 2VGNA 1VQNN 1JCEA 1XMOK 1DGKN 5E41A 3L8BA 2ZQBA 1SL1A 4KHPK 3P1GA 2O8BA 3H08A 3HZ6A 1HKCA 2KLAA 3A0IX 1NBWA 3F9MA 5AQXA 2W6LA 3AVIA 5HRSA 4B9UA 4IJAA 4DU3A 1TAQA 1KVCA 2BGGA 1NMNA 1EETA 4CCHA 2QWOA 3DRPA 1JKHA 2FSNA 3C94A 3G6EN 3SUNA 3VQ4A 3ZT1A 2KZZA 4IO9L 1L3UA 4F3OA 4N41A 5CY4A 1T6CA 4BRAA 5HROA 2ZM6K 4NYFA 1O1WA 4E1NA 3R9PA 1UWBA 1VRTA 4DR7K 2VQEK 3KHYA 4KTWA 1GLJO 4CJ5A 2W40A 3HOTA 3RTVA 1TKZA 1B92A 5LMUK 1S1WA 1ZYQA 2G8WA 3BP8A 5FDLA 4FM0A 2IC3A 3VQ5A 2HBKA 2YCHA 1KD1O 4JN4A 3V9SA 2GELA 3D2FB 4BDZA 2I5JA 3O9UA 2Z1GA 1V4SA 2IIRA 3A5LC 3DMJA 3QINA 1L5UA 4NCGA 3SUOA 3G4SN 3ZT2A 3ALYA 3MCAB 4NYNA 3PLAA 3CJAA 3I56N 4CGHA 1YIJN 3KK2A 1TUUA 3ZSRA 1NK5A 5J1EA 2JLEA 4B8CA 2HHUA 3I0RA 3OVNA 4H0XB 4FCYA 3O1BA 3OYKA 2ASPA 3K5MA 3O5BA 3AV9A 1ATSA 3CJ7A 1WAJA 4CBUA 1S6PA 3RVCA 4BGBA 3EYZA 2ZJPL 4FZXC 4OLAA 4X65K 3SAHA 3NAEA 3NBPA 5I9EB 3K5LA 4IEEA 1IV0A 4RWTA 1GLEG 4O4GA 3KLFA 5AQGA 3QESA 4EP4A 4DSKA 4GW6A 3NE6A 1O13A 4FSVA 4H0TB 4LSNA 4O44A 4BWMA 2FF3B 4DR6K 5JLHA 3A5MC 5IWAK 3SUPA 3KWIA 3P31A 4M3XA 1LAVA 3OS2A 4FLVA 3WQTA 2V7YA 3AO5A 5DK5A 4JAXA 1QSSA 2YI1A 1UAXA 3PV8A 4BQLA 1R0AA 4KHQA 4JI0K 4CJEA 4CHPA 1J9AA 1NGEA 2YHXA 4JKHA 3ULEA 4FZZA 5ELZA 3G71N 1F21A 3CFPA 4B1UB 1TL1A 2XY8A 1SZ2A 2AP1A 1WSFA 3U4LA 4E7IA 3SLCA 4CFDA 3AO2A 4BVOA 1KAYA 4W5RA 1WUAA 5HOOA 1QE1A 3LDLA 4BY9C 4BG9A 1GOCA 2QXFA 3VTIA 2EX3A 3TAPA 4IJNA 3OYBA 1OH6A 4KHNA 5K14A 3OYIA 3TSUA 3CXCM 3CJBA 3LPTA 4DTXA 2GTDA 1NNEA 4LF6K 4CZMA 1HPMA 2A40A 3R8EA 4E7HA 2KW4A 3ZETB 1NOZA 4QCLA 1TV6A 1JCFA 3HTVA 1W97L 3I33A 4M7XA 3CCMN 3VOVA 4FJIA 4YFUA 3UB5A 1B9DA 3AVGA 1X9JA 2PY5A 3VQQA 1NGBA 1HQEA 5AQMA 4BE1A 1G99A 1QSYA 2HVHA 2YX6A 5KQ8A 2D0BA 4RW8A 1VSLA 4EIAA 3FR0A 3QBXA 4EAHD 1LV5A 3SV3A 5FPEA 4YDUC 4J8FA 4FK2A 1BIZA 2OCEA 4CJ3A 2YNHA 5C15A 4M3ZA 1QHTA 4LH4A 3TAFA 3L2WA 3LZIA 3OJSA 2F96A 1VK0A 2P9UB 4W5TA 4FOIA 2QW9A 3THYB 1WSHA 4YY3K 4YOUA 1S22A 5DM7L 4ILHA 1C6VA 2PFUA 3LDNA 4CZIA 3WXIA 3L2RA 4JK7A 1XMQK 3HJFA 3NF9A 3OYMA 2ZGZA 2B4JA 2HNYA 3AA3A 2QK9A 4AM6A 1RDBA 1SQKA 2O4IA 3VEXA 1RTHA 2GUPA 2UUCK 4B9TA 2F9WA 3SNNA 3THXA 3B8AX 3Q7BA 4WQ5A 1VAZA 4JD2B 3ASMA 1NU0A 5CHIA 2P9SA 1BA1A 5FLXO 4DUYK 2O8CB 3E1YA 1RBTA 2Q1NA 4KO0A 2DFEA 1YAGA 4JS5A 4PY5A 4WQ4C 2IDOA 1H1VA 3WNEA 1MWKA 1VQPN 2HMPA 3H1QA 3IFRA 2ETJA 2OPRA 1RGIA 3O4QA 4BRFA 2Z1IA 4Y0WA 3KJVA 1VRUA 1JLEA 3IMXA 4CZLA 4LFCK 1E3MA 4DR5K 2P9KB 3U3GA 1RFQA 3MMVA 4YORA 5DMRA 2HOEA 1GLFO 5MLCQ 4JKAA 4FLXA 4BDPA 4CF1A 5AQJA 4DV7K 1RDCA 1NKCA 4HCBA 2OA8A 1U6ZA 5JVHL 2ZE2A 3LPUA 3EN9A 1QTMA 3S3MA 5FRMA 4OO1J 4PKHA 3MN5A 2QWMA 1JLBA 1ZBSA 4B1ZA 4PA1A 3ZSOA 3KK1A 2JGUA 4R5PA 3CCRN 2F8TA 1NJZA 3DXKB 4X66K 4YOWA 4C1NI 4PKIA 4CBXA 2QKKA 3C7NA 4IFVA 3SCXA 5GAGP 3SQ2A 2HF3A 5JICA 4NB4A 2NLXA 3EZWA 5BRFA 3DLBA 1GLCG 3IDHA 5KGXA 5AQFA 4B3TK 3QB0A 3DRRA 3ID6A 4DV2K 3HT3A 4DLEA 4C8MA 2W41A 4FZYA 1S1VA 2FF6A 2Q0UA 1X9WA 2YKNA 2HHXA 4PKGA 4FO0A 4F2RA 3Q7CA 3AVCA 1YJWN 2E2NA 1VSJA 2Q31A 4NLCA 5AQSA 1D9FA 1WBDA 1A5XA 5HLFA 3BUZB 3FGUA 4OPKA 1XNRK 4HHTA 3TAQA 4FPBA 1QHAA 1LWEA 3CIPA 2P9PA 3TPQA 1ASUA 4FWRA 3VEYA 1HLUA 1RNHA 1RTDA 1VHXA 5HRRA 4DB3A 4CESA 3CCEN 3OHRA 1K9MO 4N76A 4DHYA 4HUGA 3T1HK 3QETA 2O8EB 3TABA 5BR8K 3ZSXA 4JYAK 1NLVA 3OJUA 2VWKA 2P9IA 3GOIA 5AFUA 3QFPA 3OYLA 1NGJA 3ATVA 4GV3A 3NVKA 4DQRA 4CF9A 4KB1A 1QZ5A 2YHWA 4CFCA 4Q0BA 1GLDG 3DXMA 1FXXA 4A57A 3CHWA 5KRSA 4B9MA 1NGCA 3V4IA 1GOAA 2YNGA 1QZ6A 4ELVA 3LAKA 2Q97A 1VQ8N 1QQOA 4FWPA 3U6FA 2E1YA 5BRHA 2QM1A 1IO2A 2DY4A 3M8RA 3FZLA 2FBTA 4BR5A 1OH7A 2HF4A 3KD1E 3E9LA 4KPYA 2X6SA 1RT2A 2E88A 1DEJA 3JXUA 4ELTA 4Y1CA 1Q9XA 4FW1A 2RN2A 3CETA 1KVBA 1TGOA 4LF7K 4JI2K 2P5GA 3F73A 4WQ5C 2PYLA 3K0SA 4LF9K 4WE1A 1U2VB 4DTNA 3RR8A 3ENOA 3BZKA 4KHUA 3PIPL 1IG9A 3W0LA 2R7YA 1S1UA 3DJCA 3OYHA 2HHQA 2O8FB 1BDGA 2OPSA 4CJSA 3H1VX 1U48A 1VQKN 3HO1A 3C6TA 4U7BA 5H1SQ 4DSIA 5F2RA 3WEEB 4A59A 5LJWA 3TWHA 3HPOA 5JS2A 4X62K 4EFHA 2NNWA 2P9LB 4FJHA 3CM6A 4FJ5A 1KC8O 4CERA 3NVMA 1T3VA 1NKEA 1VSEA 4CJRA 4MDAA 2KHOA 2BDPA 5LJVA 4A5AA 4KI6A 4EHTA 2A42A 3PY8A 2DPNA 4I7FA 3SJJA 4BC3A 1BU6O 1NGIA 1T8EA 4DSLA 3T19A 1JLQA 4AHCA 4PWDA 1QQMA 2KFZA 1Z26A 1QSLA 4OGCA 1RT7A 4DFKA 3H45C 3EO3A 1MDUB 1NK8A 4DTUA 1NG9A 4DR4K 1NK4A 2CGLA 2X6NA 2GBZA 4F3TA 2HHWA 1RTJA 3OS1A 3ZX0A 3VQAA 1TK8A 2QWRA 4IDKA 3D45A 4Z4GA 4DV1K 4I2QA 4KV8A 4Q5VA 4GV9A 3OA9A 5F0XA 2QWNA 3D0PA 4LF5K 3MWPA 2IS3A 1XWLA 3OS0A 3VQ8A 2CH6A 1IJJA 1KQSM 4RW9A 3KLIA 1JJ2M 4C23A 4FOEA 3MXIA 4I9QA 5AFUH 3MXMA 4W5OA 1BCMA 4FWOA 4K41A 4QAGA 1LWCA 1BO5O 5AZJA 1WB9A 5BN9A 5JVGL 4DV0K 3L4IA 3SMSA 1LCUA 3LZJA 3DRSA 3MXJA 5AQLA 1WSIA 3VENA 4PL8A 1HYVA 3ZYYX 3PUFA 1ZBUA 3U9DA 2NRHA 1K8AO 3IS9A 4DQQA 3AY9A 5AQHA 3VA3A 1N6QA 5E26A 3P5JA 3L3VA 4BRCA 4RW7A 3GG4A 5BPLA 4ZTJA 4CJUA 3RR7A 2YNIA 3E66A 3VEWA 4YDUA 2D1KA 2VYPA 3HM9A 4K0KK 4JHDA 5GIOA 4JI3K 1JLGA 3IG1A 4M42A 4FLZA 3NH1A 3P4IA 1LW0A 3EL2A 3N4QA 2VQFK 4Z4IA 3PIOL 5M1FA 4L8RB 3AVKA 1I39A 1J6ZA 1HYSA 1HQUA 2O8DA 3MK6A 4JNEA 3O9QA 5C25A 4A61A 3QEPA 1WLJA 1VQON 4JKGA 5I3UA 1E4GT 1XNQK 5GINA 1X9SA 1XI1A 1REVA 1YXQA 3VPZA 3CD6N 3K5OA 5AQZA 4UQGA 1Q8IA 4CGGA 3HVRA 3OYFA 1OVYA 5AQYA 4IOXA 3IKMA 2FBXA 3SPZA 1FKOA 3K57A 4WQ4A 4KH6A 5AQTA 2PAVA 3OY9A 3HOSA 4H8KA 3L3UA 4DWIA 1ZXOA 3D7EO 3K5NA 3FZHA 3ENBA 3V9ZA 2KFNA 3WXLA 3A8YA 3DWLA 3EKUA 3PX6A 2FXUA 2A3ZA 1C0FA 2HBLA 3WNHA 3CYMA 4H0PA 2P51A 2OZSA 4BC2A 2W6KA 3HSCA 2D0PA 5KPRA 4I6MB 1LAWA 3ZSWA 3CC2N 3DOKA 4GVMA 3W3DA 3O9TA 4FWMA 4BE2A 3SZ2A 4B9QA 1S3XA 4MO5A 3VQ7A 3DLLL 3JYTA 4CGFA 3G10A 1EO1A 1KAZA 1CXQA 2G8HA 3ID8A 4H5RA 5C2FA 4ISEA 4AHRA 3JAMO 3NGZA 2GWJA 3D6RA 1VQMN 2W42A 4BR9A 4C8LA 4OLBA 3EZ5A 3M5RA 1DTTA 1L3TA 2F9TA 1Z25A 3AGKA 4AHUA 4BRKA 5CZ1A 3BF3A 2ITMA 3OYAA 3HRGA 3M8SA 4DQSA 1J5EK 2WBNA 3LP0A 1Z05A 3TTFA 4JI8K 4OPAA 4DTJA 4O0IA 1WOQA 3G25A 2JWLA 4DQIA 2HNDA 4CJ4A 1S1XA 3P83D 4ZTFA 4FVMA 3VGKA 4TSXA 2HVIA 4DR2K 1X3MA 3VQEA 1UA0A 3ZCMA 3LAMA 3H3OB 3QO9A 5CYMA 4CEEA 5AZIB 1KVAA 3OYGA 3CCLN 4KTZA 3LDSA 5M1NA 3SPYA 2F8SA 2HMIA 4BC4A 3C6HA 1SS6A 2FSJA 4JLHA 1FK9A 1YUWA 5J2QA 1HNXK 4M3UA 3C95A 4WFNL 4GKJK 4Z4CA 4HUEA 3QMLA 5EOYA 4V19S 3AVAA 1CZAN 4WFBL 4NXNK 4KH5A 3MN7A 3LWMA 5AR0A 3ULDA 5HL7L 3TI0A 4DFPA 3CCSN 1RDAA 3VGLA 2OPQA 2G8KA 1C0MA 4QS8A 3HI0A 3RMBA 4FJ7A 3O3HA 3TSPA 4A2BA 1X9MA 5FPMA 4RW4A 4KTQA 1DT9A 5EU7A 2VCPA 4FL9A 4DSEA 2A1RA 3ZEUB 3AAQA 3H3NO 2KQ2A 2BANA 3GE1A 1NGGA 2H3GX 3VQ6A 4CJKA 1HKGA 4DU4A 3AO1A 5C0YA 1DTQA 1TKXA 1P90A 4Z94A 2A6AA 2RE2A 2G8UA 1HJOA 2HNZA 1D9DA 5BPNA 4CHYA 3DAWA 2E2QA 4FM1A 3SQ4A 1CZ9A 4LC9B 1T6DA 4FWNA 3D2FA 3SQ1A 4A5BA 4N47A 2HSTA 3O9SA 1Q81O 3WQUA 4DV3K 5AQOA 1BI4B 3PSFA 3CCUN 1IBMK 3OYNA 4JRPA 1T7PA 4E7JA 3WUHA 3DM2A 1SAZA 1RT4A 5LY3A 4DTPA 5C2DA 4IG3A 4Z4EA 3TR8A 4JI7K 2F7TA 4DQPA 1NOYA 4M3TA 1KXPA 5AQNA 1HJRA 4KHYA 4CVNE 4XIUA 4JKFA 1YJ9N 4I9LA 5M1QA 4E1JA 3SI6A 3QBWA 3CJ1A 1G15A 3ENHA 1BGXT 4BC5A 4B3SK 3KLEA 3NDKA 4FWLA 3CF5L 1TVRA 4CJTA 3N4PA 4DCHA 2FBVA 4DLGA 1VQ5N 1BQNA 1B9FA 4CJWA 1IKVA 3E9PA 3F5TA 4KI4A 1TYQB 5A2QO 2UXBK 4CF2A 3KK3A 3MDQA 3AVHA 2Q36A 4EZ9A 3VETA 4GVEA 3T7ZA 3CC7N 4CFAA 4AHVA 3AA4A 3HYFA 1IKWA 5KI6A 1K8KB 4B1WB 3NF6A 4AILC 1GLBG 5SZTA 2WONA 1S72N 3SJHA 4J2BA 4DG1A 4DR1K 2ASOA 3CQ8A 3CI5A 2D4WA 2BH1A 2VG7A 1M90O 4CZKA 1TKDA 4FJLA 1FKPA 2D0AA 3HM8A 2BE2A 4Y1DA 3RRGA 3MN9A 4N56A 2F4VK 2FSKA 3J7AP 3UKUB 3SBTA 2A41A 4H4MA 1N36K 3F2KA 3CJ9A 4C8KA 3HP6A 1NMDA 5BRDA 1VSDA 2D5RA 3BGRA 4ID5A 3KVGA 1J53A 1JL1A 3HK2A 3CERA 4YOVA 5AQKA 1U45A 2Q2RA 1M1KO 4M3YA 3EKSA 4K25A
chains in the Genus database with same CATH topology
3V9SA 1NKEA 4CK2A 1VSEA 5C24A 3HPGA 4BDZA 4CJRA 1QQCA 4OPJA 4CIGA 2LSNA 3L2VA 2I5JA 1SV5A 1RT5A 2Z1GA 2EHGA 3SV4A 2BDPA 4KI6A 3ZSQA 4BE0A 1SUQA 4OJRA 3DMJA 4DF8A 2Y1JA 2VG6A 3DLHA 4FJMA 3QINA 4B9VA 1T03A 4CFBA 5SWMA 3CFRA 3PY8A 4I7FA 3SJJA 1L5UA 4NCGA 3SUOA 2P5OA 1T8EA 3ZT2A 3RRHA 3ALYA 4DSLA 1A5VA 1NK0A 3T1AA 2RKIA 1EXQA 3ITHA 4NYNA 3T19A 4FJ7A 1JLQA 1TKTA 4AHCA 4CHZA 2YKMA 3NGIA 1L3VA 4PWDA 2Y1IA 4HTUA 3NCIA 2AJQA 2FBYA 4CGHA 4DS4A 1Z26A 2KFZA 1C1BA 4CF0A 1WNSA 3ZSRA 3KK2A 1SL2A 1NK5A 3O4NA 1QSLA 4OGCA 1RT7A 2JLEA 1BL3A 2IAJA 4B8CA 3I0RA 5J1EA 3OVNA 4DFKA 1NK8A 1SKRA 2HHUA 4DTUA 4FCYA 1HRHA 1NK4A 3S3NA 3KKRA 2X6NA 3OYKA 2E6LA 2GBZA 3EY1A 4F3TA 3K5MA 4CK1A 1RTJA 3OS1A 2HHWA 3AV9A 1TK8A 3VQAA 4IDKA 1J5OA 3D45A 5CYQA 2G8VA 4Z4GA 4I2QA 4KV8A 4Q5VA 2ZD1A 1NJWA 2G8IA 3QNNA 2Z1HA 4OKKA 3D0PA 3TAEA 1C0UA 1WAJA 1ASVA 1BQMA 1U4BA 1MU2A 2IS3A 4FK0A 1S6PA 3EYZA 1LWFA 1XWLA 2YHBA 3ZT3A 3VQ8A 3OS0A 4FZXC 4OLAA 3DLKA 4RW9A 3KLIA 4DSJA 4PQUA 3NAEA 4LD0A 2XRIA 3ZSZA 3NBPA 1WSGA 2B6AA 3K5LA 3MXIA 4I9QA 4FYDA 3HL8A 4W5OA 5KGWA 3MXMA 1ASWA 1BCOA 1BCMA 1NJYA 4FJGA 1U04A 3L2UA 4QAGA 1TL3A 4O4GA 3KLFA 5J2PA 1LWCA 3QESA 4CECA 2YHAA 4EP4A 3LP2A 4DSKA 4GW6A 3B6PA 3NE6A 1CZBA 1WAFA 4LSNA 4O44A 4BWMA 4CEOA 3LZJA 4M3WA 4EP5A 3DRSA 3MXJA 4IFYA 3RMCA 3CFOA 2OYQA 3SUPA 4DF4A 3QIOA 1WSIA 1KSPA 4M3XA 1LAVA 4RW6A 3OS2A 4FLVA 3O3FA 3KD5E 1HYVA 3PUFA 3VQ9A 1ZBUA 3DLGA 3AO5A 5DK5A 3LWLA 3M8PA 1D5AA 4CIFA 3K58A 4F8RA 3O3GA 4FW2A 4CEFA 1QSSA 1UAXA 3IS9A 4DQQA 3PV8A 1R0AA 4KHQA 4DFJA 3VA3A 5HP1A 1N6QA 3P5JA 3L3VA 1RT3A 4CJEA 1HYZA 4CHPA 1J9AA 4RW7A 3WNFA 3RMDA 4FK4A 3VQBA 4CHOA 3KLGA 3DI6A 4ZTJA 4CJUA 4FZZA 3RR7A 1F21A 3CFPA 2YNIA 5HRNA 1TL1A 2XY8A 4B8AB 1NKBA 3L2QA 3HM9A 4B9NA 1WSFA 4KHWA 1JLGA 3IG1A 5D3GA 4M42A 4FLZA 3SQ0A 4E7IA 4CFDA 3IAYA 3NH1A 3S3OA 4E3SA 3THVA 1LW0A 1RBRA 4CGJA 1NK7A 4FXDA 3AO2A 4W5RA 1HNVA 1QE1A 4DTSA 4Z4IA 2ATQA 1GOCA 1KFSA 2QXFA 4DMNA 4L8RB 3AVKA 2XHBA 2EX3A 4O5BA 1C1AA 1I39A 3TAPA 3OYBA 4KHNA 1HYSA 1HQUA 3AO4A 5K14A 3OYIA 3WNGA 3UIQA 5C25A 3LPTA 1RBSA 3QEPA 4QOZB 4B08A 4DTXA 1WLJA 4Z0UA 1ZBLA 3ZT0A 3V9UA 5I3UA 2NUBA 3C6UA 4G1QA 1X9SA 4K8ZA 4E7HA 2KW4A 4KRFA 1NOZA 1XI1A 4QCLA 1REVA 3CM5A 1TV6A 3LANA 1LW2A 3TAGA 3K5OA 3QLHA 3TARA 4YNQA 4UQGA 3NFAA 1Q8IA 3AVNA 4FJIA 4K8XA 3FFIA 5C42A 4YFUA 4CGGA 3V6DA 3K2PA 3VQDA 4CF8A 4HVJA 1WSJA 3HVRA 1B9DA 2B5JA 3OYFA 3AVGA 1SL0A 3KTQA 2PY5A 2FBXA 3VQQA 4BE1A 1J54A 1HQEA 3SPZA 1FKOA 2XY7A 1QSYA 2HVHA 1JL2A 3K57A 2D0BA 3DLEA 4RW8A 1VSLA 3V1RA 4MQ3A 1LV5A 3SV3A 4CEDA 2WOMA 4FK2A 3OY9A 3DLRA 1BIZA 4CJ3A 2YNHA 1NK6A 3AVBA 4M3ZA 4H8KA 3L3UA 5JS1A 1QHTA 4LH4A 4DWIA 3TAFA 1S1TA 2Q3SA 3K5NA 3L2WA 1XHZA 3LZIA 3OJSA 2F96A 1UOCA 3SYZA 1VK0A 4Z4FA 3V9ZA 2KFNA 4C8NA 3V81A 4W5TA 1JXBA 3PX6A 2OZMA 3WNHA 3ZSVA 4ICLA 1WSHA 1K6YA 1C6VA 3CYMA 4CJPA 3OYDA 3AVMA 1CLQA 2P51A 3A2FA 2OZSA 1EX4A 2GV9A 1LAWA 3ZSWA 3L2RA 3DOKA 3QEWA 3HJFA 3NHGA 3NF9A 3OYMA 4FJ8A 2B4JA 2HNYA 4GVMA 3AA3A 2QK9A 3LP3A 4FM2A 1S6QA 3AO3A 5KTQA 1RDBA 2XO7A 4BE2A 3SZ2A 4AHTA 5KRTA 3ZSYA 2YV0X 4F2SA 3VQ7A 1YVUA 3AVFA 3JYTA 1VSMA 3G10A 4O55A 1RTHA 2X78A 4CGFA 3MEGA 4W5QA 4B9TA 2HW3A 1ZBHA 4FLUA 1I3AA 3SNNA 1CXQA 2G8HA 1NK9A 4LH5A 4J2EA 5HBMA 4IKFA 4B9LA 4GMJB 3ASMA 4AHRA 5T7BA 3NGZA 3VN5A 1YTUA 3HVTA 1RBTA 4KO0A 4OVLA 3V9XA 4B3OA 2DFEA 4JS5A 4PY5A 2W42A 4C8LA 2IDOA 3WNEA 1ZBIA 4OLBA 1KTQA 2X74A 3EZ5A 3AA5X 4F4KA 1DTTA 1L3TA 1D8YA 1Z25A 4AHUA 4FJNA 2GUIA 2ETJA 2OPRA 3O4QA 5CZ1A 3OYAA 3HSTB 2Z1IA 2XY6A 3M8SA 3T3FA 3OYEA 1VRUA 3KJVA 4DQSA 5J2MA 3LP0A 1RDDA 1JLEA 2RF2A 3QIPA 1RT6A 3U3GA 1KLMA 4CEQA 4DTJA 4O0IA 4KAZA 1BI4A 5DMRA 1N5YA 3MEEA 4DQIA 2P1JA 1QS4A 2HNDA 4FLXA 4CJ4A 3RMAA 1VSHA 4DTOA 4CF1A 4BDPA 1S1XA 1NKCA 1RDCA 4DSFA 4HCBA 3SUQA 3P83D 2FC0A 4ZTFA 2OA8A 2D0CA 3G0ZA 4FVMA 1SKSA 4TSXA 2HVIA 3ISNC 2G8FA 1UA0A 3VQEA 1VSFA 2ZE2A 3HP9A 4IBNA 3ZCMA 3LAMA 3LPUA 4CEZA 4N5SA 2KTQA 3QO9A 5CYMA 1QTMA 3S3MA 2OPPA 2HHSA 4CEEA 1NJXA 4M45A 4O0JA 5J2NA 5FRMA 2RPIA 4JS4A 1KVAA 3OYGA 1GOBA 4KTZA 3LDSA 2F8SA 3SPYA 1ITGA 4CK3A 1JLBA 3VA0A 2HMIA 4PA1A 3V1QA 3AVJA 3ZSOA 1S9GA 4JRQA 3QEVA 3KK1A 4JLHA 1JLCA 1FK9A 5J2QA 5CZ2A 2JGUA 4R5PA 4M3UA 2F8TA 3C95A 4Z4HA 1NJZA 1HMVA 3DOLA 3NF8A 4Z4CA 4HUEA 1SKWA 3PX4A 2QKKA 4IFVA 3SCXA 3SQ2A 2A1SA 3AVAA 3KKSA 1KCFA 1YT3A 2DFHA 4E19A 4DS5A 1IH7A 3KLHA 3DLBA 1TAUA 3AA2A 4FJKA 4LY7A 1HNIA 3M8QA 5KGXA 4E1MA 3LWMA 3QEXA 3ULDA 4FJJA 3DRRA 3HT3A 1XC9A 3OYCA 4DLEA 3TI0A 4C8MA 2HHTA 3V9WA 1VSKA 4DFPA 2ITGA 1RDAA 4IG0A 1S1VA 4FZYA 3BDPA 2OPQA 1X9WA 2YKNA 2G8KA 1C0MA 4F2RA 2HHXA 3RWUA 3AVCA 1X1PA 4KREA 3ZT4A 1VSJA 4CJQA 3RMBA 4OKEA 4LSLA 4CGIA 3MAQA 4DFMA 1D9FA 3O3HA 1KLNA 4HCCA 1A5XA 5HLFA 4ZHRA 4RW4A 1X9MA 3AVLA 4KTQA 4OPKA 4OGEA 1TK5A 1JLFA 5EU7A 4BACA 1RT1A 1RILA 4KFBA 4DSEA 4FJXA 4HHTA 3TAQA 2A1RA 3JSMA 3K59A 2DFFA 4E7LA 1LWEA 1Y97A 1W9HA 4BDYA 1RCHA 5FROA 2KQ2A 1JLAA 1A5WA 2BANA 3PO5A 1ASUA 4E89A 3QEIA 1DLOA 3NH0A 1RNHA 3VQ6A 5HRRA 1RTDA 4CJKA 4HUFA 4DU4A 2XY5A 3AO1A 3V1OA 2O4IA 3TANA 1DTQA 1TKXA 3TAMA 4C8OA 4CESA 1EKEA 1BISA 2VG5A 4BWJA 4N76A 4AH9A 4CE9A 5FRNA 2G8UA 4E7KA 2HB5A 4I2PA 4HUGA 4NCBA 2HNZA 2VWJA 3QETA 1D9DA 3U3YA 4CHYA 3TABA 4FM1A 3SQ4A 1CZ9A 3ZSXA 1L3SA 4AHSA 3OJUA 4CJLA 2VWKA 3SQ1A 3I8DA 4N47A 3OYLA 2IOCA 4M3RA 3NGYA 4FLWA 1S9EA 4DQRA 2HHVA 4CEBA 1BIUA 1RBVA 4CEAA 4CF9A 4KB1A 2KZMA 1BI4B 2E4LA 3LP1A 4CFCA 1Q9YA 4Q0BA 3OYNA 1KFDA 4JRPA 1FXXA 4CGDA 1T7PA 3LALA 4E7JA 5KRSA 3I0SA 3DM2A 4DTMA 3V4IA 3MECA 4B9MA 3HPHA 3PO4A 1RT4A 1U49A 1GOAA 1BHLA 2DTUA 4DTPA 2YNGA 4IG3A 4Z4EA 3TR8A 1IKYA 4DQPA 4ELVA 3LAKA 1NOYA 4M3TA 3U6FA 4CHQA 1C0TA 1HJRA 4FLTA 4KHYA 4XIUA 1WSEA 3IRXA 4E0DA 4I9LA 2PZSA 4ID1A 2IGIA 1IO2A 4MFBA 3SI6A 2DY4A 1G15A 4NCAA 1BGXT 1T05A 3KLEA 2YNFA 3NDKA 3M8RA 5I42A 2FBTA 2O4GA 2E6MA 3HXMA 1TVRA 4FLYA 4CJTA 1RBUA 1YTAA 1ZBFA 1C1CA 3KD1E 4KPYA 2FBVA 3OYJA 2PYJA 4CIEA 4CHNA 4DLGA 4ELUA 2X6SA 4KB0A 5E41A 3L8BA 2ZQBA 1BQNA 1RT2A 1SL1A 1B9FA 4CJWA 1IKVA 4KI4A 3P1GA 4ELTA 4DTRA 4M41A 4Y1CA 4CF2A 3KK3A 4DU1A 3AVHA 3H08A 4FW1A 1Q9XA 4EZ6A 2RN2A 4J2AA 3QERA 1KVBA 1TGOA 3AVIA 5HRSA 2P5GA 3F73A 4EZ9A 3E01A 4B9UA 2PYLA 1VSIA 1HPZA 4CFAA 1TAQA 4AHVA 4DU3A 3PX0A 1KVCA 1S5JA 3AA4A 3HYFA 1IKWA 4WE1A 5KI6A 4DTNA 3RR8A 2BGGA 3NF6A 1EETA 4AILC 4KHUA 1TK0A 3CG7A 5SZTA 2WONA 4CCHA 4FJ9A 4J2BA 4DG1A 3DRPA 1JKHA 1IG9A 3C94A 3SUNA 3VQ4A 3ZT1A 3CQ8A 1UA1A 5HRPA 2R7YA 1U47A 1L3UA 2KZZA 3MEDA 1S1UA 2VG7A 4CJVA 4F3OA 1XHXA 1W0HA 5CY4A 3VQCA 3OYHA 1TKDA 3F9KA 4N41A 2HHQA 4FJLA 1FKPA 2D0AA 4H4OA 2OPSA 2BE2A 4CJSA 4Y1DA 5HROA 3RRGA 3QNOA 4N56A 4NYFA 1O1WA 1U48A 4PUOA 4E1NA 3HO1A 4H4MA 3C6TA 1RTIA 1UWBA 1WN7A 1VRTA 4DSIA 3S9HA 1JXEA 4OKJA 4CJFA 4C8KA 2QKBA 1CXUA 4KTWA 2Z1JA 3TWHA 3VQPA 1IKXA 3HP6A 4CJ5A 3HPOA 1KRPA 5JS2A 3KIOA 3RTVA 1TKZA 3B6OA 1B92A 4W5NA 1VSDA 2D5RA 3BGRA 1S1WA 3DYAA 4ID5A 1ZYQA 2G8WA 4B9SA 1J53A 4J2DA 3NH2A 5FDLA 1JL1A 4FM0A 4KKOA 3HK2A 2IC3A 3VQ5A 1EP4A 4RG8A 1U45A 3CM6A 4FJHA 4FJ5A 4M3YA 4KHSA 4CERA 3NF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V9S A;  1NKE A;  4CK2 A;  1VSE A;  5C24 A;  3HPG A;  4BDZ A;  4CJR A;  1QQC A;  4OPJ A;  4CIG A;  2LSN A;  3L2V A;  2I5J A;  1SV5 A;  1RT5 A;  2Z1G A;  2EHG A;  3SV4 A;  2BDP A;  4KI6 A;  3ZSQ A;  4BE0 A;  1SUQ A;  4OJR A;  3DMJ A;  4DF8 A;  2Y1J A;  2VG6 A;  3DLH A;  4FJM A;  3QIN A;  4B9V A;  1T03 A;  4CFB A;  5SWM A;  3CFR A;  3PY8 A;  4I7F A;  3SJJ A;  1L5U A;  4NCG A;  3SUO A;  2P5O A;  1T8E A;  3ZT2 A;  3RRH A;  3ALY A;  4DSL A;  1A5V A;  1NK0 A;  3T1A A;  2RKI A;  1EXQ A;  3ITH A;  4NYN A;  3T19 A;  4FJ7 A;  1JLQ A;  1TKT A;  4AHC A;  4CHZ A;  2YKM A;  3NGI A;  1L3V A;  4PWD A;  2Y1I A;  4HTU A;  3NCI A;  2AJQ A;  2FBY A;  4CGH A;  4DS4 A;  1Z26 A;  2KFZ A;  1C1B A;  4CF0 A;  1WNS A;  3ZSR A;  3KK2 A;  1SL2 A;  1NK5 A;  3O4N A;  1QSL A;  4OGC A;  1RT7 A;  2JLE A;  1BL3 A;  2IAJ A;  4B8C A;  3I0R A;  5J1E A;  3OVN A;  4DFK A;  1NK8 A;  1SKR A;  2HHU A;  4DTU A;  4FCY A;  1HRH A;  1NK4 A;  3S3N A;  3KKR A;  2X6N A;  3OYK A;  2E6L A;  2GBZ A;  3EY1 A;  4F3T A;  3K5M A;  4CK1 A;  1RTJ A;  3OS1 A;  2HHW A;  3AV9 A;  1TK8 A;  3VQA A;  4IDK A;  1J5O A;  3D45 A;  5CYQ A;  2G8V A;  4Z4G A;  4I2Q A;  4KV8 A;  4Q5V A;  2ZD1 A;  1NJW A;  2G8I A;  3QNN A;  2Z1H A;  4OKK A;  3D0P A;  3TAE A;  1C0U A;  1WAJ A;  1ASV A;  1BQM A;  1U4B A;  1MU2 A;  2IS3 A;  4FK0 A;  1S6P A;  3EYZ A;  1LWF A;  1XWL A;  2YHB A;  3ZT3 A;  3VQ8 A;  3OS0 A;  4FZX C;  4OLA A;  3DLK A;  4RW9 A;  3KLI A;  4DSJ A;  4PQU A;  3NAE A;  4LD0 A;  2XRI A;  3ZSZ A;  3NBP A;  1WSG A;  2B6A A;  3K5L A;  3MXI A;  4I9Q A;  4FYD A;  3HL8 A;  4W5O A;  5KGW A;  3MXM A;  1ASW A;  1BCO A;  1BCM A;  1NJY A;  4FJG A;  1U04 A;  3L2U A;  4QAG A;  1TL3 A;  4O4G A;  3KLF A;  5J2P A;  1LWC A;  3QES A;  4CEC A;  2YHA A;  4EP4 A;  3LP2 A;  4DSK A;  4GW6 A;  3B6P A;  3NE6 A;  1CZB A;  1WAF A;  4LSN A;  4O44 A;  4BWM A;  4CEO A;  3LZJ A;  4M3W A;  4EP5 A;  3DRS A;  3MXJ A;  4IFY A;  3RMC A;  3CFO A;  2OYQ A;  3SUP A;  4DF4 A;  3QIO A;  1WSI A;  1KSP A;  4M3X A;  1LAV A;  4RW6 A;  3OS2 A;  4FLV A;  3O3F A;  3KD5 E;  1HYV A;  3PUF A;  3VQ9 A;  1ZBU A;  3DLG A;  3AO5 A;  5DK5 A;  3LWL A;  3M8P A;  1D5A A;  4CIF A;  3K58 A;  4F8R A;  3O3G A;  4FW2 A;  4CEF A;  1QSS A;  1UAX A;  3IS9 A;  4DQQ A;  3PV8 A;  1R0A A;  4KHQ A;  4DFJ A;  3VA3 A;  5HP1 A;  1N6Q A;  3P5J A;  3L3V A;  1RT3 A;  4CJE A;  1HYZ A;  4CHP A;  1J9A A;  4RW7 A;  3WNF A;  3RMD A;  4FK4 A;  3VQB A;  4CHO A;  3KLG A;  3DI6 A;  4ZTJ A;  4CJU A;  4FZZ A;  3RR7 A;  1F21 A;  3CFP A;  2YNI A;  5HRN A;  1TL1 A;  2XY8 A;  4B8A B;  1NKB A;  3L2Q A;  3HM9 A;  4B9N A;  1WSF A;  4KHW A;  1JLG A;  3IG1 A;  5D3G A;  4M42 A;  4FLZ A;  3SQ0 A;  4E7I A;  4CFD A;  3IAY A;  3NH1 A;  3S3O A;  4E3S A;  3THV A;  1LW0 A;  1RBR A;  4CGJ A;  1NK7 A;  4FXD A;  3AO2 A;  4W5R A;  1HNV A;  1QE1 A;  4DTS A;  4Z4I A;  2ATQ A;  1GOC A;  1KFS A;  2QXF A;  4DMN A;  4L8R B;  3AVK A;  2XHB A;  2EX3 A;  4O5B A;  1C1A A;  1I39 A;  3TAP A;  3OYB A;  4KHN A;  1HYS A;  1HQU A;  3AO4 A;  5K14 A;  3OYI A;  3WNG A;  3UIQ A;  5C25 A;  3LPT A;  1RBS A;  3QEP A;  4QOZ B;  4B08 A;  4DTX A;  1WLJ A;  4Z0U A;  1ZBL A;  3ZT0 A;  3V9U A;  5I3U A;  2NUB A;  3C6U A;  4G1Q A;  1X9S A;  4K8Z A;  4E7H A;  2KW4 A;  4KRF A;  1NOZ A;  1XI1 A;  4QCL A;  1REV A;  3CM5 A;  1TV6 A;  3LAN A;  1LW2 A;  3TAG A;  3K5O A;  3QLH A;  3TAR A;  4YNQ A;  4UQG A;  3NFA A;  1Q8I A;  3AVN A;  4FJI A;  4K8X A;  3FFI A;  5C42 A;  4YFU A;  4CGG A;  3V6D A;  3K2P A;  3VQD A;  4CF8 A;  4HVJ A;  1WSJ A;  3HVR A;  1B9D A;  2B5J A;  3OYF A;  3AVG A;  1SL0 A;  3KTQ A;  2PY5 A;  2FBX A;  3VQQ A;  4BE1 A;  1J54 A;  1HQE A;  3SPZ A;  1FKO A;  2XY7 A;  1QSY A;  2HVH A;  1JL2 A;  3K57 A;  2D0B A;  3DLE A;  4RW8 A;  1VSL A;  3V1R A;  4MQ3 A;  1LV5 A;  3SV3 A;  4CED A;  2WOM A;  4FK2 A;  3OY9 A;  3DLR A;  1BIZ A;  4CJ3 A;  2YNH A;  1NK6 A;  3AVB A;  4M3Z A;  4H8K A;  3L3U A;  5JS1 A;  1QHT A;  4LH4 A;  4DWI A;  3TAF A;  1S1T A;  2Q3S A;  3K5N A;  3L2W A;  1XHZ A;  3LZI A;  3OJS A;  2F96 A;  1UOC A;  3SYZ A;  1VK0 A;  4Z4F A;  3V9Z A;  2KFN A;  4C8N A;  3V81 A;  4W5T A;  1JXB A;  3PX6 A;  2OZM A;  3WNH A;  3ZSV A;  4ICL A;  1WSH A;  1K6Y A;  1C6V A;  3CYM A;  4CJP A;  3OYD A;  3AVM A;  1CLQ A;  2P51 A;  3A2F A;  2OZS A;  1EX4 A;  2GV9 A;  1LAW A;  3ZSW A;  3L2R A;  3DOK A;  3QEW A;  3HJF A;  3NHG A;  3NF9 A;  3OYM A;  4FJ8 A;  2B4J A;  2HNY A;  4GVM A;  3AA3 A;  2QK9 A;  3LP3 A;  4FM2 A;  1S6Q A;  3AO3 A;  5KTQ A;  1RDB A;  2XO7 A;  4BE2 A;  3SZ2 A;  4AHT A;  5KRT A;  3ZSY A;  2YV0 X;  4F2S A;  3VQ7 A;  1YVU A;  3AVF A;  3JYT A;  1VSM A;  3G10 A;  4O55 A;  1RTH A;  2X78 A;  4CGF A;  3MEG A;  4W5Q A;  4B9T A;  2HW3 A;  1ZBH A;  4FLU A;  1I3A A;  3SNN A;  1CXQ A;  2G8H A;  1NK9 A;  4LH5 A;  4J2E A;  5HBM A;  4IKF A;  4B9L A;  4GMJ B;  3ASM A;  4AHR A;  5T7B A;  3NGZ A;  3VN5 A;  1YTU A;  3HVT A;  1RBT A;  4KO0 A;  4OVL A;  3V9X A;  4B3O A;  2DFE A;  4JS5 A;  4PY5 A;  2W42 A;  4C8L A;  2IDO A;  3WNE A;  1ZBI A;  4OLB A;  1KTQ A;  2X74 A;  3EZ5 A;  3AA5 X;  4F4K A;  1DTT A;  1L3T A;  1D8Y A;  1Z25 A;  4AHU A;  4FJN A;  2GUI A;  2ETJ A;  2OPR A;  3O4Q A;  5CZ1 A;  3OYA A;  3HST B;  2Z1I A;  2XY6 A;  3M8S A;  3T3F A;  3OYE A;  1VRU A;  3KJV A;  4DQS A;  5J2M A;  3LP0 A;  1RDD A;  1JLE A;  2RF2 A;  3QIP A;  1RT6 A;  3U3G A;  1KLM A;  4CEQ A;  4DTJ A;  4O0I A;  4KAZ A;  1BI4 A;  5DMR A;  1N5Y A;  3MEE A;  4DQI A;  2P1J A;  1QS4 A;  2HND A;  4FLX A;  4CJ4 A;  3RMA A;  1VSH A;  4DTO A;  4CF1 A;  4BDP A;  1S1X A;  1NKC A;  1RDC A;  4DSF A;  4HCB A;  3SUQ A;  3P83 D;  2FC0 A;  4ZTF A;  2OA8 A;  2D0C A;  3G0Z A;  4FVM A;  1SKS A;  4TSX A;  2HVI A;  3ISN C;  2G8F A;  1UA0 A;  3VQE A;  1VSF A;  2ZE2 A;  3HP9 A;  4IBN A;  3ZCM A;  3LAM A;  3LPU A;  4CEZ A;  4N5S A;  2KTQ A;  3QO9 A;  5CYM A;  1QTM A;  3S3M A;  2OPP A;  2HHS A;  4CEE A;  1NJX A;  4M45 A;  4O0J A;  5J2N A;  5FRM A;  2RPI A;  4JS4 A;  1KVA A;  3OYG A;  1GOB A;  4KTZ A;  3LDS A;  2F8S A;  3SPY A;  1ITG A;  4CK3 A;  1JLB A;  3VA0 A;  2HMI A;  4PA1 A;  3V1Q A;  3AVJ A;  3ZSO A;  1S9G A;  4JRQ A;  3QEV A;  3KK1 A;  4JLH A;  1JLC A;  1FK9 A;  5J2Q A;  5CZ2 A;  2JGU A;  4R5P A;  4M3U A;  2F8T A;  3C95 A;  4Z4H A;  1NJZ A;  1HMV A;  3DOL A;  3NF8 A;  4Z4C A;  4HUE A;  1SKW A;  3PX4 A;  2QKK A;  4IFV A;  3SCX A;  3SQ2 A;  2A1S A;  3AVA A;  3KKS A;  1KCF A;  1YT3 A;  2DFH A;  4E19 A;  4DS5 A;  1IH7 A;  3KLH A;  3DLB A;  1TAU A;  3AA2 A;  4FJK A;  4LY7 A;  1HNI A;  3M8Q A;  5KGX A;  4E1M A;  3LWM A;  3QEX A;  3ULD A;  4FJJ A;  3DRR A;  3HT3 A;  1XC9 A;  3OYC A;  4DLE A;  3TI0 A;  4C8M A;  2HHT A;  3V9W A;  1VSK A;  4DFP A;  2ITG A;  1RDA A;  4IG0 A;  1S1V A;  4FZY A;  3BDP A;  2OPQ A;  1X9W A;  2YKN A;  2G8K A;  1C0M A;  4F2R A;  2HHX A;  3RWU A;  3AVC A;  1X1P A;  4KRE A;  3ZT4 A;  1VSJ A;  4CJQ A;  3RMB A;  4OKE A;  4LSL A;  4CGI A;  3MAQ A;  4DFM A;  1D9F A;  3O3H A;  1KLN A;  4HCC A;  1A5X A;  5HLF A;  4ZHR A;  4RW4 A;  1X9M A;  3AVL A;  4KTQ A;  4OPK A;  4OGE A;  1TK5 A;  1JLF A;  5EU7 A;  4BAC A;  1RT1 A;  1RIL A;  4KFB A;  4DSE A;  4FJX A;  4HHT A;  3TAQ A;  2A1R A;  3JSM A;  3K59 A;  2DFF A;  4E7L A;  1LWE A;  1Y97 A;  1W9H A;  4BDY A;  1RCH A;  5FRO A;  2KQ2 A;  1JLA A;  1A5W A;  2BAN A;  3PO5 A;  1ASU A;  4E89 A;  3QEI A;  1DLO A;  3NH0 A;  1RNH A;  3VQ6 A;  5HRR A;  1RTD A;  4CJK A;  4HUF A;  4DU4 A;  2XY5 A;  3AO1 A;  3V1O A;  2O4I A;  3TAN A;  1DTQ A;  1TKX A;  3TAM A;  4C8O A;  4CES A;  1EKE A;  1BIS A;  2VG5 A;  4BWJ A;  4N76 A;  4AH9 A;  4CE9 A;  5FRN A;  2G8U A;  4E7K A;  2HB5 A;  4I2P A;  4HUG A;  4NCB A;  2HNZ A;  2VWJ A;  3QET A;  1D9D A;  3U3Y A;  4CHY A;  3TAB A;  4FM1 A;  3SQ4 A;  1CZ9 A;  3ZSX A;  1L3S A;  4AHS A;  3OJU A;  4CJL A;  2VWK A;  3SQ1 A;  3I8D A;  4N47 A;  3OYL A;  2IOC A;  4M3R A;  3NGY A;  4FLW A;  1S9E A;  4DQR A;  2HHV A;  4CEB A;  1BIU A;  1RBV A;  4CEA A;  4CF9 A;  4KB1 A;  2KZM A;  1BI4 B;  2E4L A;  3LP1 A;  4CFC A;  1Q9Y A;  4Q0B A;  3OYN A;  1KFD A;  4JRP A;  1FXX A;  4CGD A;  1T7P A;  3LAL A;  4E7J A;  5KRS A;  3I0S A;  3DM2 A;  4DTM A;  3V4I A;  3MEC A;  4B9M A;  3HPH A;  3PO4 A;  1RT4 A;  1U49 A;  1GOA A;  1BHL A;  2DTU A;  4DTP A;  2YNG A;  4IG3 A;  4Z4E A;  3TR8 A;  1IKY A;  4DQP A;  4ELV A;  3LAK A;  1NOY A;  4M3T A;  3U6F A;  4CHQ A;  1C0T A;  1HJR A;  4FLT A;  4KHY A;  4XIU A;  1WSE A;  3IRX A;  4E0D A;  4I9L A;  2PZS A;  4ID1 A;  2IGI A;  1IO2 A;  4MFB A;  3SI6 A;  2DY4 A;  1G15 A;  4NCA A;  1BGX T;  1T05 A;  3KLE A;  2YNF A;  3NDK A;  3M8R A;  5I42 A;  2FBT A;  2O4G A;  2E6M A;  3HXM A;  1TVR A;  4FLY A;  4CJT A;  1RBU A;  1YTA A;  1ZBF A;  1C1C A;  3KD1 E;  4KPY A;  2FBV A;  3OYJ A;  2PYJ A;  4CIE A;  4CHN A;  4DLG A;  4ELU A;  2X6S A;  4KB0 A;  5E41 A;  3L8B A;  2ZQB A;  1BQN A;  1RT2 A;  1SL1 A;  1B9F A;  4CJW A;  1IKV A;  4KI4 A;  3P1G A;  4ELT A;  4DTR A;  4M41 A;  4Y1C A;  4CF2 A;  3KK3 A;  4DU1 A;  3AVH A;  3H08 A;  4FW1 A;  1Q9X A;  4EZ6 A;  2RN2 A;  4J2A A;  3QER A;  1KVB A;  1TGO A;  3AVI A;  5HRS A;  2P5G A;  3F73 A;  4EZ9 A;  3E01 A;  4B9U A;  2PYL A;  1VSI A;  1HPZ A;  4CFA A;  1TAQ A;  4AHV A;  4DU3 A;  3PX0 A;  1KVC A;  1S5J A;  3AA4 A;  3HYF A;  1IKW A;  4WE1 A;  5KI6 A;  4DTN A;  3RR8 A;  2BGG A;  3NF6 A;  1EET A;  4AIL C;  4KHU A;  1TK0 A;  3CG7 A;  5SZT A;  2WON A;  4CCH A;  4FJ9 A;  4J2B A;  4DG1 A;  3DRP A;  1JKH A;  1IG9 A;  3C94 A;  3SUN A;  3VQ4 A;  3ZT1 A;  3CQ8 A;  1UA1 A;  5HRP A;  2R7Y A;  1U47 A;  1L3U A;  2KZZ A;  3MED A;  1S1U A;  2VG7 A;  4CJV A;  4F3O A;  1XHX A;  1W0H A;  5CY4 A;  3VQC A;  3OYH A;  1TKD A;  3F9K A;  4N41 A;  2HHQ A;  4FJL A;  1FKP A;  2D0A A;  4H4O A;  2OPS A;  2BE2 A;  4CJS A;  4Y1D A;  5HRO A;  3RRG A;  3QNO A;  4N56 A;  4NYF A;  1O1W A;  1U48 A;  4PUO A;  4E1N A;  3HO1 A;  4H4M A;  3C6T A;  1RTI A;  1UWB A;  1WN7 A;  1VRT A;  4DSI A;  3S9H A;  1JXE A;  4OKJ A;  4CJF A;  4C8K A;  2QKB A;  1CXU A;  4KTW A;  2Z1J A;  3TWH A;  3VQP A;  1IKX A;  3HP6 A;  4CJ5 A;  3HPO A;  1KRP A;  5JS2 A;  3KIO A;  3RTV A;  1TKZ A;  3B6O A;  1B92 A;  4W5N A;  1VSD A;  2D5R A;  3BGR A;  1S1W A;  3DYA A;  4ID5 A;  1ZYQ A;  2G8W A;  4B9S A;  1J53 A;  4J2D A;  3NH2 A;  5FDL A;  1JL1 A;  4FM0 A;  4KKO A;  3HK2 A;  2IC3 A;  3VQ5 A;  1EP4 A;  4RG8 A;  1U45 A;  3CM6 A;  4FJH A;  4FJ5 A;  4M3Y A;  4KHS A;  4CER A;  3NF7 A; 
#chains in the Genus database with same CATH topology
 4CK2 A;  5C24 A;  3HPG A;  4L3Q A;  4OPJ A;  4CIG A;  3L2V A;  4BRD A;  4UY8 O;  2PBD A;  2EHG A;  4BRG A;  3ZSQ A;  3TTD A;  1SUQ A;  2Y1J A;  2VG6 A;  4FJM A;  1T03 A;  3CFR A;  4BRI A;  3VES A;  3C6A A;  3RRH A;  2RKI A;  3ITH A;  2V7Z A;  1L3V A;  2YKM A;  3ZET A;  1KAX A;  4HTU A;  1C1B A;  1WNS A;  2CGJ A;  4K42 A;  1BL3 A;  2IAJ A;  3O08 A;  1HRH A;  3BZC A;  1V4T A;  2E6L A;  3EY1 A;  3CME N;  3O6W A;  4RTF D;  3UKR B;  4CK1 A;  5AQW A;  1EWR A;  2ZJQ L;  1N8R O;  5CYQ A;  3R1X A;  5CE3 A;  4M7Y A;  1VQ4 N;  2ZD1 A;  1NJW A;  2G8I A;  3QNN A;  4WCE L;  3TAE A;  1U4B A;  1MU2 A;  4FK0 A;  1LWF A;  3RSE B;  3J8A A;  3DLK A;  1YIT N;  4BR4 A;  2O8B B;  4PQU A;  4FYD A;  2P9U A;  1FW6 A;  5KGW A;  2P9N B;  1BCO A;  3THY A;  5KQD A;  5AQP A;  1TL3 A;  3I8B A;  2YHA A;  1NGD A;  4ISF A;  1CZB A;  1Q86 O;  3FE1 A;  3SK3 A;  4M3W A;  1P8Z A;  3CFO A;  1KSP A;  4RW6 A;  4ILJ A;  4BRQ A;  3KD5 E;  2A5X A;  3VQ9 A;  3DLG A;  3LWL A;  3M8P A;  4F8R A;  3ZLJ A;  1EQY A;  3A5O C;  4JD2 A;  3OTO K;  5HP1 A;  2O8C A;  3K9K A;  1HYZ A;  4JI1 K;  4R79 A;  3WNF A;  3RMD A;  3VQB A;  4JKC A;  3OBW A;  3KLG A;  5C10 A;  4GV6 A;  1HUX A;  3FZM A;  5AQV A;  3AAP A;  4B8A B;  1NKB A;  3L2Q A;  5M1O A;  4BQZ A;  2QXL A;  4B3M K;  3P39 A;  2P9K A;  4NO7 A;  1RBR A;  2E2P A;  3O80 A;  4DTS A;  2ATQ A;  3WXM B;  2XHB A;  4O5B A;  1C1A A;  3MCP A;  3WNG A;  3UIQ A;  2CH5 A;  4QOZ B;  4B08 A;  4Z0U A;  2J4R A;  3IUC A;  2NUB A;  3C6U A;  4G1Q A;  1Y64 A;  4K8Z A;  4BR2 A;  3EEQ A;  3CM5 A;  1LW2 A;  4BRH A;  3TAR A;  4IEI A;  4CI6 A;  5C42 A;  3LDQ A;  4YOY A;  3VQD A;  4CF8 A;  1WSJ A;  3CCJ N;  3KTQ A;  2E1Z A;  5BR9 A;  5M1P A;  3DXK A;  4IZ9 A;  3DLE A;  4MQ3 A;  4O8K A;  4CED A;  2WOM A;  1YJN N;  3DLR A;  5JS1 A;  3CQX A;  3OBY A;  2Q3S A;  3R6M A;  4YOT A;  3SYZ A;  4OPH A;  1XHZ A;  4B3R K;  3V81 A;  1Q7Y O;  2OZM A;  2QWL A;  3ZSV A;  1HR0 K;  4ICL A;  1K6Y A;  3OYD A;  5B8H A;  3AVM A;  1MWM A;  2GV9 A;  3QEW A;  4FJ8 A;  4H0O A;  3LP3 A;  1S6Q A;  5KTQ A;  2AA4 A;  5KRT A;  3ZSY A;  2YV0 X;  4DUZ K;  1YVU A;  3AVF A;  3K9J A;  1VSM A;  2HW3 A;  3MEG A;  3VEO A;  1N33 K;  1ZBH A;  1Z6R A;  4J2E A;  4IKF A;  4ISG A;  4B9L A;  1W2B M;  4GMJ B;  5T7B A;  3CCV N;  4GKK K;  3VN5 A;  1YTU A;  3V9X A;  1K73 O;  4B3O A;  4JK9 A;  4XH1 A;  1IG8 A;  1QQN A;  3ULE B;  1BOT O;  1KTQ A;  5BRE A;  4F4K A;  1RDW X;  3TU5 A;  2O8E A;  4FJN A;  2WFB A;  4AQY K;  3FLC O;  3A5N C;  5EVZ A;  3OYE A;  5J2M A;  3VEZ A;  1GLA G;  1RT6 A;  3J7Z O;  1KLM A;  4CEQ A;  4BVP A;  3UKR A;  3MEE A;  4H5W A;  4LF8 K;  4DTO A;  4MDB A;  4BGA A;  2FLO A;  1T44 A;  2FC0 A;  1SKS A;  3PSI A;  3RSE A;  1VSF A;  4IBN A;  4DV6 K;  3ATU A;  2KTQ A;  1XUP O;  2GWK A;  2OPP A;  2HHS A;  1NJX A;  4HTL A;  4M45 A;  3KWG A;  2P9N A;  4JS4 A;  2IVO A;  3MWT A;  1YF5 L;  5C12 A;  4JK8 A;  3L6Q A;  4JKD A;  3CC4 N;  1S9G A;  3QEV A;  1JLC A;  3FFK B;  2YJF A;  3DOL A;  3L0Q A;  1QVG M;  3NF8 A;  1SKW A;  5EX5 A;  1YT3 A;  4DS5 A;  1IH7 A;  3GDQ A;  3LM2 A;  3THW B;  3AA2 A;  1GLL O;  1HNI A;  3QEX A;  4FJJ A;  3QIC A;  3CCQ N;  1XC9 A;  2HHT A;  1U2V A;  3HBT A;  2ITG A;  3RWU A;  4KRE A;  4CJQ A;  4CGI A;  1KLN A;  4LFA K;  4ZHR A;  3AVL A;  2UYT A;  4BAC A;  2O8F A;  3BY5 A;  1LOT B;  3THX B;  2D0O A;  2DFF A;  1Y97 A;  3JS6 A;  5ADX A;  4DR3 K;  5FRO A;  1JLA A;  1A5W A;  3U9Z A;  3PO5 A;  2QWP A;  4E89 A;  3WEE A;  1DLO A;  2ASM A;  2JWK A;  2P9S B;  3NH0 A;  3WXJ A;  3TAN A;  3TAM A;  4C8O A;  2VG5 A;  1ATN A;  4AH9 A;  2P9L A;  5FRN A;  1MA9 B;  4E7K A;  2HB5 A;  1R59 O;  4FWK A;  1FJG K;  4AHS A;  2I7P A;  2I7N A;  2BUP A;  1NGF A;  4XH4 A;  3I8D A;  2IOC A;  2BTF A;  4O8U A;  3NGY A;  2QA4 N;  1HNZ K;  2GX9 A;  1BIU A;  2WTU A;  2KZM A;  3LP1 A;  4CGD A;  3LAL A;  1W7A A;  4WYB A;  3I0S A;  5E84 A;  3MEC A;  3PO4 A;  1XC3 A;  1U49 A;  3FZK A;  1BHL A;  4YHH K;  1JCG A;  4JV5 K;  3T1Y K;  1DKG D;  3I55 N;  4CHQ A;  1WSE A;  1WBB A;  4E0D A;  4BRP A;  2IGI A;  4MFB A;  4CZJ A;  4NCA A;  4LFB K;  3VMF B;  5I42 A;  2O4G A;  4FLY A;  4QS9 A;  1C1C A;  4JEP A;  4KH4 A;  3OYJ A;  2PYJ A;  4CIE A;  4CHN A;  4ELU A;  4KB0 A;  5AQI A;  4BRM A;  3C7N B;  4IOA L;  4DTR A;  4M41 A;  4DU1 A;  5KPT A;  4J2A A;  4EZ6 A;  2UU9 K;  3QER A;  1C0G A;  4CJ7 A;  3E01 A;  3LM9 A;  1NJI O;  3LDP A;  3U8X A;  1VSI A;  1HPZ A;  3PX0 A;  1S5J A;  2YJE A;  2QEX N;  4IOC L;  1YI2 N;  3CG7 A;  2GEM A;  4KBO A;  1TK0 A;  2IVP A;  3C65 A;  5M1K A;  5CR4 A;  4CBW A;  5EXW A;  1UA1 A;  1U47 A;  5HRP A;  3MED A;  4JI4 K;  4CJV A;  1XHX A;  1W0H A;  3VQC A;  5GAH P;  3F9K A;  1HKB A;  4BRN A;  4H4O A;  1BG3 A;  2V51 B;  3QNO A;  4PUO A;  4BRL A;  2P9P B;  2E20 A;  3AAR A;  1RTI A;  1NGH A;  1WN7 A;  3S9H A;  1JXE A;  4OKJ A;  4CJF A;  2QTD A;  2ZJR L;  2QKB A;  1VQ6 N;  1CXU A;  2Z1J A;  4A2A A;  3VQP A;  1IKX A;  3OW2 M;  1Q82 O;  1KRP A;  3KIO A;  3B6O A;  4W5N A;  1BWF O;  3DYA A;  3J80 O;  4B9S A;  3T69 A;  4J2D A;  3NH2 A;  4KKO A;  1EP4 A;  4RG8 A;  3EE9 A;  4KHS A;  2QWQ A;  4IFE A;  2E2O A;  3NF7 A;  4B1V A;  3GBT A;  1QQC A;  2P9I B;  2LSN A;  1SV5 A;  1Q18 A;  5TKW A;  1RT5 A;  3SV4 A;  3SAF A;  4BE0 A;  4OJR A;  4DF8 A;  3DXM B;  3DLH A;  3VTH A;  4B9V A;  4CFB A;  5SWM A;  1N32 K;  5AQU A;  3O1W A;  4IXC A;  1D4X A;  2P5O A;  1A5V A;  1NK0 A;  3T1A A;  4AM7 A;  4IDH A;  1EXQ A;  4H5V A;  1TKT A;  4CHZ A;  1YHQ N;  3NGI A;  2Y1I A;  4BG8 A;  5EY4 A;  3NCI A;  2FBY A;  4DS4 A;  2AJQ A;  3THW A;  4DKW A;  4A62 A;  4CF0 A;  4H0V B;  1SL2 A;  3O4N A;  1SKR A;  2EWS A;  5ADX H;  3L4Q A;  4NXM K;  3S3N A;  3KKR A;  2VWB A;  1HX1 A;  2WC9 A;  1J5O A;  2UXD K;  2G8V A;  3SAG A;  2Z1H A;  4OKK A;  1C0U A;  1ASV A;  1BQM A;  4H0Y B;  4B1X B;  3ZT3 A;  2YHB A;  2RHK A;  4FPA A;  4DSJ A;  4PL7 A;  4LD0 A;  2XRI A;  3ZSZ A;  1WSG A;  2B6A A;  3J7Y P;  3HL8 A;  4ILG B;  4BRO A;  1NJY A;  1ASW A;  4FJG A;  1U04 A;  3L2U A;  4BR7 A;  5J2P A;  4CEC A;  3LP2 A;  4I6M A;  3B6P A;  3CMA N;  2UUB K;  1WAF A;  4CEO A;  4NLB A;  4EP5 A;  5AQR A;  4IFY A;  3RMC A;  2OYQ A;  4DF4 A;  3QIO A;  3O3F A;  4CZH A;  1D5A A;  4CIF A;  3K58 A;  2V52 B;  3O3G A;  4FW2 A;  4CEF A;  4DFJ A;  4LF4 K;  4CD1 A;  5BPM A;  2KKZ A;  1RT3 A;  1VQ9 N;  4FK4 A;  4CHO A;  3DI6 A;  1TUY A;  5HRN A;  3VF4 A;  2WUS A;  4CD3 A;  2OAN A;  4B9N A;  4F9O A;  4KHW A;  5GAD P;  2NRW A;  3WXK A;  5D3G A;  3SQ0 A;  3IAY A;  3S3O A;  4E3S A;  3THV A;  4CGJ A;  1NM1 A;  1NK7 A;  4FXD A;  3UE5 A;  1HNV A;  1VQL N;  1KFS A;  3SBG A;  4DMN A;  1NGA A;  3S41 A;  1HNW K;  4X64 K;  3VF6 A;  3AO4 A;  1RBS A;  3GL1 A;  2YHY A;  3QDK A;  1ZBL A;  3ZT0 A;  2QI2 A;  3V9U A;  4HWI A;  5IT9 O;  3TTC A;  4KRF A;  4XH5 A;  3LAN A;  3TAG A;  5AZI A;  4B1Y B;  3QLH A;  4YNQ A;  1ATR A;  3NFA A;  3AVN A;  5AQQ A;  3VEV A;  4K8X A;  3FFI A;  5TKY A;  4MLE A;  2NRV A;  3H46 O;  3K2P A;  4RCH A;  4HVJ A;  3V6D A;  2B5J A;  1XQS C;  1SL0 A;  1YVN A;  1J54 A;  2XY7 A;  1JL2 A;  2IVN A;  4CZG A;  3V1R A;  3FZF A;  3D2E B;  2ZGY A;  4C1N K;  4WF9 L;  4FWQ A;  1NK6 A;  3AVB A;  3VF2 A;  1N34 K;  1S1T A;  1BUP A;  1ZC6 A;  4Z4F A;  1UOC A;  4C8N A;  1JXB A;  2E5L K;  4CJP A;  1CLQ A;  3A2F A;  5AZJ B;  4FVU A;  1EX4 A;  3NHG A;  4JKE A;  5GIP A;  2E8A A;  4FM2 A;  3AO3 A;  2XO7 A;  4AHT A;  4F2S A;  1I94 K;  4O55 A;  2X78 A;  4W5Q A;  5GAE P;  2NZT A;  4K43 A;  4XEI A;  4FLU A;  1I3A A;  1ESV A;  3ZEU A;  4LH5 A;  1NK9 A;  5HBM A;  3ZX3 A;  4MLH A;  4BR0 A;  3O8M A;  3HVT A;  4OVL A;  4EHU A;  1ZBI A;  2X74 A;  3AA5 X;  1D8Y A;  2OTJ N;  2GUI A;  1IBK K;  3HST B;  2XY6 A;  3CPE A;  4JHD B;  3T3F A;  2OTL N;  1RDD A;  2CGK A;  3M1F A;  3EE8 A;  3MX5 A;  2RF2 A;  3CJC A;  3QIP A;  2UXC K;  4KAZ A;  1BI4 A;  1N5Y A;  5LL6 Z;  1OH5 A;  2P1J A;  1QS4 A;  3CPW M;  5JMV A;  4FWS A;  3RMA A;  3O9R A;  1VSH A;  4DSF A;  3SUQ A;  2O8D B;  3C0B A;  2D0C A;  3G0Z A;  1EWQ A;  3ISN C;  4JKG B;  2G8F A;  4FJ9 A;  1ILY A;  2NRR A;  3HP9 A;  4CEZ A;  4YOX A;  2HHH K;  4N5S A;  2VGM A;  2NRX A;  4O0J A;  3VGM A;  4CZF A;  2RPI A;  5J2N A;  3MN6 A;  1X3N A;  3NMU A;  1GOB A;  2NRZ A;  1ITG A;  4CK3 A;  3VA0 A;  4O5F A;  3V1Q A;  3P38 A;  5KPZ A;  3AVJ A;  4MO4 A;  3WT0 A;  4JRQ A;  3O4W A;  5CZ2 A;  2ZF5 O;  4Z4H A;  1HMV A;  4GY2 B;  5BN8 A;  3M3Z A;  5FPN A;  3PX4 A;  1TYQ A;  2A1S A;  2NRT A;  3KKS A;  1KCF A;  4E19 A;  2DFH A;  4CZE A;  3KLH A;  3BEX A;  1TAU A;  4FJK A;  4LY7 A;  3M8Q A;  4DV5 K;  4E1M A;  3OYC A;  3E9O A;  3V9W A;  1VSK A;  5LMN K;  1K8K A;  2ZWH A;  4IG0 A;  3BDP A;  5FPD A;  3KZB A;  1BA0 A;  1X1P A;  3ZT4 A;  3AGR A;  3QFU A;  4LSL A;  4OKE A;  4DQ8 A;  3MAQ A;  4DFM A;  4HCC A;  3R3L A;  1RDU A;  1OVQ A;  1NWK A;  4H5T A;  4OGE A;  1TK5 A;  1JLF A;  1IBL K;  1RT1 A;  1RIL A;  4KFB A;  4FJX A;  3JSM A;  3K59 A;  4GNI A;  4E7L A;  4CW7 B;  4DV4 K;  1W9H A;  3UKU A;  4IWV A;  4BDY A;  1RCH A;  3LDO A;  4IO8 A;  3QEI A;  3ZX2 A;  4HUF A;  2XY5 A;  3V1O A;  1OKJ A;  2HBJ A;  3H6E A;  3CQY A;  1EKE A;  1BIS A;  3MX2 A;  4BWJ A;  4JKB A;  3SMP A;  4CE9 A;  4I2P A;  4NCB A;  2VWJ A;  3U3Y A;  1L3S A;  4U67 L;  2HBM A;  4CJL A;  1VQ7 N;  4H5N A;  2UUA K;  4M3R A;  4FLW A;  1S9E A;  3TSQ A;  2HHV A;  4CEB A;  1RBV A;  4CEA A;  2E4L A;  4JI6 K;  1Q9Y A;  1OH8 A;  1KFD A;  4PHT X;  3LL3 A;  4QS7 A;  3KK7 A;  4DTM A;  3HPH A;  3D2E A;  1E4F T;  2DTU A;  3BF1 A;  5F1X A;  5DM6 L;  1IKY A;  3J81 O;  1C0T A;  4FLT A;  4AF1 A;  1QVF M;  3IRX A;  5AJ3 K;  2PZS A;  2Q0R A;  4ID1 A;  4BRE A;  4WFA L;  3VER A;  1T05 A;  4G9Z A;  2YNF A;  5JLF A;  2E6M A;  3M6G A;  3HXM A;  4H03 B;  1RBU A;  1YTA A;  1ZBF A;  4OX9 K;  4JI5 K;  4M63 C;  2VGN A;  1VQN N;  1JCE A;  1XMO K;  1DGK N;  5E41 A;  3L8B A;  2ZQB A;  1SL1 A;  4KHP K;  3P1G A;  2O8B A;  3H08 A;  3HZ6 A;  1HKC A;  2KLA A;  3A0I X;  1NBW A;  3F9M A;  5AQX A;  2W6L A;  3AVI A;  5HRS A;  4B9U A;  4IJA A;  4DU3 A;  1TAQ A;  1KVC A;  2BGG A;  1NMN A;  1EET A;  4CCH A;  2QWO A;  3DRP A;  1JKH A;  2FSN A;  3C94 A;  3G6E N;  3SUN A;  3VQ4 A;  3ZT1 A;  2KZZ A;  4IO9 L;  1L3U A;  4F3O A;  4N41 A;  5CY4 A;  1T6C A;  4BRA A;  5HRO A;  2ZM6 K;  4NYF A;  1O1W A;  4E1N A;  3R9P A;  1UWB A;  1VRT A;  4DR7 K;  2VQE K;  3KHY A;  4KTW A;  1GLJ O;  4CJ5 A;  2W40 A;  3HOT A;  3RTV A;  1TKZ A;  1B92 A;  5LMU K;  1S1W A;  1ZYQ A;  2G8W A;  3BP8 A;  5FDL A;  4FM0 A;  2IC3 A;  3VQ5 A;  2HBK A;  2YCH A;  1KD1 O;  4JN4 A;  3V9S A;  2GEL A;  3D2F B;  4BDZ A;  2I5J A;  3O9U A;  2Z1G A;  1V4S A;  2IIR A;  3A5L C;  3DMJ A;  3QIN A;  1L5U A;  4NCG A;  3SUO A;  3G4S N;  3ZT2 A;  3ALY A;  3MCA B;  4NYN A;  3PLA A;  3CJA A;  3I56 N;  4CGH A;  1YIJ N;  3KK2 A;  1TUU A;  3ZSR A;  1NK5 A;  5J1E A;  2JLE A;  4B8C A;  2HHU A;  3I0R A;  3OVN A;  4H0X B;  4FCY A;  3O1B A;  3OYK A;  2ASP A;  3K5M A;  3O5B A;  3AV9 A;  1ATS A;  3CJ7 A;  1WAJ A;  4CBU A;  1S6P A;  3RVC A;  4BGB A;  3EYZ A;  2ZJP L;  4FZX C;  4OLA A;  4X65 K;  3SAH A;  3NAE A;  3NBP A;  5I9E B;  3K5L A;  4IEE A;  1IV0 A;  4RWT A;  1GLE G;  4O4G A;  3KLF A;  5AQG A;  3QES A;  4EP4 A;  4DSK A;  4GW6 A;  3NE6 A;  1O13 A;  4FSV A;  4H0T B;  4LSN A;  4O44 A;  4BWM A;  2FF3 B;  4DR6 K;  5JLH A;  3A5M C;  5IWA K;  3SUP A;  3KWI A;  3P31 A;  4M3X A;  1LAV A;  3OS2 A;  4FLV A;  3WQT A;  2V7Y A;  3AO5 A;  5DK5 A;  4JAX A;  1QSS A;  2YI1 A;  1UAX A;  3PV8 A;  4BQL A;  1R0A A;  4KHQ A;  4JI0 K;  4CJE A;  4CHP A;  1J9A A;  1NGE A;  2YHX A;  4JKH A;  3ULE A;  4FZZ A;  5ELZ A;  3G71 N;  1F21 A;  3CFP A;  4B1U B;  1TL1 A;  2XY8 A;  1SZ2 A;  2AP1 A;  1WSF A;  3U4L A;  4E7I A;  3SLC A;  4CFD A;  3AO2 A;  4BVO A;  1KAY A;  4W5R A;  1WUA A;  5HOO A;  1QE1 A;  3LDL A;  4BY9 C;  4BG9 A;  1GOC A;  2QXF A;  3VTI A;  2EX3 A;  3TAP A;  4IJN A;  3OYB A;  1OH6 A;  4KHN A;  5K14 A;  3OYI A;  3TSU A;  3CXC M;  3CJB A;  3LPT A;  4DTX A;  2GTD A;  1NNE A;  4LF6 K;  4CZM A;  1HPM A;  2A40 A;  3R8E A;  4E7H A;  2KW4 A;  3ZET B;  1NOZ A;  4QCL A;  1TV6 A;  1JCF A;  3HTV A;  1W97 L;  3I33 A;  4M7X A;  3CCM N;  3VOV A;  4FJI A;  4YFU A;  3UB5 A;  1B9D A;  3AVG A;  1X9J A;  2PY5 A;  3VQQ A;  1NGB A;  1HQE A;  5AQM A;  4BE1 A;  1G99 A;  1QSY A;  2HVH A;  2YX6 A;  5KQ8 A;  2D0B A;  4RW8 A;  1VSL A;  4EIA A;  3FR0 A;  3QBX A;  4EAH D;  1LV5 A;  3SV3 A;  5FPE A;  4YDU C;  4J8F A;  4FK2 A;  1BIZ A;  2OCE A;  4CJ3 A;  2YNH A;  5C15 A;  4M3Z A;  1QHT A;  4LH4 A;  3TAF A;  3L2W A;  3LZI A;  3OJS A;  2F96 A;  1VK0 A;  2P9U B;  4W5T A;  4FOI A;  2QW9 A;  3THY B;  1WSH A;  4YY3 K;  4YOU A;  1S22 A;  5DM7 L;  4ILH A;  1C6V A;  2PFU A;  3LDN A;  4CZI A;  3WXI A;  3L2R A;  4JK7 A;  1XMQ K;  3HJF A;  3NF9 A;  3OYM A;  2ZGZ A;  2B4J A;  2HNY A;  3AA3 A;  2QK9 A;  4AM6 A;  1RDB A;  1SQK A;  2O4I A;  3VEX A;  1RTH A;  2GUP A;  2UUC K;  4B9T A;  2F9W A;  3SNN A;  3THX A;  3B8A X;  3Q7B A;  4WQ5 A;  1VAZ A;  4JD2 B;  3ASM A;  1NU0 A;  5CHI A;  2P9S A;  1BA1 A;  5FLX O;  4DUY K;  2O8C B;  3E1Y A;  1RBT A;  2Q1N A;  4KO0 A;  2DFE A;  1YAG A;  4JS5 A;  4PY5 A;  4WQ4 C;  2IDO A;  1H1V A;  3WNE A;  1MWK A;  1VQP N;  2HMP A;  3H1Q A;  3IFR A;  2ETJ A;  2OPR A;  1RGI A;  3O4Q A;  4BRF A;  2Z1I A;  4Y0W A;  3KJV A;  1VRU A;  1JLE A;  3IMX A;  4CZL A;  4LFC K;  1E3M A;  4DR5 K;  2P9K B;  3U3G A;  1RFQ A;  3MMV A;  4YOR A;  5DMR A;  2HOE A;  1GLF O;  5MLC Q;  4JKA A;  4FLX A;  4BDP A;  4CF1 A;  5AQJ A;  4DV7 K;  1RDC A;  1NKC A;  4HCB A;  2OA8 A;  1U6Z A;  5JVH L;  2ZE2 A;  3LPU A;  3EN9 A;  1QTM A;  3S3M A;  5FRM A;  4OO1 J;  4PKH A;  3MN5 A;  2QWM A;  1JLB A;  1ZBS A;  4B1Z A;  4PA1 A;  3ZSO A;  3KK1 A;  2JGU A;  4R5P A;  3CCR N;  2F8T A;  1NJZ A;  3DXK B;  4X66 K;  4YOW A;  4C1N I;  4PKI A;  4CBX A;  2QKK A;  3C7N A;  4IFV A;  3SCX A;  5GAG P;  3SQ2 A;  2HF3 A;  5JIC A;  4NB4 A;  2NLX A;  3EZW A;  5BRF A;  3DLB A;  1GLC G;  3IDH A;  5KGX A;  5AQF A;  4B3T K;  3QB0 A;  3DRR A;  3ID6 A;  4DV2 K;  3HT3 A;  4DLE A;  4C8M A;  2W41 A;  4FZY A;  1S1V A;  2FF6 A;  2Q0U A;  1X9W A;  2YKN A;  2HHX A;  4PKG A;  4FO0 A;  4F2R A;  3Q7C A;  3AVC A;  1YJW N;  2E2N A;  1VSJ A;  2Q31 A;  4NLC A;  5AQS A;  1D9F A;  1WBD A;  1A5X A;  5HLF A;  3BUZ B;  3FGU A;  4OPK A;  1XNR K;  4HHT A;  3TAQ A;  4FPB A;  1QHA A;  1LWE A;  3CIP A;  2P9P A;  3TPQ A;  1ASU A;  4FWR A;  3VEY A;  1HLU A;  1RNH A;  1RTD A;  1VHX A;  5HRR A;  4DB3 A;  4CES A;  3CCE N;  3OHR A;  1K9M O;  4N76 A;  4DHY A;  4HUG A;  3T1H K;  3QET A;  2O8E B;  3TAB A;  5BR8 K;  3ZSX A;  4JYA K;  1NLV A;  3OJU A;  2VWK A;  2P9I A;  3GOI A;  5AFU A;  3QFP A;  3OYL A;  1NGJ A;  3ATV A;  4GV3 A;  3NVK A;  4DQR A;  4CF9 A;  4KB1 A;  1QZ5 A;  2YHW A;  4CFC A;  4Q0B A;  1GLD G;  3DXM A;  1FXX A;  4A57 A;  3CHW A;  5KRS A;  4B9M A;  1NGC A;  3V4I A;  1GOA A;  2YNG A;  1QZ6 A;  4ELV A;  3LAK A;  2Q97 A;  1VQ8 N;  1QQO A;  4FWP A;  3U6F A;  2E1Y A;  5BRH A;  2QM1 A;  1IO2 A;  2DY4 A;  3M8R A;  3FZL A;  2FBT A;  4BR5 A;  1OH7 A;  2HF4 A;  3KD1 E;  3E9L A;  4KPY A;  2X6S A;  1RT2 A;  2E88 A;  1DEJ A;  3JXU A;  4ELT A;  4Y1C A;  1Q9X A;  4FW1 A;  2RN2 A;  3CET A;  1KVB A;  1TGO A;  4LF7 K;  4JI2 K;  2P5G A;  3F73 A;  4WQ5 C;  2PYL A;  3K0S A;  4LF9 K;  4WE1 A;  1U2V B;  4DTN A;  3RR8 A;  3ENO A;  3BZK A;  4KHU A;  3PIP L;  1IG9 A;  3W0L A;  2R7Y A;  1S1U A;  3DJC A;  3OYH A;  2HHQ A;  2O8F B;  1BDG A;  2OPS A;  4CJS A;  3H1V X;  1U48 A;  1VQK N;  3HO1 A;  3C6T A;  4U7B A;  5H1S Q;  4DSI A;  5F2R A;  3WEE B;  4A59 A;  5LJW A;  3TWH A;  3HPO A;  5JS2 A;  4X62 K;  4EFH A;  2NNW A;  2P9L B;  4FJH A;  3CM6 A;  4FJ5 A;  1KC8 O;  4CER A;  3NVM A;  1T3V A;  1NKE A;  1VSE A;  4CJR A;  4MDA A;  2KHO A;  2BDP A;  5LJV A;  4A5A A;  4KI6 A;  4EHT A;  2A42 A;  3PY8 A;  2DPN A;  4I7F A;  3SJJ A;  4BC3 A;  1BU6 O;  1NGI A;  1T8E A;  4DSL A;  3T19 A;  1JLQ A;  4AHC A;  4PWD A;  1QQM A;  2KFZ A;  1Z26 A;  1QSL A;  4OGC A;  1RT7 A;  4DFK A;  3H45 C;  3EO3 A;  1MDU B;  1NK8 A;  4DTU A;  1NG9 A;  4DR4 K;  1NK4 A;  2CGL A;  2X6N A;  2GBZ A;  4F3T A;  2HHW A;  1RTJ A;  3OS1 A;  3ZX0 A;  3VQA A;  1TK8 A;  2QWR A;  4IDK A;  3D45 A;  4Z4G A;  4DV1 K;  4I2Q A;  4KV8 A;  4Q5V A;  4GV9 A;  3OA9 A;  5F0X A;  2QWN A;  3D0P A;  4LF5 K;  3MWP A;  2IS3 A;  1XWL A;  3OS0 A;  3VQ8 A;  2CH6 A;  1IJJ A;  1KQS M;  4RW9 A;  3KLI A;  1JJ2 M;  4C23 A;  4FOE A;  3MXI A;  4I9Q A;  5AFU H;  3MXM A;  4W5O A;  1BCM A;  4FWO A;  4K41 A;  4QAG A;  1LWC A;  1BO5 O;  5AZJ A;  1WB9 A;  5BN9 A;  5JVG L;  4DV0 K;  3L4I A;  3SMS A;  1LCU A;  3LZJ A;  3DRS A;  3MXJ A;  5AQL A;  1WSI A;  3VEN A;  4PL8 A;  1HYV A;  3ZYY X;  3PUF A;  1ZBU A;  3U9D A;  2NRH A;  1K8A O;  3IS9 A;  4DQQ A;  3AY9 A;  5AQH A;  3VA3 A;  1N6Q A;  5E26 A;  3P5J A;  3L3V A;  4BRC A;  4RW7 A;  3GG4 A;  5BPL A;  4ZTJ A;  4CJU A;  3RR7 A;  2YNI A;  3E66 A;  3VEW A;  4YDU A;  2D1K A;  2VYP A;  3HM9 A;  4K0K K;  4JHD A;  5GIO A;  4JI3 K;  1JLG A;  3IG1 A;  4M42 A;  4FLZ A;  3NH1 A;  3P4I A;  1LW0 A;  3EL2 A;  3N4Q A;  2VQF K;  4Z4I A;  3PIO L;  5M1F A;  4L8R B;  3AVK A;  1I39 A;  1J6Z A;  1HYS A;  1HQU A;  2O8D A;  3MK6 A;  4JNE A;  3O9Q A;  5C25 A;  4A61 A;  3QEP A;  1WLJ A;  1VQO N;  4JKG A;  5I3U A;  1E4G T;  1XNQ K;  5GIN A;  1X9S A;  1XI1 A;  1REV A;  1YXQ A;  3VPZ A;  3CD6 N;  3K5O A;  5AQZ A;  4UQG A;  1Q8I A;  4CGG A;  3HVR A;  3OYF A;  1OVY A;  5AQY A;  4IOX A;  3IKM A;  2FBX A;  3SPZ A;  1FKO A;  3K57 A;  4WQ4 A;  4KH6 A;  5AQT A;  2PAV A;  3OY9 A;  3HOS A;  4H8K A;  3L3U A;  4DWI A;  1ZXO A;  3D7E O;  3K5N A;  3FZH A;  3ENB A;  3V9Z A;  2KFN A;  3WXL A;  3A8Y A;  3DWL A;  3EKU A;  3PX6 A;  2FXU A;  2A3Z A;  1C0F A;  2HBL A;  3WNH A;  3CYM A;  4H0P A;  2P51 A;  2OZS A;  4BC2 A;  2W6K A;  3HSC A;  2D0P A;  5KPR A;  4I6M B;  1LAW A;  3ZSW A;  3CC2 N;  3DOK A;  4GVM A;  3W3D A;  3O9T A;  4FWM A;  4BE2 A;  3SZ2 A;  4B9Q A;  1S3X A;  4MO5 A;  3VQ7 A;  3DLL L;  3JYT A;  4CGF A;  3G10 A;  1EO1 A;  1KAZ A;  1CXQ A;  2G8H A;  3ID8 A;  4H5R A;  5C2F A;  4ISE A;  4AHR A;  3JAM O;  3NGZ A;  2GWJ A;  3D6R A;  1VQM N;  2W42 A;  4BR9 A;  4C8L A;  4OLB A;  3EZ5 A;  3M5R A;  1DTT A;  1L3T A;  2F9T A;  1Z25 A;  3AGK A;  4AHU A;  4BRK A;  5CZ1 A;  3BF3 A;  2ITM A;  3OYA A;  3HRG A;  3M8S A;  4DQS A;  1J5E K;  2WBN A;  3LP0 A;  1Z05 A;  3TTF A;  4JI8 K;  4OPA A;  4DTJ A;  4O0I A;  1WOQ A;  3G25 A;  2JWL A;  4DQI A;  2HND A;  4CJ4 A;  1S1X A;  3P83 D;  4ZTF A;  4FVM A;  3VGK A;  4TSX A;  2HVI A;  4DR2 K;  1X3M A;  3VQE A;  1UA0 A;  3ZCM A;  3LAM A;  3H3O B;  3QO9 A;  5CYM A;  4CEE A;  5AZI B;  1KVA A;  3OYG A;  3CCL N;  4KTZ A;  3LDS A;  5M1N A;  3SPY A;  2F8S A;  2HMI A;  4BC4 A;  3C6H A;  1SS6 A;  2FSJ A;  4JLH A;  1FK9 A;  1YUW A;  5J2Q A;  1HNX K;  4M3U A;  3C95 A;  4WFN L;  4GKJ K;  4Z4C A;  4HUE A;  3QML A;  5EOY A;  4V19 S;  3AVA A;  1CZA N;  4WFB L;  4NXN K;  4KH5 A;  3MN7 A;  3LWM A;  5AR0 A;  3ULD A;  5HL7 L;  3TI0 A;  4DFP A;  3CCS N;  1RDA A;  3VGL A;  2OPQ A;  2G8K A;  1C0M A;  4QS8 A;  3HI0 A;  3RMB A;  4FJ7 A;  3O3H A;  3TSP A;  4A2B A;  1X9M A;  5FPM A;  4RW4 A;  4KTQ A;  1DT9 A;  5EU7 A;  2VCP A;  4FL9 A;  4DSE A;  2A1R A;  3ZEU B;  3AAQ A;  3H3N O;  2KQ2 A;  2BAN A;  3GE1 A;  1NGG A;  2H3G X;  3VQ6 A;  4CJK A;  1HKG A;  4DU4 A;  3AO1 A;  5C0Y A;  1DTQ A;  1TKX A;  1P90 A;  4Z94 A;  2A6A A;  2RE2 A;  2G8U A;  1HJO A;  2HNZ A;  1D9D A;  5BPN A;  4CHY A;  3DAW A;  2E2Q A;  4FM1 A;  3SQ4 A;  1CZ9 A;  4LC9 B;  1T6D A;  4FWN A;  3D2F A;  3SQ1 A;  4A5B A;  4N47 A;  2HST A;  3O9S A;  1Q81 O;  3WQU A;  4DV3 K;  5AQO A;  1BI4 B;  3PSF A;  3CCU N;  1IBM K;  3OYN A;  4JRP A;  1T7P A;  4E7J A;  3WUH A;  3DM2 A;  1SAZ A;  1RT4 A;  5LY3 A;  4DTP A;  5C2D A;  4IG3 A;  4Z4E A;  3TR8 A;  4JI7 K;  2F7T A;  4DQP A;  1NOY A;  4M3T A;  1KXP A;  5AQN A;  1HJR A;  4KHY A;  4CVN E;  4XIU A;  4JKF A;  1YJ9 N;  4I9L A;  5M1Q A;  4E1J A;  3SI6 A;  3QBW A;  3CJ1 A;  1G15 A;  3ENH A;  1BGX T;  4BC5 A;  4B3S K;  3KLE A;  3NDK A;  4FWL A;  3CF5 L;  1TVR A;  4CJT A;  3N4P A;  4DCH A;  2FBV A;  4DLG A;  1VQ5 N;  1BQN A;  1B9F A;  4CJW A;  1IKV A;  3E9P A;  3F5T A;  4KI4 A;  1TYQ B;  5A2Q O;  2UXB K;  4CF2 A;  3KK3 A;  3MDQ A;  3AVH A;  2Q36 A;  4EZ9 A;  3VET A;  4GVE A;  3T7Z A;  3CC7 N;  4CFA A;  4AHV A;  3AA4 A;  3HYF A;  1IKW A;  5KI6 A;  1K8K B;  4B1W B;  3NF6 A;  4AIL C;  1GLB G;  5SZT A;  2WON A;  1S72 N;  3SJH A;  4J2B A;  4DG1 A;  4DR1 K;  2ASO A;  3CQ8 A;  3CI5 A;  2D4W A;  2BH1 A;  2VG7 A;  1M90 O;  4CZK A;  1TKD A;  4FJL A;  1FKP A;  2D0A A;  3HM8 A;  2BE2 A;  4Y1D A;  3RRG A;  3MN9 A;  4N56 A;  2F4V K;  2FSK A;  3J7A P;  3UKU B;  3SBT A;  2A41 A;  4H4M A;  1N36 K;  3F2K A;  3CJ9 A;  4C8K A;  3HP6 A;  1NMD A;  5BRD A;  1VSD A;  2D5R A;  3BGR A;  4ID5 A;  3KVG A;  1J53 A;  1JL1 A;  3HK2 A;  3CER A;  4YOV A;  5AQK A;  1U45 A;  2Q2R A;  1M1K O;  4M3Y A;  3EKS A;  4K25 A; 
#chains in the Genus database with same CATH homology
 3V9S A;  1NKE A;  4CK2 A;  1VSE A;  5C24 A;  3HPG A;  4BDZ A;  4CJR A;  1QQC A;  4OPJ A;  4CIG A;  2LSN A;  3L2V A;  2I5J A;  1SV5 A;  1RT5 A;  2Z1G A;  2EHG A;  3SV4 A;  2BDP A;  4KI6 A;  3ZSQ A;  4BE0 A;  1SUQ A;  4OJR A;  3DMJ A;  4DF8 A;  2Y1J A;  2VG6 A;  3DLH A;  4FJM A;  3QIN A;  4B9V A;  1T03 A;  4CFB A;  5SWM A;  3CFR A;  3PY8 A;  4I7F A;  3SJJ A;  1L5U A;  4NCG A;  3SUO A;  2P5O A;  1T8E A;  3ZT2 A;  3RRH A;  3ALY A;  4DSL A;  1A5V A;  1NK0 A;  3T1A A;  2RKI A;  1EXQ A;  3ITH A;  4NYN A;  3T19 A;  4FJ7 A;  1JLQ A;  1TKT A;  4AHC A;  4CHZ A;  2YKM A;  3NGI A;  1L3V A;  4PWD A;  2Y1I A;  4HTU A;  3NCI A;  2AJQ A;  2FBY A;  4CGH A;  4DS4 A;  1Z26 A;  2KFZ A;  1C1B A;  4CF0 A;  1WNS A;  3ZSR A;  3KK2 A;  1SL2 A;  1NK5 A;  3O4N A;  1QSL A;  4OGC A;  1RT7 A;  2JLE A;  1BL3 A;  2IAJ A;  4B8C A;  3I0R A;  5J1E A;  3OVN A;  4DFK A;  1NK8 A;  1SKR A;  2HHU A;  4DTU A;  4FCY A;  1HRH A;  1NK4 A;  3S3N A;  3KKR A;  2X6N A;  3OYK A;  2E6L A;  2GBZ A;  3EY1 A;  4F3T A;  3K5M A;  4CK1 A;  1RTJ A;  3OS1 A;  2HHW A;  3AV9 A;  1TK8 A;  3VQA A;  4IDK A;  1J5O A;  3D45 A;  5CYQ A;  2G8V A;  4Z4G A;  4I2Q A;  4KV8 A;  4Q5V A;  2ZD1 A;  1NJW A;  2G8I A;  3QNN A;  2Z1H A;  4OKK A;  3D0P A;  3TAE A;  1C0U A;  1WAJ A;  1ASV A;  1BQM A;  1U4B A;  1MU2 A;  2IS3 A;  4FK0 A;  1S6P A;  3EYZ A;  1LWF A;  1XWL A;  2YHB A;  3ZT3 A;  3VQ8 A;  3OS0 A;  4FZX C;  4OLA A;  3DLK A;  4RW9 A;  3KLI A;  4DSJ A;  4PQU A;  3NAE A;  4LD0 A;  2XRI A;  3ZSZ A;  3NBP A;  1WSG A;  2B6A A;  3K5L A;  3MXI A;  4I9Q A;  4FYD A;  3HL8 A;  4W5O A;  5KGW A;  3MXM A;  1ASW A;  1BCO A;  1BCM A;  1NJY A;  4FJG A;  1U04 A;  3L2U A;  4QAG A;  1TL3 A;  4O4G A;  3KLF A;  5J2P A;  1LWC A;  3QES A;  4CEC A;  2YHA A;  4EP4 A;  3LP2 A;  4DSK A;  4GW6 A;  3B6P A;  3NE6 A;  1CZB A;  1WAF A;  4LSN A;  4O44 A;  4BWM A;  4CEO A;  3LZJ A;  4M3W A;  4EP5 A;  3DRS A;  3MXJ A;  4IFY A;  3RMC A;  3CFO A;  2OYQ A;  3SUP A;  4DF4 A;  3QIO A;  1WSI A;  1KSP A;  4M3X A;  1LAV A;  4RW6 A;  3OS2 A;  4FLV A;  3O3F A;  3KD5 E;  1HYV A;  3PUF A;  3VQ9 A;  1ZBU A;  3DLG A;  3AO5 A;  5DK5 A;  3LWL A;  3M8P A;  1D5A A;  4CIF A;  3K58 A;  4F8R A;  3O3G A;  4FW2 A;  4CEF A;  1QSS A;  1UAX A;  3IS9 A;  4DQQ A;  3PV8 A;  1R0A A;  4KHQ A;  4DFJ A;  3VA3 A;  5HP1 A;  1N6Q A;  3P5J A;  3L3V A;  1RT3 A;  4CJE A;  1HYZ A;  4CHP A;  1J9A A;  4RW7 A;  3WNF A;  3RMD A;  4FK4 A;  3VQB A;  4CHO A;  3KLG A;  3DI6 A;  4ZTJ A;  4CJU A;  4FZZ A;  3RR7 A;  1F21 A;  3CFP A;  2YNI A;  5HRN A;  1TL1 A;  2XY8 A;  4B8A B;  1NKB A;  3L2Q A;  3HM9 A;  4B9N A;  1WSF A;  4KHW A;  1JLG A;  3IG1 A;  5D3G A;  4M42 A;  4FLZ A;  3SQ0 A;  4E7I A;  4CFD A;  3IAY A;  3NH1 A;  3S3O A;  4E3S A;  3THV A;  1LW0 A;  1RBR A;  4CGJ A;  1NK7 A;  4FXD A;  3AO2 A;  4W5R A;  1HNV A;  1QE1 A;  4DTS A;  4Z4I A;  2ATQ A;  1GOC A;  1KFS A;  2QXF A;  4DMN A;  4L8R B;  3AVK A;  2XHB A;  2EX3 A;  4O5B A;  1C1A A;  1I39 A;  3TAP A;  3OYB A;  4KHN A;  1HYS A;  1HQU A;  3AO4 A;  5K14 A;  3OYI A;  3WNG A;  3UIQ A;  5C25 A;  3LPT A;  1RBS A;  3QEP A;  4QOZ B;  4B08 A;  4DTX A;  1WLJ A;  4Z0U A;  1ZBL A;  3ZT0 A;  3V9U A;  5I3U A;  2NUB A;  3C6U A;  4G1Q A;  1X9S A;  4K8Z A;  4E7H A;  2KW4 A;  4KRF A;  1NOZ A;  1XI1 A;  4QCL A;  1REV A;  3CM5 A;  1TV6 A;  3LAN A;  1LW2 A;  3TAG A;  3K5O A;  3QLH A;  3TAR A;  4YNQ A;  4UQG A;  3NFA A;  1Q8I A;  3AVN A;  4FJI A;  4K8X A;  3FFI A;  5C42 A;  4YFU A;  4CGG A;  3V6D A;  3K2P A;  3VQD A;  4CF8 A;  4HVJ A;  1WSJ A;  3HVR A;  1B9D A;  2B5J A;  3OYF A;  3AVG A;  1SL0 A;  3KTQ A;  2PY5 A;  2FBX A;  3VQQ A;  4BE1 A;  1J54 A;  1HQE A;  3SPZ A;  1FKO A;  2XY7 A;  1QSY A;  2HVH A;  1JL2 A;  3K57 A;  2D0B A;  3DLE A;  4RW8 A;  1VSL A;  3V1R A;  4MQ3 A;  1LV5 A;  3SV3 A;  4CED A;  2WOM A;  4FK2 A;  3OY9 A;  3DLR A;  1BIZ A;  4CJ3 A;  2YNH A;  1NK6 A;  3AVB A;  4M3Z A;  4H8K A;  3L3U A;  5JS1 A;  1QHT A;  4LH4 A;  4DWI A;  3TAF A;  1S1T A;  2Q3S A;  3K5N A;  3L2W A;  1XHZ A;  3LZI A;  3OJS A;  2F96 A;  1UOC A;  3SYZ A;  1VK0 A;  4Z4F A;  3V9Z A;  2KFN A;  4C8N A;  3V81 A;  4W5T A;  1JXB A;  3PX6 A;  2OZM A;  3WNH A;  3ZSV A;  4ICL A;  1WSH A;  1K6Y A;  1C6V A;  3CYM A;  4CJP A;  3OYD A;  3AVM A;  1CLQ A;  2P51 A;  3A2F A;  2OZS A;  1EX4 A;  2GV9 A;  1LAW A;  3ZSW A;  3L2R A;  3DOK A;  3QEW A;  3HJF A;  3NHG A;  3NF9 A;  3OYM A;  4FJ8 A;  2B4J A;  2HNY A;  4GVM A;  3AA3 A;  2QK9 A;  3LP3 A;  4FM2 A;  1S6Q A;  3AO3 A;  5KTQ A;  1RDB A;  2XO7 A;  4BE2 A;  3SZ2 A;  4AHT A;  5KRT A;  3ZSY A;  2YV0 X;  4F2S A;  3VQ7 A;  1YVU A;  3AVF A;  3JYT A;  1VSM A;  3G10 A;  4O55 A;  1RTH A;  2X78 A;  4CGF A;  3MEG A;  4W5Q A;  4B9T A;  2HW3 A;  1ZBH A;  4FLU A;  1I3A A;  3SNN A;  1CXQ A;  2G8H A;  1NK9 A;  4LH5 A;  4J2E A;  5HBM A;  4IKF A;  4B9L A;  4GMJ B;  3ASM A;  4AHR A;  5T7B A;  3NGZ A;  3VN5 A;  1YTU A;  3HVT A;  1RBT A;  4KO0 A;  4OVL A;  3V9X A;  4B3O A;  2DFE A;  4JS5 A;  4PY5 A;  2W42 A;  4C8L A;  2IDO A;  3WNE A;  1ZBI A;  4OLB A;  1KTQ A;  2X74 A;  3EZ5 A;  3AA5 X;  4F4K A;  1DTT A;  1L3T A;  1D8Y A;  1Z25 A;  4AHU A;  4FJN A;  2GUI A;  2ETJ A;  2OPR A;  3O4Q A;  5CZ1 A;  3OYA A;  3HST B;  2Z1I A;  2XY6 A;  3M8S A;  3T3F A;  3OYE A;  1VRU A;  3KJV A;  4DQS A;  5J2M A;  3LP0 A;  1RDD A;  1JLE A;  2RF2 A;  3QIP A;  1RT6 A;  3U3G A;  1KLM A;  4CEQ A;  4DTJ A;  4O0I A;  4KAZ A;  1BI4 A;  5DMR A;  1N5Y A;  3MEE A;  4DQI A;  2P1J A;  1QS4 A;  2HND A;  4FLX A;  4CJ4 A;  3RMA A;  1VSH A;  4DTO A;  4CF1 A;  4BDP A;  1S1X A;  1NKC A;  1RDC A;  4DSF A;  4HCB A;  3SUQ A;  3P83 D;  2FC0 A;  4ZTF A;  2OA8 A;  2D0C A;  3G0Z A;  4FVM A;  1SKS A;  4TSX A;  2HVI A;  3ISN C;  2G8F A;  1UA0 A;  3VQE A;  1VSF A;  2ZE2 A;  3HP9 A;  4IBN A;  3ZCM A;  3LAM A;  3LPU A;  4CEZ A;  4N5S A;  2KTQ A;  3QO9 A;  5CYM A;  1QTM A;  3S3M A;  2OPP A;  2HHS A;  4CEE A;  1NJX A;  4M45 A;  4O0J A;  5J2N A;  5FRM A;  2RPI A;  4JS4 A;  1KVA A;  3OYG A;  1GOB A;  4KTZ A;  3LDS A;  2F8S A;  3SPY A;  1ITG A;  4CK3 A;  1JLB A;  3VA0 A;  2HMI A;  4PA1 A;  3V1Q A;  3AVJ A;  3ZSO A;  1S9G A;  4JRQ A;  3QEV A;  3KK1 A;  4JLH A;  1JLC A;  1FK9 A;  5J2Q A;  5CZ2 A;  2JGU A;  4R5P A;  4M3U A;  2F8T A;  3C95 A;  4Z4H A;  1NJZ A;  1HMV A;  3DOL A;  3NF8 A;  4Z4C A;  4HUE A;  1SKW A;  3PX4 A;  2QKK A;  4IFV A;  3SCX A;  3SQ2 A;  2A1S A;  3AVA A;  3KKS A;  1KCF A;  1YT3 A;  2DFH A;  4E19 A;  4DS5 A;  1IH7 A;  3KLH A;  3DLB A;  1TAU A;  3AA2 A;  4FJK A;  4LY7 A;  1HNI A;  3M8Q A;  5KGX A;  4E1M A;  3LWM A;  3QEX A;  3ULD A;  4FJJ A;  3DRR A;  3HT3 A;  1XC9 A;  3OYC A;  4DLE A;  3TI0 A;  4C8M A;  2HHT A;  3V9W A;  1VSK A;  4DFP A;  2ITG A;  1RDA A;  4IG0 A;  1S1V A;  4FZY A;  3BDP A;  2OPQ A;  1X9W A;  2YKN A;  2G8K A;  1C0M A;  4F2R A;  2HHX A;  3RWU A;  3AVC A;  1X1P A;  4KRE A;  3ZT4 A;  1VSJ A;  4CJQ A;  3RMB A;  4OKE A;  4LSL A;  4CGI A;  3MAQ A;  4DFM A;  1D9F A;  3O3H A;  1KLN A;  4HCC A;  1A5X A;  5HLF A;  4ZHR A;  4RW4 A;  1X9M A;  3AVL A;  4KTQ A;  4OPK A;  4OGE A;  1TK5 A;  1JLF A;  5EU7 A;  4BAC A;  1RT1 A;  1RIL A;  4KFB A;  4DSE A;  4FJX A;  4HHT A;  3TAQ A;  2A1R A;  3JSM A;  3K59 A;  2DFF A;  4E7L A;  1LWE A;  1Y97 A;  1W9H A;  4BDY A;  1RCH A;  5FRO A;  2KQ2 A;  1JLA A;  1A5W A;  2BAN A;  3PO5 A;  1ASU A;  4E89 A;  3QEI A;  1DLO A;  3NH0 A;  1RNH A;  3VQ6 A;  5HRR A;  1RTD A;  4CJK A;  4HUF A;  4DU4 A;  2XY5 A;  3AO1 A;  3V1O A;  2O4I A;  3TAN A;  1DTQ A;  1TKX A;  3TAM A;  4C8O A;  4CES A;  1EKE A;  1BIS A;  2VG5 A;  4BWJ A;  4N76 A;  4AH9 A;  4CE9 A;  5FRN A;  2G8U A;  4E7K A;  2HB5 A;  4I2P A;  4HUG A;  4NCB A;  2HNZ A;  2VWJ A;  3QET A;  1D9D A;  3U3Y A;  4CHY A;  3TAB A;  4FM1 A;  3SQ4 A;  1CZ9 A;  3ZSX A;  1L3S A;  4AHS A;  3OJU A;  4CJL A;  2VWK A;  3SQ1 A;  3I8D A;  4N47 A;  3OYL A;  2IOC A;  4M3R A;  3NGY A;  4FLW A;  1S9E A;  4DQR A;  2HHV A;  4CEB A;  1BIU A;  1RBV A;  4CEA A;  4CF9 A;  4KB1 A;  2KZM A;  1BI4 B;  2E4L A;  3LP1 A;  4CFC A;  1Q9Y A;  4Q0B A;  3OYN A;  1KFD A;  4JRP A;  1FXX A;  4CGD A;  1T7P A;  3LAL A;  4E7J A;  5KRS A;  3I0S A;  3DM2 A;  4DTM A;  3V4I A;  3MEC A;  4B9M A;  3HPH A;  3PO4 A;  1RT4 A;  1U49 A;  1GOA A;  1BHL A;  2DTU A;  4DTP A;  2YNG A;  4IG3 A;  4Z4E A;  3TR8 A;  1IKY A;  4DQP A;  4ELV A;  3LAK A;  1NOY A;  4M3T A;  3U6F A;  4CHQ A;  1C0T A;  1HJR A;  4FLT A;  4KHY A;  4XIU A;  1WSE A;  3IRX A;  4E0D A;  4I9L A;  2PZS A;  4ID1 A;  2IGI A;  1IO2 A;  4MFB A;  3SI6 A;  2DY4 A;  1G15 A;  4NCA A;  1BGX T;  1T05 A;  3KLE A;  2YNF A;  3NDK A;  3M8R A;  5I42 A;  2FBT A;  2O4G A;  2E6M A;  3HXM A;  1TVR A;  4FLY A;  4CJT A;  1RBU A;  1YTA A;  1ZBF A;  1C1C A;  3KD1 E;  4KPY A;  2FBV A;  3OYJ A;  2PYJ A;  4CIE A;  4CHN A;  4DLG A;  4ELU A;  2X6S A;  4KB0 A;  5E41 A;  3L8B A;  2ZQB A;  1BQN A;  1RT2 A;  1SL1 A;  1B9F A;  4CJW A;  1IKV A;  4KI4 A;  3P1G A;  4ELT A;  4DTR A;  4M41 A;  4Y1C A;  4CF2 A;  3KK3 A;  4DU1 A;  3AVH A;  3H08 A;  4FW1 A;  1Q9X A;  4EZ6 A;  2RN2 A;  4J2A A;  3QER A;  1KVB A;  1TGO A;  3AVI A;  5HRS A;  2P5G A;  3F73 A;  4EZ9 A;  3E01 A;  4B9U A;  2PYL A;  1VSI A;  1HPZ A;  4CFA A;  1TAQ A;  4AHV A;  4DU3 A;  3PX0 A;  1KVC A;  1S5J A;  3AA4 A;  3HYF A;  1IKW A;  4WE1 A;  5KI6 A;  4DTN A;  3RR8 A;  2BGG A;  3NF6 A;  1EET A;  4AIL C;  4KHU A;  1TK0 A;  3CG7 A;  5SZT A;  2WON A;  4CCH A;  4FJ9 A;  4J2B A;  4DG1 A;  3DRP A;  1JKH A;  1IG9 A;  3C94 A;  3SUN A;  3VQ4 A;  3ZT1 A;  3CQ8 A;  1UA1 A;  5HRP A;  2R7Y A;  1U47 A;  1L3U A;  2KZZ A;  3MED A;  1S1U A;  2VG7 A;  4CJV A;  4F3O A;  1XHX A;  1W0H A;  5CY4 A;  3VQC A;  3OYH A;  1TKD A;  3F9K A;  4N41 A;  2HHQ A;  4FJL A;  1FKP A;  2D0A A;  4H4O A;  2OPS A;  2BE2 A;  4CJS A;  4Y1D A;  5HRO A;  3RRG A;  3QNO A;  4N56 A;  4NYF A;  1O1W A;  1U48 A;  4PUO A;  4E1N A;  3HO1 A;  4H4M A;  3C6T A;  1RTI A;  1UWB A;  1WN7 A;  1VRT A;  4DSI A;  3S9H A;  1JXE A;  4OKJ A;  4CJF A;  4C8K A;  2QKB A;  1CXU A;  4KTW A;  2Z1J A;  3TWH A;  3VQP A;  1IKX A;  3HP6 A;  4CJ5 A;  3HPO A;  1KRP A;  5JS2 A;  3KIO A;  3RTV A;  1TKZ A;  3B6O A;  1B92 A;  4W5N A;  1VSD A;  2D5R A;  3BGR A;  1S1W A;  3DYA A;  4ID5 A;  1ZYQ A;  2G8W A;  4B9S A;  1J53 A;  4J2D A;  3NH2 A;  5FDL A;  1JL1 A;  4FM0 A;  4KKO A;  3HK2 A;  2IC3 A;  3VQ5 A;  1EP4 A;  4RG8 A;  1U45 A;  3CM6 A;  4FJH A;  4FJ5 A;  4M3Y A;  4KHS A;  4CER A;  3NF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...