4MQ3A

The 1.1 angstrom structure of catalytic core domain of fiv integrase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
129
structure length
129
Chain Sequence
b'MGIWQMDCTHFDGKIILVGIHVESGYIWAQIISQETADCTVKAVLQLLSAHNVTELQTDNGPNFKNQKMEGVLNYMGVKHKFGIPGNPQSQALVENVNHTLKVWIQKFLPETTSLDNALSLAVHSLNKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Identification of phe187 as a crucial dimerization determinant facilitates crystallization of a monomeric retroviral integrase core domain.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 43
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4mq3A00
3TARA 3CFOA 3L2VA 1I3AA 2OPPA 4OJRA 2YHBA 2QXFA 4FJ5A 3C6UA 1GOAA 3V1OA 3BGRA 4ID1A 3SPYA 4FJKA 4LSNA 1J54A 4C8LA 2Q3SA 3DLEA 4CHOA 2O4IA 3VQ5A 1Z25A 1GOBA 4CGDA 1KLNA 3KKRA 4OPKA 1JXEA 4LD0A 3NH2A 1NJYA 5FRMA 1IG9A 2B5JA 1VSIA 3M8QA 3AA3A 3ZT4A 1KCFA 4B9LA 1C0MA 1TKDA 3HPGA 1WSIA 4O55A 3OS0A 3VQEA 2Z1IA 3FFIA 4AHTA 1LW2A 4Q5VA 3E01A 3AVCA 4DTUA 1WSEA 3VQQA 3LWMA 1RT1A 4IBNA 5HROA 3ZSQA 2HMIA 4J2EA 3ITHA 3L2RA 2HNYA 3QNOA 3S3NA 4AHUA 1JLGA 5HLFA 2HHXA 1WSGA 4FK2A 3AA2A 4BDZA 2XY8A 2EX3A 4AHRA 2B4JA 3G10A 4KO0A 4AH9A 3LAKA 3OS2A 1QTMA 2OA8A 4PA1A 1TKTA 4CHZA 1REVA 1LV5A 4DS5A 4BDPA 4BE0A 4OPJA 1LWCA 3DRRA 2YNIA 3CYMA 3V9UA 4FZYA 4CEZA 3AVKA 3RMBA 3I0SA 1S5JA 4DTPA 4KB0A 1RTDA 5CYMA 4CJTA 1CLQA 4CESA 1C6VA 3LZJA 4F2RA 1UAXA 1JL2A 3L3UA 1WLJA 3OY9A 1L5UA 4OVLA 3QEPA 3OYGA 1IH7A 1NK6A 4N76A 4O44A 4BE1A 1O1WA 2RPIA 4E19A 3WNFA 3LAMA 3SQ2A 1RBVA 3AVFA 2YNGA 4Z4HA 3V9SA 5HP1A 3LP3A 4F8RA 4K8ZA 1FKOA 3SPZA 1N6QA 3QIOA 3M8SA 3NAEA 4JS4A 2YV0X 2XHBA 4M3YA 1QQCA 3WNHA 1TL1A 4JLHA 1TL3A 3IAYA 3S3MA 1ZBFA 3QNNA 4CK1A 4M45A 4DQRA 1S1TA 3SNNA 4KREA 2E4LA 1RTJA 3HJFA 3JYTA 2JLEA 1SKRA 3DLBA 3KK1A 4OKJA 1J9AA 5D3GA 5JS1A 3T19A 2DFFA 3TAGA 3V9ZA 1X9SA 3LP0A 3HP9A 3OJSA 3VQ6A 5EU7A 1RT4A 3HPHA 1JLBA 4Z4CA 3LZIA 3HK2A 4FJLA 3IRXA 3ZT3A 4CHYA 2FC0A 2A1SA 1DLOA 1SV5A 3DLRA 4H8KA 4KTZA 4N41A 3DM2A 3V9WA 2HHUA 1LAVA 3KLHA 1A5VA 1KVCA 4IG0A 2YKNA 4LH4A 4RW6A 1BL3A 1MU2A 2BDPA 4CJ4A 3PX0A 4B9UA 3OYFA 2G8HA 3ZT2A 1U49A 1IKWA 3BDPA 4LH5A 3TAEA 4W5OA 4B9VA 4QOZB 1RT3A 1QSYA 4B9SA 3MEDA 3VQ9A 4KFBA 1BI4B 4CGFA 3SQ4A 1SKSA 1NOYA 4M3ZA 1ZYQA 4CJLA 4B8CA 3TWHA 3DOKA 3NH1A 4OLAA 3UIQA 1F21A 1HNVA 4XIUA 2XO7A 5HBMA 3OYJA 3OYNA 1L3SA 1ASWA 5I3UA 3QLHA 1S1XA 4GW6A 3NGIA 5KRTA 4CFBA 3LPTA 1U47A 4HUEA 1TK0A 2Z1JA 1CXUA 4F2SA 2IAJA 1EXQA 1BQMA 4W5NA 3SI6A 4DSIA 3K5MA 3TAMA 4B9MA 4CECA 4C8KA 2HHVA 5J2QA 4BWMA 2E6MA 1D5AA 5I42A 1XI1A 1VSDA 1TV6A 2X6NA 2G8KA 1VSEA 3V9XA 3KD5E 3L2UA 1RTHA 1SKWA 2YNFA 1LWFA 4YFUA 4KHUA 1RCHA 4M3RA 3VQCA 3IG1A 3ZSXA 1RBRA 3TAPA 2VWKA 1NKCA 4KHSA 4I7FA 5KGWA 3HO1A 3PO4A 1S1VA 4FCYA 1RT7A 3K57A 2G8UA 1JL1A 1LW0A 1C0TA 3HM9A 3C94A 3M8RA 4E0DA 1QS4A 4NYFA 4B9NA 2VG7A 3PX4A 4O4GA 3SUPA 1IKVA 2HHTA 4JS5A 3NFAA 3MECA 1B92A 3DOLA 4J2BA 1CZBA 1BQNA 1UA1A 2X78A 5CZ1A 3L2WA 2R7YA 3P5JA 3SUNA 3DRSA 1WSHA 4FJJA 4DF8A 4HCBA 3EY1A 2VG5A 4NCGA 3ZT1A 3VA0A 1NK5A 4KKOA 3TANA 2IOCA 3RMAA 4CK3A 4DFPA 4L8RB 4KHWA 1DTQA 1HJRA 3ZSVA 5J2PA 1KFSA 1D9FA 3QINA 4EP4A 3PO5A 4FJ9A 1Q8IA 1ASVA 4FM0A 3O4QA 3F73A 5DMRA 4DWIA 3AVNA 2ZE2A 1VSJA 4CE9A 3U6FA 4DU4A 1NKEA 5CZ2A 4DTNA 2P1JA 2GBZA 4J2AA 3RR8A 4J2DA 2IGIA 1TKXA 3PUFA 3OYMA 4YNQA 2RKIA 4I9QA 2G8IA 3NHGA 1BISA 1EETA 3KK2A 3MXIA 2HW3A 3A2FA 3NF7A 4DLGA 1C1AA 3RMDA 1RDDA 1XC9A 4I2QA 3NF9A 4UQGA 4FJNA 1TK5A 3RRGA 1QE1A 1S6PA 3HYFA 3CQ8A 3DI6A 4CJVA 4NCAA 1HRHA 5T7BA 3ASMA 4KB1A 4K8XA 4FK4A 1JLCA 1NK4A 5HRPA 4CFCA 3NH0A 4HUFA 3V6DA 1J53A 3OS1A 2FBYA 3LALA 3K2PA 3O4NA 3CFPA 5FDLA 4FJIA 4M3WA 4H4OA 1WN7A 4LSLA 3AVIA 4Y1CA 4EZ6A 1Y97A 3OYLA 1RBTA 4DSEA 1UOCA 4E1MA 3AO5A 3VA3A 1VSLA 3DRPA 3KKSA 4CEEA 1NJZA 2KZMA 1LWEA 1NKBA 1CXQA 4F4KA 2HB5A 4OKEA 4RW4A 4EP5A 3KTQA 4W5QA 2PZSA 4M41A 1WAJA 2XY7A 1BHLA 1X9MA 1KSPA 4M3TA 3NF8A 4NCBA 3O3GA 1BGXT 4O0IA 1W9HA 4BWJA 3SUQA 1S1WA 5CY4A 5DK5A 1HYZA 1RT6A 3LP2A 3TABA 3VQBA 4C8MA 2HVIA 2IC3A 1HQEA 4QAGA 2XY6A 4FVMA 1B9FA 1JLEA 1ZBHA 3RWUA 3TAQA 3LWLA 2D5RA 2NUBA 3AO4A 3AVMA 3HSTB 4NYNA 2HHSA 1S9EA 4IG3A 3NE6A 2QK9A 4KHQA 4AHVA 3MEEA 2OYQA 4CEFA 1U45A 5E41A 3O3FA 4MQ3A 4FLUA 1YTAA 3AV9A 3M8PA 1U4BA 4CJ3A 3O3HA 3RTVA 4FJGA 1KFDA 3HPOA 3HVRA 3PY8A 1UWBA 4ELUA 3ZSZA 4PUOA 4ELVA 4BDYA 2ZD1A 3MXJA 4CJFA 4FLXA 3AVJA 4C8NA 2EHGA 4DTSA 2LSNA 4DF4A 4Q0BA 4AHCA 3QEIA 2FBXA 3VQDA 3K5LA 4ID5A 1BI4A 4ZTFA 3AVHA 4FM1A 4E7KA 5CYQA 4DTMA 3TAFA 3L2QA 2WOMA 4M42A 3CM5A 4WE1A 4DSFA 1EKEA 4CF0A 3B6OA 4CJKA 3OYAA 3HT3A 2F8TA 3OYBA 2PYLA 4DSLA 4FXDA 3WNGA 1SL2A 2HNDA 1ZBLA 3AO3A 3KK3A 1TVRA 1D8YA 3KLFA 3K58A 3OYKA 4HTUA 2RF2A 1XHZA 3TR8A 3AVAA 1LAWA 3VQPA 2E6LA 2Z1HA 4GMJB 5JS2A 5KRSA 4E3SA 1Q9XA 4FJ8A 1NJWA 4CIGA 2VWJA 4CFAA 3U3YA 3KIOA 2ATQA 5J1EA 3K5OA 2YNHA 4RW9A 4B08A 4E7JA 4FJ7A 1HYVA 1ZBIA 2KFZA 4I9LA 2HVHA 1JLQA 4FZZA 1EX4A 3T1AA 3EYZA 3SQ0A 4KI4A 2G8FA 4CIEA 1C1CA 1JLAA 4CCHA 1J5OA 1VSMA 2BE2A 2B6AA 4EZ9A 3K59A 3F9KA 4FJXA 1BCMA 3L3VA 3EZ5A 2IS3A 3V1RA 3LP1A 4IFYA 4DLEA 1B9DA 4FLYA 4IFVA 3T3FA 2D0AA 1QSLA 3DLGA 4F3OA 4Y1DA 5FRNA 2HHWA 1GOCA 2GV9A 1YTUA 1QSSA 1G15A 1ITGA 2VG6A 1NK7A 3KD1E 1NK8A 3PV8A 4CJ5A 3SQ1A 4DSKA 3KJVA 3IS9A 3RR7A 4FJMA 4LY7A 2IDOA 1WNSA 4DTOA 3KLIA 2KTQA 3AVGA 4CF8A 3RMCA 4BE2A 1KTQA 3S3OA 2I5JA 1FKPA 4ELTA 1HPZA 4M3UA 4CJWA 2ITGA 3SV4A 1T7PA 1RBUA 3HXMA 1A5WA 3AO1A 3ZCMA 3ZT0A 3PX6A 3ZSYA 4CK2A 2Y1IA 1ASUA 1XHXA 1HYSA 3CM6A 3QIPA 4OGEA 4CGJA 4CJSA 1NK9A 3VN5A 3K5NA 4HUGA 3NF6A 4W5RA 2DTUA 3V1QA 1RBSA 4FLWA 2HNZA 1UA0A 1U48A 1Z26A 3G0ZA 4KV8A 3KLEA 1TAUA 1KVBA 2OZMA 1JLFA 2QKBA 2PY5A 2OPQA 4CF2A 2Y1JA 4CJUA 4KAZA 2AJQA 3S9HA 1VSHA 1IKYA 1A5XA 3CG7A 4E7LA 3SUOA 2KFNA 4ZHRA 3DLKA 3QO9A 4CJEA 1KLMA 3AVLA 1R0AA 1L3TA 2HHQA 2D0CA 1S6QA 3WNEA 1DTTA 4IKFA 4B9TA 4KHYA 5C24A 2KW4A 1YVUA 1HMVA 2GUIA 1CZ9A 1FXXA 2FBVA 3ZSWA 4DQQA 4DFKA 2XY5A 2G8VA 5KTQA 3NGZA 1I39A 3LPUA 4CHPA 4DU1A 1KVAA 3VQAA 4N56A 5J2NA 3SCXA 2P5OA 1S1UA 4PQUA 4CEOA 3SJJA 4DFMA 4DTRA 5KI6A 3KLGA 4DQPA 4DQIA 1C0UA 1RDBA 1IKXA 1EP4A 4DSJA 1FK9A 1VSKA 4RG8A 5SWMA 2A1RA 1VSFA 5K14A 4FW1A 4KI6A 2X74A 4E7IA 1NK0A 3DYAA 1ZBUA 2DFHA 4JRPA 1W0HA 3ZSRA 4CERA 3D0PA 4CGHA 4C8OA 3AA4A 4CEBA 4FLTA 2QKKA 5SZTA 2P5GA 2OZSA 4B3OA 3LANA 1T05A 3HP6A 2ZQBA 4ZTJA 4TSXA 2PYJA 1JKHA 1QHTA 2X6SA 3QERA 1WAFA 4OKKA 4FK0A 4Z4GA 2WONA 3AA5X 3AVBA 4KRFA 3V81A 3C95A 4FM2A 3JSMA 2OPSA 4RW7A 3MXMA 5C42A 4CF9A 4DMNA 4HCCA 4IDKA 1JXBA 1RT5A 4GVMA 4N47A 4DTJA 1X9WA 1D9DA 4PY5A 3P83D 4QCLA 1NJXA 1K6YA 4CJRA 3SYZA 3V4IA 4KHNA 3VQ4A 1RDAA 4Z4FA 2XRIA 4PWDA 4B8AB 2G8WA 4CHNA 2KZZA 3HL8A 1RNHA 4CJPA 3L8BA 1T8EA 4FJHA 1RTIA 1RILA 4CEDA 1TGOA 4CEQA 1NOZA 4JRQA 4CHQA 4DS4A 1TKZA 4KTQA 4Z4IA 1KRPA 1WSJA 3OYCA 1YT3A 4CGGA 3I0RA 4FLZA 3SV3A 1HQUA 2KQ2A 4AILC 1T03A 3H08A 3QEVA 2DY4A 1L3UA 3ALYA 1XWLA 4M3XA 2Z1GA 5KGXA 3DLHA 1SL0A 4MFBA 4W5TA 1BCOA 4HHTA 4KPYA 4R5PA 4Z4EA 1IO2A 3U3GA 1VRTA 1BIZA 1L3VA 3QEXA 4I2PA 2JGUA 4E7HA 3MEGA 3SZ2A 3P1GA 3OJUA 3MAQA 1TK8A 5J2MA 3B6PA 2O4GA 4CIFA 2YHAA 4DQSA 5HRSA 4HVJA 4H4MA 4FYDA 4F3TA 3QEWA 3AO2A 2BANA 2RN2A 1VRUA 4O5BA 3VQ7A 3OYEA 3C6TA 2YKMA 3VQ8A 3DMJA 3ISNC 4CGIA 4E1NA 1N5YA 3QESA 1SL1A 1HNIA 4CJQA 4Z0UA 5HRNA 3TI0A 1X1PA 4RW8A 2P51A 4OLBA 2W42A 3OYHA 1RDCA 4CF1A 4FLVA 3NCIA 4E89A 3LDSA 3OYDA 2D0BA 3RRHA 1RT2A 2F96A 3NBPA 4OGCA 1SUQA 4KTWA 4CFDA 4N5SA 4BACA 1Q9YA 1C1BA 3OYIA 1TAQA 1S9GA 1VK0A 3NDKA 4CEAA 4FW2A 4DG1A 3QETA 3ULDA 4ICLA 2F8SA 3CFRA 2BGGA 2FBTA 3I8DA 3ZSOA 2ETJA 4DTXA 1WSFA 3D45A 3OVNA 4DU3A 4DFJA 1U04A 5C25A 5HRRA 5FROA 4G1QA 3HVTA 2OPRA 4AHSA 1BIUA 3THVA 2DFEA 4FZXC 4O0JA 3NGYA
chains in the Genus database with same CATH superfamily
3M6GA 1NGBA 3L2VA 2OPPA 4OJRA 4FJ5A 2NRVA 3V1OA 4FJKA 3AAPA 3DLEA 1KAXA 1JXEA 2B5JA 3QBWA 3ZT4A 1C0MA 3W0LA 3HPGA 4H0YB 4O55A 4DR7K 4AHTA 2J4RA 3AVCA 1WSEA 3O6WA 3LWMA 2UYTA 4CD3A 5HROA 4J2EA 2HNYA 2EX3A 4IJNA 1S72N 2OCEA 1QTMA 2QA4N 2OA8A 1TKTA 1VQON 4BDPA 4BE0A 3V9UA 1LWCA 2YNIA 2BH1A 1S5JA 1CLQA 3I33A 1O13A 4CESA 3ZETA 3L3UA 1OH8A 4A5AA 1RFQA 2RPIA 4K8ZA 3LP3A 1HKBA 1N6QA 3MN9A 3QIOA 3SAFA 3M8SA 4DR1K 4IFEA 2XHBA 3T7ZA 3A5OC 1TL1A 4JLHA 4DR2K 4BR0A 3S3MA 3QNNA 4NXMK 4M45A 3J81O 3I56N 4CZHA 2YCHA 2E4LA 1RTJA 3HJFA 3JYTA 3CMEN 3J7YP 3T19A 5EU7A 3IRXA 3ZEUB 3ZT3A 1DLOA 5C15A 3FFKB 4RW6A 4LH4A 4CZEA 1BL3A 5HOOA 3R9PA 3IDHA 1LCUA 3BDPA 4LH5A 4Y0WA 2P9UA 1SZ2A 3J7AP 5GAGP 5AQUA 1ZYQA 4CJLA 1R59O 3DOKA 4BY9C 3CCEN 5C0YA 3UIQA 1F21A 2GEMA 2O8CB 5HBMA 1ASWA 5I3UA 2P9PB 4GW6A 4CFBA 3LPTA 3CCJN 2KKZA 1TK0A 4W5NA 3SI6A 1NGAA 2HHVA 1ZC6A 2E6MA 5I42A 1XI1A 1TV6A 2X6NA 5AQXA 4M3RA 4FVUA 3IG1A 3ZSXA 5KGWA 4FCYA 1RT7A 2YHXA 1LW0A 3AY9A 1QS4A 4O4GA 1JCGA 1C0GA 4JS5A 3VTIA 3IKMA 3MECA 4OPAA 3C6HA 5AQWA 3MDQA 5JVHL 1UA1A 2X78A 2ZGYA 3P5JA 2W6KA 2E2QA 3EY1A 3OA9A 3CI5A 4KKOA 2O8BA 1D4XA 3DWLA 1QHAA 3DXMA 1HJRA 1KFSA 5J2PA 5AQJA 3L4QA 3W3DA 1ASVA 3T1YK 1X3MA 3VMFB 4CE9A 3U6FA 3SMPA 1NKEA 4DTNA 4J2AA 1Q82O 4I9QA 3MXIA 1BDGA 4I2QA 1K8KB 4BRKA 4UQGA 3CCQN 1HJOA 1QE1A 3RRGA 4NCAA 1KAZA 3VGLA 4K8XA 5DM7L 1NK4A 1BWFO 5HRPA 3NH0A 1J53A 4DV6K 2FBYA 2QWPA 4YDUA 4BGBA 5FDLA 2WFBA 4LSLA 4Y1CA 4H03B 4M63C 4DSEA 1UOCA 4H0XB 3G4SN 3SK3A 4B3RK 1VSLA 3DRPA 3HBTA 2KZMA 1LWEA 3H3OB 1CXQA 3THYA 3HRGA 2FF3B 1HLUA 2XY7A 4K41A 3LDQA 3O3GA 3SUQA 3EE8A 2V7ZA 3LP2A 5BPNA 4E1JA 2IC3A 4QAGA 4NO7A 1B9FA 1TUYA 3RWUA 3O9TA 2D5RA 1T3VA 1HR0K 4NYNA 1J6ZA 4AHVA 2ZJRL 1TYQA 3MEEA 1U45A 3O3FA 1KXPA 3AV9A 4CJ3A 3RTVA 4BGAA 3PY8A 1NMDA 3QMLA 4PUOA 3D2FB 1C0FA 4DTSA 4AHCA 2E88A 3FR0A 2FBXA 4ISGA 3VQDA 4ID5A 4V19S 2P9SB 2YI1A 5CYQA 4DTMA 4BQLA 4X65K 1E4FT 4O8UA 4CF0A 3VOVA 1NGCA 4CJKA 3OYAA 2F8TA 1ZXOA 3OYBA 4FXDA 1SL2A 1ZBLA 4U7BA 1TVRA 3GE1A 3KLFA 2G8UA 1MDUB 5KRSA 2E6LA 4CIGA 3U3YA 2YNHA 3CPEA 4I9LA 3EYZA 4EHTA 2G8FA 4CIEA 4CCHA 1JLAA 5AQVA 3O08A 3NMUA 4BROA 3EZ5A 2IS3A 3V1RA 4BR4A 4IFYA 4DLEA 4DQQA 2V51B 5FRNA 4F3OA 4Y1DA 5AR0A 4CBWA 4DKWA 1YTUA 4YOYA 4FJMA 1SQKA 1YITN 4CZKA 4WFBL 2KTQA 4CF8A 4BE2A 3S3OA 2P9KB 3SV4A 2OTLN 3HXMA 3PX6A 3ZT0A 4JV5K 2HBMA 1HYSA 1XHXA 3MN6A 4OGEA 4CGJA 1Q86O 3NF6A 2GELA 3IUCA 1U48A 1Z26A 1JLFA 2OPQA 3TTFA 4MLHA 4CJUA 4DV0K 4JD2A 3S9HA 1XUPO 1A5XA 4BR5A 4LF6K 3H6EA 3ZETB 3RVCA 1KLMA 1XMOK 1S6QA 4KHYA 2KW4A 3N4PA 1NJIO 2GUIA 2FBVA 2XY5A 3HOSA 5KTQA 4DUYK 1I39A 5J2NA 3VQAA 3SCXA 3TSQA 1S1UA 4CEOA 4DFMA 5KI6A 4DQIA 1HUXA 3EO3A 1IKXA 1VSKA 4RG8A 1NM1A 4YOTA 2UXDK 4JRPA 3D0PA 4CGHA 3AA4A 3VF4A 5HL7L 1T05A 2ZQBA 4TSXA 1OH7A 4CI6A 1NWKA 2IVOA 4FK0A 3V81A 5KPRA 1JXBA 4JYAK 2A40A 3ENOA 4KHNA 4CJRA 2D0OA 2P9UB 1RDAA 2AA4A 3U8XA 4CJPA 1U6ZA 1NLVA 2GWJA 2RE2A 1WSJA 3OYCA 1YT3A 4FLZA 3I0RA 2UUCK 2KQ2A 4AILC 1T03A 2DY4A 2WC9A 3ALYA 3C0BA 3SJHA 1VQ8N 2HF3A 4E7HA 3MEGA 2P9PA 3P1GA 5J2MA 4CIFA 1EQYA 2O4GA 3FZLA 4A59A 4IXCA 3AO2A 2BANA 4JK7A 4K25A 4O5BA 3VEZA 3VQ8A 5F1XA 4BVOA 5HRNA 3TI0A 1NGIA 1X1PA 4OLBA 2NLXA 3NCIA 4Z94A 5JLFA 3RRHA 3JXUA 4FOEA 3NBPA 4OGCA 4CFDA 1C1BA 4BRPA 1TAQA 3QETA 3MN7A 5GIPA 3ULDA 4JK8A 2ETJA 1WB9A 3BZCA 4QS7A 2O8BB 4MDBA 5LMNK 3DXKA 4AHSA 4FZXC 1GLCG 2P9NA 3TARA 3CFOA 5BRDA 4WYBA 3C6UA 4CBXA 3M3ZA 2VQEK 4LSNA 4C8LA 2Q3SA 4CHOA 1WUAA 1KLNA 1ILYA 2ASMA 3KKRA 4YOXA 4JKDA 4LD0A 1NJYA 4LF5K 4JNEA 3VGKA 1TKDA 2JWKA 3OS0A 3FFIA 1QZ6A 2E5LK 2IVNA 3MWPA 5AQFA 1NGHA 2E2NA 4IO8A 3ZSQA 3L2RA 3QNOA 4CZIA 2CH6A 4JI4K 3HZ6A 4AHUA 5HLFA 1WSGA 4FK2A 5EXWA 3G10A 2QEXN 3OS2A 1K8KA 4PA1A 3P39A 3DRRA 4EAHD 4FZYA 4CEZA 3RMBA 2FSNA 4DTPA 2E20A 5M1QA 4I6MA 4DV1K 2VGMA 1JL2A 4EHUA 3QEPA 1IH7A 4N76A 3E9OA 1RBVA 3SBTA 2YNGA 2PBDA 4Z4HA 4F8RA 4G9ZA 2ZWHA 1FKOA 3SPZA 3NAEA 3P31A 3F5TA 3H1QA 1OH6A 2YV0X 4M3YA 4JI1K 3CCRN 1YJWN 3SNNA 4DQRA 4KREA 5TKWA 4FWOA 3O4WA 4OKJA 5JS1A 4LFBK 3ZX0A 2DFFA 2ZF5O 3HP9A 3WUHA 3VQ6A 2QM1A 3LZIA 2ITMA 1JLBA 3A5NC 5AQPA 4K42A 3DLRA 4H8KA 1TYQB 4N41A 1V4TA 3LDOA 3V9WA 4H5VA 1GLLO 2Q0UA 4B9UA 3PX0A 3OYFA 3FLCO 1U49A 5LJWA 4B9VA 4NLCA 4QOZB 1QSYA 1Z6RA 2A3ZA 3VQ9A 4KFBA 3SQ4A 4PKGA 3QBXA 3FGUA 4M3ZA 2JWLA 2Q2RA 5GIOA 4OLAA 5BRFA 3WXMB 1S1XA 3JAMO 4HUEA 2Z1JA 4F2SA 2IAJA 3K5MA 4GV9A 4B9MA 4CECA 5J2QA 1D5AA 1VSDA 3O9RA 2G8KA 3KD5E 1HX1A 3L2UA 1SKWA 4JI6K 1LWFA 5BREA 3TAPA 2VWKA 1NKCA 1Y64A 4I7FA 1S1VA 2NZTA 3K57A 1JL1A 5C12A 3HM9A 3M8RA 2VG7A 3PX4A 4H5WA 3SUPA 2HHTA 3NFAA 4JI5K 4CZMA 4A2BA 3KWGA 3ENBA 4BG9A 1VQ5N 5IWAK 5AZIA 3ZT1A 3VA0A 1NK5A 3RMAA 5BRHA 3S41A 4DFPA 4KHWA 1DTQA 3ZSVA 3QINA 3QDKA 4EP4A 3PO5A 4CZLA 5DM6L 2P9KA 3DJCA 1NGDA 4JD2B 1S3XA 4ILGB 4J2DA 3RR8A 2IGIA 1TKXA 4YNQA 2G8IA 2NRRA 5E26A 2UXCK 4WQ4A 4GKKK 2P9LA 3VF6A 4A57A 3I55N 4FJNA 3UKUA 2FXUA 1S6PA 3HYFA 3CQ8A 4CJVA 1HRHA 3PLAA 4LF8K 3ASMA 4FK4A 4CFCA 4HUFA 5LL6Z 2AP1A 3T69A 4BC5A 4C1NK 4FJIA 2YJFA 4H4OA 3AVIA 1ATSA 4BG8A 2RHKA 2QXLA 4F4KA 2HB5A 2NRHA 3CPWM 3KTQA 2PZSA 4M41A 3T1HK 2I7PA 4YOVA 3FZMA 1WAJA 1X9MA 3ENHA 4JKHA 1YIJN 3NF8A 4BWJA 3LDNA 5DK5A 1HYZA 3VQBA 4F9OA 3ULEB 4FWPA 2A6AA 4FVMA 5AQZA 1ZBHA 1XQSC 2KLAA 4IOXA 2UUBK 2UXBK 3QICA 2HHSA 3H1VX 4RWTA 2OYQA 4CEFA 3OTOK 4FLUA 3SBGA 4JKEA 3M8PA 1U4BA 3MCPA 3HVRA 2Q0RA 3ZSZA 3CC2N 4ELVA 3AVJA 3UE5A 2IVPA 3CQYA 3AVHA 5I9EB 4WCEL 3VEOA 2H3GX 1YF5L 2FF6A 4CW7B 5C10A 3HT3A 3THXB 1YJ9N 4ISEA 4B1ZA 3KK3A 3CJAA 2RF2A 3AVAA 1BA0A 5JS2A 3C65A 5J1EA 4BRCA 1ZBIA 1Q81O 4FZZA 1EX4A 4JI2K 3SQ0A 4EFHA 3DXKB 4FWNA 4K0KK 1J5OA 2B6AA 2P9NB 4FJXA 4FLYA 3LP1A 5AQHA 4IFVA 3DLGA 2VCPA 2BUPA 1QSSA 1G15A 3U4LA 1NK7A 4B3MK 1NK8A 3PV8A 4CJ5A 4H5NA 2Q1NA 4GV3A 3L4IA 3KLIA 4IOCL 2Q31A 3AVGA 2I5JA 1FKPA 3D2EA 1HPZA 4CJWA 1RBUA 4H0PA 5BPMA 3ZSYA 4CK2A 4BR9A 2CGLA 3F2KA 1RBSA 4IWVA 4J8FA 2HNZA 1UA0A 4LF9K 3M5RA 3KLEA 5M1FA 2OZMA 3HTVA 2PY5A 5FPEA 2E1ZA 4WFNL 4FPAA 3TTCA 2HBLA 4E7LA 4I6MB 5AQKA 5F2RA 4B1UB 4CJEA 1L3TA 2QW9A 2YX6A 4BC3A 3PSFA 4U67L 3KZBA 4M7XA 1OKJA 4B9TA 3NVMA 3A5LC 1CZ9A 3ZSWA 4DFKA 4KH6A 3L0QA 1EWRA 5IT9O 4DU1A 3TU5A 1NBWA 4PQUA 2ZM6K 4DQPA 1C0UA 2QI2A 4DSJA 1EP4A 4PKIA 1FK9A 1WOQA 2A1RA 3OBWA 4FWKA 4FW1A 4KI6A 4E7IA 2O8DA 4LFAK 1ZBUA 1W0HA 4CERA 5B8HA 5SZTA 3TTDA 1ATNA 5GINA 4ZTJA 4ISFA 1JKHA 1QHTA 4Z4GA 4FM2A 3AGKA 5BR9A 4IDKA 1RT5A 4GVMA 4DTJA 1D9DA 4PY5A 4QCLA 3VERA 1DKGD 3P83D 1K6YA 3V4IA 1NJXA 1MWKA 3VEYA 3VQ4A 3KVGA 4B8AB 2G8WA 1RNHA 3CERA 3L8BA 2QWMA 1J5EK 5M1PA 3HOTA 2NRZA 1GLJO 1KRPA 1JJ2M 3O1WA 1XWLA 4BQZA 4M3XA 4BRLA 5KGXA 2NRXA 4MFBA 4W5TA 3DAWA 4HHTA 4KPYA 1N32K 3U3GA 4BC2A 1VRTA 2QWQA 2UUAK 3MAQA 3OJUA 1JCEA 1TK8A 3MN5A 2ASPA 3EL2A 2YHAA 3G25A 4DQSA 4BRMA 4H4MA 5LJVA 3NVKA 2RN2A 3OYEA 4OX9K 3C6TA 4IJAA 3ISNC 4H5RA 1HNIA 4CJQA 4Z0UA 2P51A 2W42A 3OYHA 3LDSA 3TPQA 2WUSA 4FWQA 4N5SA 4KTWA 1VQ6N 5CHIA 1Q9YA 1S9GA 4CEAA 4FW2A 4DG1A 2A41A 3LM2A 5AZIB 4AM7A 4DFJA 1U04A 4JEPA 4NLBA 5HRRA 4BC4A 5GADP 2DFEA 3VQ7A 3NGYA 3LL3A 4HTLA 3LDLA 4JHDA 1GOAA 3BGRA 1J54A 4MO5A 1Z25A 1GOBA 3N4QA 3VQ5A 4CGDA 4OPKA 3NH2A 1IG9A 1VSIA 2P9LB 3AA3A 3GOIA 4B9LA 3A8YA 3IFRA 4B1VA 1WSIA 2KHOA 4DV2K 3VQEA 2Z1IA 4UY8O 1LW2A 4A2AA 3UKUB 3VQQA 5FLXO 4IBNA 2YHYA 2HMIA 3S3NA 2VYPA 1JLGA 3CCLN 3AA2A 4DV7K 2XY8A 3K0SA 4IEEA 4AHRA 4BDZA 4AH9A 1V4SA 3CJCA 1REVA 4RCHA 4DS5A 5EX5A 4OPJA 3CYMA 2W6LA 3AVKA 3I0SA 3VETA 4KB0A 1RTDA 4CJTA 1WLJA 1L5UA 4OVLA 2FSKA 3OYGA 3WNFA 4JKGB 5HP1A 4KH5A 4BRAA 2VQFK 4BREA 5BN9A 1I94K 3VEWA 1NU0A 1QQCA 3WNHA 1TL3A 4DQ8A 3IAYA 1ZBFA 4YOUA 4CK1A 3CQXA 2JLEA 1SKRA 4CZGA 3DLBA 1J9AA 4BR2A 3CF5L 4WQ5C 3WT0A 1RT4A 2A5XA 3WEEA 5AJ3K 3HK2A 4FJLA 3R6MA 4CHYA 1SV5A 4KTZA 2E1YA 3DM2A 3ULEA 5JLHA 1KVCA 4IG0A 5BR8K 4FJ7A 1MU2A 3A0IX 3SAGA 3J80O 1IKWA 1KD1O 1BO5O 4JN4A 5A2QO 3TAEA 4JI0K 1RT3A 4B9SA 4WF9L 3MEDA 1GLDG 2ASOA 4B8CA 3TWHA 5AFUA 3NH1A 4B3TK 3C7NA 4XIUA 2XO7A 3OYJA 3OYNA 4DR4K 4KHPK 3AARA 1U47A 1CXUA 5AZJB 1EXQA 4JKAA 4XH1A 5LY3A 2EWSA 4BWMA 4BR7A 1Q18A 3THXA 1VSEA 1RTHA 4YFUA 1T44A 3VQCA 4KH4A 1RBRA 3A5MC 4KHSA 1C0TA 3C94A 4E0DA 5AQNA 3WXJA 4B9NA 2CH5A 1MWMA 4IZ9A 1B92A 3DOLA 4J2BA 2PAVA 1BQNA 3O9SA 5CZ1A 2R7YA 3C6AA 3SUNA 3O80A 3D2EB 3DRSA 1WSHA 4FJJA 4BRDA 4HCBA 2VG5A 4NCGA 3TANA 4L8RB 1X3NA 3PIPL 1D9FA 4FJ9A 1Q8IA 3O4QA 3F73A 1HPMA 5DMRA 4DWIA 3AVNA 4JKCA 2ZE2A 1VSJA 3CXCM 1X9JA 4C1NI 5CZ2A 3AAQA 2P1JA 3PUFA 5GAHP 3NHGA 1BISA 1EETA 1KAYA 3NF7A 3CD6N 1C1AA 3RMDA 1RDDA 1XC9A 1KC8O 1TK5A 3DI6A 2D4WA 3BY5A 5E84A 1JLCA 3LDPA 4DR6K 2E8AA 4H0TB 3E66A 2O8DB 3LALA 3K2PA 3VESA 2GWKA 1WN7A 1VQLN 3D7EO 1NGGA 4YORA 3AO5A 4B9QA 1NJZA 3KKSA 4CEEA 3GDQA 5KPTA 3EKUA 4OKEA 4EP5A 3FZFA 3SAHA 1BHLA 1BGXT 4O0IA 1NGFA 1S1WA 2HSTA 5CY4A 3J7ZO 1RT6A 3F9MA 3TABA 4C8MA 1HQEA 4DUZK 2XY6A 1JLEA 3OW2M 1SS6A 3TAQA 3GL1A 1NNEA 3AO4A 3AVMA 4IG3A 3NE6A 2QK9A 4KHQA 1MA9B 3CJ7A 5E41A 1YTAA 2E2OA 1N33K 1YXQA 3O3HA 2ZJPL 1KFDA 1IBLK 4ELUA 1RGIA 4BDYA 4JKFA 4C8NA 2EHGA 4DF4A 2LSNA 4DR3K 5JICA 4BRFA 3QEIA 4DHYA 3VTHA 4R79A 4CBUA 3K5LA 1BI4A 1JCFA 4O5FA 4ZTFA 4QS8A 3CJBA 3ATVA 3TAFA 3L6QA 4M42A 2HF4A 4WE1A 4DSFA 1EKEA 5ELZA 3O8MA 3B8AX 4IOAL 3OYKA 4HTUA 4X62K 4E3SA 4FJ8A 1NJWA 4YHHK 3K5OA 4B08A 4E7JA 4PL8A 2HVHA 1JLQA 3H45C 3T1AA 1C1CA 1VSMA 2BE2A 4EZ9A 4B3SK 3L3VA 2QWOA 1B9DA 4JHDB 2FLOA 2HHWA 3BEXA 2VG6A 3CCUN 3ID6A 4DSKA 4AQYK 3KJVA 3CC7N 1H1VA 4LY7A 3WQUA 3CMAN 3J8AA 4M3UA 1VQ9N 2ITGA 1QQNA 3ZX3A 4BRIA 3AO1A 3ZCMA 2NRTA 2Y1IA 1ASUA 4CJSA 3QIPA 1NG9A 1GLEG 3VN5A 3K5NA 4HUGA 1QVFM 4W5RA 2DTUA 3V1QA 3ATUA 4FLWA 1TAUA 3FZKA 4IO9L 4CF2A 2Y1JA 5JVGL 3G6EN 4KAZA 2AJQA 1VSHA 1BOTO 3CG7A 2KFNA 3SUOA 4ZHRA 3DLKA 1R0AA 3AVLA 3WQTA 4IKFA 1ZBSA 5C24A 1BG3A 1HMVA 1FXXA 4RTFD 1BUPA 3BZKA 2FSJA 3LPUA 1WBDA 5GAEP 5FPMA 4N56A 2F7TA 4BRNA 5CE3A 3H3NO 5AQOA 1FW6A 1RDBA 4JKGA 5K14A 4AM6A 2DFHA 2YHWA 3CIPA 3HM8A 4CEBA 4FLTA 2QKKA 1RDUA 4LC9B 3WEEB 4B3OA 3BF3A 3HP6A 2PYJA 2P9IA 3EE9A 1WAFA 1N36K 4OKKA 2WONA 3C95A 3MXMA 5C42A 1EO1A 4HCCA 2F9WA 5EVZA 3GBTA 4Z4FA 2XRIA 4XH4A 1EWQA 2O8FA 1ATRA 4CHNA 2ZGZA 3HL8A 3CHWA 3IMXA 4MLEA 1T8EA 4FJHA 3E9LA 3D6RA 1RILA 4CEDA 1TGOA 4CEQA 4JRQA 1NMNA 5EY4A 4CHQA 1TKZA 4KTQA 3C7NB 1K8AO 3H08A 1L3UA 4DB3A 3BF1A 1P8ZA 1QZ5A 2Z1GA 1VAZA 5KQ8A 3DLHA 1SL0A 1IBMK 3ZLJA 3MX2A 4R5PA 1IO2A 1DEJA 3UKRA 4BVPA 4I2PA 3EN9A 3VEVA 3SLCA 5AZJA 4HVJA 4FYDA 3QEWA 3G71N 1VRUA 1GLFO 2YKMA 3DMJA 4E1NA 3DLLL 1N5YA 3QESA 1SL1A 4RW8A 5M1KA 2CGJA 1RDCA 4CF1A 4FLVA 3OYDA 2D0BA 2OANA 3EKSA 2F96A 4BACA 2GTDA 3NDKA 2W41A 2F8SA 3CFRA 2BGGA 4FL9A 2FBTA 3I8DA 1WSFA 4YDUC 3OVNA 4DU3A 3ZX2A 1VQ7N 1U2VA 5C25A 4G1QA 4FWLA 1YVNA 2OPRA 1BIUA 4B1XB 3THVA 3SMSA 3BP8A 3Q7BA 1I3AA 1GLBG 2YHBA 2QXFA 4BRHA 4ID1A 3SPYA 5ADXH 2O4IA 1VQNN 3CCMN 2F4VK 1XC3A 5FRMA 4H0OA 3EZWA 3M8QA 2UU9K 1KCFA 4JI8K 1G99A 5AQLA 3BUZB 4Q5VA 3E01A 4DTUA 4IDHA 1RT1A 3ITHA 3Q7CA 4QS9A 2HHXA 4H5TA 2B4JA 1OVYA 4KO0A 3LAKA 4CHZA 2PFUA 1LV5A 5KPZA 1HNZK 2D0PA 2GUPA 2V7YA 4BRGA 1IJJA 5CYMA 4OO1J 1C6VA 3LZJA 4F2RA 1UAXA 3OY9A 4DR5K 1YJNN 1M90O 3OBYA 1NK6A 1LOTB 4DV4K 4O44A 4BE1A 1O1WA 4E19A 1VQPN 3LAMA 3SQ2A 3AVFA 1K9MO 4CZJA 3V9SA 4YOWA 3E9PA 1DT9A 4FSVA 4JS4A 4GV6A 1Z05A 1N8RO 2WBNA 4FWSA 1S1TA 4X66K 4CZFA 1SAZA 3KK1A 5JMVA 5D3GA 3TAGA 3V9ZA 1X9SA 3LP0A 1T6CA 4CD1A 4JAXA 3OJSA 3HPHA 4Z4CA 2FC0A 2A1SA 2VGNA 2HHUA 1LAVA 3KLHA 4PKHA 1A5VA 2O8EA 4JI3K 2YKNA 1XNQK 2BDPA 3P4IA 4CJ4A 2G8HA 3ZT2A 5AFUH 4W5OA 1RDWX 1SKSA 1NOYA 1BI4B 4CGFA 1T6DA 4C23A 3VF2A 3THWA 1HNVA 1NGJA 5CR4A 1L3SA 3MCAB 5MLCQ 3QLHA 5C2DA 3NGIA 5KRTA 3TSUA 1BQMA 4A61A 1IV0A 4DSIA 3TAMA 4X64K 4C8KA 1YHQN 4FPBA 4PL7A 3V9XA 2YNFA 3HSCA 4XEIA 3EEQA 3CCVN 4KHUA 1RCHA 3E1YA 4HWIA 3HO1A 3PO4A 1VQKN 3O1BA 3R3LA 4NYFA 1IKVA 3RSEA 2Q36A 1CZBA 2F9TA 3L2WA 1WBBA 1BU6O 4DF8A 5AQYA 3WXKA 2IOCA 3U9ZA 4CK3A 5M1OA 3QFUA 5ADXA 1K73O 2CGKA 2DPNA 1Q7YO 5KQDA 4FM0A 3KK7A 3QB0A 4DU4A 3PIOL 2GBZA 1P90A 3OYMA 2RKIA 3KK2A 2HW3A 3A2FA 4DLGA 3NF9A 5EOYA 3U9DA 5FPNA 5AQIA 5T7BA 3WXLA 4KB1A 2HMPA 3CJ9A 4LF7K 3V6DA 4AF1A 3OS1A 3O4NA 3CFPA 4M3WA 3O5BA 5H1SQ 4EZ6A 1Y97A 3OYLA 1RBTA 4E1MA 2P9IB 3VA3A 1NKBA 1YI2N 3O9UA 3UB5A 4RW4A 1NGEA 2BTFA 4W5QA 2HBKA 1E4GT 3R1XA 1QVGM 1KSPA 4M3TA 4NCBA 1W9HA 2O8FB 3ID8A 4B1YB 2HVIA 3FE1A 4CJ7A 1QQMA 3LM9A 4O8KA 4DV3K 3LWLA 2NUBA 3HSTB 1S9EA 3ZEUA 4CVNE 5AQQA 1VHXA 4MQ3A 3VPZA 5BN8A 4FJGA 3HPOA 3UKRB 3GG4A 1UWBA 5BPLA 2ZD1A 3MXJA 4NB4A 3VEXA 4CJFA 4FLXA 4DCHA 1W7AA 4Q0BA 3P38A 3CJ1A 2IIRA 1KQSM 2GX9A 4FM1A 4E7KA 2QWLA 3L2QA 2WOMA 3CM5A 5AQSA 2O8CA 3B6OA 2PYLA 2WTUA 4DSLA 2YJEA 3K9KA 5FPDA 2HOEA 3PSIA 3WNGA 1IBKK 3QFPA 2HNDA 3AO3A 1IG8A 1D8YA 3K58A 4FOIA 3TR8A 3VQPA 1LAWA 2Z1HA 4GMJB 1Q9XA 2ZJQL 1OVQA 4CFAA 2VWJA 3KIOA 2ATQA 4RW9A 2KFZA 1YUWA 1HYVA 4WQ5A 3M1FA 1U2VB 4KI4A 3K59A 3F9KA 1BCMA 3T3FA 1XHZA 1ESVA 2D0AA 3I8BA 1QSLA 1GOCA 4PHTX 2GV9A 1ITGA 3KD1E 1TUUA 3ZYYX 3SQ1A 3VGMA 3IS9A 3RR7A 2IDOA 3DXMB 4LF4K 1WNSA 4DTOA 1DGKN 4K43A 5AQRA 3RMCA 5AQGA 1KTQA 4MDAA 4ELTA 1W97L 1T7PA 4YY3K 1VQMN 1A5WA 4JI7K 3CM6A 4ILJA 3CCSN 3OHRA 1NK9A 4MO4A 4KV8A 3G0ZA 1KVBA 2QKBA 3K9JA 1GLAG 1BA1A 1OH5A 3KWIA 3H46O 2W40A 5F0XA 1IKYA 5LMUK 4NXNK 2QWNA 3QO9A 2HHQA 2D0CA 3WNEA 4L3QA 1DTTA 3MWTA 2VWBA 1YVUA 4JKBA 2G8VA 4B1WB 4JK9A 1N34K 1HNXK 3NGZA 4CHPA 1KVAA 4LFCK 2P5OA 2HBJA 2Q97A 3SJJA 4GY2B 3KLGA 4DTRA 5AQTA 4FWRA 5SWMA 1VSFA 1S22A 2X74A 3MX5A 1NK0A 4IEIA 3KHYA 4GVEA 3THYB 3DYAA 5TKYA 3ZSRA 5M1NA 4C8OA 1CZAN 1M1KO 2OTJN 2P5GA 2OZSA 3LANA 4FWMA 3WXIA 2X6SA 3QERA 2HHHK 2O8EB 3HI0A 3AVBA 3AA5X 4BRQA 4KRFA 3R8EA 4XH5A 3JSMA 1HKCA 2OPSA 4RW7A 4CF9A 4DMNA 4M7YA 4N47A 1X9WA 2A42A 3SYZA 2KZZA 4ILHA 1RTIA 3JS6A 3TSPA 5AQMA 1NOZA 2D1KA 2QWRA 4A62A 4DS4A 4Z4IA 4PWDA 4EIAA 3THWB 4H0VB 4CGGA 3SV3A 1HQUA 3CC4N 1HNWK 3QEVA 4WFAL 4KBOA 3AGRA 1FJGK 4GKJK 1BCOA 5C2FA 4Z4EA 3CETA 2I7NA 1BIZA 1L3VA 3QEXA 1E3MA 2JGUA 1XMQK 3SZ2A 4FO0A 3D2FA 3B6PA 4OPHA 2QTDA 5HRSA 4F3TA 3MMVA 4WQ4C 1W2BM 2P9SA 1QQOA 4DV5K 4CGIA 4GNIA 1HKGA 1YAGA 3RSEB 4E89A 2E2PA 1RT2A 1SUQA 3OYIA 1VK0A 4ICLA 2NNWA 2NRWA 3ZSOA 4DTXA 3D45A 3FZHA 1VQ4N 3MK6A 3VENA 5FROA 3O9QA 3HVTA 1XNRK 4A5BA 2V52B 4O0JA
chains in the Genus database with same CATH topology
3TARA 3CFOA 3L2VA 1I3AA 2OPPA 4OJRA 2YHBA 2QXFA 4FJ5A 3C6UA 1GOAA 3V1OA 3BGRA 4ID1A 3SPYA 4FJKA 4LSNA 1J54A 4C8LA 2Q3SA 3DLEA 4CHOA 2O4IA 3VQ5A 1Z25A 1GOBA 4CGDA 1KLNA 3KKRA 4OPKA 1JXEA 4LD0A 3NH2A 1NJYA 5FRMA 1IG9A 2B5JA 1VSIA 3M8QA 3AA3A 3ZT4A 1KCFA 4B9LA 1C0MA 1TKDA 3HPGA 1WSIA 4O55A 3OS0A 3VQEA 2Z1IA 3FFIA 4AHTA 1LW2A 4Q5VA 3E01A 3AVCA 4DTUA 1WSEA 3VQQA 3LWMA 1RT1A 4IBNA 5HROA 3ZSQA 2HMIA 4J2EA 3ITHA 3L2RA 2HNYA 3QNOA 3S3NA 4AHUA 1JLGA 5HLFA 2HHXA 1WSGA 4FK2A 3AA2A 4BDZA 2XY8A 2EX3A 4AHRA 2B4JA 3G10A 4KO0A 4AH9A 3LAKA 3OS2A 1QTMA 2OA8A 4PA1A 1TKTA 4CHZA 1REVA 1LV5A 4DS5A 4BDPA 4BE0A 4OPJA 1LWCA 3DRRA 2YNIA 3CYMA 3V9UA 4FZYA 4CEZA 3AVKA 3RMBA 3I0SA 1S5JA 4DTPA 4KB0A 1RTDA 5CYMA 4CJTA 1CLQA 4CESA 1C6VA 3LZJA 4F2RA 1UAXA 1JL2A 3L3UA 1WLJA 3OY9A 1L5UA 4OVLA 3QEPA 3OYGA 1IH7A 1NK6A 4N76A 4O44A 4BE1A 1O1WA 2RPIA 4E19A 3WNFA 3LAMA 3SQ2A 1RBVA 3AVFA 2YNGA 4Z4HA 3V9SA 5HP1A 3LP3A 4F8RA 4K8ZA 1FKOA 3SPZA 1N6QA 3QIOA 3M8SA 3NAEA 4JS4A 2YV0X 2XHBA 4M3YA 1QQCA 3WNHA 1TL1A 4JLHA 1TL3A 3IAYA 3S3MA 1ZBFA 3QNNA 4CK1A 4M45A 4DQRA 1S1TA 3SNNA 4KREA 2E4LA 1RTJA 3HJFA 3JYTA 2JLEA 1SKRA 3DLBA 3KK1A 4OKJA 1J9AA 5D3GA 5JS1A 3T19A 2DFFA 3TAGA 3V9ZA 1X9SA 3LP0A 3HP9A 3OJSA 3VQ6A 5EU7A 1RT4A 3HPHA 1JLBA 4Z4CA 3LZIA 3HK2A 4FJLA 3IRXA 3ZT3A 4CHYA 2FC0A 2A1SA 1DLOA 1SV5A 3DLRA 4H8KA 4KTZA 4N41A 3DM2A 3V9WA 2HHUA 1LAVA 3KLHA 1A5VA 1KVCA 4IG0A 2YKNA 4LH4A 4RW6A 1BL3A 1MU2A 2BDPA 4CJ4A 3PX0A 4B9UA 3OYFA 2G8HA 3ZT2A 1U49A 1IKWA 3BDPA 4LH5A 3TAEA 4W5OA 4B9VA 4QOZB 1RT3A 1QSYA 4B9SA 3MEDA 3VQ9A 4KFBA 1BI4B 4CGFA 3SQ4A 1SKSA 1NOYA 4M3ZA 1ZYQA 4CJLA 4B8CA 3TWHA 3DOKA 3NH1A 4OLAA 3UIQA 1F21A 1HNVA 4XIUA 2XO7A 5HBMA 3OYJA 3OYNA 1L3SA 1ASWA 5I3UA 3QLHA 1S1XA 4GW6A 3NGIA 5KRTA 4CFBA 3LPTA 1U47A 4HUEA 1TK0A 2Z1JA 1CXUA 4F2SA 2IAJA 1EXQA 1BQMA 4W5NA 3SI6A 4DSIA 3K5MA 3TAMA 4B9MA 4CECA 4C8KA 2HHVA 5J2QA 4BWMA 2E6MA 1D5AA 5I42A 1XI1A 1VSDA 1TV6A 2X6NA 2G8KA 1VSEA 3V9XA 3KD5E 3L2UA 1RTHA 1SKWA 2YNFA 1LWFA 4YFUA 4KHUA 1RCHA 4M3RA 3VQCA 3IG1A 3ZSXA 1RBRA 3TAPA 2VWKA 1NKCA 4KHSA 4I7FA 5KGWA 3HO1A 3PO4A 1S1VA 4FCYA 1RT7A 3K57A 2G8UA 1JL1A 1LW0A 1C0TA 3HM9A 3C94A 3M8RA 4E0DA 1QS4A 4NYFA 4B9NA 2VG7A 3PX4A 4O4GA 3SUPA 1IKVA 2HHTA 4JS5A 3NFAA 3MECA 1B92A 3DOLA 4J2BA 1CZBA 1BQNA 1UA1A 2X78A 5CZ1A 3L2WA 2R7YA 3P5JA 3SUNA 3DRSA 1WSHA 4FJJA 4DF8A 4HCBA 3EY1A 2VG5A 4NCGA 3ZT1A 3VA0A 1NK5A 4KKOA 3TANA 2IOCA 3RMAA 4CK3A 4DFPA 4L8RB 4KHWA 1DTQA 1HJRA 3ZSVA 5J2PA 1KFSA 1D9FA 3QINA 4EP4A 3PO5A 4FJ9A 1Q8IA 1ASVA 4FM0A 3O4QA 3F73A 5DMRA 4DWIA 3AVNA 2ZE2A 1VSJA 4CE9A 3U6FA 4DU4A 1NKEA 5CZ2A 4DTNA 2P1JA 2GBZA 4J2AA 3RR8A 4J2DA 2IGIA 1TKXA 3PUFA 3OYMA 4YNQA 2RKIA 4I9QA 2G8IA 3NHGA 1BISA 1EETA 3KK2A 3MXIA 2HW3A 3A2FA 3NF7A 4DLGA 1C1AA 3RMDA 1RDDA 1XC9A 4I2QA 3NF9A 4UQGA 4FJNA 1TK5A 3RRGA 1QE1A 1S6PA 3HYFA 3CQ8A 3DI6A 4CJVA 4NCAA 1HRHA 5T7BA 3ASMA 4KB1A 4K8XA 4FK4A 1JLCA 1NK4A 5HRPA 4CFCA 3NH0A 4HUFA 3V6DA 1J53A 3OS1A 2FBYA 3LALA 3K2PA 3O4NA 3CFPA 5FDLA 4FJIA 4M3WA 4H4OA 1WN7A 4LSLA 3AVIA 4Y1CA 4EZ6A 1Y97A 3OYLA 1RBTA 4DSEA 1UOCA 4E1MA 3AO5A 3VA3A 1VSLA 3DRPA 3KKSA 4CEEA 1NJZA 2KZMA 1LWEA 1NKBA 1CXQA 4F4KA 2HB5A 4OKEA 4RW4A 4EP5A 3KTQA 4W5QA 2PZSA 4M41A 1WAJA 2XY7A 1BHLA 1X9MA 1KSPA 4M3TA 3NF8A 4NCBA 3O3GA 1BGXT 4O0IA 1W9HA 4BWJA 3SUQA 1S1WA 5CY4A 5DK5A 1HYZA 1RT6A 3LP2A 3TABA 3VQBA 4C8MA 2HVIA 2IC3A 1HQEA 4QAGA 2XY6A 4FVMA 1B9FA 1JLEA 1ZBHA 3RWUA 3TAQA 3LWLA 2D5RA 2NUBA 3AO4A 3AVMA 3HSTB 4NYNA 2HHSA 1S9EA 4IG3A 3NE6A 2QK9A 4KHQA 4AHVA 3MEEA 2OYQA 4CEFA 1U45A 5E41A 3O3FA 4MQ3A 4FLUA 1YTAA 3AV9A 3M8PA 1U4BA 4CJ3A 3O3HA 3RTVA 4FJGA 1KFDA 3HPOA 3HVRA 3PY8A 1UWBA 4ELUA 3ZSZA 4PUOA 4ELVA 4BDYA 2ZD1A 3MXJA 4CJFA 4FLXA 3AVJA 4C8NA 2EHGA 4DTSA 2LSNA 4DF4A 4Q0BA 4AHCA 3QEIA 2FBXA 3VQDA 3K5LA 4ID5A 1BI4A 4ZTFA 3AVHA 4FM1A 4E7KA 5CYQA 4DTMA 3TAFA 3L2QA 2WOMA 4M42A 3CM5A 4WE1A 4DSFA 1EKEA 4CF0A 3B6OA 4CJKA 3OYAA 3HT3A 2F8TA 3OYBA 2PYLA 4DSLA 4FXDA 3WNGA 1SL2A 2HNDA 1ZBLA 3AO3A 3KK3A 1TVRA 1D8YA 3KLFA 3K58A 3OYKA 4HTUA 2RF2A 1XHZA 3TR8A 3AVAA 1LAWA 3VQPA 2E6LA 2Z1HA 4GMJB 5JS2A 5KRSA 4E3SA 1Q9XA 4FJ8A 1NJWA 4CIGA 2VWJA 4CFAA 3U3YA 3KIOA 2ATQA 5J1EA 3K5OA 2YNHA 4RW9A 4B08A 4E7JA 4FJ7A 1HYVA 1ZBIA 2KFZA 4I9LA 2HVHA 1JLQA 4FZZA 1EX4A 3T1AA 3EYZA 3SQ0A 4KI4A 2G8FA 4CIEA 1C1CA 1JLAA 4CCHA 1J5OA 1VSMA 2BE2A 2B6AA 4EZ9A 3K59A 3F9KA 4FJXA 1BCMA 3L3VA 3EZ5A 2IS3A 3V1RA 3LP1A 4IFYA 4DLEA 1B9DA 4FLYA 4IFVA 3T3FA 2D0AA 1QSLA 3DLGA 4F3OA 4Y1DA 5FRNA 2HHWA 1GOCA 2GV9A 1YTUA 1QSSA 1G15A 1ITGA 2VG6A 1NK7A 3KD1E 1NK8A 3PV8A 4CJ5A 3SQ1A 4DSKA 3KJVA 3IS9A 3RR7A 4FJMA 4LY7A 2IDOA 1WNSA 4DTOA 3KLIA 2KTQA 3AVGA 4CF8A 3RMCA 4BE2A 1KTQA 3S3OA 2I5JA 1FKPA 4ELTA 1HPZA 4M3UA 4CJWA 2ITGA 3SV4A 1T7PA 1RBUA 3HXMA 1A5WA 3AO1A 3ZCMA 3ZT0A 3PX6A 3ZSYA 4CK2A 2Y1IA 1ASUA 1XHXA 1HYSA 3CM6A 3QIPA 4OGEA 4CGJA 4CJSA 1NK9A 3VN5A 3K5NA 4HUGA 3NF6A 4W5RA 2DTUA 3V1QA 1RBSA 4FLWA 2HNZA 1UA0A 1U48A 1Z26A 3G0ZA 4KV8A 3KLEA 1TAUA 1KVBA 2OZMA 1JLFA 2QKBA 2PY5A 2OPQA 4CF2A 2Y1JA 4CJUA 4KAZA 2AJQA 3S9HA 1VSHA 1IKYA 1A5XA 3CG7A 4E7LA 3SUOA 2KFNA 4ZHRA 3DLKA 3QO9A 4CJEA 1KLMA 3AVLA 1R0AA 1L3TA 2HHQA 2D0CA 1S6QA 3WNEA 1DTTA 4IKFA 4B9TA 4KHYA 5C24A 2KW4A 1YVUA 1HMVA 2GUIA 1CZ9A 1FXXA 2FBVA 3ZSWA 4DQQA 4DFKA 2XY5A 2G8VA 5KTQA 3NGZA 1I39A 3LPUA 4CHPA 4DU1A 1KVAA 3VQAA 4N56A 5J2NA 3SCXA 2P5OA 1S1UA 4PQUA 4CEOA 3SJJA 4DFMA 4DTRA 5KI6A 3KLGA 4DQPA 4DQIA 1C0UA 1RDBA 1IKXA 1EP4A 4DSJA 1FK9A 1VSKA 4RG8A 5SWMA 2A1RA 1VSFA 5K14A 4FW1A 4KI6A 2X74A 4E7IA 1NK0A 3DYAA 1ZBUA 2DFHA 4JRPA 1W0HA 3ZSRA 4CERA 3D0PA 4CGHA 4C8OA 3AA4A 4CEBA 4FLTA 2QKKA 5SZTA 2P5GA 2OZSA 4B3OA 3LANA 1T05A 3HP6A 2ZQBA 4ZTJA 4TSXA 2PYJA 1JKHA 1QHTA 2X6SA 3QERA 1WAFA 4OKKA 4FK0A 4Z4GA 2WONA 3AA5X 3AVBA 4KRFA 3V81A 3C95A 4FM2A 3JSMA 2OPSA 4RW7A 3MXMA 5C42A 4CF9A 4DMNA 4HCCA 4IDKA 1JXBA 1RT5A 4GVMA 4N47A 4DTJA 1X9WA 1D9DA 4PY5A 3P83D 4QCLA 1NJXA 1K6YA 4CJRA 3SYZA 3V4IA 4KHNA 3VQ4A 1RDAA 4Z4FA 2XRIA 4PWDA 4B8AB 2G8WA 4CHNA 2KZZA 3HL8A 1RNHA 4CJPA 3L8BA 1T8EA 4FJHA 1RTIA 1RILA 4CEDA 1TGOA 4CEQA 1NOZA 4JRQA 4CHQA 4DS4A 1TKZA 4KTQA 4Z4IA 1KRPA 1WSJA 3OYCA 1YT3A 4CGGA 3I0RA 4FLZA 3SV3A 1HQUA 2KQ2A 4AILC 1T03A 3H08A 3QEVA 2DY4A 1L3UA 3ALYA 1XWLA 4M3XA 2Z1GA 5KGXA 3DLHA 1SL0A 4MFBA 4W5TA 1BCOA 4HHTA 4KPYA 4R5PA 4Z4EA 1IO2A 3U3GA 1VRTA 1BIZA 1L3VA 3QEXA 4I2PA 2JGUA 4E7HA 3MEGA 3SZ2A 3P1GA 3OJUA 3MAQA 1TK8A 5J2MA 3B6PA 2O4GA 4CIFA 2YHAA 4DQSA 5HRSA 4HVJA 4H4MA 4FYDA 4F3TA 3QEWA 3AO2A 2BANA 2RN2A 1VRUA 4O5BA 3VQ7A 3OYEA 3C6TA 2YKMA 3VQ8A 3DMJA 3ISNC 4CGIA 4E1NA 1N5YA 3QESA 1SL1A 1HNIA 4CJQA 4Z0UA 5HRNA 3TI0A 1X1PA 4RW8A 2P51A 4OLBA 2W42A 3OYHA 1RDCA 4CF1A 4FLVA 3NCIA 4E89A 3LDSA 3OYDA 2D0BA 3RRHA 1RT2A 2F96A 3NBPA 4OGCA 1SUQA 4KTWA 4CFDA 4N5SA 4BACA 1Q9YA 1C1BA 3OYIA 1TAQA 1S9GA 1VK0A 3NDKA 4CEAA 4FW2A 4DG1A 3QETA 3ULDA 4ICLA 2F8SA 3CFRA 2BGGA 2FBTA 3I8DA 3ZSOA 2ETJA 4DTXA 1WSFA 3D45A 3OVNA 4DU3A 4DFJA 1U04A 5C25A 5HRRA 5FROA 4G1QA 3HVTA 2OPRA 4AHSA 1BIUA 3THVA 2DFEA 4FZXC 4O0JA 3NGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAR A;  3CFO A;  3L2V A;  1I3A A;  2OPP A;  4OJR A;  2YHB A;  2QXF A;  4FJ5 A;  3C6U A;  1GOA A;  3V1O A;  3BGR A;  4ID1 A;  3SPY A;  4FJK A;  4LSN A;  1J54 A;  4C8L A;  2Q3S A;  3DLE A;  4CHO A;  2O4I A;  3VQ5 A;  1Z25 A;  1GOB A;  4CGD A;  1KLN A;  3KKR A;  4OPK A;  1JXE A;  4LD0 A;  3NH2 A;  1NJY A;  5FRM A;  1IG9 A;  2B5J A;  1VSI A;  3M8Q A;  3AA3 A;  3ZT4 A;  1KCF A;  4B9L A;  1C0M A;  1TKD A;  3HPG A;  1WSI A;  4O55 A;  3OS0 A;  3VQE A;  2Z1I A;  3FFI A;  4AHT A;  1LW2 A;  4Q5V A;  3E01 A;  3AVC A;  4DTU A;  1WSE A;  3VQQ A;  3LWM A;  1RT1 A;  4IBN A;  5HRO A;  3ZSQ A;  2HMI A;  4J2E A;  3ITH A;  3L2R A;  2HNY A;  3QNO A;  3S3N A;  4AHU A;  1JLG A;  5HLF A;  2HHX A;  1WSG A;  4FK2 A;  3AA2 A;  4BDZ A;  2XY8 A;  2EX3 A;  4AHR A;  2B4J A;  3G10 A;  4KO0 A;  4AH9 A;  3LAK A;  3OS2 A;  1QTM A;  2OA8 A;  4PA1 A;  1TKT A;  4CHZ A;  1REV A;  1LV5 A;  4DS5 A;  4BDP A;  4BE0 A;  4OPJ A;  1LWC A;  3DRR A;  2YNI A;  3CYM A;  3V9U A;  4FZY A;  4CEZ A;  3AVK A;  3RMB A;  3I0S A;  1S5J A;  4DTP A;  4KB0 A;  1RTD A;  5CYM A;  4CJT A;  1CLQ A;  4CES A;  1C6V A;  3LZJ A;  4F2R A;  1UAX A;  1JL2 A;  3L3U A;  1WLJ A;  3OY9 A;  1L5U A;  4OVL A;  3QEP A;  3OYG A;  1IH7 A;  1NK6 A;  4N76 A;  4O44 A;  4BE1 A;  1O1W A;  2RPI A;  4E19 A;  3WNF A;  3LAM A;  3SQ2 A;  1RBV A;  3AVF A;  2YNG A;  4Z4H A;  3V9S A;  5HP1 A;  3LP3 A;  4F8R A;  4K8Z A;  1FKO A;  3SPZ A;  1N6Q A;  3QIO A;  3M8S A;  3NAE A;  4JS4 A;  2YV0 X;  2XHB A;  4M3Y A;  1QQC A;  3WNH A;  1TL1 A;  4JLH A;  1TL3 A;  3IAY A;  3S3M A;  1ZBF A;  3QNN A;  4CK1 A;  4M45 A;  4DQR A;  1S1T A;  3SNN A;  4KRE A;  2E4L A;  1RTJ A;  3HJF A;  3JYT A;  2JLE A;  1SKR A;  3DLB A;  3KK1 A;  4OKJ A;  1J9A A;  5D3G A;  5JS1 A;  3T19 A;  2DFF A;  3TAG A;  3V9Z A;  1X9S A;  3LP0 A;  3HP9 A;  3OJS A;  3VQ6 A;  5EU7 A;  1RT4 A;  3HPH A;  1JLB A;  4Z4C A;  3LZI A;  3HK2 A;  4FJL A;  3IRX A;  3ZT3 A;  4CHY A;  2FC0 A;  2A1S A;  1DLO A;  1SV5 A;  3DLR A;  4H8K A;  4KTZ A;  4N41 A;  3DM2 A;  3V9W A;  2HHU A;  1LAV A;  3KLH A;  1A5V A;  1KVC A;  4IG0 A;  2YKN A;  4LH4 A;  4RW6 A;  1BL3 A;  1MU2 A;  2BDP A;  4CJ4 A;  3PX0 A;  4B9U A;  3OYF A;  2G8H A;  3ZT2 A;  1U49 A;  1IKW A;  3BDP A;  4LH5 A;  3TAE A;  4W5O A;  4B9V A;  4QOZ B;  1RT3 A;  1QSY A;  4B9S A;  3MED A;  3VQ9 A;  4KFB A;  1BI4 B;  4CGF A;  3SQ4 A;  1SKS A;  1NOY A;  4M3Z A;  1ZYQ A;  4CJL A;  4B8C A;  3TWH A;  3DOK A;  3NH1 A;  4OLA A;  3UIQ A;  1F21 A;  1HNV A;  4XIU A;  2XO7 A;  5HBM A;  3OYJ A;  3OYN A;  1L3S A;  1ASW A;  5I3U A;  3QLH A;  1S1X A;  4GW6 A;  3NGI A;  5KRT A;  4CFB A;  3LPT A;  1U47 A;  4HUE A;  1TK0 A;  2Z1J A;  1CXU A;  4F2S A;  2IAJ A;  1EXQ A;  1BQM A;  4W5N A;  3SI6 A;  4DSI A;  3K5M A;  3TAM A;  4B9M A;  4CEC A;  4C8K A;  2HHV A;  5J2Q A;  4BWM A;  2E6M A;  1D5A A;  5I42 A;  1XI1 A;  1VSD A;  1TV6 A;  2X6N A;  2G8K A;  1VSE A;  3V9X A;  3KD5 E;  3L2U A;  1RTH A;  1SKW A;  2YNF A;  1LWF A;  4YFU A;  4KHU A;  1RCH A;  4M3R A;  3VQC A;  3IG1 A;  3ZSX A;  1RBR A;  3TAP A;  2VWK A;  1NKC A;  4KHS A;  4I7F A;  5KGW A;  3HO1 A;  3PO4 A;  1S1V A;  4FCY A;  1RT7 A;  3K57 A;  2G8U A;  1JL1 A;  1LW0 A;  1C0T A;  3HM9 A;  3C94 A;  3M8R A;  4E0D A;  1QS4 A;  4NYF A;  4B9N A;  2VG7 A;  3PX4 A;  4O4G A;  3SUP A;  1IKV A;  2HHT A;  4JS5 A;  3NFA A;  3MEC A;  1B92 A;  3DOL A;  4J2B A;  1CZB A;  1BQN A;  1UA1 A;  2X78 A;  5CZ1 A;  3L2W A;  2R7Y A;  3P5J A;  3SUN A;  3DRS A;  1WSH A;  4FJJ A;  4DF8 A;  4HCB A;  3EY1 A;  2VG5 A;  4NCG A;  3ZT1 A;  3VA0 A;  1NK5 A;  4KKO A;  3TAN A;  2IOC A;  3RMA A;  4CK3 A;  4DFP A;  4L8R B;  4KHW A;  1DTQ A;  1HJR A;  3ZSV A;  5J2P A;  1KFS A;  1D9F A;  3QIN A;  4EP4 A;  3PO5 A;  4FJ9 A;  1Q8I A;  1ASV A;  4FM0 A;  3O4Q A;  3F73 A;  5DMR A;  4DWI A;  3AVN A;  2ZE2 A;  1VSJ A;  4CE9 A;  3U6F A;  4DU4 A;  1NKE A;  5CZ2 A;  4DTN A;  2P1J A;  2GBZ A;  4J2A A;  3RR8 A;  4J2D A;  2IGI A;  1TKX A;  3PUF A;  3OYM A;  4YNQ A;  2RKI A;  4I9Q A;  2G8I A;  3NHG A;  1BIS A;  1EET A;  3KK2 A;  3MXI A;  2HW3 A;  3A2F A;  3NF7 A;  4DLG A;  1C1A A;  3RMD A;  1RDD A;  1XC9 A;  4I2Q A;  3NF9 A;  4UQG A;  4FJN A;  1TK5 A;  3RRG A;  1QE1 A;  1S6P A;  3HYF A;  3CQ8 A;  3DI6 A;  4CJV A;  4NCA A;  1HRH A;  5T7B A;  3ASM A;  4KB1 A;  4K8X A;  4FK4 A;  1JLC A;  1NK4 A;  5HRP A;  4CFC A;  3NH0 A;  4HUF A;  3V6D A;  1J53 A;  3OS1 A;  2FBY A;  3LAL A;  3K2P A;  3O4N A;  3CFP A;  5FDL A;  4FJI A;  4M3W A;  4H4O A;  1WN7 A;  4LSL A;  3AVI A;  4Y1C A;  4EZ6 A;  1Y97 A;  3OYL A;  1RBT A;  4DSE A;  1UOC A;  4E1M A;  3AO5 A;  3VA3 A;  1VSL A;  3DRP A;  3KKS A;  4CEE A;  1NJZ A;  2KZM A;  1LWE A;  1NKB A;  1CXQ A;  4F4K A;  2HB5 A;  4OKE A;  4RW4 A;  4EP5 A;  3KTQ A;  4W5Q A;  2PZS A;  4M41 A;  1WAJ A;  2XY7 A;  1BHL A;  1X9M A;  1KSP A;  4M3T A;  3NF8 A;  4NCB A;  3O3G A;  1BGX T;  4O0I A;  1W9H A;  4BWJ A;  3SUQ A;  1S1W A;  5CY4 A;  5DK5 A;  1HYZ A;  1RT6 A;  3LP2 A;  3TAB A;  3VQB A;  4C8M A;  2HVI A;  2IC3 A;  1HQE A;  4QAG A;  2XY6 A;  4FVM A;  1B9F A;  1JLE A;  1ZBH A;  3RWU A;  3TAQ A;  3LWL A;  2D5R A;  2NUB A;  3AO4 A;  3AVM A;  3HST B;  4NYN A;  2HHS A;  1S9E A;  4IG3 A;  3NE6 A;  2QK9 A;  4KHQ A;  4AHV A;  3MEE A;  2OYQ A;  4CEF A;  1U45 A;  5E41 A;  3O3F A;  4MQ3 A;  4FLU A;  1YTA A;  3AV9 A;  3M8P A;  1U4B A;  4CJ3 A;  3O3H A;  3RTV A;  4FJG A;  1KFD A;  3HPO A;  3HVR A;  3PY8 A;  1UWB A;  4ELU A;  3ZSZ A;  4PUO A;  4ELV A;  4BDY A;  2ZD1 A;  3MXJ A;  4CJF A;  4FLX A;  3AVJ A;  4C8N A;  2EHG A;  4DTS A;  2LSN A;  4DF4 A;  4Q0B A;  4AHC A;  3QEI A;  2FBX A;  3VQD A;  3K5L A;  4ID5 A;  1BI4 A;  4ZTF A;  3AVH A;  4FM1 A;  4E7K A;  5CYQ A;  4DTM A;  3TAF A;  3L2Q A;  2WOM A;  4M42 A;  3CM5 A;  4WE1 A;  4DSF A;  1EKE A;  4CF0 A;  3B6O A;  4CJK A;  3OYA A;  3HT3 A;  2F8T A;  3OYB A;  2PYL A;  4DSL A;  4FXD A;  3WNG A;  1SL2 A;  2HND A;  1ZBL A;  3AO3 A;  3KK3 A;  1TVR A;  1D8Y A;  3KLF A;  3K58 A;  3OYK A;  4HTU A;  2RF2 A;  1XHZ A;  3TR8 A;  3AVA A;  1LAW A;  3VQP A;  2E6L A;  2Z1H A;  4GMJ B;  5JS2 A;  5KRS A;  4E3S A;  1Q9X A;  4FJ8 A;  1NJW A;  4CIG A;  2VWJ A;  4CFA A;  3U3Y A;  3KIO A;  2ATQ A;  5J1E A;  3K5O A;  2YNH A;  4RW9 A;  4B08 A;  4E7J A;  4FJ7 A;  1HYV A;  1ZBI A;  2KFZ A;  4I9L A;  2HVH A;  1JLQ A;  4FZZ A;  1EX4 A;  3T1A A;  3EYZ A;  3SQ0 A;  4KI4 A;  2G8F A;  4CIE A;  1C1C A;  1JLA A;  4CCH A;  1J5O A;  1VSM A;  2BE2 A;  2B6A A;  4EZ9 A;  3K59 A;  3F9K A;  4FJX A;  1BCM A;  3L3V A;  3EZ5 A;  2IS3 A;  3V1R A;  3LP1 A;  4IFY A;  4DLE A;  1B9D A;  4FLY A;  4IFV A;  3T3F A;  2D0A A;  1QSL A;  3DLG A;  4F3O A;  4Y1D A;  5FRN A;  2HHW A;  1GOC A;  2GV9 A;  1YTU A;  1QSS A;  1G15 A;  1ITG A;  2VG6 A;  1NK7 A;  3KD1 E;  1NK8 A;  3PV8 A;  4CJ5 A;  3SQ1 A;  4DSK A;  3KJV A;  3IS9 A;  3RR7 A;  4FJM A;  4LY7 A;  2IDO A;  1WNS A;  4DTO A;  3KLI A;  2KTQ A;  3AVG A;  4CF8 A;  3RMC A;  4BE2 A;  1KTQ A;  3S3O A;  2I5J A;  1FKP A;  4ELT A;  1HPZ A;  4M3U A;  4CJW A;  2ITG A;  3SV4 A;  1T7P A;  1RBU A;  3HXM A;  1A5W A;  3AO1 A;  3ZCM A;  3ZT0 A;  3PX6 A;  3ZSY A;  4CK2 A;  2Y1I A;  1ASU A;  1XHX A;  1HYS A;  3CM6 A;  3QIP A;  4OGE A;  4CGJ A;  4CJS A;  1NK9 A;  3VN5 A;  3K5N A;  4HUG A;  3NF6 A;  4W5R A;  2DTU A;  3V1Q A;  1RBS A;  4FLW A;  2HNZ A;  1UA0 A;  1U48 A;  1Z26 A;  3G0Z A;  4KV8 A;  3KLE A;  1TAU A;  1KVB A;  2OZM A;  1JLF A;  2QKB A;  2PY5 A;  2OPQ A;  4CF2 A;  2Y1J A;  4CJU A;  4KAZ A;  2AJQ A;  3S9H A;  1VSH A;  1IKY A;  1A5X A;  3CG7 A;  4E7L A;  3SUO A;  2KFN A;  4ZHR A;  3DLK A;  3QO9 A;  4CJE A;  1KLM A;  3AVL A;  1R0A A;  1L3T A;  2HHQ A;  2D0C A;  1S6Q A;  3WNE A;  1DTT A;  4IKF A;  4B9T A;  4KHY A;  5C24 A;  2KW4 A;  1YVU A;  1HMV A;  2GUI A;  1CZ9 A;  1FXX A;  2FBV A;  3ZSW A;  4DQQ A;  4DFK A;  2XY5 A;  2G8V A;  5KTQ A;  3NGZ A;  1I39 A;  3LPU A;  4CHP A;  4DU1 A;  1KVA A;  3VQA A;  4N56 A;  5J2N A;  3SCX A;  2P5O A;  1S1U A;  4PQU A;  4CEO A;  3SJJ A;  4DFM A;  4DTR A;  5KI6 A;  3KLG A;  4DQP A;  4DQI A;  1C0U A;  1RDB A;  1IKX A;  1EP4 A;  4DSJ A;  1FK9 A;  1VSK A;  4RG8 A;  5SWM A;  2A1R A;  1VSF A;  5K14 A;  4FW1 A;  4KI6 A;  2X74 A;  4E7I A;  1NK0 A;  3DYA A;  1ZBU A;  2DFH A;  4JRP A;  1W0H A;  3ZSR A;  4CER A;  3D0P A;  4CGH A;  4C8O A;  3AA4 A;  4CEB A;  4FLT A;  2QKK A;  5SZT A;  2P5G A;  2OZS A;  4B3O A;  3LAN A;  1T05 A;  3HP6 A;  2ZQB A;  4ZTJ A;  4TSX A;  2PYJ A;  1JKH A;  1QHT A;  2X6S A;  3QER A;  1WAF A;  4OKK A;  4FK0 A;  4Z4G A;  2WON A;  3AA5 X;  3AVB A;  4KRF A;  3V81 A;  3C95 A;  4FM2 A;  3JSM A;  2OPS A;  4RW7 A;  3MXM A;  5C42 A;  4CF9 A;  4DMN A;  4HCC A;  4IDK A;  1JXB A;  1RT5 A;  4GVM A;  4N47 A;  4DTJ A;  1X9W A;  1D9D A;  4PY5 A;  3P83 D;  4QCL A;  1NJX A;  1K6Y A;  4CJR A;  3SYZ A;  3V4I A;  4KHN A;  3VQ4 A;  1RDA A;  4Z4F A;  2XRI A;  4PWD A;  4B8A B;  2G8W A;  4CHN A;  2KZZ A;  3HL8 A;  1RNH A;  4CJP A;  3L8B A;  1T8E A;  4FJH A;  1RTI A;  1RIL A;  4CED A;  1TGO A;  4CEQ A;  1NOZ A;  4JRQ A;  4CHQ A;  4DS4 A;  1TKZ A;  4KTQ A;  4Z4I A;  1KRP A;  1WSJ A;  3OYC A;  1YT3 A;  4CGG A;  3I0R A;  4FLZ A;  3SV3 A;  1HQU A;  2KQ2 A;  4AIL C;  1T03 A;  3H08 A;  3QEV A;  2DY4 A;  1L3U A;  3ALY A;  1XWL A;  4M3X A;  2Z1G A;  5KGX A;  3DLH A;  1SL0 A;  4MFB A;  4W5T A;  1BCO A;  4HHT A;  4KPY A;  4R5P A;  4Z4E A;  1IO2 A;  3U3G A;  1VRT A;  1BIZ A;  1L3V A;  3QEX A;  4I2P A;  2JGU A;  4E7H A;  3MEG A;  3SZ2 A;  3P1G A;  3OJU A;  3MAQ A;  1TK8 A;  5J2M A;  3B6P A;  2O4G A;  4CIF A;  2YHA A;  4DQS A;  5HRS A;  4HVJ A;  4H4M A;  4FYD A;  4F3T A;  3QEW A;  3AO2 A;  2BAN A;  2RN2 A;  1VRU A;  4O5B A;  3VQ7 A;  3OYE A;  3C6T A;  2YKM A;  3VQ8 A;  3DMJ A;  3ISN C;  4CGI A;  4E1N A;  1N5Y A;  3QES A;  1SL1 A;  1HNI A;  4CJQ A;  4Z0U A;  5HRN A;  3TI0 A;  1X1P A;  4RW8 A;  2P51 A;  4OLB A;  2W42 A;  3OYH A;  1RDC A;  4CF1 A;  4FLV A;  3NCI A;  4E89 A;  3LDS A;  3OYD A;  2D0B A;  3RRH A;  1RT2 A;  2F96 A;  3NBP A;  4OGC A;  1SUQ A;  4KTW A;  4CFD A;  4N5S A;  4BAC A;  1Q9Y A;  1C1B A;  3OYI A;  1TAQ A;  1S9G A;  1VK0 A;  3NDK A;  4CEA A;  4FW2 A;  4DG1 A;  3QET A;  3ULD A;  4ICL A;  2F8S A;  3CFR A;  2BGG A;  2FBT A;  3I8D A;  3ZSO A;  2ETJ A;  4DTX A;  1WSF A;  3D45 A;  3OVN A;  4DU3 A;  4DFJ A;  1U04 A;  5C25 A;  5HRR A;  5FRO A;  4G1Q A;  3HVT A;  2OPR A;  4AHS A;  1BIU A;  3THV A;  2DFE A;  4FZX C;  4O0J A;  3NGY A; 
#chains in the Genus database with same CATH topology
 3M6G A;  1NGB A;  3L2V A;  2OPP A;  4OJR A;  4FJ5 A;  2NRV A;  3V1O A;  4FJK A;  3AAP A;  3DLE A;  1KAX A;  1JXE A;  2B5J A;  3QBW A;  3ZT4 A;  1C0M A;  3W0L A;  3HPG A;  4H0Y B;  4O55 A;  4DR7 K;  4AHT A;  2J4R A;  3AVC A;  1WSE A;  3O6W A;  3LWM A;  2UYT A;  4CD3 A;  5HRO A;  4J2E A;  2HNY A;  2EX3 A;  4IJN A;  1S72 N;  2OCE A;  1QTM A;  2QA4 N;  2OA8 A;  1TKT A;  1VQO N;  4BDP A;  4BE0 A;  3V9U A;  1LWC A;  2YNI A;  2BH1 A;  1S5J A;  1CLQ A;  3I33 A;  1O13 A;  4CES A;  3ZET A;  3L3U A;  1OH8 A;  4A5A A;  1RFQ A;  2RPI A;  4K8Z A;  3LP3 A;  1HKB A;  1N6Q A;  3MN9 A;  3QIO A;  3SAF A;  3M8S A;  4DR1 K;  4IFE A;  2XHB A;  3T7Z A;  3A5O C;  1TL1 A;  4JLH A;  4DR2 K;  4BR0 A;  3S3M A;  3QNN A;  4NXM K;  4M45 A;  3J81 O;  3I56 N;  4CZH A;  2YCH A;  2E4L A;  1RTJ A;  3HJF A;  3JYT A;  3CME N;  3J7Y P;  3T19 A;  5EU7 A;  3IRX A;  3ZEU B;  3ZT3 A;  1DLO A;  5C15 A;  3FFK B;  4RW6 A;  4LH4 A;  4CZE A;  1BL3 A;  5HOO A;  3R9P A;  3IDH A;  1LCU A;  3BDP A;  4LH5 A;  4Y0W A;  2P9U A;  1SZ2 A;  3J7A P;  5GAG P;  5AQU A;  1ZYQ A;  4CJL A;  1R59 O;  3DOK A;  4BY9 C;  3CCE N;  5C0Y A;  3UIQ A;  1F21 A;  2GEM A;  2O8C B;  5HBM A;  1ASW A;  5I3U A;  2P9P B;  4GW6 A;  4CFB A;  3LPT A;  3CCJ N;  2KKZ A;  1TK0 A;  4W5N A;  3SI6 A;  1NGA A;  2HHV A;  1ZC6 A;  2E6M A;  5I42 A;  1XI1 A;  1TV6 A;  2X6N A;  5AQX A;  4M3R A;  4FVU A;  3IG1 A;  3ZSX A;  5KGW A;  4FCY A;  1RT7 A;  2YHX A;  1LW0 A;  3AY9 A;  1QS4 A;  4O4G A;  1JCG A;  1C0G A;  4JS5 A;  3VTI A;  3IKM A;  3MEC A;  4OPA A;  3C6H A;  5AQW A;  3MDQ A;  5JVH L;  1UA1 A;  2X78 A;  2ZGY A;  3P5J A;  2W6K A;  2E2Q A;  3EY1 A;  3OA9 A;  3CI5 A;  4KKO A;  2O8B A;  1D4X A;  3DWL A;  1QHA A;  3DXM A;  1HJR A;  1KFS A;  5J2P A;  5AQJ A;  3L4Q A;  3W3D A;  1ASV A;  3T1Y K;  1X3M A;  3VMF B;  4CE9 A;  3U6F A;  3SMP A;  1NKE A;  4DTN A;  4J2A A;  1Q82 O;  4I9Q A;  3MXI A;  1BDG A;  4I2Q A;  1K8K B;  4BRK A;  4UQG A;  3CCQ N;  1HJO A;  1QE1 A;  3RRG A;  4NCA A;  1KAZ A;  3VGL A;  4K8X A;  5DM7 L;  1NK4 A;  1BWF O;  5HRP A;  3NH0 A;  1J53 A;  4DV6 K;  2FBY A;  2QWP A;  4YDU A;  4BGB A;  5FDL A;  2WFB A;  4LSL A;  4Y1C A;  4H03 B;  4M63 C;  4DSE A;  1UOC A;  4H0X B;  3G4S N;  3SK3 A;  4B3R K;  1VSL A;  3DRP A;  3HBT A;  2KZM A;  1LWE A;  3H3O B;  1CXQ A;  3THY A;  3HRG A;  2FF3 B;  1HLU A;  2XY7 A;  4K41 A;  3LDQ A;  3O3G A;  3SUQ A;  3EE8 A;  2V7Z A;  3LP2 A;  5BPN A;  4E1J A;  2IC3 A;  4QAG A;  4NO7 A;  1B9F A;  1TUY A;  3RWU A;  3O9T A;  2D5R A;  1T3V A;  1HR0 K;  4NYN A;  1J6Z A;  4AHV A;  2ZJR L;  1TYQ A;  3MEE A;  1U45 A;  3O3F A;  1KXP A;  3AV9 A;  4CJ3 A;  3RTV A;  4BGA A;  3PY8 A;  1NMD A;  3QML A;  4PUO A;  3D2F B;  1C0F A;  4DTS A;  4AHC A;  2E88 A;  3FR0 A;  2FBX A;  4ISG A;  3VQD A;  4ID5 A;  4V19 S;  2P9S B;  2YI1 A;  5CYQ A;  4DTM A;  4BQL A;  4X65 K;  1E4F T;  4O8U A;  4CF0 A;  3VOV A;  1NGC A;  4CJK A;  3OYA A;  2F8T A;  1ZXO A;  3OYB A;  4FXD A;  1SL2 A;  1ZBL A;  4U7B A;  1TVR A;  3GE1 A;  3KLF A;  2G8U A;  1MDU B;  5KRS A;  2E6L A;  4CIG A;  3U3Y A;  2YNH A;  3CPE A;  4I9L A;  3EYZ A;  4EHT A;  2G8F A;  4CIE A;  4CCH A;  1JLA A;  5AQV A;  3O08 A;  3NMU A;  4BRO A;  3EZ5 A;  2IS3 A;  3V1R A;  4BR4 A;  4IFY A;  4DLE A;  4DQQ A;  2V51 B;  5FRN A;  4F3O A;  4Y1D A;  5AR0 A;  4CBW A;  4DKW A;  1YTU A;  4YOY A;  4FJM A;  1SQK A;  1YIT N;  4CZK A;  4WFB L;  2KTQ A;  4CF8 A;  4BE2 A;  3S3O A;  2P9K B;  3SV4 A;  2OTL N;  3HXM A;  3PX6 A;  3ZT0 A;  4JV5 K;  2HBM A;  1HYS A;  1XHX A;  3MN6 A;  4OGE A;  4CGJ A;  1Q86 O;  3NF6 A;  2GEL A;  3IUC A;  1U48 A;  1Z26 A;  1JLF A;  2OPQ A;  3TTF A;  4MLH A;  4CJU A;  4DV0 K;  4JD2 A;  3S9H A;  1XUP O;  1A5X A;  4BR5 A;  4LF6 K;  3H6E A;  3ZET B;  3RVC A;  1KLM A;  1XMO K;  1S6Q A;  4KHY A;  2KW4 A;  3N4P A;  1NJI O;  2GUI A;  2FBV A;  2XY5 A;  3HOS A;  5KTQ A;  4DUY K;  1I39 A;  5J2N A;  3VQA A;  3SCX A;  3TSQ A;  1S1U A;  4CEO A;  4DFM A;  5KI6 A;  4DQI A;  1HUX A;  3EO3 A;  1IKX A;  1VSK A;  4RG8 A;  1NM1 A;  4YOT A;  2UXD K;  4JRP A;  3D0P A;  4CGH A;  3AA4 A;  3VF4 A;  5HL7 L;  1T05 A;  2ZQB A;  4TSX A;  1OH7 A;  4CI6 A;  1NWK A;  2IVO A;  4FK0 A;  3V81 A;  5KPR A;  1JXB A;  4JYA K;  2A40 A;  3ENO A;  4KHN A;  4CJR A;  2D0O A;  2P9U B;  1RDA A;  2AA4 A;  3U8X A;  4CJP A;  1U6Z A;  1NLV A;  2GWJ A;  2RE2 A;  1WSJ A;  3OYC A;  1YT3 A;  4FLZ A;  3I0R A;  2UUC K;  2KQ2 A;  4AIL C;  1T03 A;  2DY4 A;  2WC9 A;  3ALY A;  3C0B A;  3SJH A;  1VQ8 N;  2HF3 A;  4E7H A;  3MEG A;  2P9P A;  3P1G A;  5J2M A;  4CIF A;  1EQY A;  2O4G A;  3FZL A;  4A59 A;  4IXC A;  3AO2 A;  2BAN A;  4JK7 A;  4K25 A;  4O5B A;  3VEZ A;  3VQ8 A;  5F1X A;  4BVO A;  5HRN A;  3TI0 A;  1NGI A;  1X1P A;  4OLB A;  2NLX A;  3NCI A;  4Z94 A;  5JLF A;  3RRH A;  3JXU A;  4FOE A;  3NBP A;  4OGC A;  4CFD A;  1C1B A;  4BRP A;  1TAQ A;  3QET A;  3MN7 A;  5GIP A;  3ULD A;  4JK8 A;  2ETJ A;  1WB9 A;  3BZC A;  4QS7 A;  2O8B B;  4MDB A;  5LMN K;  3DXK A;  4AHS A;  4FZX C;  1GLC G;  2P9N A;  3TAR A;  3CFO A;  5BRD A;  4WYB A;  3C6U A;  4CBX A;  3M3Z A;  2VQE K;  4LSN A;  4C8L A;  2Q3S A;  4CHO A;  1WUA A;  1KLN A;  1ILY A;  2ASM A;  3KKR A;  4YOX A;  4JKD A;  4LD0 A;  1NJY A;  4LF5 K;  4JNE A;  3VGK A;  1TKD A;  2JWK A;  3OS0 A;  3FFI A;  1QZ6 A;  2E5L K;  2IVN A;  3MWP A;  5AQF A;  1NGH A;  2E2N A;  4IO8 A;  3ZSQ A;  3L2R A;  3QNO A;  4CZI A;  2CH6 A;  4JI4 K;  3HZ6 A;  4AHU A;  5HLF A;  1WSG A;  4FK2 A;  5EXW A;  3G10 A;  2QEX N;  3OS2 A;  1K8K A;  4PA1 A;  3P39 A;  3DRR A;  4EAH D;  4FZY A;  4CEZ A;  3RMB A;  2FSN A;  4DTP A;  2E20 A;  5M1Q A;  4I6M A;  4DV1 K;  2VGM A;  1JL2 A;  4EHU A;  3QEP A;  1IH7 A;  4N76 A;  3E9O A;  1RBV A;  3SBT A;  2YNG A;  2PBD A;  4Z4H A;  4F8R A;  4G9Z A;  2ZWH A;  1FKO A;  3SPZ A;  3NAE A;  3P31 A;  3F5T A;  3H1Q A;  1OH6 A;  2YV0 X;  4M3Y A;  4JI1 K;  3CCR N;  1YJW N;  3SNN A;  4DQR A;  4KRE A;  5TKW A;  4FWO A;  3O4W A;  4OKJ A;  5JS1 A;  4LFB K;  3ZX0 A;  2DFF A;  2ZF5 O;  3HP9 A;  3WUH A;  3VQ6 A;  2QM1 A;  3LZI A;  2ITM A;  1JLB A;  3A5N C;  5AQP A;  4K42 A;  3DLR A;  4H8K A;  1TYQ B;  4N41 A;  1V4T A;  3LDO A;  3V9W A;  4H5V A;  1GLL O;  2Q0U A;  4B9U A;  3PX0 A;  3OYF A;  3FLC O;  1U49 A;  5LJW A;  4B9V A;  4NLC A;  4QOZ B;  1QSY A;  1Z6R A;  2A3Z A;  3VQ9 A;  4KFB A;  3SQ4 A;  4PKG A;  3QBX A;  3FGU A;  4M3Z A;  2JWL A;  2Q2R A;  5GIO A;  4OLA A;  5BRF A;  3WXM B;  1S1X A;  3JAM O;  4HUE A;  2Z1J A;  4F2S A;  2IAJ A;  3K5M A;  4GV9 A;  4B9M A;  4CEC A;  5J2Q A;  1D5A A;  1VSD A;  3O9R A;  2G8K A;  3KD5 E;  1HX1 A;  3L2U A;  1SKW A;  4JI6 K;  1LWF A;  5BRE A;  3TAP A;  2VWK A;  1NKC A;  1Y64 A;  4I7F A;  1S1V A;  2NZT A;  3K57 A;  1JL1 A;  5C12 A;  3HM9 A;  3M8R A;  2VG7 A;  3PX4 A;  4H5W A;  3SUP A;  2HHT A;  3NFA A;  4JI5 K;  4CZM A;  4A2B A;  3KWG A;  3ENB A;  4BG9 A;  1VQ5 N;  5IWA K;  5AZI A;  3ZT1 A;  3VA0 A;  1NK5 A;  3RMA A;  5BRH A;  3S41 A;  4DFP A;  4KHW A;  1DTQ A;  3ZSV A;  3QIN A;  3QDK A;  4EP4 A;  3PO5 A;  4CZL A;  5DM6 L;  2P9K A;  3DJC A;  1NGD A;  4JD2 B;  1S3X A;  4ILG B;  4J2D A;  3RR8 A;  2IGI A;  1TKX A;  4YNQ A;  2G8I A;  2NRR A;  5E26 A;  2UXC K;  4WQ4 A;  4GKK K;  2P9L A;  3VF6 A;  4A57 A;  3I55 N;  4FJN A;  3UKU A;  2FXU A;  1S6P A;  3HYF A;  3CQ8 A;  4CJV A;  1HRH A;  3PLA A;  4LF8 K;  3ASM A;  4FK4 A;  4CFC A;  4HUF A;  5LL6 Z;  2AP1 A;  3T69 A;  4BC5 A;  4C1N K;  4FJI A;  2YJF A;  4H4O A;  3AVI A;  1ATS A;  4BG8 A;  2RHK A;  2QXL A;  4F4K A;  2HB5 A;  2NRH A;  3CPW M;  3KTQ A;  2PZS A;  4M41 A;  3T1H K;  2I7P A;  4YOV A;  3FZM A;  1WAJ A;  1X9M A;  3ENH A;  4JKH A;  1YIJ N;  3NF8 A;  4BWJ A;  3LDN A;  5DK5 A;  1HYZ A;  3VQB A;  4F9O A;  3ULE B;  4FWP A;  2A6A A;  4FVM A;  5AQZ A;  1ZBH A;  1XQS C;  2KLA A;  4IOX A;  2UUB K;  2UXB K;  3QIC A;  2HHS A;  3H1V X;  4RWT A;  2OYQ A;  4CEF A;  3OTO K;  4FLU A;  3SBG A;  4JKE A;  3M8P A;  1U4B A;  3MCP A;  3HVR A;  2Q0R A;  3ZSZ A;  3CC2 N;  4ELV A;  3AVJ A;  3UE5 A;  2IVP A;  3CQY A;  3AVH A;  5I9E B;  4WCE L;  3VEO A;  2H3G X;  1YF5 L;  2FF6 A;  4CW7 B;  5C10 A;  3HT3 A;  3THX B;  1YJ9 N;  4ISE A;  4B1Z A;  3KK3 A;  3CJA A;  2RF2 A;  3AVA A;  1BA0 A;  5JS2 A;  3C65 A;  5J1E A;  4BRC A;  1ZBI A;  1Q81 O;  4FZZ A;  1EX4 A;  4JI2 K;  3SQ0 A;  4EFH A;  3DXK B;  4FWN A;  4K0K K;  1J5O A;  2B6A A;  2P9N B;  4FJX A;  4FLY A;  3LP1 A;  5AQH A;  4IFV A;  3DLG A;  2VCP A;  2BUP A;  1QSS A;  1G15 A;  3U4L A;  1NK7 A;  4B3M K;  1NK8 A;  3PV8 A;  4CJ5 A;  4H5N A;  2Q1N A;  4GV3 A;  3L4I A;  3KLI A;  4IOC L;  2Q31 A;  3AVG A;  2I5J A;  1FKP A;  3D2E A;  1HPZ A;  4CJW A;  1RBU A;  4H0P A;  5BPM A;  3ZSY A;  4CK2 A;  4BR9 A;  2CGL A;  3F2K A;  1RBS A;  4IWV A;  4J8F A;  2HNZ A;  1UA0 A;  4LF9 K;  3M5R A;  3KLE A;  5M1F A;  2OZM A;  3HTV A;  2PY5 A;  5FPE A;  2E1Z A;  4WFN L;  4FPA A;  3TTC A;  2HBL A;  4E7L A;  4I6M B;  5AQK A;  5F2R A;  4B1U B;  4CJE A;  1L3T A;  2QW9 A;  2YX6 A;  4BC3 A;  3PSF A;  4U67 L;  3KZB A;  4M7X A;  1OKJ A;  4B9T A;  3NVM A;  3A5L C;  1CZ9 A;  3ZSW A;  4DFK A;  4KH6 A;  3L0Q A;  1EWR A;  5IT9 O;  4DU1 A;  3TU5 A;  1NBW A;  4PQU A;  2ZM6 K;  4DQP A;  1C0U A;  2QI2 A;  4DSJ A;  1EP4 A;  4PKI A;  1FK9 A;  1WOQ A;  2A1R A;  3OBW A;  4FWK A;  4FW1 A;  4KI6 A;  4E7I A;  2O8D A;  4LFA K;  1ZBU A;  1W0H A;  4CER A;  5B8H A;  5SZT A;  3TTD A;  1ATN A;  5GIN A;  4ZTJ A;  4ISF A;  1JKH A;  1QHT A;  4Z4G A;  4FM2 A;  3AGK A;  5BR9 A;  4IDK A;  1RT5 A;  4GVM A;  4DTJ A;  1D9D A;  4PY5 A;  4QCL A;  3VER A;  1DKG D;  3P83 D;  1K6Y A;  3V4I A;  1NJX A;  1MWK A;  3VEY A;  3VQ4 A;  3KVG A;  4B8A B;  2G8W A;  1RNH A;  3CER A;  3L8B A;  2QWM A;  1J5E K;  5M1P A;  3HOT A;  2NRZ A;  1GLJ O;  1KRP A;  1JJ2 M;  3O1W A;  1XWL A;  4BQZ A;  4M3X A;  4BRL A;  5KGX A;  2NRX A;  4MFB A;  4W5T A;  3DAW A;  4HHT A;  4KPY A;  1N32 K;  3U3G A;  4BC2 A;  1VRT A;  2QWQ A;  2UUA K;  3MAQ A;  3OJU A;  1JCE A;  1TK8 A;  3MN5 A;  2ASP A;  3EL2 A;  2YHA A;  3G25 A;  4DQS A;  4BRM A;  4H4M A;  5LJV A;  3NVK A;  2RN2 A;  3OYE A;  4OX9 K;  3C6T A;  4IJA A;  3ISN C;  4H5R A;  1HNI A;  4CJQ A;  4Z0U A;  2P51 A;  2W42 A;  3OYH A;  3LDS A;  3TPQ A;  2WUS A;  4FWQ A;  4N5S A;  4KTW A;  1VQ6 N;  5CHI A;  1Q9Y A;  1S9G A;  4CEA A;  4FW2 A;  4DG1 A;  2A41 A;  3LM2 A;  5AZI B;  4AM7 A;  4DFJ A;  1U04 A;  4JEP A;  4NLB A;  5HRR A;  4BC4 A;  5GAD P;  2DFE A;  3VQ7 A;  3NGY A;  3LL3 A;  4HTL A;  3LDL A;  4JHD A;  1GOA A;  3BGR A;  1J54 A;  4MO5 A;  1Z25 A;  1GOB A;  3N4Q A;  3VQ5 A;  4CGD A;  4OPK A;  3NH2 A;  1IG9 A;  1VSI A;  2P9L B;  3AA3 A;  3GOI A;  4B9L A;  3A8Y A;  3IFR A;  4B1V A;  1WSI A;  2KHO A;  4DV2 K;  3VQE A;  2Z1I A;  4UY8 O;  1LW2 A;  4A2A A;  3UKU B;  3VQQ A;  5FLX O;  4IBN A;  2YHY A;  2HMI A;  3S3N A;  2VYP A;  1JLG A;  3CCL N;  3AA2 A;  4DV7 K;  2XY8 A;  3K0S A;  4IEE A;  4AHR A;  4BDZ A;  4AH9 A;  1V4S A;  3CJC A;  1REV A;  4RCH A;  4DS5 A;  5EX5 A;  4OPJ A;  3CYM A;  2W6L A;  3AVK A;  3I0S A;  3VET A;  4KB0 A;  1RTD A;  4CJT A;  1WLJ A;  1L5U A;  4OVL A;  2FSK A;  3OYG A;  3WNF A;  4JKG B;  5HP1 A;  4KH5 A;  4BRA A;  2VQF K;  4BRE A;  5BN9 A;  1I94 K;  3VEW A;  1NU0 A;  1QQC A;  3WNH A;  1TL3 A;  4DQ8 A;  3IAY A;  1ZBF A;  4YOU A;  4CK1 A;  3CQX A;  2JLE A;  1SKR A;  4CZG A;  3DLB A;  1J9A A;  4BR2 A;  3CF5 L;  4WQ5 C;  3WT0 A;  1RT4 A;  2A5X A;  3WEE A;  5AJ3 K;  3HK2 A;  4FJL A;  3R6M A;  4CHY A;  1SV5 A;  4KTZ A;  2E1Y A;  3DM2 A;  3ULE A;  5JLH A;  1KVC A;  4IG0 A;  5BR8 K;  4FJ7 A;  1MU2 A;  3A0I X;  3SAG A;  3J80 O;  1IKW A;  1KD1 O;  1BO5 O;  4JN4 A;  5A2Q O;  3TAE A;  4JI0 K;  1RT3 A;  4B9S A;  4WF9 L;  3MED A;  1GLD G;  2ASO A;  4B8C A;  3TWH A;  5AFU A;  3NH1 A;  4B3T K;  3C7N A;  4XIU A;  2XO7 A;  3OYJ A;  3OYN A;  4DR4 K;  4KHP K;  3AAR A;  1U47 A;  1CXU A;  5AZJ B;  1EXQ A;  4JKA A;  4XH1 A;  5LY3 A;  2EWS A;  4BWM A;  4BR7 A;  1Q18 A;  3THX A;  1VSE A;  1RTH A;  4YFU A;  1T44 A;  3VQC A;  4KH4 A;  1RBR A;  3A5M C;  4KHS A;  1C0T A;  3C94 A;  4E0D A;  5AQN A;  3WXJ A;  4B9N A;  2CH5 A;  1MWM A;  4IZ9 A;  1B92 A;  3DOL A;  4J2B A;  2PAV A;  1BQN A;  3O9S A;  5CZ1 A;  2R7Y A;  3C6A A;  3SUN A;  3O80 A;  3D2E B;  3DRS A;  1WSH A;  4FJJ A;  4BRD A;  4HCB A;  2VG5 A;  4NCG A;  3TAN A;  4L8R B;  1X3N A;  3PIP L;  1D9F A;  4FJ9 A;  1Q8I A;  3O4Q A;  3F73 A;  1HPM A;  5DMR A;  4DWI A;  3AVN A;  4JKC A;  2ZE2 A;  1VSJ A;  3CXC M;  1X9J A;  4C1N I;  5CZ2 A;  3AAQ A;  2P1J A;  3PUF A;  5GAH P;  3NHG A;  1BIS A;  1EET A;  1KAY A;  3NF7 A;  3CD6 N;  1C1A A;  3RMD A;  1RDD A;  1XC9 A;  1KC8 O;  1TK5 A;  3DI6 A;  2D4W A;  3BY5 A;  5E84 A;  1JLC A;  3LDP A;  4DR6 K;  2E8A A;  4H0T B;  3E66 A;  2O8D B;  3LAL A;  3K2P A;  3VES A;  2GWK A;  1WN7 A;  1VQL N;  3D7E O;  1NGG A;  4YOR A;  3AO5 A;  4B9Q A;  1NJZ A;  3KKS A;  4CEE A;  3GDQ A;  5KPT A;  3EKU A;  4OKE A;  4EP5 A;  3FZF A;  3SAH A;  1BHL A;  1BGX T;  4O0I A;  1NGF A;  1S1W A;  2HST A;  5CY4 A;  3J7Z O;  1RT6 A;  3F9M A;  3TAB A;  4C8M A;  1HQE A;  4DUZ K;  2XY6 A;  1JLE A;  3OW2 M;  1SS6 A;  3TAQ A;  3GL1 A;  1NNE A;  3AO4 A;  3AVM A;  4IG3 A;  3NE6 A;  2QK9 A;  4KHQ A;  1MA9 B;  3CJ7 A;  5E41 A;  1YTA A;  2E2O A;  1N33 K;  1YXQ A;  3O3H A;  2ZJP L;  1KFD A;  1IBL K;  4ELU A;  1RGI A;  4BDY A;  4JKF A;  4C8N A;  2EHG A;  4DF4 A;  2LSN A;  4DR3 K;  5JIC A;  4BRF A;  3QEI A;  4DHY A;  3VTH A;  4R79 A;  4CBU A;  3K5L A;  1BI4 A;  1JCF A;  4O5F A;  4ZTF A;  4QS8 A;  3CJB A;  3ATV A;  3TAF A;  3L6Q A;  4M42 A;  2HF4 A;  4WE1 A;  4DSF A;  1EKE A;  5ELZ A;  3O8M A;  3B8A X;  4IOA L;  3OYK A;  4HTU A;  4X62 K;  4E3S A;  4FJ8 A;  1NJW A;  4YHH K;  3K5O A;  4B08 A;  4E7J A;  4PL8 A;  2HVH A;  1JLQ A;  3H45 C;  3T1A A;  1C1C A;  1VSM A;  2BE2 A;  4EZ9 A;  4B3S K;  3L3V A;  2QWO A;  1B9D A;  4JHD B;  2FLO A;  2HHW A;  3BEX A;  2VG6 A;  3CCU N;  3ID6 A;  4DSK A;  4AQY K;  3KJV A;  3CC7 N;  1H1V A;  4LY7 A;  3WQU A;  3CMA N;  3J8A A;  4M3U A;  1VQ9 N;  2ITG A;  1QQN A;  3ZX3 A;  4BRI A;  3AO1 A;  3ZCM A;  2NRT A;  2Y1I A;  1ASU A;  4CJS A;  3QIP A;  1NG9 A;  1GLE G;  3VN5 A;  3K5N A;  4HUG A;  1QVF M;  4W5R A;  2DTU A;  3V1Q A;  3ATU A;  4FLW A;  1TAU A;  3FZK A;  4IO9 L;  4CF2 A;  2Y1J A;  5JVG L;  3G6E N;  4KAZ A;  2AJQ A;  1VSH A;  1BOT O;  3CG7 A;  2KFN A;  3SUO A;  4ZHR A;  3DLK A;  1R0A A;  3AVL A;  3WQT A;  4IKF A;  1ZBS A;  5C24 A;  1BG3 A;  1HMV A;  1FXX A;  4RTF D;  1BUP A;  3BZK A;  2FSJ A;  3LPU A;  1WBD A;  5GAE P;  5FPM A;  4N56 A;  2F7T A;  4BRN A;  5CE3 A;  3H3N O;  5AQO A;  1FW6 A;  1RDB A;  4JKG A;  5K14 A;  4AM6 A;  2DFH A;  2YHW A;  3CIP A;  3HM8 A;  4CEB A;  4FLT A;  2QKK A;  1RDU A;  4LC9 B;  3WEE B;  4B3O A;  3BF3 A;  3HP6 A;  2PYJ A;  2P9I A;  3EE9 A;  1WAF A;  1N36 K;  4OKK A;  2WON A;  3C95 A;  3MXM A;  5C42 A;  1EO1 A;  4HCC A;  2F9W A;  5EVZ A;  3GBT A;  4Z4F A;  2XRI A;  4XH4 A;  1EWQ A;  2O8F A;  1ATR A;  4CHN A;  2ZGZ A;  3HL8 A;  3CHW A;  3IMX A;  4MLE A;  1T8E A;  4FJH A;  3E9L A;  3D6R A;  1RIL A;  4CED A;  1TGO A;  4CEQ A;  4JRQ A;  1NMN A;  5EY4 A;  4CHQ A;  1TKZ A;  4KTQ A;  3C7N B;  1K8A O;  3H08 A;  1L3U A;  4DB3 A;  3BF1 A;  1P8Z A;  1QZ5 A;  2Z1G A;  1VAZ A;  5KQ8 A;  3DLH A;  1SL0 A;  1IBM K;  3ZLJ A;  3MX2 A;  4R5P A;  1IO2 A;  1DEJ A;  3UKR A;  4BVP A;  4I2P A;  3EN9 A;  3VEV A;  3SLC A;  5AZJ A;  4HVJ A;  4FYD A;  3QEW A;  3G71 N;  1VRU A;  1GLF O;  2YKM A;  3DMJ A;  4E1N A;  3DLL L;  1N5Y A;  3QES A;  1SL1 A;  4RW8 A;  5M1K A;  2CGJ A;  1RDC A;  4CF1 A;  4FLV A;  3OYD A;  2D0B A;  2OAN A;  3EKS A;  2F96 A;  4BAC A;  2GTD A;  3NDK A;  2W41 A;  2F8S A;  3CFR A;  2BGG A;  4FL9 A;  2FBT A;  3I8D A;  1WSF A;  4YDU C;  3OVN A;  4DU3 A;  3ZX2 A;  1VQ7 N;  1U2V A;  5C25 A;  4G1Q A;  4FWL A;  1YVN A;  2OPR A;  1BIU A;  4B1X B;  3THV A;  3SMS A;  3BP8 A;  3Q7B A;  1I3A A;  1GLB G;  2YHB A;  2QXF A;  4BRH A;  4ID1 A;  3SPY A;  5ADX H;  2O4I A;  1VQN N;  3CCM N;  2F4V K;  1XC3 A;  5FRM A;  4H0O A;  3EZW A;  3M8Q A;  2UU9 K;  1KCF A;  4JI8 K;  1G99 A;  5AQL A;  3BUZ B;  4Q5V A;  3E01 A;  4DTU A;  4IDH A;  1RT1 A;  3ITH A;  3Q7C A;  4QS9 A;  2HHX A;  4H5T A;  2B4J A;  1OVY A;  4KO0 A;  3LAK A;  4CHZ A;  2PFU A;  1LV5 A;  5KPZ A;  1HNZ K;  2D0P A;  2GUP A;  2V7Y A;  4BRG A;  1IJJ A;  5CYM A;  4OO1 J;  1C6V A;  3LZJ A;  4F2R A;  1UAX A;  3OY9 A;  4DR5 K;  1YJN N;  1M90 O;  3OBY A;  1NK6 A;  1LOT B;  4DV4 K;  4O44 A;  4BE1 A;  1O1W A;  4E19 A;  1VQP N;  3LAM A;  3SQ2 A;  3AVF A;  1K9M O;  4CZJ A;  3V9S A;  4YOW A;  3E9P A;  1DT9 A;  4FSV A;  4JS4 A;  4GV6 A;  1Z05 A;  1N8R O;  2WBN A;  4FWS A;  1S1T A;  4X66 K;  4CZF A;  1SAZ A;  3KK1 A;  5JMV A;  5D3G A;  3TAG A;  3V9Z A;  1X9S A;  3LP0 A;  1T6C A;  4CD1 A;  4JAX A;  3OJS A;  3HPH A;  4Z4C A;  2FC0 A;  2A1S A;  2VGN A;  2HHU A;  1LAV A;  3KLH A;  4PKH A;  1A5V A;  2O8E A;  4JI3 K;  2YKN A;  1XNQ K;  2BDP A;  3P4I A;  4CJ4 A;  2G8H A;  3ZT2 A;  5AFU H;  4W5O A;  1RDW X;  1SKS A;  1NOY A;  1BI4 B;  4CGF A;  1T6D A;  4C23 A;  3VF2 A;  3THW A;  1HNV A;  1NGJ A;  5CR4 A;  1L3S A;  3MCA B;  5MLC Q;  3QLH A;  5C2D A;  3NGI A;  5KRT A;  3TSU A;  1BQM A;  4A61 A;  1IV0 A;  4DSI A;  3TAM A;  4X64 K;  4C8K A;  1YHQ N;  4FPB A;  4PL7 A;  3V9X A;  2YNF A;  3HSC A;  4XEI A;  3EEQ A;  3CCV N;  4KHU A;  1RCH A;  3E1Y A;  4HWI A;  3HO1 A;  3PO4 A;  1VQK N;  3O1B A;  3R3L A;  4NYF A;  1IKV A;  3RSE A;  2Q36 A;  1CZB A;  2F9T A;  3L2W A;  1WBB A;  1BU6 O;  4DF8 A;  5AQY A;  3WXK A;  2IOC A;  3U9Z A;  4CK3 A;  5M1O A;  3QFU A;  5ADX A;  1K73 O;  2CGK A;  2DPN A;  1Q7Y O;  5KQD A;  4FM0 A;  3KK7 A;  3QB0 A;  4DU4 A;  3PIO L;  2GBZ A;  1P90 A;  3OYM A;  2RKI A;  3KK2 A;  2HW3 A;  3A2F A;  4DLG A;  3NF9 A;  5EOY A;  3U9D A;  5FPN A;  5AQI A;  5T7B A;  3WXL A;  4KB1 A;  2HMP A;  3CJ9 A;  4LF7 K;  3V6D A;  4AF1 A;  3OS1 A;  3O4N A;  3CFP A;  4M3W A;  3O5B A;  5H1S Q;  4EZ6 A;  1Y97 A;  3OYL A;  1RBT A;  4E1M A;  2P9I B;  3VA3 A;  1NKB A;  1YI2 N;  3O9U A;  3UB5 A;  4RW4 A;  1NGE A;  2BTF A;  4W5Q A;  2HBK A;  1E4G T;  3R1X A;  1QVG M;  1KSP A;  4M3T A;  4NCB A;  1W9H A;  2O8F B;  3ID8 A;  4B1Y B;  2HVI A;  3FE1 A;  4CJ7 A;  1QQM A;  3LM9 A;  4O8K A;  4DV3 K;  3LWL A;  2NUB A;  3HST B;  1S9E A;  3ZEU A;  4CVN E;  5AQQ A;  1VHX A;  4MQ3 A;  3VPZ A;  5BN8 A;  4FJG A;  3HPO A;  3UKR B;  3GG4 A;  1UWB A;  5BPL A;  2ZD1 A;  3MXJ A;  4NB4 A;  3VEX A;  4CJF A;  4FLX A;  4DCH A;  1W7A A;  4Q0B A;  3P38 A;  3CJ1 A;  2IIR A;  1KQS M;  2GX9 A;  4FM1 A;  4E7K A;  2QWL A;  3L2Q A;  2WOM A;  3CM5 A;  5AQS A;  2O8C A;  3B6O A;  2PYL A;  2WTU A;  4DSL A;  2YJE A;  3K9K A;  5FPD A;  2HOE A;  3PSI A;  3WNG A;  1IBK K;  3QFP A;  2HND A;  3AO3 A;  1IG8 A;  1D8Y A;  3K58 A;  4FOI A;  3TR8 A;  3VQP A;  1LAW A;  2Z1H A;  4GMJ B;  1Q9X A;  2ZJQ L;  1OVQ A;  4CFA A;  2VWJ A;  3KIO A;  2ATQ A;  4RW9 A;  2KFZ A;  1YUW A;  1HYV A;  4WQ5 A;  3M1F A;  1U2V B;  4KI4 A;  3K59 A;  3F9K A;  1BCM A;  3T3F A;  1XHZ A;  1ESV A;  2D0A A;  3I8B A;  1QSL A;  1GOC A;  4PHT X;  2GV9 A;  1ITG A;  3KD1 E;  1TUU A;  3ZYY X;  3SQ1 A;  3VGM A;  3IS9 A;  3RR7 A;  2IDO A;  3DXM B;  4LF4 K;  1WNS A;  4DTO A;  1DGK N;  4K43 A;  5AQR A;  3RMC A;  5AQG A;  1KTQ A;  4MDA A;  4ELT A;  1W97 L;  1T7P A;  4YY3 K;  1VQM N;  1A5W A;  4JI7 K;  3CM6 A;  4ILJ A;  3CCS N;  3OHR A;  1NK9 A;  4MO4 A;  4KV8 A;  3G0Z A;  1KVB A;  2QKB A;  3K9J A;  1GLA G;  1BA1 A;  1OH5 A;  3KWI A;  3H46 O;  2W40 A;  5F0X A;  1IKY A;  5LMU K;  4NXN K;  2QWN A;  3QO9 A;  2HHQ A;  2D0C A;  3WNE A;  4L3Q A;  1DTT A;  3MWT A;  2VWB A;  1YVU A;  4JKB A;  2G8V A;  4B1W B;  4JK9 A;  1N34 K;  1HNX K;  3NGZ A;  4CHP A;  1KVA A;  4LFC K;  2P5O A;  2HBJ A;  2Q97 A;  3SJJ A;  4GY2 B;  3KLG A;  4DTR A;  5AQT A;  4FWR A;  5SWM A;  1VSF A;  1S22 A;  2X74 A;  3MX5 A;  1NK0 A;  4IEI A;  3KHY A;  4GVE A;  3THY B;  3DYA A;  5TKY A;  3ZSR A;  5M1N A;  4C8O A;  1CZA N;  1M1K O;  2OTJ N;  2P5G A;  2OZS A;  3LAN A;  4FWM A;  3WXI A;  2X6S A;  3QER A;  2HHH K;  2O8E B;  3HI0 A;  3AVB A;  3AA5 X;  4BRQ A;  4KRF A;  3R8E A;  4XH5 A;  3JSM A;  1HKC A;  2OPS A;  4RW7 A;  4CF9 A;  4DMN A;  4M7Y A;  4N47 A;  1X9W A;  2A42 A;  3SYZ A;  2KZZ A;  4ILH A;  1RTI A;  3JS6 A;  3TSP A;  5AQM A;  1NOZ A;  2D1K A;  2QWR A;  4A62 A;  4DS4 A;  4Z4I A;  4PWD A;  4EIA A;  3THW B;  4H0V B;  4CGG A;  3SV3 A;  1HQU A;  3CC4 N;  1HNW K;  3QEV A;  4WFA L;  4KBO A;  3AGR A;  1FJG K;  4GKJ K;  1BCO A;  5C2F A;  4Z4E A;  3CET A;  2I7N A;  1BIZ A;  1L3V A;  3QEX A;  1E3M A;  2JGU A;  1XMQ K;  3SZ2 A;  4FO0 A;  3D2F A;  3B6P A;  4OPH A;  2QTD A;  5HRS A;  4F3T A;  3MMV A;  4WQ4 C;  1W2B M;  2P9S A;  1QQO A;  4DV5 K;  4CGI A;  4GNI A;  1HKG A;  1YAG A;  3RSE B;  4E89 A;  2E2P A;  1RT2 A;  1SUQ A;  3OYI A;  1VK0 A;  4ICL A;  2NNW A;  2NRW A;  3ZSO A;  4DTX A;  3D45 A;  3FZH A;  1VQ4 N;  3MK6 A;  3VEN A;  5FRO A;  3O9Q A;  3HVT A;  1XNR K;  4A5B A;  2V52 B;  4O0J A; 
#chains in the Genus database with same CATH homology
 3TAR A;  3CFO A;  3L2V A;  1I3A A;  2OPP A;  4OJR A;  2YHB A;  2QXF A;  4FJ5 A;  3C6U A;  1GOA A;  3V1O A;  3BGR A;  4ID1 A;  3SPY A;  4FJK A;  4LSN A;  1J54 A;  4C8L A;  2Q3S A;  3DLE A;  4CHO A;  2O4I A;  3VQ5 A;  1Z25 A;  1GOB A;  4CGD A;  1KLN A;  3KKR A;  4OPK A;  1JXE A;  4LD0 A;  3NH2 A;  1NJY A;  5FRM A;  1IG9 A;  2B5J A;  1VSI A;  3M8Q A;  3AA3 A;  3ZT4 A;  1KCF A;  4B9L A;  1C0M A;  1TKD A;  3HPG A;  1WSI A;  4O55 A;  3OS0 A;  3VQE A;  2Z1I A;  3FFI A;  4AHT A;  1LW2 A;  4Q5V A;  3E01 A;  3AVC A;  4DTU A;  1WSE A;  3VQQ A;  3LWM A;  1RT1 A;  4IBN A;  5HRO A;  3ZSQ A;  2HMI A;  4J2E A;  3ITH A;  3L2R A;  2HNY A;  3QNO A;  3S3N A;  4AHU A;  1JLG A;  5HLF A;  2HHX A;  1WSG A;  4FK2 A;  3AA2 A;  4BDZ A;  2XY8 A;  2EX3 A;  4AHR A;  2B4J A;  3G10 A;  4KO0 A;  4AH9 A;  3LAK A;  3OS2 A;  1QTM A;  2OA8 A;  4PA1 A;  1TKT A;  4CHZ A;  1REV A;  1LV5 A;  4DS5 A;  4BDP A;  4BE0 A;  4OPJ A;  1LWC A;  3DRR A;  2YNI A;  3CYM A;  3V9U A;  4FZY A;  4CEZ A;  3AVK A;  3RMB A;  3I0S A;  1S5J A;  4DTP A;  4KB0 A;  1RTD A;  5CYM A;  4CJT A;  1CLQ A;  4CES A;  1C6V A;  3LZJ A;  4F2R A;  1UAX A;  1JL2 A;  3L3U A;  1WLJ A;  3OY9 A;  1L5U A;  4OVL A;  3QEP A;  3OYG A;  1IH7 A;  1NK6 A;  4N76 A;  4O44 A;  4BE1 A;  1O1W A;  2RPI A;  4E19 A;  3WNF A;  3LAM A;  3SQ2 A;  1RBV A;  3AVF A;  2YNG A;  4Z4H A;  3V9S A;  5HP1 A;  3LP3 A;  4F8R A;  4K8Z A;  1FKO A;  3SPZ A;  1N6Q A;  3QIO A;  3M8S A;  3NAE A;  4JS4 A;  2YV0 X;  2XHB A;  4M3Y A;  1QQC A;  3WNH A;  1TL1 A;  4JLH A;  1TL3 A;  3IAY A;  3S3M A;  1ZBF A;  3QNN A;  4CK1 A;  4M45 A;  4DQR A;  1S1T A;  3SNN A;  4KRE A;  2E4L A;  1RTJ A;  3HJF A;  3JYT A;  2JLE A;  1SKR A;  3DLB A;  3KK1 A;  4OKJ A;  1J9A A;  5D3G A;  5JS1 A;  3T19 A;  2DFF A;  3TAG A;  3V9Z A;  1X9S A;  3LP0 A;  3HP9 A;  3OJS A;  3VQ6 A;  5EU7 A;  1RT4 A;  3HPH A;  1JLB A;  4Z4C A;  3LZI A;  3HK2 A;  4FJL A;  3IRX A;  3ZT3 A;  4CHY A;  2FC0 A;  2A1S A;  1DLO A;  1SV5 A;  3DLR A;  4H8K A;  4KTZ A;  4N41 A;  3DM2 A;  3V9W A;  2HHU A;  1LAV A;  3KLH A;  1A5V A;  1KVC A;  4IG0 A;  2YKN A;  4LH4 A;  4RW6 A;  1BL3 A;  1MU2 A;  2BDP A;  4CJ4 A;  3PX0 A;  4B9U A;  3OYF A;  2G8H A;  3ZT2 A;  1U49 A;  1IKW A;  3BDP A;  4LH5 A;  3TAE A;  4W5O A;  4B9V A;  4QOZ B;  1RT3 A;  1QSY A;  4B9S A;  3MED A;  3VQ9 A;  4KFB A;  1BI4 B;  4CGF A;  3SQ4 A;  1SKS A;  1NOY A;  4M3Z A;  1ZYQ A;  4CJL A;  4B8C A;  3TWH A;  3DOK A;  3NH1 A;  4OLA A;  3UIQ A;  1F21 A;  1HNV A;  4XIU A;  2XO7 A;  5HBM A;  3OYJ A;  3OYN A;  1L3S A;  1ASW A;  5I3U A;  3QLH A;  1S1X A;  4GW6 A;  3NGI A;  5KRT A;  4CFB A;  3LPT A;  1U47 A;  4HUE A;  1TK0 A;  2Z1J A;  1CXU A;  4F2S A;  2IAJ A;  1EXQ A;  1BQM A;  4W5N A;  3SI6 A;  4DSI A;  3K5M A;  3TAM A;  4B9M A;  4CEC A;  4C8K A;  2HHV A;  5J2Q A;  4BWM A;  2E6M A;  1D5A A;  5I42 A;  1XI1 A;  1VSD A;  1TV6 A;  2X6N A;  2G8K A;  1VSE A;  3V9X A;  3KD5 E;  3L2U A;  1RTH A;  1SKW A;  2YNF A;  1LWF A;  4YFU A;  4KHU A;  1RCH A;  4M3R A;  3VQC A;  3IG1 A;  3ZSX A;  1RBR A;  3TAP A;  2VWK A;  1NKC A;  4KHS A;  4I7F A;  5KGW A;  3HO1 A;  3PO4 A;  1S1V A;  4FCY A;  1RT7 A;  3K57 A;  2G8U A;  1JL1 A;  1LW0 A;  1C0T A;  3HM9 A;  3C94 A;  3M8R A;  4E0D A;  1QS4 A;  4NYF A;  4B9N A;  2VG7 A;  3PX4 A;  4O4G A;  3SUP A;  1IKV A;  2HHT A;  4JS5 A;  3NFA A;  3MEC A;  1B92 A;  3DOL A;  4J2B A;  1CZB A;  1BQN A;  1UA1 A;  2X78 A;  5CZ1 A;  3L2W A;  2R7Y A;  3P5J A;  3SUN A;  3DRS A;  1WSH A;  4FJJ A;  4DF8 A;  4HCB A;  3EY1 A;  2VG5 A;  4NCG A;  3ZT1 A;  3VA0 A;  1NK5 A;  4KKO A;  3TAN A;  2IOC A;  3RMA A;  4CK3 A;  4DFP A;  4L8R B;  4KHW A;  1DTQ A;  1HJR A;  3ZSV A;  5J2P A;  1KFS A;  1D9F A;  3QIN A;  4EP4 A;  3PO5 A;  4FJ9 A;  1Q8I A;  1ASV A;  4FM0 A;  3O4Q A;  3F73 A;  5DMR A;  4DWI A;  3AVN A;  2ZE2 A;  1VSJ A;  4CE9 A;  3U6F A;  4DU4 A;  1NKE A;  5CZ2 A;  4DTN A;  2P1J A;  2GBZ A;  4J2A A;  3RR8 A;  4J2D A;  2IGI A;  1TKX A;  3PUF A;  3OYM A;  4YNQ A;  2RKI A;  4I9Q A;  2G8I A;  3NHG A;  1BIS A;  1EET A;  3KK2 A;  3MXI A;  2HW3 A;  3A2F A;  3NF7 A;  4DLG A;  1C1A A;  3RMD A;  1RDD A;  1XC9 A;  4I2Q A;  3NF9 A;  4UQG A;  4FJN A;  1TK5 A;  3RRG A;  1QE1 A;  1S6P A;  3HYF A;  3CQ8 A;  3DI6 A;  4CJV A;  4NCA A;  1HRH A;  5T7B A;  3ASM A;  4KB1 A;  4K8X A;  4FK4 A;  1JLC A;  1NK4 A;  5HRP A;  4CFC A;  3NH0 A;  4HUF A;  3V6D A;  1J53 A;  3OS1 A;  2FBY A;  3LAL A;  3K2P A;  3O4N A;  3CFP A;  5FDL A;  4FJI A;  4M3W A;  4H4O A;  1WN7 A;  4LSL A;  3AVI A;  4Y1C A;  4EZ6 A;  1Y97 A;  3OYL A;  1RBT A;  4DSE A;  1UOC A;  4E1M A;  3AO5 A;  3VA3 A;  1VSL A;  3DRP A;  3KKS A;  4CEE A;  1NJZ A;  2KZM A;  1LWE A;  1NKB A;  1CXQ A;  4F4K A;  2HB5 A;  4OKE A;  4RW4 A;  4EP5 A;  3KTQ A;  4W5Q A;  2PZS A;  4M41 A;  1WAJ A;  2XY7 A;  1BHL A;  1X9M A;  1KSP A;  4M3T A;  3NF8 A;  4NCB A;  3O3G A;  1BGX T;  4O0I A;  1W9H A;  4BWJ A;  3SUQ A;  1S1W A;  5CY4 A;  5DK5 A;  1HYZ A;  1RT6 A;  3LP2 A;  3TAB A;  3VQB A;  4C8M A;  2HVI A;  2IC3 A;  1HQE A;  4QAG A;  2XY6 A;  4FVM A;  1B9F A;  1JLE A;  1ZBH A;  3RWU A;  3TAQ A;  3LWL A;  2D5R A;  2NUB A;  3AO4 A;  3AVM A;  3HST B;  4NYN A;  2HHS A;  1S9E A;  4IG3 A;  3NE6 A;  2QK9 A;  4KHQ A;  4AHV A;  3MEE A;  2OYQ A;  4CEF A;  1U45 A;  5E41 A;  3O3F A;  4MQ3 A;  4FLU A;  1YTA A;  3AV9 A;  3M8P A;  1U4B A;  4CJ3 A;  3O3H A;  3RTV A;  4FJG A;  1KFD A;  3HPO A;  3HVR A;  3PY8 A;  1UWB A;  4ELU A;  3ZSZ A;  4PUO A;  4ELV A;  4BDY A;  2ZD1 A;  3MXJ A;  4CJF A;  4FLX A;  3AVJ A;  4C8N A;  2EHG A;  4DTS A;  2LSN A;  4DF4 A;  4Q0B A;  4AHC A;  3QEI A;  2FBX A;  3VQD A;  3K5L A;  4ID5 A;  1BI4 A;  4ZTF A;  3AVH A;  4FM1 A;  4E7K A;  5CYQ A;  4DTM A;  3TAF A;  3L2Q A;  2WOM A;  4M42 A;  3CM5 A;  4WE1 A;  4DSF A;  1EKE A;  4CF0 A;  3B6O A;  4CJK A;  3OYA A;  3HT3 A;  2F8T A;  3OYB A;  2PYL A;  4DSL A;  4FXD A;  3WNG A;  1SL2 A;  2HND A;  1ZBL A;  3AO3 A;  3KK3 A;  1TVR A;  1D8Y A;  3KLF A;  3K58 A;  3OYK A;  4HTU A;  2RF2 A;  1XHZ A;  3TR8 A;  3AVA A;  1LAW A;  3VQP A;  2E6L A;  2Z1H A;  4GMJ B;  5JS2 A;  5KRS A;  4E3S A;  1Q9X A;  4FJ8 A;  1NJW A;  4CIG A;  2VWJ A;  4CFA A;  3U3Y A;  3KIO A;  2ATQ A;  5J1E A;  3K5O A;  2YNH A;  4RW9 A;  4B08 A;  4E7J A;  4FJ7 A;  1HYV A;  1ZBI A;  2KFZ A;  4I9L A;  2HVH A;  1JLQ A;  4FZZ A;  1EX4 A;  3T1A A;  3EYZ A;  3SQ0 A;  4KI4 A;  2G8F A;  4CIE A;  1C1C A;  1JLA A;  4CCH A;  1J5O A;  1VSM A;  2BE2 A;  2B6A A;  4EZ9 A;  3K59 A;  3F9K A;  4FJX A;  1BCM A;  3L3V A;  3EZ5 A;  2IS3 A;  3V1R A;  3LP1 A;  4IFY A;  4DLE A;  1B9D A;  4FLY A;  4IFV A;  3T3F A;  2D0A A;  1QSL A;  3DLG A;  4F3O A;  4Y1D A;  5FRN A;  2HHW A;  1GOC A;  2GV9 A;  1YTU A;  1QSS A;  1G15 A;  1ITG A;  2VG6 A;  1NK7 A;  3KD1 E;  1NK8 A;  3PV8 A;  4CJ5 A;  3SQ1 A;  4DSK A;  3KJV A;  3IS9 A;  3RR7 A;  4FJM A;  4LY7 A;  2IDO A;  1WNS A;  4DTO A;  3KLI A;  2KTQ A;  3AVG A;  4CF8 A;  3RMC A;  4BE2 A;  1KTQ A;  3S3O A;  2I5J A;  1FKP A;  4ELT A;  1HPZ A;  4M3U A;  4CJW A;  2ITG A;  3SV4 A;  1T7P A;  1RBU A;  3HXM A;  1A5W A;  3AO1 A;  3ZCM A;  3ZT0 A;  3PX6 A;  3ZSY A;  4CK2 A;  2Y1I A;  1ASU A;  1XHX A;  1HYS A;  3CM6 A;  3QIP A;  4OGE A;  4CGJ A;  4CJS A;  1NK9 A;  3VN5 A;  3K5N A;  4HUG A;  3NF6 A;  4W5R A;  2DTU A;  3V1Q A;  1RBS A;  4FLW A;  2HNZ A;  1UA0 A;  1U48 A;  1Z26 A;  3G0Z A;  4KV8 A;  3KLE A;  1TAU A;  1KVB A;  2OZM A;  1JLF A;  2QKB A;  2PY5 A;  2OPQ A;  4CF2 A;  2Y1J A;  4CJU A;  4KAZ A;  2AJQ A;  3S9H A;  1VSH A;  1IKY A;  1A5X A;  3CG7 A;  4E7L A;  3SUO A;  2KFN A;  4ZHR A;  3DLK A;  3QO9 A;  4CJE A;  1KLM A;  3AVL A;  1R0A A;  1L3T A;  2HHQ A;  2D0C A;  1S6Q A;  3WNE A;  1DTT A;  4IKF A;  4B9T A;  4KHY A;  5C24 A;  2KW4 A;  1YVU A;  1HMV A;  2GUI A;  1CZ9 A;  1FXX A;  2FBV A;  3ZSW A;  4DQQ A;  4DFK A;  2XY5 A;  2G8V A;  5KTQ A;  3NGZ A;  1I39 A;  3LPU A;  4CHP A;  4DU1 A;  1KVA A;  3VQA A;  4N56 A;  5J2N A;  3SCX A;  2P5O A;  1S1U A;  4PQU A;  4CEO A;  3SJJ A;  4DFM A;  4DTR A;  5KI6 A;  3KLG A;  4DQP A;  4DQI A;  1C0U A;  1RDB A;  1IKX A;  1EP4 A;  4DSJ A;  1FK9 A;  1VSK A;  4RG8 A;  5SWM A;  2A1R A;  1VSF A;  5K14 A;  4FW1 A;  4KI6 A;  2X74 A;  4E7I A;  1NK0 A;  3DYA A;  1ZBU A;  2DFH A;  4JRP A;  1W0H A;  3ZSR A;  4CER A;  3D0P A;  4CGH A;  4C8O A;  3AA4 A;  4CEB A;  4FLT A;  2QKK A;  5SZT A;  2P5G A;  2OZS A;  4B3O A;  3LAN A;  1T05 A;  3HP6 A;  2ZQB A;  4ZTJ A;  4TSX A;  2PYJ A;  1JKH A;  1QHT A;  2X6S A;  3QER A;  1WAF A;  4OKK A;  4FK0 A;  4Z4G A;  2WON A;  3AA5 X;  3AVB A;  4KRF A;  3V81 A;  3C95 A;  4FM2 A;  3JSM A;  2OPS A;  4RW7 A;  3MXM A;  5C42 A;  4CF9 A;  4DMN A;  4HCC A;  4IDK A;  1JXB A;  1RT5 A;  4GVM A;  4N47 A;  4DTJ A;  1X9W A;  1D9D A;  4PY5 A;  3P83 D;  4QCL A;  1NJX A;  1K6Y A;  4CJR A;  3SYZ A;  3V4I A;  4KHN A;  3VQ4 A;  1RDA A;  4Z4F A;  2XRI A;  4PWD A;  4B8A B;  2G8W A;  4CHN A;  2KZZ A;  3HL8 A;  1RNH A;  4CJP A;  3L8B A;  1T8E A;  4FJH A;  1RTI A;  1RIL A;  4CED A;  1TGO A;  4CEQ A;  1NOZ A;  4JRQ A;  4CHQ A;  4DS4 A;  1TKZ A;  4KTQ A;  4Z4I A;  1KRP A;  1WSJ A;  3OYC A;  1YT3 A;  4CGG A;  3I0R A;  4FLZ A;  3SV3 A;  1HQU A;  2KQ2 A;  4AIL C;  1T03 A;  3H08 A;  3QEV A;  2DY4 A;  1L3U A;  3ALY A;  1XWL A;  4M3X A;  2Z1G A;  5KGX A;  3DLH A;  1SL0 A;  4MFB A;  4W5T A;  1BCO A;  4HHT A;  4KPY A;  4R5P A;  4Z4E A;  1IO2 A;  3U3G A;  1VRT A;  1BIZ A;  1L3V A;  3QEX A;  4I2P A;  2JGU A;  4E7H A;  3MEG A;  3SZ2 A;  3P1G A;  3OJU A;  3MAQ A;  1TK8 A;  5J2M A;  3B6P A;  2O4G A;  4CIF A;  2YHA A;  4DQS A;  5HRS A;  4HVJ A;  4H4M A;  4FYD A;  4F3T A;  3QEW A;  3AO2 A;  2BAN A;  2RN2 A;  1VRU A;  4O5B A;  3VQ7 A;  3OYE A;  3C6T A;  2YKM A;  3VQ8 A;  3DMJ A;  3ISN C;  4CGI A;  4E1N A;  1N5Y A;  3QES A;  1SL1 A;  1HNI A;  4CJQ A;  4Z0U A;  5HRN A;  3TI0 A;  1X1P A;  4RW8 A;  2P51 A;  4OLB A;  2W42 A;  3OYH A;  1RDC A;  4CF1 A;  4FLV A;  3NCI A;  4E89 A;  3LDS A;  3OYD A;  2D0B A;  3RRH A;  1RT2 A;  2F96 A;  3NBP A;  4OGC A;  1SUQ A;  4KTW A;  4CFD A;  4N5S A;  4BAC A;  1Q9Y A;  1C1B A;  3OYI A;  1TAQ A;  1S9G A;  1VK0 A;  3NDK A;  4CEA A;  4FW2 A;  4DG1 A;  3QET A;  3ULD A;  4ICL A;  2F8S A;  3CFR A;  2BGG A;  2FBT A;  3I8D A;  3ZSO A;  2ETJ A;  4DTX A;  1WSF A;  3D45 A;  3OVN A;  4DU3 A;  4DFJ A;  1U04 A;  5C25 A;  5HRR A;  5FRO A;  4G1Q A;  3HVT A;  2OPR A;  4AHS A;  1BIU A;  3THV A;  2DFE A;  4FZX C;  4O0J A;  3NGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...