4MQ6A

Pantothenate synthase in complex with 2-(5-methoxy-2-(tosylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mq6A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mq6A01
4MQ6A 3L92A 3ZJVA 2A86A 3IVGA 3MUEA 3FOCA 3GUZA 4FZJA 1N3LA 5BNZA 1MOPA 4HJXA 1O95C 1UFVA 4U63A 3AG6A 2CYCA 4ZCSA 3UOWA 2OV4A 4RUKA 3RHSA 2DERA 4MUKA 3G6KA 2CYBA 2QTNA 2NZ2A 3FI0A 3SEQA 1WXGA 1OWOA 3CVVA 3VU8A 4MW1A 4KKVA 3L93A 4MW7A 2DETA 5FO1A 1ULHA 1N2EA 3F3MA 3MXTA 1OBCA 3GLVA 1LI7A 2AKEA 3M5WA 4DE5A 2X0KA 4MW6A 4DDHA 4X0EA 1GTSA 1WXEA 1I6LA 5EKDA 3IH5A 4WNYA 2Z3VA 1XNHA 4KPUA 3ZUGA 3Q12A 5HG0A 1U7DA 2CSXA 4JZYA 4EG8A 1EFVB 1MBZA 4U8HA 3N8HA 5AHWA 1MAUA 3N2YA 1FFYA 2DEUA 3A4IA 1Q11A 1HYBA 3IMCA 1PFWA 3ZJUA 1EXDA 5K0TA 4DNXA 3VRHA 3COWA 1N1DA 1U3CA 4GRIA 3G5AA 4JXZA 1KQPA 1TQ8A 3UMVA 3U1VA 1N2BA 3COZA 4MUJA 1U7XA 3KT6A 4EGAA 4NDAA 4Q16A 3FY4A 2O8VA 1G8FA 4ARCA 1IFXA 2DUMA 2QUIA 3VGJA 4KR6A 2QJFA 3X1JA 4EG5A 1M8GA 1A8HA 1EFPA 1NUTA 5H16A 2C5SA 3RJZA 1Q77A 1B6TA 3Q10A 4G5YA 5KCMA 4YP5A 2VXOA 4E1AA 3DV2A 5IJXA 1J1ZA 1X6VA 3CLSD 3N05A 4OUDA 1EE1A 3IMGA 1OWMA 5TEWA 3FNRA 3H97A 3FH0A 1CT9A 5LM3A 1JECA 4EG6A 1KH3A 2CYAA 3FHJA 3IUEA 2A1UA 5JBNA 4MW5A 4ZT3A 4MLPA 1H1TA 3UK2A 1O0CA 1M8PA 1O97D 2IELA 1NUSA 4QBTA 5DK4A 5FNZA 5LFAA 4PBTA 2PIDA 1R6XA 4F4HA 4AQ7A 3ELBA 4ZT5A 4MULA 3HZRA 2A4MA 1MB9A 4NATA 3K9WA 1RQGA 4MW4A 1WQ3A 1VBNA 1TFUA 1XJQA 1IRXA 4L2IB 1Q15A 1LI5A 1QTQA 1YIAA 2E21A 1U0BB 2PZAA 3FG9A 2J08A 3DLAA 1F7UA 2DR2A 5HUJA 2EJCA 2J5BA 1G8HA 4ZCTA 4DDKA 2O5RA 5DB4A 2DXIA 2DLCX 1OWLA 1JEEA 1G59A 3CLRD 3ZXIA 3H9CA 4P2BA 1EUQA 1NUQA 3SDBA 4A91A 1PFVA 1KR2A 5HUHA 1M1ZA 2PG3A 3HMQA 3FETA 2G36A 2GKSA 2YXNA 1QU3A 2IJGX 4MUEA 3TZEA 4Q93A 2GM3A 1ZUNA 1P7PA 1VBKA 4DJAA 1PG0A 2ZUFA 2VTBA 4TS1A 3OP1A 4UZEA 4ND6A 2XRZA 4MWBA 2YWCA 3RK0A 1NSYA 1WKBA 4WSOA 4EG4A 1JIKA 2QTMA 2QUKA 4NAUA 4NZPA 4PBSA 1O94D 1I6KA 5DEOA 1H3EA 1U3DA 4DDMA 1F4LA 4DLPA 5TGTA 3COYA 3QTTA 1GPMA 1M8FA 4YBRA 1YI8A 5TS2A 4H3SA 2WQ6A 3COVA 4MWDA 2WSIA 1MJHA 4MVXA 4AS1A 3HL4A 5KWVA 3SP1A 1O0BA 5H7XA 3CA8A 4MW9A 4ZT6A 1TEZA 2BYTA 1KAMA 5DASA 3CVUA 4QREA 3JXEA 3D6VA 1VLHA 1F7VA 3HV0A 5KHAA 3HGMA 1JIIA 3PNYA 3X1KA 2JANA 1V8FA 1QU2A 3CLTD 2IP1A 1WZ2A 3AFHA 3CLSC 4GU5A 1ZJWA 3TZLA 1K97A 2AG6A 3ND7A 2CUZA 2EL7A 3E27A 1FYDA 3IVCA 4EG3A 3LE8A 1NUPA 4KR9A 1S4MA 1GTRA 3INNA 3PXUA 1O97C 2YWBA 1JZQA 1EFVA 2TS1A 2ZUEA 4MUFA 1OWPA 1EUYA 2A88A 2ZP1A 3K32A 1J1UA 3SZ3A 1YUNA 5J58A 2JAXA 4R2LA 2WQ7A 3ND6A 1N2HA 1N2JA 1R6UA 1NUUA 1XNJA 3NBAA 4J76A 1ZH0A 1QJCA 4OUDB 4EG1A 4HK4A 3QE4A 3OTWA 4MVCA 1J21A 1WOYA 3CLUD 3G59A 2A1TR 2D54A 3CLRC 4MW0A 2V0GA 1IVSA 3SEZA 1EJ2A 1JZSA 3NV7A 1JHDA 4EG7A 3X1MA 3N9IA 1I2DA 3KFLA 3FWKA 1JMVA 2HGZA 1JIJA 1JEDA 3SZGA 4MUHA 1QNFA 4ZCRA 4ZT4A 1O96B 4R0NA 4ZT2A 1M8KA 1X8XA 2R5WA 1O94C 2CFOA 3ZJTA 1KKUA 2CT8A 1T9GS 4ARIA 5F23A 2CV2A 3NBKA 2XRYA 3H05A 3KT0A 1F9AA 3P52A 4YMIA 1IQRA 1O6BA 3TNJA 4ZT7A 3CVWA 4MUGA 3SYTA 2PFSA 4PY2A 1TYBE 2X1LA 1N78A 2PXHA 2X1MA 3AG5A 3H99A 5K0SA 5J59A 2NSYA 3DPIA 1VL2A 2H2AA 3CVYA 4L2IA 3IOBA 1PFYA 3LCJA 1N77A 1LW7A 1OWNA 2A1TS 3I05A 2V0CA 1PG2A 3ISJA 3CLTC 4MAFA 1N2IA 1H3NA 1QRSA 3IOEA 1V47A 3P0IA 2HZ7A 3PNBA 3TQOA 1GZUA 1NURA 2E0IA 4G6ZA 3AKZA 3IODA 5FO0A 2QUJA 1NYLA 1NP7A 1KP2A 3RBAA 2AZXA 2BTEA 3CVXA 3RK1A 2RD2A 1JGTA 3PRHA 4MWEA 4QRDA 1WXHA 3BL5A 3P0HA 1XNGA 1K4MA 1MRZA 5IHXA 3A04A 3MLAA 4I6JA 4CQNA 1TYCA 3IOCA 2D13A 2QJOA 2DPLA 2CV1A 1O5TA 4KPUB 1YULA 4OJMX 4PBRA 4MW2A 1JILA 1T6ZA 3RFFA 5TEVA 1KQOA 1TYAE 1IQUA 1I6MA 1M83A 4F3RA 1ILEA 3S3TA 4K03A 1IQ0A 1Q19A 1MAWA 1KORA 3FIUA 1BS2A 4J75A 1DNPA 2PZ8A 2QUHA 2D5BA 4MVWA 1K4KA 3CLUC 3ZIUA 4MUIA 1H3FA 3PNVA 1PFUA 1N2OA 3Q4GA 3TS1A 2J4DA 4JXXA 1N2GA 1O95D 1YUMA 4ZCQA 3A2KA 1T9GR 5LLTA 2Z09A 1KH2A 4G5FA 3ZGZA 1WXIA 1EFPB 1WY5A 3GMIA 5J5AA 1IHOA 2Z08A 3UC5A 1J70A 2YY5A 3MLBA 4CDNA 1K92A 2E18A 4CT0A 4XFJA 4KR7A 3ILVA 4EFKA 1OD6A 1QRTA 3KT3A 4HPWA 3IUBA 2A7XA 3P0JA 4EF6A 1TYDE 1QRUA 4JYZA 1GAXA 3IVXA 4ND7A 1WXFA 2H29A 4K0RA 3ZXSA 3QTBA 2A1UB 1KQNA 2RE8A 3IMEA 1GN8A 1OBHA 3KT8A 1NI5A 3CR8A 1J09A 4I6GA 1J20A 1QQTA 4XSVA 1KP3A 4NX2A 1VBMA 4RPIA 4NAHA 2JA2A 2QJTA 3LOQA 4CDMA 1WQ4A 3UY4A 1YIDA 4HJRA 3C8ZA 2A84A 1T6XA 1NZJA 2B7LA 2X3FA 2GOYA 3AL0C 4MUNA 3DO8A 2CV0A 1COZA 2I1LA 2E89A 4YP7A 3H9BA 1N75A 4YP6A 2HMAA 4MVYA 4XFDA 2J07A 3MMXA 1M8JA 1G8GA 1IH8A 1KAQA 4S1OA 3IDFA 4JFAA 1KH1A 1MB2A 1R6TA 1WJGA 2PZBA 4U7JA 4BWVA 2WB2A 4I6EA 4MWCA 3AIIA 3ND5A 1Y42X 2QTRA 3FDXA 3HFJA 4UZFA 1SURA 2OQ2A 1O96A 3A05A 4R2MA 1D2RA 1GLNA 3TQIA 1T6YA 2VTBB 1ZH6A 3D6UA 2J09A 1MC1A 4ZCPA
chains in the Genus database with same CATH superfamily
3UA0A 1IY1A 2BV3A 1SXQA 2J59A 4EF5A 3C3AA 2D2IA 4FS8A 1F0NA 2V5UA 4GM1A 3WOVA 1G98A 4L57A 9LDTA 1JFLA 4MV8A 2A86A 4UHKA 3T94A 3H1FA 2VJCA 1KY3A 2I76A 2OWDA 3OY7A 4J07A 1AKQA 4JEMA 4WZAA 3OIWA 4R2IA 3DWFA 1OXUA 3GI1A 2YWRA 4GMGA 8LDHA 5FUVA 1Y7IA 4INOA 3K6RA 1RBQA 4TMWA 1UEJA 4I3GA 3FIJA 1E61A 4UU7A 3JQAB 5E6UB 4LXYA 4NJEA 4KXWA 3SJCA 1UK6A 1JHYA 2O2XA 2P30A 2P0AA 1Q0QA 1NW6A 1J0CA 1J6UA 5D3MA 1DKRA 3LQ2A 4YJGB 5J2UA 2V3CC 4DEXA 1MX3A 1L3IA 2O50A 4MUKA 4FOLA 4NOJA 3AUSA 3FI0A 1NL3A 1G55A 3RR2A 5JPDA 1OWOA 1PGNA 4O59O 1G8AA 3C74A 8ADHA 3KL4A 4Z0PA 1V41E 3DWGA 2Q4OA 3PXEA 1X7YB 3F3MA 4FFLA 1R0RE 4LRYA 4URYR 5A3VA 3T54A 4BIMA 1DS6A 1RYEA 2OCIA 4ALNA 4AZ3A 4F38A 1OBCA 3W05A 5F2OA 2C2YA 1BX0A 4N8DA 3T7CA 3K6SB 1XRSB 4BLRA 3EOAI 3PB3A 3Q88A 5JJCA 2G16A 4DRYA 2P6RA 3LWZA 4UDNA 4MIYA 2CXUA 4EQ6A 3LFUA 3E1SA 4X0EA 5FOUA 5F7OA 1MF7A 3O31A 2Q6VA 4HAIA 1VLZA 4EHKA 1O87A 3MJTA 4IKEA 2JVIA 1S8AA 4IG4A 4LRTB 4BO2A 2YCBA 3D8RA 2DG2A 2Q0HA 4UUAA 5HG0A 3NPMA 2NU9B 4XM0A 1DPFA 1SCQA 3I52A 3NHZA 4IIJF 2IW1A 3Q3IA 4LVUA 1BEEA 3AEYA 4X6LA 1LCIA 1XVLA 3KPJA 1QIMA 1XHFA 3BL6A 2B92A 1SQ5A 4QECA 3UN1A 1H0HA 1THGA 2B69A 2XWJI 3WHIA 1ULAA 4KAJA 4OQEA 1UMBA 4JXJA 3LPCA 1I4DD 2RB5A 5MGBA 3OWXA 4DJDC 2XNCA 2H7XA 4CIYA 3F7NA 2ZYUX 3KZNA 5IT5A 5BR7A 4RW0A 4CEHB 1F8GA 4HATA 1OAAA 1PR3A 1XELA 2EVWX 3N3AC 4LC0A 3RYFA 3ROKA 4EEZA 2HMTA 1T3TA 1HI9A 3E2IA 1T1RA 1DFGA 1T9KA 1XB2A 4L4SA 1OH8A 5DT2A 4HY3A 4UVIA 2XCQA 1W0JD 1GL9B 2E4XA 4L16A 2VQFB 5LXTA 2C5SA 4LOHA 2V3VA 3RJZA 2CKMA 2EJVA 2QPOA 1M1YE 2R1UA 4XR9A 4QNRA 2W7TA 4QASA 1H66A 2WSYB 4GXTA 4YMTA 2VXOA 1WZUA 3L18A 1K6EA 2P3LA 3A25A 3GMDA 3W2GA 3H9QA 3WGJA 3K09A 1C0EA 3ZNOA 4GBMA 1KRWA 3QWBA 4MJXA 2IEBA 1EUDB 1YOBA 4P7KA 3QWIA 1IHUA 5CU7A 4RYLA 4OYYA 1M2GA 1XYGA 1KZ7B 1VG1A 3H97A 2PSHA 5CYPA 3D02A 3DLCA 4EG6A 4UREA 3OY2A 1KH3A 1IMOA 1XPRA 3KYCB 4K9OA 3Q0IA 3ZWKA 2WOJA 4NNOA 2V5VA 3U7GA 5JAOA 2IXTA 4E15A 4C5CA 4PAWA 1TI7A 1M7GA 3JATA 1P73A 1YBFA 4LI0A 1S2DA 4DQXA 4QE3A 5JAIA 5DP1A 4XRRA 5KWJA 2AHRA 2F8TA 1H22A 3ZDDA 1AF7A 4HMPA 1PHRA 2KQUA 5KKNB 1WMFA 4EJ2A 3QUAA 5SY9A 4ZOQI 4Q7EA 3M34A 1XLVA 1H5UA 2XODA 2ACWA 2JRLA 1VPLA 2JIQA 1FTQA 3LGSA 1PHPA 4UUQA 1V9SA 4JDUA 4KQEA 1Q15A 3T9DA 2E21A 3HJUA 3FNFA 4DYVA 2PZAA 5JSZA 4Y6QA 4WFIA 4YMLA 2JLXA 1KJQA 5EIAA 3BCHA 1CZNA 2XLBA 1UT5A 2OCPA 3LECA 1SQ0A 2POQX 3O75A 2EJCA 2J5BA 1J0BA 1M67A 2OHOA 2O5RA 4N1AA 1NNI1 5LCXA 5HJ7A 2QN9A 3FPCA 2P1ZA 4O3MA 1KYXA 2EIXA 5IKEA 1ISMA 1G18A 1HE1C 1W93A 1XEAA 3PX2A 4IRUB 1FTNA 1KE2A 3QMWA 3A10A 3MT7A 4R8KA 1TJPB 2ZIEA 2WW8A 4KITB 3FETA 4MB0A 3KHTA 2GH1A 4ZPXA 3VVLA 5B6JA 1ZUNA 2G70A 1A96A 2F1RA 3EGWA 3FWYA 3QVXA 5TS3A 1E3EA 2IS6A 4LJKA 2Q5IA 4RANA 3TVYA 1AURA 5A3JA 4K9MA 5CNMA 4F06A 4ND6A 5PNTA 1UZUA 4Z49A 1KKLA 2ZB3A 3RSZA 4TXJA 4MLDA 3T5PA 5AI8A 3EW7A 4U0JA 4AUMA 3HYCA 4I9GA 4Z1OA 1F8YA 3U5ZB 2FR0A 3BJEA 2ASVA 4JHXA 2QRLA 4KKXB 2EZ8A 5DEOA 2GBPA 3GNQA 3S4YA 1Z15A 5ED0A 4B81A 4Z4FA 4O2RA 1U2SA 3PT9A 4J91A 3L0IB 2ODNA 1DAPA 3BMCB 3UMBA 4YX9A 7YASA 2XVZA 3QVVA 2JIBA 4U2KA 3JQ9A 1GZ6A 4TTPA 4L5CA 1C8VB 3COVA 1VDMA 1DDIA 4WZAE 3SS8A 4BN0A 1SC3A 5C2JB 5DV9A 2JFWA 4MK4A 3JSXA 5LQAA 1MAAA 4IJQA 3R7WA 2M98A 5ALGA 4MDYA 4WFKA 3WLTA 2OYRA 1YAJA 3F90A 1EBUA 4YJHA 4BVKA 1NGSA 2VI5A 3RSLA 1B6RA 1CF9A 2PU5A 3UJNA 3K9FC 4FZVA 3ZCRA 3INRA 1VDZA 4YROA 2J3HA 2R97A 2JANA 3R3UA 4JA2A 5JD5A 5JNWA 1E6EA 4M6WB 1VHLA 1XEFA 3EVNA 5KSYA 3FF1A 4KVFA 3LT4A 3S2IA 2EYQA 4PW0A 4BO1A 2GCPA 5JNUA 1EJBA 2J9RA 3RRYA 2CUKA 3K0CA 1RWVA 3QFRA 4ZO7A 2CGEA 4HC4A 4H4EA 3OTIA 5D7NA 5A5VA 4LF5B 4GLOA 2PLAA 2HCBA 4HNTA 4UMDA 1NYRA 1TJ3A 4P54A 3QQ5A 1VJRA 2ANBA 1KA9H 3G2HA 3MW8A 1YZHA 3QBDA 1BU5A 1T2CA 3F5DA 2I6FA 1G0OA 2P7IA 3GT7A 4MR7A 4Z7QB 4F92B 4WCFB 3UT0A 1HDXA 3WDMA 4V0RA 1EK6A 5JDIC 1KIMA 4RZIA 2CBXA 4CUJA 1VGVA 3SR4A 3D7RA 3BGOS 3ZZNA 4DV4B 4OM8A 5ECWA 1ZU5A 3LI2A 4X95A 3T0FA 4OFXA 1IHDA 2UVDA 1DQRA 3I0NA 1RFLA 3SZ3A 4D9MA 2NO7A 3QHPA 4NENB 3ND6A 4IJUA 1TVEA 4P53A 4OBXA 1J2TA 1ZGGA 4PHHA 2C5LA 3KYDB 3P4XA 4LX0A 2QX9A 4UM5A 1HYEA 2BPOA 4P6VF 1NQVA 4YRNA 1YB5A 4D25A 3HDVA 1QJCA 3U3OA 3Q85A 1XR3A 5HX7A 1SQ6A 4AX8A 3PEWA 1TLTA 1P74A 2H1VA 3AXTA 2WKQA 2QVLA 3TO5A 3NKLA 1PW7A 4B3XA 2HRDA 3AF0A 2GR8A 1DRKA 2JCVA 4JP3A 3WMRA 4I1UA 3NOVA 1YJXA 1JUDA 4HNHA 3D7MA 3EGDB 4YMWA 4B4UA 3ZY2A 4YV1A 1G4UR 4JJKA 3Q7IA 3Q9SA 5FUMA 4KMOA 1Y8RB 2DFTA 2O1WA 3PFIA 5K5EA 5ISMA 4GPZA 3FWKA 3JWJA 2R8ZA 4NPCA 1COWA 4ZC8A 1BVYF 2XW6A 4JDPA 3UJCA 4A10A 4E5SA 1E7WA 4RK5A 5EE5B 2OGTA 4IY1A 5H59A 1U8AA 4D43A 1ZGAA 4P1ZA 3RABA 3U3KA 2BN4A 4KAFA 4F5DA 1OXTA 3BAFA 1X3SA 3M70A 4R0NA 4DDTA 2I54A 2JGAA 2NVOA 2QQFA 3P2JA 4AJIA 3O91A 1N7HA 4F5YA 2QZJA 2YL2A 1ST2A 1LRJA 4MI1A 2Q2NA 1T9GS 4PAMA 4D9GA 4GLFA 5A5EA 1USIA 1PJRA 2ADMA 3RBXA 3KT0A 5KTMA 2WKRA 3FNQA 3KJEA 4YMIA 4G86A 5FAKA 3CVWA 3U7FB 4ZGWA 2VLBA 2W5UA 2OY0A 3ZXYA 2HU7A 2JI8A 4CM4A 1Z6PA 3JWPA 3KQVA 3R09A 2I4NA 2MJLA 2G25A 2ZIZA 3F5FA 1JVSA 4MVJM 1CUFA 4QRIA 5JROA 3QHAA 4GAEA 2XOKA 2CMHA 1XDGA 2YZKA 4P33A 3NC4A 4QXPA 5AM5A 1VL2A 5H3CA 4WLVA 3ZDXB 1PR1A 4FWBA 1E92A 1Y7TA 3O74A 2AI3A 3R7DA 5IP5A 3F8TA 3IXMA 4Z0TA 4X1IA 4Y98A 1H5NA 1KMNA 4QO8A 3GIDA 4I81A 3CNBA 1S01A 5SICE 2V4MA 3T99A 5J4HA 2R6GA 3LQYA 4O4JB 2E55A 2P11A 1SVUA 2G77B 2SHKA 5FEUA 2FR1A 4YDHB 2X77A 3WYEA 3DE1X 1AK1A 1KKMA 5F7JA 4KLZA 5BV7A 1K75A 2ZIXA 4OMCA 1W2WB 1DC7A 1TM5E 3C0KA 1T1JA 4D74A 2VUUA 1UH5A 1DJPA 4XTRA 1PF7E 1H8HA 4JV5B 2JAOA 2WC1A 3PYMA 2WM2A 4LZZA 2CCJA 2XEXA 1PEAA 5K9ZA 3MWDB 3HKEA 2HYIC 1GFWA 1E2KA 1FQJA 2A0YA 3W7AA 1DAHA 3KXIA 3RSFA 2CF6A 4AJJA 3NYRA 4ID3A 4WXEA 5U1PA 2FPSA 1VKHA 2EGGA 4QU5A 4F9FA 1DFIA 1U4NA 1S8FA 2X41A 1OREA 5AHXA 3S3TA 3QENA 2FRVA 2OGWA 3FRIA 1Y80A 1OR8A 1NKSA 2DWCA 4INZA 4KXLA 4XDZA 4NR0A 4DMLA 3E84A 1BWSA 3G3EA 3OT1A 2BP7A 1P2DA 3A9CA 3TQRA 2JCYA 1XHLA 4ND3A 2Q9BA 3ZVLA 1H3FA 3HJBA 2HWYA 3NHWA 4JI7B 4LA4A 4KWCA 3AESB 1KC1A 3L7BA 1GTL1 3EVZA 1NA5A 1RC0A 2AFHA 2PZKA 4D3FA 3L7CA 5KTKA 2CEKA 5D51S 5KO2A 1LNSA 2WHYA 1S9HA 4KVAA 1X92A 2LBPA 2HSGA 3WX0A 4EUSA 5JXJA 1HL7A 3NH9A 1R66A 5BOVA 1A1VA 4EI7A 3GMIA 4X94A 1GP2A 5AXAA 4MDHA 2HUNA 1UQUA 4HAUA 3PFCA 3TQQA 1Z2EA 2JF0A 1E2BA 4E6PA 5JLAA 3GHYA 2WM8A 4MKRA 4ZEXA 4YMGA 4IV8A 4XM1A 4CL3A 1K1EA 2HOQA 2XD4A 3L7LA 5A5FA 5D84A 3BMNA 5FKJA 3JVIA 2WWTA 2OLEA 1AUVA 4Y9TA 1J8DA 1MOSA 1X1BA 3OIFA 1VZ3A 1AGRA 2RHHA 1U2GA 3L1VA 3Q3EA 4FYJA 4YJ3B 4BE9A 1MCZA 1T1IA 3DLIA 4IM7A 4UDOA 1CJBA 1ND5A 3IJRA 3ZWPA 4E13A 2MHCA 3P9RA 2JLVA 5LNK1 2UZ0A 2WD7A 5HGXA 1X8KA 1E9FA 4QGAA 5CJPA 1FUYB 3TZHA 1VM6A 2OV6A 5J2TA 2IBTA 4XWAA 4CDMA 4MV5A 4O1IA 3T9AA 5AW5A 5K03A 2GYUA 3EXFB 1SU8A 4P82A 3H5WA 5C1PA 3DR3A 4Q19A 4YRPA 2I8CA 1GZSA 2HY7A 2VT2A 2MSDB 3ZJ5A 4IIVA 3DDSA 2VAMA 5JFTA 3LKVA 4I66A 4PM4A 4AYXA 1HTTA 2QN6A 4P34A 2AEMA 2BSQA 4K9RA 1Q7EA 1NI3A 2H1FA 3VPBA 4HH0A 1OIXA 2M32A 3HACA 3CFYA 3PQDA 3VSEA 3IP8A 1TZKA 5BRNA 4ND1A 1M8JA 1PSWA 3HA2A 3AF1A 1IH8A 4NH0A 5DH9A 5HXAA 2FEPA 3CG0A 2IX3A 1WKVA 5CCXA 2R6AA 1MB2A 1NVVQ 2YWJA 3LKZA 4C89A 5F52A 2XUOA 5I47A 2DWQA 4G67A 4YI5A 1HFJA 3RWBA 4LN1A 2Q6KA 4R81A 2I22A 5ILQA 4JI6B 4AUNA 2OPBA 2RBGA 4XVUA 3NNNA 4UZFA 1R8QA 4IIEA 4ZV9A 3IELA 2AFVA 4AJNA 5HSGA 2D7CA 3A6FA 2ZIAA 4Z3DA 5IF9A 2NU8B 3F49S 3MILA 1PSDA 1FK8A 5IW8A 1WBJB 2P6NA 4L7QA 3NDBB 3JW8A 3ILSA 5FX2A 3E3AA 1W87A 1JEQA 1Q0UA 3VOBA 2RHMA 3BH0A 1UC4B 3JS5A 4LBYA 4NPAA 4O02B 4ZEOA 4AYWA 4DWOA 4ADSG 4M87A 3B51X 3DV9A 3N5KA 1UBFA 1YDHA 3T4EA 4H7JA 1A7KA 4Q47A 5T4FA 1DJMA 2ZRAA 5J4YA 3TE6A 2RHJA 4RFSB 3FYHA 3M0EA 4UHCA 5T8KA 3SF8B 3HPQA 5IM4F 2HSZA 3ICPA 4QHTA 2ZJ5A 3T1NA 3G9ZA 1E9BA 4KP7A 4BB9A 1VG8A 4BASA 4KPEC 3ADDA 5G0SA 3T3EA 1GL6A 1SUEA 1RC1A 2LUOA 3ZIDA 2CL6X 4LVNA 5FB3A 4CV0A 1W1UA 1ZNXA 2O1EA 4Q9DA 1IDOA 2QVBA 3CJQA 4ILKA 1FS4A 3AERA 4S1WA 1QHIA 1EWKA 4G0ZA 3TW8A 2J5QA 3BHMA 2V9PA 3PCRB 2HU8A 4MVJD 4TS4A 1QK5A 2VDRB 3G0CA 3BQMB 4MR9A 4M53A 1U1CA 4OO3A 3VVMA 2VR1A 4L9AA 2DERA 1EEXB 3OUTA 4RSGA 1WDWB 4KYUA 1F1BA 3Q15C 3TQFA 2DSNA 5GONA 3M33A 5EUBA 1ODLA 2WTMA 3L93A 3B3GA 4EFLA 2PKXA 4MRRA 4GVXA 5F76A 1ID8A 4IJKA 1Z16A 2XZPA 3SQMA 5B57C 3VH2A 4YMHA 2FTKE 4HB2A 3WHKA 4C20A 4JUDX 3JALB 4KVGA 1U1EA 3K94A 4FDUA 4IX1A 3RSGA 4C21A 3L43A 4I1VA 4TQ9A 4YASA 1K2VN 4Q0MA 1IY0A 1GAEO 2ID9A 3KUUA 1TQDA 4FBMA 1P4JA 2ZROA 5JNVA 1SULA 4PVDA 1QFSA 1V16B 2OWEA 4EPYA 1OILA 2IYUA 2O8FB 4MS4A 3A9SA 1M0TA 3KD2A 4IGKA 3OM1A 3MWKA 4YCAA 3NBFA 2A7QA 3C70A 2V54A 2Q7OE 3TQTA 4B4OA 5IJ0A 2H1OA 1DCMA 2YINC 1F51E 1R6BX 5FHQA 3RUPA 5JATA 1ZJ6A 2FV8A 4L3VA 5CLLA 1N33B 1P18A 1T0PA 3GARA 2RHDA 5T7BA 2GZRA 4BGIA 3PDWA 2PJDA 2XEDA 3AUJB 4JB8A 1C3OB 3GJSA 1DI0A 1D6MA 1UOOA 1XJCA 1FY2A 2WOOA 3FZYA 2PGOA 4UHEA 4XJVA 1YHNA 2VPPA 4LBVA 6CHYA 3R74A 5IBPA 1KFBB 4J0EA 4PZ0A 3T6KA 2ZYVX 1Z2PX 3HC7A 4JC5A 2VRCD 4XSGA 4DT1A 3IR5A 2HK7A 1P0IA 2OK7A 3NHKA 1Y1LA 3R3YA 4P4SB 4Q7MB 2AFHE 2WHPB 1YR9A 4ZVMA 3KSAC 2F00A 3IBFA 4MIKA 1TLLA 2B4QA 3ABZA 3NFYA 1MB0A 4LRUA 3R44A 2MSEB 4QYSA 4RZXA 3TTVA 3ZQJA 3DXFA 4QGGA 1KJYA 4HLDA 3QLTA 4V0MA 3SNHA 3THSA 4WINA 1JKJA 4ZXPA 2WTUA 1A8QA 1MA3A 1W19A 2F55A 2EQ5A 5E4JA 1AMNA 1HRKA 1NM5C 1TQHA 5AI0A 4FQ5A 2X2OA 3K30A 4P4NA 2TMGA 1P7YA 3O26A 4U2DA 3ZKWB 1ZOPA 4Y6SA 1K5HA 1L4GA 2R1TA 4ZYLA 4C7VA 3IPCA 3IO5A 2GMWA 1H23A 1S1CA 2F4NA 1HRDA 3JQGB 2F8MA 3QE0A 1O9BA 1RVDA 2WF6A 4LMRA 2X2PA 4PONA 4ZU3A 2JASA 2PX5A 4BNKA 4CDGA 3COJA 4OI0A 3FHJA 3N07A 2AOVA 3ENWA 5CA1F 4JP1A 3OQJA 2AQ8A 1EVLA 3UGKA 5F5XA 3E7XA 3M6AA 1E9VA 3ENVA 5AM2A 3I8OA 5DK4A 4DW8A 5JMTA 4RTKA 1UDWA 1J1IA 1KJ9A 3FSGD 2Q4RA 2E1PA 3BXHA 1P9NA 3O8LA 1RACA 3U9SA 8GPBA 3D1JA 3LPMA 3DFFA 4FDMA 4N49A 4GWLA 1JU3A 1W5FA 5F77A 3RAJA 4CG0A 1AKWA 1V4NA 3LBNA 1FYXA 1USWA 4NF2A 4NMWA 2ZANA 3ONNA 5KU7A 1MFPA 1ETUA 1BVUA 1QGYA 1UADA 3B12A 1U0FA 1DGQA 4L2IB 5EWMB 5LUAA 1CUSA 1LI5A 2B8WA 2P90A 4PNPA 4J9UE 1RYDA 4UZSA 3WRYA 1JT9A 4CXMA 3T4PA 1TVMA 1LNQA 3WO0A 4ZCTA 1U5AA 3DZGA 3F2IA 3PDIB 2AH5A 1PSZA 2C88A 3CX7A 3ESBA 1RVV1 4ZANA 2GGSA 1R9NA 1MJGA 1GGKA 2JLQA 2QHXA 3L7MA 1QZ3A 3BFJA 5EJAA 4KWEA 4ZYXA 2YFQA 3T9CA 4KFCA 3BWVA 2OXFA 2AUTA 4K40A 5G1OA 2XI4A 2Q0XA 3IT3A 1K9SA 2G36A 1NBWB 2FPUA 2GS9A 2L2QA 3PE3A 3OE4A 3SZOA 2I52A 1ATZA 3GL9A 4TXLA 5FBQB 1YA4A 4LZPA 4HP8A 4OQFA 5AOCA 2UYHA 2GN4A 5A3QA 5DHRA 3OP1A 3CN7A 16PKA 4AP5A 1FU8A 4ITUA 4DA6A 3RT9A 3ZHZA 4MICA 5IFKA 2YJ3A 2BE9A 2IZ7A 4OH1A 3CUVA 4Q4HB 4RPLA 4ID9A 2Q4EA 3JQPA 5BR4A 5AVQA 5H9WA 3Q8KA 1NZFA 2GARA 1KNQA 3P9KA 1G2PA 4B17A 1MOZA 3ZVKA 5J1TB 4GPTA 1EU1A 4KGVA 1AGXA 2I4LA 2VATA 3LHDA 3T34A 1NPYA 1YGPA 2LRHA 2GCOB 2G08A 3A27A 3HBLA 3TDNA 5HKBA 3U6BA 4YRBA 1O0BA 3R20A 1QYXA 4OKSA 5H7XA 3W5VA 4HEA6 1B16A 2QD5A 1BHJA 1K3FA 4OHBA 1ZCFA 2WWFA 3Q2IA 4N3GA 3LUBA 4QREA 2WY2D 2GAAA 3WK4A 4F1WA 3R24A 2AOTB 4M1OA 1GKLA 1RIIA 4MDFA 2QLFA 3QFTA 3GRYA 1OLSA 4PZDA 3TFOA 1U2ZA 1OX5A 3U44B 3ME5A 4GRAA 5IEBA 5T3UA 2JIPA 3AFHA 4YEDA 3TSYA 2GBLA 1I4EB 2ZFUA 5EJ9A 1E2JA 5AXDA 3ZCQA 3Q11A 3D8UA 1E6KA 1NULA 2AG6A 3TZLA 1H1LA 2HW8A 5B1YA 1PQWA 1Q44A 2OXCA 5NULA 2KW5A 1I4LD 4FYVA 2XECA 2B4KA 3KKOA 4UW9A 2P9YA 3IMFA 4F3TA 3D3WA 2HA6A 2J3IA 3R9WA 4O1HA 4C4RA 2RK6A 1W48A 3OE7D 4QX6A 5G2OA 5L3ZA 4S05A 1SHLA 4MRMA 4AJOA 2ZRDA 4JT2A 4FSHA 3MJFA 4EJSA 4MYDA 3PICA 2HQSA 4JGGA 2J6IA 5DBHX 4ABTA 4UBOA 2FEOA 2E7ZA 2ZU6A 4M3NA 4Q1VA 3WNZA 3ZUPA 3CNLA 1CNEA 2PMDA 5BYAA 1Z0ZA 3DBVO 3ZNPA 2WQ7A 1MLDA 3EOZA 1CHDA 4XDHA 2C98A 5L45A 4H16A 4Y2RA 4PIPA 3PDHA 2P5UA 5ETJA 4E88A 4DM3A 2CXSA 4E33A 2PS1A 5B7NA 2P2CA 2NT3A 4L8VA 2P1RA 1Z06A 4IIJB 3TRIA 3VAYA 5K4GA 1VL6A 3KUXA 3M49A 1HG1A 3EZ2A 4J2HA 1K8ZB 2GDJA 1MVLA 1FDRA 2R9VA 3HJHA 3OTWA 2XAAA 4QYWA 5CVCA 3VPDA 2ZXUA 3WLJA 3MJ4A 3CLRC 3F47A 3Q7RA 2JFGA 3A3NA 1AZSC 4Y18A 2XNDD 3IC5A 3BSYA 2JHCA 4KDCA 3IHKA 5BOSB 4LK2A 1IZ8A 4M0PA 1W30A 1A3CA 1T8SA 4HRYA 5AIBA 1JHOA 1AX9A 2VZLA 4V0ME 3Q3JB 4F60A 2GPWA 2K4MA 3FGPA 4LJ7A 1EXNA 2CVOA 3O90A 4X63A 5AKXA 4BLTA 1HSOA 4JVSB 1DAGA 2H0RA 3OTGA 3A3YA 4AKEA 1HYGA 4B8YA 2HTFA 5DYWA 4B45A 4NBWA 3C2QA 4OIMA 3GPIA 2ETXA 2FPLA 2OCLA 4YRTA 3QBTA 1ZJ4A 4HLUA 4Z2YA 1N9GA 2J41A 1XZCA 3NGLA 2CJPA 2QRHA 2R6DA 3CCBA 1L0BA 2VBFA 1BKYA 3S5JA 5LQKA 1UDBA 2H4HA 4H27A 3TXAA 3NBKA 1RYZA 4QFBA 4EK9A 2MTBA 2HF8A 2E1RA 3IKVA 1D1PA 2H3EA 2V9ZA 1PUIA 2H5LA 4NCKA 4PY2A 2EBWA 1H0SA 4TS3A 3N0XA 4TUYB 4X92A 3ZE7A 4ZIRA 3GBSA 3OZFA 4ON9A 3DBOB 4ENUA 4GMKA 2MR5A 3TBHA 1RPZA 1QCCA 2VT6A 4YFYA 3RUIA 3IQDB 4ZOLF 1IHPA 1ZWLA 4AICA 2HIHA 4LHXA 5IM5A 2EEZA 5IN4A 1GITA 1L5GB 3LLSA 3CC8A 1QQ6A 5K45A 2JFBA 2P4SA 1GSOA 2QN8A 1DV2A 5CW2A 4EO4A 5B6PA 1FSPA 1JG4A 3IOEA 2O3RA 3C3MA 3GFBA 4POAA 3P2KA 4TV8B 1QZZA 3LP5A 2DYKA 1W5BA 2C54A 2HJGA 4M7WA 2GT1A 2ZYDA 2C4KA 4ZO4A 1G4AE 2K7ZA 2IW3A 4JKYA 4LCBA 4N39A 4XH9B 1N0UA 4L0QA 3ZWNA 4ER6A 2HXGA 2NO1A 3E22A 3UV6A 1F20A 2FPIA 1PNQA 1QS0A 4HFMA 2AZXA 3E03A 5ENVA 4CIXA 5IASA 3TG8A 1WMAA 2FXIA 4JR0A 1K7XB 3C45A 2OZLB 2REQA 3B3QA 1QIKA 4P0TA 2J6HA 4MWEA 5IZCA 1ZBDA 5AM1A 3A04A 3AR3A 1YB7A 3G8YA 4I6JA 4QEZA 3WA6A 5E1BA 1SHTX 5EIOA 4B6FA 4EKNB 2A2ZA 5HF9A 3EVDA 2J9FA 4OXNA 4B31A 2WICA 1N6RA 4W5JA 2PBRA 3FKSA 1OX4B 3ZHBA 2UUBB 4OJMX 3TEFA 2JARA 2EEPA 1GG5A 1Z4JA 3NBZC 3LWBA 4RAOA 5A0FA 1BXZA 1N3YA 2I03A 4WNCA 4ZVQA 3OX3A 4RLSA 1MW8X 4I4TA 3JQFC 2VNJA 1ZA1A 3GFPA 1IQUA 1LX6A 2QZPA 3KJGA 3Q8XB 4I50F 4O29A 4PHGA 4GX2A 2WJYA 4K28A 3U3MA 3HKDA 3X3HA 5GTDA 2VF4X 2VZ0A 1FXUA 2YV1A 2J7PA 4LJ9A 1QGUA 5DLYA 1V8ZA 3PUWA 3TNYA 3UICA 1K4KA 3HKBA 4PZ9A 4QL3A 4E51A 1QHEA 1JNXX 4DNFA 4JLPA 4YUXA 1NG9A 1NLZA 2M1ZA 3H0KA 1C41A 2QNRA 2YV4A 3TS1A 3IUPA 4MJ7A 4P0QB 4KN6A 3ZHRA 2GK6A 3AKDA 3LQ4A 3RBZA 1GT6A 1GM5A 5KTTA 4YAOA 3RUFA 1C8KA 1PK9A 4FGSA 2I3GA 2VSQA 2C7GA 3DW3X 2Z09A 1E79A 4WERA 3ETEA 3SEFA 3VU1A 2BBWA 3RUHA 1M34A 4YCMA 1HE3A 4K46A 2I7TA 4OQ4A 1HA3A 4IUYA 1VSQA 1IHOA 3KOMA 3MN1A 4YRLA 5AK0A 5F51A 1NDUA 4I9NA 5BW6B 4ZYUA 5FLKA 1FFDA 1KO5A 5IVHA 3GEIA 1IOVA 3R3VA 3JZAA 4RTPA 2H9IA 4EYGA 1T0BA 2CLKB 3CX4A 1X2EA 1J9GA 2VZEA 4FNMA 1QHXA 1JJFA 4LKOA 4PRLA 2UXBB 4BRZA 1U0GA 5C53B 1AV6A 2GK4A 3P0JA 4YAEA 4DCTA 2CE7A 1ABEA 2X19A 3C1UA 3LPDA 1QRUA 3OECA 4DR7B 2GB4A 4DWVA 4TWIA 1BGVA 5TSDA 5GZ3A 4IIYA 3MCUA 1KMIY 2I7DA 3L8CA 4HWRA 4JHLA 1TO6A 3WGKA 3WWPA 2DSTA 2O6LA 4JLSA 4CN8A 4RD3A 2E37A 5KX5F 5AW7A 3QTLA 4U7FA 1X86B 1YRYE 2NSLA 3GAZA 3DTVB 2ZWMA 2B4RO 4NX2A 4EY6A 2XMBA 5B2FA 4PTYA 3B8HA 2HF2A 3F71A 3L6BA 3T7KA 4DCVA 2QTAA 1T0IA 2OM2A 2UZ1A 1A2OA 2YIDA 1ODIA 1SN7A 3HB7A 5JU6A 2P9TA 3DEFA 2B0JA 2QQ0A 3CPSA 1XEXA 2QL6A 2GZMA 4RDHA 2C2WA 5GGYA 1YQEA 4D7AA 2O3TA 2PJRA 3AL0C 3DTYA 1OLUB 1QUFA 4CT5A 3FDZA 1T0HB 3X43A 4P3OA 2JPDA 4WK6A 5E4FA 5KNBD 5LP6A 1UXGA 2C61A 3P19A 4UTRA 2IUYA 1P0QA 3BC1A 3ANYB 3I9JA 2AC2A 4MV0A 2QV7A 4UXJA 4G4JA 4TMKA 1A2QA 4EWLA 2XHEA 2FMTA 1XVUA 2HHHB 2FPPB 4BWVA 3GQBB 1KEVA 3EFBA 4B9EA 2MSWA 4NBTA 1CV2A 3VU0A 4CM5A 2OG1A 1LDGA 2QTRA 4CRWB 3QLUC 4D97A 2OQ2A 1O96A 5EZ6B 4ZXFA 4BEWA 2JLRA 3PR1A 1YZNA 5E2IA 3WGMA 3UC5A 3VR6H 2YW9A 5EMMA 5K4HA 2W8ZA 1HT2E 3K9CA 4UOEA 3WDKA 2FN8A 1U11A 2XVXA 4HQNA 4LDAA 4CE6A 1DIHA 1WLSA 1WL8A 3C3YA 5JHGB 1B8PA 3QKRA 3N53A 2LIVA 3T7SA 1ZCZA 4Y6LA 3MWYW 1ML4A 3D5EA 1GPH1 3NBUA 3AY6A 3DPSA 2A5YB 2W6OA 3FI9A 1ZAKA 3VPXA 4BNDA 1DPGA 5KJ1A 1YCGA 3ANLA 4GDFA 4HTFA 4ZD6A 5TARA 2NN3C 2G40A 3ZD9A 4EELA 4DCMA 5LZ4A 1X74A 2I4RA 4RD0A 5H80A 2XNHA 2DH6A 4OM7A 1C4WA 2YN0A 3KJNA 3QUQA 4X1KA 5F9MA 5HQJA 4I5EA 3R76A 2BI8A 1R0CA 2BJWA 2WFZA 1BCRA 3BSFA 3AJ9A 1CQJB 3RFTA 5FCDA 3T4UA 3O6VA 1A4IA 4QTXA 4GO1A 3V3TA 1J07A 1XVTA 1P31A 1Z83A 1TM4E 1ULSA 4DMUB 4ZYYA 1AZWA 4H3HB 4D0SA 1JPJA 3CB4A 5BO5A 2FX5A 4K6CA 1GZ3A 2IYFA 4AURA 3ZHTA 1ZYUA 2HK8A 1TW2A 4PNHA 5CDGA 2GD1O 5JH7B 2OFWA 1QCZA 2QW0X 4LYYA 1YBAA 1MEJA 1RSZA 4TKMA 5FJIA 3HTXA 4D5GA 3FNGA 4A5SA 5FOWA 4AECA 4MRNA 5EZQA 5FO1A 1NVGA 3GK3A 3QU9A 1SJ9A 2BFDA 3H1AA 1UEIA 4X20A 2JGRA 2EDAA 1JQKA 4GUDA 1MG5A 1PR2A 1XDDA 1XZJA 4RDIA 5ULLA 3VJKA 2PQ2A 4KHZA 2O2JA 3D8TA 3KRTA 3BN3A 1LZKA 1Y1TA 2ZE8A 3PC2A 4G1UC 4RESA 5GM1A 3WIBA 5HKKA 2VYCA 4U3JB 3SDSA 3RK4A 1QOQB 3WICA 1U8YA 1LFDB 1UBCA 2R8OA 1XNRB 1JR2A 4G1BA 5CUQA 2EERA 1YASA 4C0JA 1L9KA 3W0LB 3EGOA 3PC8C 3B3JA 2R8YA 2YHSA 1DBVO 1GPNA 1Y3CE 3UAOA 4ZJUA 1SVKA 1PEDA 4AG3A 2DEUA 1PJZA 4PG6A 3QG5A 3DS8A 2INGX 1GQQA 1QVWA 1T4CB 3WJ7A 2P5SA 5I3ZA 3L4SO 4B3BA 4AX4A 4KEAA 2L42A 4DNXA 4IXJA 2GD0A 3MAJA 3AHHA 3ZTTA 2CNBA 2AL7A 3N8KA 4OV6B 4GRIA 4EFMA 4K2AA 1PR4A 3CRMA 3HJTA 2BFPA 2RIPA 5IAJA 1OFUX 1PR5A 5ALTA 2QB5A 4RQTA 4A15A 1O4WA 1BE1A 3ADOA 2QE7D 4GX5A 2PLFA 5AICA 2NUPB 4RA9A 2A67A 3HM2A 3ZV4A 4ESHA 2QF7A 3ISVA 4NHOA 3A2NA 1K6JA 4LHVA 5C8YB 1ESMA 2JCBA 2VNSA 3KJFA 4D79A 4HAWA 1NIPA 2PBZA 4B87A 3EAGA 3V48A 3HABA 3SJAA 1SUSA 2R8PA 1U4SA 2C07A 4HX9A 4DXDA 1B0UA 1R37A 3E53A 5CJ2A 5F2EA 5I7HA 3TPZA 4YREA 3QYAA 1C81A 2WMYA 3LO8A 1IHYA 2QU8A 3SLGA 2BW0A 1DLIA 1FLVA 4XFKA 4IXTA 1EE1A 1V5IA 1JG6A 2OCAA 2OZKA 4FEEA 4EUFA 4ZYVA 2PKRA 4OGKA 1QGDA 1S96A 4BRWA 3HQ4O 1LWOA 1OHHD 1DXQA 2I4OA 5E9JA 3SYNA 5BV0A 1CXZA 1Q12A 1DDOA 3C14C 3TKLA 3O47A 4RK4A 4YXWA 3GLFA 3I37X 1ODFA 2YZMA 3BDIA 4MLPA 2ZIUB 1OH7A 3ZR4B 5GM2A 4CIDA 5A6SA 2P9ZA 4L22A 3DHNA 3WV5A 3BX1A 4CM3A 5EVJA 4DADA 4W82A 2BFFA 2PYIA 3LDFA 2A92A 4C4AA 1P3Y1 3GRCA 3VMFA 2G63A 3EXG2 2ZRGA 1YFKA 4Y2VA 1IAQA 2UYCA 1WQ3A 2JW5A 3C7AA 4CM8B 2DB3A 3I73A 1NLMA 1JHPA 2MSNA 2VPIA 1MMFB 1NLFA 4UCXA 4J0KA 3W90A 3SHTA 1QTQA 3EJWA 4OU4A 1UODA 1NMSA 3PJEA 2WILA 2N0SA 1YCFA 3OCUA 3RG2A 4PO3X 3L8EA 4EY5A 3AHGA 1YT5A 4I08A 1QG2A 4RKYA 3H87A 5KMGB 2H48A 3UWMA 4CKBB 4RCYA 1BD4A 2UKDA 4U7WA 3GRUA 3JV7A 5BRAA 5DNCA 2YJGA 4FFBB 1FU7A 2X9LA 2JJYA 2XQIA 3TVDA 5F3WB 3F5QA 3KOOA 1L7DA 5CNIA 2HT6A 2WUEA 3ZXIA 4CTNA 2VDJA 3HUEA 1O54A 1OI2A 2VCHA 2Z83A 3LXUX 1WQ1R 2ZE7A 1JHXA 1GRQA 4E6EA 5KTYA 2A8YA 3GAMA 2C59A 3O1HB 4UUPA 1HNWB 3VC1A 1QU3A 4JCCA 3ZGXA 1UPXA 4PLCA 1Q91A 2GEBA 5FWYB 3T1YB 5L53A 3AF6A 1FLDA 1P6XA 5AVKA 3QSYA 1P62B 2LDBA 3LLVA 1WXQA 1SRRA 2V5AA 3DHWC 2E4UA 2GEUA 2A57A 3H4MA 3MSXA 3GJQA 3F5SA 3TD6A 5EPUA 3WE7A 3K96A 5I01A 2IH2A 2FUG1 1DX6A 3WLQA 4LOKA 3SS9X 4EZIA 4NZPA 3N8GA 4II2A 2V8BA 5J63A 1I01A 2F62A 2UV8A 3WR5A 4E5DA 3TAUA 3EXHA 4O4HA 1H42A 3IEVA 1KK3A 3QTTA 3DEYX 5HRAA 5B1IA 2J0SA 2XIJA 3SWWA 2OD2A 3A3OA 1WZEA 2PJUA 1CQXA 1KF0A 3RVKA 1W5TA 2Q5JA 2D1YA 3OOJA 3QIVA 4UHFA 4D44A 1L5FA 3L0PA 2ZR7A 3DDCA 3QFCA 2WHXA 4DGSA 2QX4A 4JKIA 3Q6NA 1KQ3A 3VR5H 1BC5A 1JA1A 3RCBA 2ZSKA 5JS7A 2G1KA 1KZYC 2IYZA 4BO4A 4GKAA 1QR2A 3K1TA 4BHTA 1VLHA 2WDZA 3GEHA 1NF9A 4YNBA 1BD3A 5TR9A 4MA5A 2R5NA 1YZVA 3I6YA 4RZSA 1FS5A 4WN9B 3M82A 4NS4A 3E9QA 4HRXA 3GLKA 4X6XA 5DTRA 2OMEA 3CLTD 2WZCA 1THZA 4FHFA 4YRIA 5KYYB 2R68A 4RD2A 1XDBA 3GEBA 4ISBA 1QRDA 1SIBE 2VP3A 3N59A 4GU5A 1G19A 5LZ8A 4PLZA 3AVXA 3N0WA 2R62A 1THTA 2CUZA 1Z5WA 1RR6A 2VNKA 4H4CA 2GN6A 1FYDA 1BKDR 1RAEA 5H5JA 5BMVF 3OPYA 3AZQA 2OD7A 3RYCB 2ZDQA 4LE1A 4ARZB 1NE7A 2CXPA 3I42A 3L8DA 1EFHA 1HDCA 3A3KA 3FOAA 3N39C 1FNBA 1Z26A 1I1HA 4BB5A 1ZM4A 4AWAA 5M34A 2ASEA 4MUFA 3OZDA 5A4FS 2WNHA 4E46A 4DQVA 4DXAA 2WWXA 5EYPB 5LQCA 4MTLA 4KE8A 4GYWA 5C35A 4NQRA 4KFSA 3RYHA 3VBEA 1IOZA 4GYYA 3F6BX 4C88A 2PD3A 4LJ4A 4HWPA 1DAKA 2V7QD 1BMQA 3LGAA 2X7HA 4MV6A 5K0GA 1V5FA 2VDVE 2VK1A 4LV6A 4DR4B 4OSPA 1RRVA 1VSUA 4E12A 3Q8MA 3T95A 4URVR 5TF4A 3KS9A 1OBOA 1QQAA 2FUCA 2WSSD 4HK4A 4R7ZA 3W6ZA 2WIAA 1HGXA 1RCTE 1Q7BA 1CKEA 1YJQA 5HEKA 4JOCA 4DBLC 3F6PA 1RI3A 4JI0B 3HZOA 4XSHA 1LTQA 2PTHA 4G01B 1BS9A 2QMQA 4KXUA 4BFLA 4EY4A 1CLEA 1I80A 1M73E 3LFTA 3KZXA 3MJHA 4KSCA 2WAYA 3I9NA 4HDSA 1CSEE 3RAPR 2VNIA 3LT2A 1P0FA 3RIGA 1KO1A 4ZMSA 1LPAB 3OX2A 5HVNA 4NG4A 2P8JA 1F8FA 2HPAA 1L5KA 4GC9A 1N1MA 1KDTA 5C9ZA 5IWCA 3UC9A 221PA 1AQLA 2JGFA 1RRMA 1QTIA 1RXCA 2GWHA 3HHPA 3KUCA 4HNSA 1XVVA 2H65A 3EA0A 3P2IA 4INPA 4FDLA 4ZOEA 4DKXA 3Q6MA 3PJRA 2W93A 2SKDA 5JDCA 1NX9A 2C04A 1XMQB 2HHLA 2XB9A 2CB0A 2ZUWA 3B1YA 4K9QA 3BBLA 1XU4A 1JH8A 3DW1X 3GDFA 4H7FA 3ZX4A 2C7RA 3W5IA 2QSUA 3H05A 3JPYA 3GLFE 4H4DA 2PKYX 4ENQA 4PZZA 5J9FA 1GPDG 1N5DA 4YLGA 3F8SA 3M8KA 4BNTA 1RM0A 1TYBE 3EDRA 1SZDA 1KQFA 1R7RA 3AIKA 1T29A 3ZNQA 4NZYA 5L3QA 1XL1A 2C7QA 3FZQA 2WA1A 1G9SA 1NRIA 1XQYA 1J2YA 4MHTA 2NSYA 1BXRB 4BLOA 1R2QA 3VQTA 2FLKA 3TX6A 1W4RA 3LDUA 4JBNA 4FHEA 4WZAB 2ZBQA 4XJXA 5CA1B 2ZIWB 5IJAA 3W5SA 4EHFA 3TX2A 5DOVA 2F1IA 4GOJA 4HWGA 3O2JA 2O2DA 2V0CA 4BO7A 4PYKA 1S5PA 4QOJA 3KJHA 4MV3A 2CVPA 2NYAA 3NZEA 3TIXB 3FOBA 5D3MB 5J2UB 4CL0A 1F4PA 2BF7A 1JHAA 5G1PA 4AJEA 3BKWA 1KY2A 2IYWA 3FMIA 3UHPA 2XXAA 3ECAA 3K09C 1NURA 4FGZA 1DJNA 3W06A 2CL5A 4P4TA 3ZWWA 3IODA 1SBCA 3IBSA 4G4SO 1TO1E 2WP8J 4GBED 4IEFB 3JTEA 1AQYA 2RGAA 3U62A 3LX5A 1OZHA 1FTYA 4GEKA 2PCLA 3K92A 4AIRA 1BYUA 1Z22A 2VSOA 3G49A 1BCSA 3PRHA 4MQ4A 3B78A 3GXBA 4GXNA 1F5SA 2XBLA 4R51A 5F35A 3S2FA 1T2UA 5F7XA 4N5DA 3ZXUB 5C5EA 3P9IA 4MP6A 1CJMA 1XVAA 3CGWA 5E8RA 3D6MA 4K6FA 3EXIA 2FQYA 4P93A 3PNMA 4H1HA 1SVNA 2JHPA 4QUIA 2AG0A 5I9BA 1IBLB 2I80A 3UW1A 4F4JA 4W5RA 2BFAA 3C5CA 1C9YA 5K8IA 5DSXA 3SPXA 1LLDA 4XQ9A 2JD1A 3AZPA 1U3UA 2C8KA 5KAMA 2GLXA 2DKOA 4JI4B 2EJUA 1CCWA 3C7TA 4QUAA 1R8YA 1EXVA 3N87A 4RZQA 5WRFA 1CERA 5CXXA 2XB6A 3DQZA 1SUCA 2Q3HA 5FBVB 4YAUA 1DXHA 5HA5A 3OQMA 3PUZA 5AJXA 2PZGA 1UMBB 3DXYA 1NVKA 3AR7A 2PAFA 2AYYA 3QSGA 4Y0VA 2WUDA 5CLQA 4F3KA 3C3DA 1J24A 3OQNA 1NJSA 5K8VA 4PGGA 4NVRA 1D4FA 1J49A 1OYOA 5JXIA 3K0KA 3GJYA 4OX9Y 4M0LA 3BVPA 1IRIA 5KJEA 2CFTA 2IEAA 4JXXA 4BV8A 1H9CA 2CLDX 4OA5A 3QW4B 5D7BA 6LDHA 4G0XA 5AK5A 1Y5NA 4TROA 1HQDA 2B1RA 3FWPA 1J06A 4MR8A 4W1RA 3I9KA 3GCGA 4OHMA 4B8WA 3WA7A 2OE2A 2I3ZA 3IL2A 4N5NA 4FFSA 4YH1A 5KNDA 2MYUA 1LA2A 2YRFA 3PA8A 4GYJA 4KE7A 4R6XA 2J1LA 3DHVA 3QXCA 3UHAA 3ILVA 1M2EA 2Q3DA 2PRZA 2W2KA 1P2UA 1SB9A 2WJZB 1HNNA 2ZE5A 2NP7A 2VWQA 2LPMA 3LK6A 2V1XA 4L4XA 3FJOA 5CK5A 5LBIA 4IV5A 1JWBB 1PQUA 2C2HA 3H8JA 2H2HA 3GJ6A 4N0MA 1EKXA 2ZIFA 2EQBA 2HQBA 4F5WA 5BV8A 3JQ9C 5CH5A 4AUEA 2WHRA 1OBHA 1F3LA 1MZPA 3GDOA 3CR8A 3JATB 1GN9A 2IITA 3E81A 3ENZA 1N32B 4M88A 3RJ9A 3TFQA 3UAWA 3BZWA 4G8JA 5JQGF 5BXQC 3JASA 5AT1A 1CFJA 1U8CB 2COEA 2R7KA 2X5XA 1SOAA 5IAEA 3I5YA 5FPTA 4OHKA 3KKQA 1A9SA 2FDCA 1WSWA 2RH8A 4NJMB 4DEYA 3EZFA 1FU4A 3U7JA 5BN1A 1FFGA 1E5VA 3ZI7A 4Y1EA 3VPCA 4CTOA 3ROEA 1DJQA 2CWWA 1DBPA 4MWSA 2ZSEA 2H1WA 1P4AA 1N75A 2M1XA 2AJLI 2Y9MB 4QSMA 4RK1A 5JSZB 3Q6IA 1PYDA 2BKXA 5BPFA 3RFVA 5KWSA 2JATA 1P6UA 2BISA 1KAQA 2QEQA 3FSEA 4S1OA 1ZGHA 2WU0A 2IEGA 3B70A 4DEVA 4F3YA 5BWBA 1VPWA 2W2VA 1H93A 4S24A 4HD8A 3FHTA 4YCJA 4CM6A 3G0HA 1WS6A 3D7KA 2VTVA 3GXOA 4B75A 3WL3A 4D3XA 1QMGA 2H92A 1G2OA 2OC4A 3SN6A 1ACMA 1C4KA 1ENZA 1U0SY 4PG5A 1GDHA 1IBRA 3SVZA 4QICA 1ZUNB 1YHYA 3JYOA 3QV1A 3G7SA 3R5KA 4ZAZA 1RLOA 2ADFA 2AVNA 2HAEA 3C87A 3CZQA 4HDAA 2XQGA 4JVMA 1UMDA 2RHTA 4RJKA 3P20A 4EVQA 5IUJC 3ECCA 4AMBA 2ONKA 2PZEA 4N9WA 4B2PA 4B6GA 2MYTA 1SBIA 4D3YA 4D42A 1TM7E 2IIBA 1GKYA 4JNCA 4MQ6A 1V2GA 2V58A 5A5GA 1P33A 1KJ8A 2YWGA 2HXSA 2ZB7A 4FMBB 4Y3UA 4X7BA 1VJCA 2RETA 1MQ8B 1G3MA 3EZ9A 3IVGA 3MTAA 3QEMA 4G4GA 4ZO6A 5BYBA 4ETIA 2FPWA 1B74A 4FNAA 1VECA 1Y89A 1A9PA 4GQBA 4O63O 3ETNA 4HWKA 2QM7A 3KXDA 1UJ6A 1NFQA 5BSMA 5B53A 5DKFA 4MROA 4Y2GA 3IURA 1GSHA 1K06A 2RCYA 5DHAA 4J2TA 4RSHA 8ATCA 3ANNA 3IBCA 3EC2A 1Z33A 4G07A 4HPXB 1I8TA 4EPTA 4LOJA 3BTVA 1YOVB 2QPAA 4PSCA 2YN2A 4J0GA 4L8LA 4LSWA 1IPHA 1DG1G 5H0IA 3R7WB 4QDUA 1RQ7A 4E30A 1EUCA 4YJHB 4OVKA 2C7BA 1H85A 4ZKDA 1P9RA 2H0QA 3T5MA 4CJXA 1EIWA 4MW7A 1W2HA 3SZLA 2W9XA 3LL4A 1POWA 3B9RA 4QQFA 2F90A 4JJFA 3CKMA 4EIWA 1H4QA 3PVSA 3W9YA 2O1SA 1WCYA 3ITKA 1WHSB 1GVNB 1QOZA 2IVFA 4TSFA 1YZUA 1WV0A 1Z6QA 2BCJQ 2Z1DA 1DCFA 4DIFA 3L02A 2G28A 3RTDA 2WMNB 4FFNA 2R2AA 1BEUB 3T7RA 3OHMA 4B6PA 2OV2A 5KOYA 1WXEA 3LC1O 2OENG 4O2AA 3TIIA 3GR6A 1JDZA 3JD1A 2MINA 3N6VA 1ZM2A 4MR7B 3I09A 3CT6A 1OZ0A 1E7YA 1XU9A 4DANA 4JC0A 3QF4A 2IIVA 3WLMA 1G6KA 1NP6A 2IDZA 1SCJA 3MQFA 4FK8A 4J0FA 3ELDA 2CXRA 4EMSA 2REXB 1Q11A 2P6OA 4WK2B 1TKBA 2HCTA 3HO8A 2RJOA 3PP8A 3PA6A 5L3VA 4QU9A 4K1LA 1JDJA 4OQLA 4WOPA 2CLMB 3ZHOA 1U7HA 5HOEA 2CNOA 1SVLA 3MOIA 1NKVA 1QZUA 1E1RA 1HMPA 3I34X 3UKOA 4ER5A 1R9GA 3M5DA 2B1JA 3NQ41 4ZO9A 1WXDA 2X8WA 3MJDA 3DULA 2P77A 3BCRA 2P3OA 2BY4A 1G20A 1WVIA 2HNBA 4BLVA 3FVVA 3QLVC 4C2BA 4TVSA 3A4YA 1XAJA 1QDEA 3I9MA 3PUKA 1G5HA 1KARA 4M1TA 1XZGA 5A6VA 4RL6A 2GD6A 3WKAA 4V1CA 2JJ1A 1WUYA 4PV7A 2H1HA 1W0CA 1IE3A 1OKKA 3O38A 1QIGA 4G8CA 4I5IA 1Y6QA 4H7IA 3O3CA 2ECOA 3HY6A 2IYNA 3ZTWA 2IYSA 4DA7A 3ID6C 4IHAA 4IFBA 5ALQA 4RGQA 1USKA 1ISSA 1TGVA 3RC1A 1EINA 1JLLA 1N8NA 3D5QA 2RH4A 3BGWA 5DNUA 3O93A 2ZT6A 5DGCA 4EPRA 1NU8A 2CHGA 2WFAA 3I9LA 3CZ4A 4OUDA 5AOVA 5AJTA 3AP2A 2SKCA 3LUAA 2OKGA 4CIAA 3OQ6A 4J3NA 1QIHA 4MKHA 3UOAB 5CFPA 2YNMA 1AQNA 3DZKA 2QOEA 2J0UA 4WGFA 3SHFA 2IHKA 1STOA 3THOA 2C2KA 3RUAA 5KREA 2F3QA 2VDLB 3ZY3A 1S2NA 4N8EA 2HPHA 2H52A 5FULA 3WMEA 1V6AA 4AMVA 1Z12A 4LRWA 4YJDA 2EKDA 2QMUA 1L5VA 4PBTA 3VYUB 2VK8A 5C8ZA 5KTNA 2XKBA 3L8YA 5KWIA 4IV0A 4CM4B 2XXJA 4H0NA 4DSTA 2Q1UA 4R1UA 3L0YA 5LJLA 2SECE 3L06A 1T8TA 4KDRA 2WEKA 2WUFA 3R5HA 4FFDA 4ALKA 1MZVA 1ZMXA 1YKSA 1XJQA 2WG2A 3EVFA 3F7OA 4L08A 4XWKA 1JYSA 2X22A 3PXCX 3NIBA 1RLIA 4X1IB 3X0DA 3ZGNA 5KX5B 4OEHA 4IS2A 4GOOD 1Q20A 1P8AA 2GN0A 4MYRA 2XE4A 4PR3A 1SRQA 3GO4A 5KPDA 3RKSA 3LK7A 1X9HA 4D8TA 1ZOIA 2I7XA 1NDHA 2DPMA 3DE3X 2Q1XA 1UUFA 3QFFA 4UFNA 4XQ0A 5DBGA 1B0AA 1YZKA 3FUVA 3H9CA 2BMVA 4KVZA 2ACEA 2Z2ZA 4EKGA 5JS8A 3ASUA 1MKYA 4RKQA 4AQDA 3DDHA 2EIHA 1WUIS 5HUHA 1F2UA 4P2GA 5B12A 1SVIA 1R8SA 1WF3A 2YXNA 2ZIXB 3H7IA 4MUEA 2A3RA 4QXQA 4W7SA 4BFUA 2DPGA 3SKVA 2GM3A 2R1ZA 1PG0A 4JZKA 4EENA 1U2GC 2BKEA 3M5CA 1OU0A 2I2XB 3UMFA 4UZEA 4TMFA 3V8RA 1D5WA 2CLSA 1AS3A 5EFZA 2VS1A 2NUAB 4JKOA 2BZ0A 2YWCA 1WKBA 5HE8A 3E9CA 3D0QA 3HKEB 1N6OA 2JIZD 1EQUA 5DULA 1TZBA 5EC8A 1R5NA 1KVSA 2DJ5A 1XA3A 3C8MA 1BA2A 2IEIA 3HEBA 4CCAA 5CD1A 1VYHA 3ECSA 4ZAVA 3COYA 1S2IA 1ZHFA 3RE1A 3QX7A 4N41A 1DC6A 2ZB8A 1IZZA 5TS2A 3D2CA 4F4CA 4IIBA 1MJHA 2V7GA 3HL4A 1DIAA 1XOIA 2CY0A 1M6NA 3QJ5A 5CNKA 1HTBA 1Q74A 4QJBA 4FKBA 2BP7B 4B3CA 5TLSA 3D3KA 3LUJA 1BW9A 5FXMA 4E1BA 3JD4A 3LPLA 4KRXA 4W5WA 2HWWA 2G9ZA 2DCMA 4CDRA 3E5NA 5JBQA 3HV0A 3G89A 4HNQA 2QT0A 4WUVA 1N5RA 1R3UA 4FCVA 3K20A 1UJCA 4DLTA 2AFHB 3G5MA 3UGQA 5KQPA 4BY9E 4FSDA 2UZ4A 2IP1A 4IDNA 4V0LA 1HORA 1QHFA 2NXJA 1NKTA 5GV8A 2ZJ4A 2ZR8A 1Y6RA 4M4SA 5BN3A 1C1DA 3L4JA 1KC3A 2CW5A 3HCFA 3A6PC 3VR2A 1LUAA 1P61B 3KKNA 1NUPA 2XSZD 3PNLA 4KR9A 2HMWA 2QX7A 1CLUA 4OY3A 1JDSA 5F1PA 1YZ3A 4FGKA 5K0LA 1WB4A 2ACKA 1UKAA 3BMNB 4XGRA 1S3GA 4BMSA 2A9RA 3B1JA 3FZGA 1R0ZA 3HYTA 2BT4A 3TK1A 5TY0A 3UO8B 3UG7A 4NZ9A 1O3YA 4GOXA 2H8GA 3DFZA 4NECA 2YWXA 2OV8A 1B23P 3TLAA 2R25B 3AX6A 2WD7B 4LY3A 4WEQA 3RV4A 1GEEA 3TLKA 1VHWA 4RDXA 1GZ5A 5J2TB 1ZH8A 4AZTA 1TC1A 4G0QA 1JMKC 3AJRA 1AKNA 2PXCA 4BEBA 5BNIA 2YMQA 4P3YA 4DLAA 2QN2A 1VC2A 5E7JA 4MVCA 1NF8A 3KEOA 4Q03A 4YRRA 1G20E 4O5OA 4L75A 2D54A 1N6KA 2EAUA 2HLDA 1LLQA 2OILA 1ZD2P 4ARUA 4BMZA 4KE9A 1A5ZA 1XO1A 3BD7A 3HCWA 5D1HA 2PD4A 5GIPE 4K9LA 2HB6A 4WBNF 4U5QA 2VJPA 5HHTA 2V55B 3DYBA 2ILTA 3FVWA 4O4IA 5H68A 1IBSA 2W2LA 1ARZA 4N7JA 4BFTA 4EO9A 4Y1FA 1DELA 1G291 3F1LA 1UK9A 2QIPA 1U4OA 1EFLA 4V2IA 4BPBA 1BWRA 1YDFA 4ZTBA 4LQDA 3UVEA 1RQXA 1CDZA 3QM1A 1HE4A 2JJ8A 2V4ZA 3NKFA 3IHWA 4ZVTA 4M0FA 3HCNA 4RTQA 5IKMA 1NY5A 4D82A 4X71A 3UFXA 2B4AA 4WHMA 1FPMA 1JEQB 1HV8A 1XI2A 3QF7A 4NCHA 1SXPA 3IDQA 5L4LA 3C4QA 4DLYA 4IDBA 3V4OA 4DDUA 3QLEA 3UXEA 2CDBA 1ODKA 1EFTA 2BFMA 4QUHA 2OCXA 3SYTA 3PITA 1CDOA 2B4TO 2E4WA 2O5VA 1GQSA 3E9DA 3IAM1 1Z39A 1QH9A 4N48A 3JYNA 3LJKA 3MJRA 4KOAA 3X2EA 2P9JA 5BUCA 1RHRA 5REQB 3DDNA 2IT1A 2H2AA 4FGLA 3QNUA 1QNLA 1I3MA 3VR4D 1JSZA 1XROA 1J8QA 3MRVA 4XWTA 3DMGA 4JJEA 2B0CA 2YIMA 4BS9A 4EF4A 1ND6A 5LL6P 5JVDA 1OWNA 3AERB 3RC2A 3TW8B 3JQ8A 4FQ7A 4GX1A 3LQQA 4HWSA 1SG9A 2XV1A 3AFIA 5EHGA 5BV2P 5JASA 2VP9A 1GZHB 3FPLA 4NIMA 2Z2XA 2AYZA 1B93A 3OI7A 4YLEA 1H1DA 1WD7A 3ZOZA 3ROMA 4RTRA 1HE8B 1OSNA 1R9MA 2YJ5A 4DMRA 4FGJA 3H2ZA 4IH9A 1ZRHA 4IDPA 5CPBA 4YJFB 4FLMA 4DAEA 1I3NA 1UINA 3KR1A 3MB5A 5AUQA 1DQSA 5AIAA 3NWJA 2P6UA 4YWHA 2HZBA 3LCVB 4JYBA 4RPJA 4ECEA 5A62A 2WTAA 3RGGA 1K7EB 3UT5A 1LEHA 1L8AA 1X3LA 3I8XA 2BSXA 3FR7A 3P5BA 3SIRA 3ANSA 4EBFA 1AHIA 4DXHA 1X7ZB 3L7DA 5AKYA 4UATA 3I2FA 4XRGA 2P6MA 3AVTA 1MRZA 1G2IA 1N3BA 4R01A 3DMYA 3F6SA 4XLZA 1DFHA 1QGAA 1E6CA 3SZMA 3CEJA 5LNK6 1E9SA 2PEZA 1XTTA 3IOCA 3GCZA 3HADA 1WV1A 3BORA 4XKJA 4CETA 1PE0A 2BKVA 1WEHA 4TM8A 2R8EA 1L1RA 1GA1A 4MS4B 1UMCB 1DIBA 2HCRA 2XGSA 4U9UA 1URPA 3FCUB 4IVRA 1ZX1A 5IJ0B 4HGPA 1VL8A 3A26A 1YE3A 1TYAE 1KU6A 2PVPA 3O0DA 4QDZA 4YMUA 1N0HA 3TLXA 3WGGA 4Q9NA 1R4NA 4K0KB 3AGQA 1Q0HA 2F3UA 3BS4A 3LKBA 3CKLA 3M6IA 3K70C 1Z0JA 1WPRA 1T2DA 2BGRA 2XT6A 3HLYA 4LOLA 4AQYB 4YY3B 1E3JA 2W6CX 2ZUCA 3GC6A 4YACA 3LY5A 1U7PA 1ZY2A 1XDSA 4TVKA 3UMYA 5ERYA 4F8JA 3GFTA 4IHJA 7ABPA 4B5LA 1JB1A 6REQB 3F4KA 1PU2A 3TM4A 4ENRA 3UH1A 1TAQA 1VIVA 2VT3A 3VNRA 1YUMA 3DNFA 4UVHA 4DT1B 4ZDJA 5KTSA 2IEYA 3FLAA 4RH3A 1RI4A 5KYWA 3MFQA 2QTBA 1TMKA 2PUTA 3KE8A 3JVEA 2FZWA 2H8KA 3LCRA 3CJRA 5EJIA 3WYCA 3E4DA 4KO1S 1IONA 4KXMA 4JLMA 4RMIA 2XCOA 1QVVA 4CYMA 4OBEA 1PCXA 1SK8A 2Y2VA 2DOKA 2E9SA 3PV0A 4L95C 3TGPA 4XFJA 2Q4TA 2FSGA 4L0CA 3GOQA 3KPWA 4EFKA 2X0FA 4ZI2A 2O59A 1ZU4A 2HA5A 2R6FA 1JT2A 3WG9A 5HUQA 5KSOA 2OESA 2EG5A 4LHWA 1YS4A 3W34A 1P4HA 4JBIA 3UENA 4Y0AA 4WA7A 4JYZA 1CUJA 4ND7A 1WXFA 5IXJA 4OHRA 1ESZA 1MX5A 4TV9F 3WGQA 1I14A 5ER9A 2FK8A 2IX9A 2II6A 3G8AA 3IVRA 3K2IA 3KDAA 1A88A 3NAMA 3RKUA 3KALA 4ATNA 4DQ0A 3K0HA 3BMOA 3A37A 5JS2A 1NXSA 2CKDA 3JZMA 5LZ7A 5I7UA 2AUMA 2FUKA 1ZZEA 3RAGA 1VHDA 4FCCA 3GUUA 4RPIA 2CMFA 3KYJB 3LOQA 1ULUA 3V55A 4TTRA 4DMFA 1VI5A 4NMXB 3D8SA 4KACA 2VTEA 5AKGA 5FFNA 5AQEA 1UBGA 3GJ5A 5IF3A 1ISRA 1GU7A 2AE2A 5C3MA 2OGUA 4MUNA 1DBIA 1NR5A 3ENKA 1EX9A 2XUHA 4AULA 1L7VC 4WVLA 1XZLA 3K70B 3AUKA 2X5NA 3BFXA 5IJZA 8MHTA 4D02A 3RS2A 2CUTA 3CZMA 4A2QA 5BVHA 3BD6A 4DMHA 4G2TA 3WDLA 5EHXA 2GN9A 3DQPA 3IVAA 3H6KA 3MPUA 2BFCA 3U17A 5I7RA 4L8YA 2WQZA 3MERA 1C0LA 1Y8CA 1RE0A 3EIEA 1LPOA 1JHRA 1GCOA 1P0PA 3PQ4A 1XZPA 2HBZA 4Y0NA 3FVRA 3PWSA 1D8TA 3AV3A 4FOTA 4H3KB 4DNQA 4EJSC 1SXJE 2C83A 3IFSA 1ZRSA 3LW7A 5E3IA 3ZBTA 1IIRA 2VHXA 1Z74A 3JAKA 3Q1KA 3T3IA 4NC9A 1BQ4A 4HADA 1ZNQO 2K2WA 3D6UA 4ZQEA 1Q0PA 3H5RA 3LX4A 3ZDBA 3HCRA 1SU7A 3EFHA 4C5AA 4HGYA 3G8BA 1G63A 2AG8A 2P5YA 1TEHA 2PMCA 3MS2A 2DHQA 1EP9A 1VMAA 2YHIB 3MCZA 1BNCA 4TQGA 2AT1A 3H84A 5T6MA 1OC4A 2ARKA 5B6IA 2BBOA 1GCAA 1XA0A 4XOIA 3MRSA 3WB0A 1QONA 3A4LA 3GEPA 1GILA 4ZREA 1SUBA 4B46A 4QXMA 1WD5A 3MS4A 1T5IA 4J0HA 1ORVA 2CN1A 1U8XX 2XCRB 3B20A 1WHTA 4WEOA 4UEOA 3VKGA 1LQUA 2OV4A 2Z57A 4HDQB 3EWIA 2IXAA 4MLCA 1Z8FA 3O84A 3LHSA 3PLAE 2PGAA 2PR7A 2A6PA 3G9UA 4F5EA 2BM8A 3IIEA 3CINA 2FWPA 3PQ7A 2XWBF 3HEAA 2SCUA 5T5QA 1EK0A 3WRVA 1APBA 2AQHA 2DETA 3R3JA 1ZI8A 2C03A 1OLSB 2EW8A 2HI0A 2J87A 5BURA 2RKOA 3UH0A 4RC9A 1PIWA 3ZDEA 3FD8A 4MPPA 2GZAA 1XD9A 3N5CA 4PYOA 3KQUA 1Z29A 3CW2A 2P2ZA 4LVOA 3U49A 1FVOA 4PFKA 2A0UA 1WABA 2ZJFA 1NRXA 4PZPA 4MUMA 1LV8A 1H1LB 3DMDA 4IPTA 3OQOA 2ZI5A 4ZVKA 1FFEA 5JAQA 1FB5A 1LV7A 4AKTA 3SFZA 1H9AA 2ZAMA 3HUFA 4KGZA 4R40A 1RQRA 5HE9A 4EHIA 5IJ9A 2EDCA 1NQXA 2DUJA 1LX7A 2EV9A 4XIFA 1T3SA 4MRMB 5L95A 3RU7A 4JJAA 2NX2A 2JDID 2NO9A 5AKZA 3T3MB 2QLBA 3G5TA 5DRTA 1U9IA 4EJSB 4Q7QA 2W42A 1IEXA 5EIXA 4KQJA 1MOQA 1R4AA 3IKMB 1E7RA 1ZK2A 4LY0A 3WISA 4F6CA 1XFAA 1JJIA 1UFOA 1NN0A 1ZVMA 2Z04A 5DP2A 4CL2A 5L9AA 4WOCA 5BNFA 2WMOB 4LSGA 3FYUC 3BFKA 3UA3A 4DIMA 3PQEA 4LJ6A 1L4BA 1E2FA 4Q6BA 4R6WA 3GW8A 1NYQA 1P7CA 2IYVA 3UMVA 2G1UA 4UULA 2ODTX 1QJ4A 3COZA 5DM0A 4DLZA 3I2IA 2JLWA 3IV9A 4LRSB 1JIQA 3ED1A 4RK6A 3H4IA 4QT4A 3ZWDA 1X13A 2R8RA 4ZCMA 4Q4AA 1E8DA 3D9QX 5HK9A 4PQGA 3CB2A 4XASA 3GLHA 2OBNA 1OAKA 4QGFA 2XUIA 2EG9A 3P7MA 1G8MA 1RJ9B 3GMSA 4V3CA 2G6BA 1R64A 3ITDA 1X1DA 3OHSX 1KDVA 1HWYA 5C1IA 3W7VA 4US2R 4PXAA 1EFPA 2YZNA 3NYQA 4RLQA 3P45A 1VIMA 3ILYA 2WNSA 2A54A 5IZCC 1A04A 4IINA 4KIJA 4TS9A 4BNUA 1XF1A 3VH3A 2R4UA 1NW7A 4IWXA 1W75A 4QBIA 4EVSA 3AHCA 1VE9A 5TEWA 2HWXA 3BQ9A 2ZTVA 3MNFA 3R5SA 1AUXA 2A58A 2J0QA 1DKQA 1K86A 1XC7A 1NR1A 4DA0A 1J0DA 1GEGA 1NHGA 4O2BF 5EPEA 3ADPA 2GRAA 1N9GB 2HCJB 1C2YA 4IH4A 1QGZA 3IUEA 3OEWA 3OZSA 4KDEA 3X1WA 4Y2PA 5L51A 1H8EA 4FJ2A 3ZNNA 2IP2A 1E2MA 3P9PA 5I4CA 5A2QA 2IC5A 4FINA 1R8XA 1M8PA 2AIRA 1W4CA 3KHKA 4RZUA 5FWDA 2O57A 1E0SA 1VMIA 3M7IA 3OPXA 1AMOA 2CCKA 1Y4SA 1EJ0A 1R6XA 4YP9A 3ELBA 5KSPA 4LFCB 3K71B 3R6GA 1V8OA 1QH1A 1U9JA 3QU4A 4ZIRB 5DXJA 1V11A 3AL2A 3MTGA 4YQYA 1Z5PA 4FOSA 4W63A 1OTHA 2QMOA 1J9EA 1KY4A 3A06A 1P7WA 4H35A 4AF6A 2AWNA 1QF9A 4EJ6A 3D2AA 5JJ5A 1M75A 2GPSA 2ODEA 2OHIA 4XYGA 1Z18A 4YQEA 3BHJA 3KQTA 4M7PA 4YTEA 2OUKA 2NTJA 5LMZA 1G7RA 3TLZA 1RXUA 2WZDA 5KUTA 1ORRA 3H9GA 3E05A 4B6QA 3ESDA 2YQZA 4PX2A 1G59A 2H4YA 1UL1X 2WHQA 1ZD3A 2VJKA 4KLAA 3PT5A 5C52B 4LTDA 4TTIA 1CYEA 2NQTA 4RU1A 3IE2A 1PVVA 2D3TA 4P7GA 1NUQA 3L0DA 4PLYA 5EJEA 2Y1GA 2ZVJA 5I9NA 3I5XA 2C7VA 3KB1A 4JWTA 2VNAA 2FPIB 1QS0B 2OAEA 4UPDA 4A6PA 2IJGX 4L5IA 1QANA 3B7PA 2DR2A 2D62A 1R5BA 1KSJA 1Y3HA 1P7PA 2GEDA 2REQB 5AKLA 4MMYB 1XMXA 3V7UA 2ZUFA 1GUBA 2Y0BA 4RHEA 3PNOA 3BMXA 3IPLA 2VQEB 2NVUA 4PNEA 4FXPA 2O8BA 5FR1A 1PK7A 1QX4A 4ER0A 2R00A 5JSKA 3RYTC 4XX1A 2BEWB 3WFZA 2XMGA 3PRJA 4JL6A 3UCFA 4A2PA 4B6RA 5HW0A 3RU2A 3V1UA 3WI7A 3E1KA 1V6SA 2J9FB 3T61A 2L17A 3RVJA 1L1EA 2W71A 1LK5A 3KXKA 1ZIOA 3PQ2A 3E4CA 5CVDA 3VGPA 4BO6A 4NBKA 3OPMA 3PE4A 5FPQA 4FW9A 2VQSA 1U2TA 3I3SR 3VYRB 5HYVA 4I4TB 1RIFA 3EEOA 1YI8A 4MYCA 2EC5A 1N8SA 2AK2A 4H3SA 2WSIA 5AK6A 5LN1A 3NYIA 3HKDB 3TMYA 3MELA 2W2QA 3FCOA 2Z56A 5CGZA 9ATCA 4DV6B 4NK5A 4GZMA 4HBGA 1BKSB 3BXGA 2PH1A 3HKBB 2HRCA 4I8IA 4IX9A 4D9HA 1DUSA 5CXUA 2BYTA 1JVBA 1I4TD 4NFYA 4OHZA 3W2EA 3R7AA 1CQIA 2I3AA 1DQNA 2FE1A 5EXCA 4RORA 2GZSA 2NYVA 3SOZA 1GPJA 3S8MA 4D45A 4ERNA 1I9CA 1RAFA 4QUDA 5FTJA 1GDTA 1U8UA 1J8MF 2ONCA 1BDMA 1F3OA 1M5UA 1QF7A 1ZKMA 3A1DA 1A71A 2XCUA 4DLSA 3IRVA 1YQGA 2BGKA 1XAIA 2R44A 3NH6A 4FNOA 5TV2A 4C0XA 1E3WA 2GEJA 3T4XA 4AXXA 1E94E 3NASA 1M34B 4IDCA 4UTXA 1RZUA 1Z34A 3UJ7A 3V1NA 4Q9LA 2FA9A 2VJBA 1TMYA 1Z07A 3D1VA 4QDOA 2KPOA 4MCJA 5CX1A 1RS0A 3U60B 2QL5A 3IALA 1I24A 2VUTA 3ZTYA 3WQSB 2XE6A 3EPKA 1CY1A 3E8SA 5ICGA 3IAAA 3U4GA 2Q0QA 3SNKA 1ZD5A 3IRUA 4NESA 1JZQA 2VJMA 5BWOA 4MB2A 1EK5A 1SXIA 2WLTA 4R8RA 4IGFA 2A4KA 1XRPA 3K31A 3U4CA 4MUYA 3C6ZA 1DOHA 3TNFA 4ED9A 3S44A 1N2JA 1U6JA 2W4QA 5C3UA 3G9QA 1HEUA 1RP1A 2BVNA 3P71T 4CWAA 5FUQA 1E89A 3SLRA 4ZEVA 3NIWA 1A7UA 1A2KC 1EJ6A 2EKZA 4GKBA 1M6WA 4PHTA 3EY4A 3G0BA 1Z2AA 4K5QA 4CVNA 1UM9A 4AS2A 2A9FA 4KO2S 3GCDA 2Z6UA 2UZ1B 1MTOA 1PFQA 5IK2A 1P1BA 4K81B 4BKPA 3CMCO 1XEXB 1R18A 4E5PA 1YR7A 4QVKA 5FV4A 2GW4A 5JXGA 3DG9A 2C5AA 3GLHE 4JJ7A 1F14A 1HYHA 4LX8A 4WX2B 2P27A 3SJ7A 3FDZB 5LWQA 5A0VA 1VPDA 1C80A 4D4MA 2Y76A 1K89A 4MINA 5LP6B 4HDRA 2FEKA 2V6JA 3UJ3X 1ZJZA 3UOGA 1FFXB 1FOEB 1HSZA 5BW5A 5HQ3B 4ER3A 1OFUA 4QQRA 2A3NA 3PYXA 4RLHA 4BKUA 2IRWA 1QHNA 1NAIA 3SZGA 1ZD4A 1F6WA 5DCYA 2MSCB 4B83A 3WOHA 2X5OA 2HJRA 4JMPA 2NGRA 1O96B 3UJ8A 1ZQ1A 1H65A 1QGOA 4ZQBA 5D5QA 3EGEA 5LKAA 4LF7B 2Q21A 3WJ2A 4C2TA 3RVLA 2JK0A 4CEIB 2HADA 4YCLA 3O4IA 1FQWA 5AK3A 2QJRA 1Q0ZA 1NNUA 3ZZ1A 4A36A 1GKUB 2H2WA 5IC4A 1GFZA 2XY4A 3LRPA 1ESCA 3N28A 2FN4A 1TB4A 4B3TB 4XB1A 4ZI3A 2X8AA 1TK3A 3LIIA 3DO6A 4XGQA 3KB2A 2AQKA 4HTFB 2XWSA 2PYDA 4JI1B 5DGHA 3U39A 4XIYA 4YXFA 2WKPA 5J59A 1CD5A 1S3FA 1XNQB 3DPIA 4ZCLA 5TX7A 3E35A 1QPBA 5COBA 1WY7A 1OB2A 4BYGA 5I7FA 3ORYA 1BCRB 5HKKD 3OA2A 2VDWA 2Y1KA 4E4RA 3F7MA 4FZ3A 4C5BA 1UC9A 4KK3A 2PX0A 3L7IA 1SY7A 1YBMA 1IXSB 4X7MA 5FQOA 4QYXA 3PTZA 2H1SA 3EG5A 3WGYA 3DA8A 3OPVA 2Q49A 1EHCA 2V7PA 1IN5A 3NVDA 4J3JA 5C4GB 3ER8A 4CLXA 5HPYB 4RD4A 3PX7A 2IDJA 4WNAA 5LU9A 1PZEA 2C42A 1OGJA 3LZ6A 4QTUB 1CVLA 4GR4A 3ZJYA 3AVQA 1KBOA 3OQIA 3R5XA 4CR8A 1KYWA 1J39A 2C5HA 3I5UA 2BFDB 4QOFA 5ICFA 2QBYA 4X20B 3AI3A 1ZS9A 1LDBA