4MQ7A

Structure of human cd1d-sulfatide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
273
structure length
268
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d, Cd1d1 protein
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 65
structure length 268
sequence length 273
ec nomenclature
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mq7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mq7A01
4YFLF 4M4PA 4XH2A 3O4OB 3QAZB 2P5EE 1KEGL 4NN7B 3ROLA 5IKCA 2XNAB 1D7FA 2X4UA 1KB9J 4TPRH 1CLZL 1LEIB 2YUVA 2F54E 4PV9A 3RVUD 3TN0B 1OW0A 2DLGA 4NO2A 3RDTC 2D4DA 1AE6L 3VFSB 4S1DD 3U46A 4N1EA 5E5MA 3E6HB 3L3GA 3B2VL 3Q6FB 3MLXH 2OQJB 2W9DL 5SWSE 2D7OA 2EDJA 4XP5L 5KSBF 4EI6B 4IRSA 4M61A 3MMEB 2O93L 1F00I 5DQDH 5C0AD 4M5YH 2ADFL 1A3QA 2R2CA 4XP1L 2P4AB 3PGDB 1D3CA 2IAMB 1S7QB 4XCNA 4MQ7B 4FFYL 5CEXB 3LEXB 1RUAH 1S5IL 1NGXB 3F7VB 4LBEA 3QDME 1Z9MA 3O6KL 5D7IA 5DJ8A 2HFEA 4GKZA 2N56A 3AREC 5F3BA 1DVFB 5C0RH 3DUSB 1A7QH 2B5IC 3S8WA 1NCBL 2GTWB 3OKLA 1LO3H 5EORL 5FGCB 2DQJL 3GSNL 1RUPL 2JJSA 2Z31A 1H3PL 2IADA 4I13B 3OKMA 1AGEB 3BHBB 2A0LD 1M7DB 2QLVB 5T3ZD 3BESR 4WI7A 3WFHB 4WEBH 1P2CA 1CK0L 4U1KB 3ZE1F 1MCWM 4Q6IA 4U1SA 4XNZB 1YQVL 2VH5L 1ZK9A 4JZJB 2WBJA 3L95A 1J7VR 4UQ2A 2AK4A 2PR4L 4QGYA 3BRDA 2Q3ZA 5FYLD 3KLDA 3L5XH 1QBLL 4FXKB 3T2PA 3VA2C 2AEQH 4IHOB 3OB0H 1K5NB 2SEBA 3W0WB 3TBYB 4UUJB 1I1AD 1F3DH 1JWMB 3I50H 4HBQA 3SDDB 5D6CA 3LH2L 3I3BA 4LLDA 3FRUB 3D39E 4O9HH 4WO4D 4CVZA 3BKML 3VFMB 1WGOA 3O3BB 5EC2A 2XZCH 1VSCA 1S7XA 2R4RL 3BDBA 2YKLL 4OLVL 1CIDA 1T83C 1Q9KA 1VPOH 2D7PA 3CVHB 4EKXA 4FQXA 1FL6A 4RGOL 4PJGF 3QDMB 2BVQB 5DC9B 4HJGB 4NO3B 5HHOE 4ORGA 3E3QA 1CR9L 3O3AA 1BM3H 1TCMA 1IGFL 1NUDA 3B2UC 4TSAL 3FHAA 4NPYB 4ZAKB 3M1BA 4LOUC 1KIRA 3CX5K 1UH3A 3V5HA 5C09A 2VXVH 3B83A 3DSNA 1CLOL 5I6XB 2UZYB 5FOJA 1JZ7A 4MNQA 3MCKA 4MJ2A 4LSRL 1C16A 2KUTA 2W91A 3U36B 3OF6D 5L7XH 3HC0A 1UM6H 2J6EH 2XYCA 2DQCL 1U8MB 3IFOB 2QSCL 3U7YH 4TVPE 4HF5L 4OCMC 1N5AB 4L3EE 4N0RA 1PG7L 5HPMB 1BAFH 1OAZL 3DO7A 2HRPL 5TDPB 3QG7L 3BRFA 1UWGL 2IC2A 5C0EB 4NFDA 4Z77B 3CFEA 4XBPA 5J1TC 4M6OH 1XF2B 1MJUL 3S96A 2DQUL 1UVQB 5I76A 3I75B 1F6LL 3KYKL 4YHOL 3O4OC 3QAZC 5JOEA 3WS6C 3J8F7 5JORB 4HHAA 5EIIA 3D39B 4QXUL 1U8IB 1D9KD 1H3TA 5C9JB 1W0WB 3WMSA 3BWAA 5EU7E 1ZGLM 3QDJD 4J4PA 3PDDA 3TN0C 2IH1A 2OK0H 5CIPA 4FMKA 4E0RA 1FNEB 2IMNA 1R6VA 2XN9A 2XI9A 4X83A 1DANU 4Q9BA 3QUZA 4NM8H 4UDUB 3T2QA 4PP8C 3HI6H 2FIKA 2E6PA 1I85C 1IGYB 5B38B 1MUJA 1UXWA 3ARDB 3BDYH 5HYJB 5BZWB 1XMWA 1YEFL 3M8OH 3ROOB 4B7LA 3MV9B 1N3NA 2VWEE 2E7MA 1Q1JL 3VFNB 3LHPL 4XBGB 5BXFA 3FKUS 2IALA 1I8KA 2VMFA 4A2MA 3C2AL 3IVKB 1I4FB 4C56A 5T1MA 1FL3B 3MLSL 5C3TA 1XGYL 3RX8A 3H9SD 4PLJD 3T65B 1KNOB 5IFAH 2A1WH 3QPQC 3KPLA 4PP1C 1TCRB 3CH1B 4CMHB 2VXUH 1ORSA 3ARQA 4QHMA 3W82A 2AQ1A 1INQB 1ORQA 3PWNA 4YO0B 2BXZA 3CDGA 2KDGA 4A6YB 5HVWA 3MFFB 5ISZB 2WIIB 2AJZA 4GAYA 2AP2A 3S4SG 5C6PB 4XNZC 3ULVL 3MJ9H 4YGVA 3U2SA 2Y7QA 3MXVH 1BP3B 3I9GH 2DM3A 2XPGA 1VENA 3IYLW 4KFZC 4GW5B 4LGSB 1MOEA 1FNFA 1SYSA 2R69L 5AZ2L 3ORJA 1QR1B 3IJYB 3FL7A 2AXFB 2W59A 3TVMD 4DTGH 4WU5A 5HHQA 1G6VK 3MRPB 1CD1A 4TN9A 3T3MF 3U9UB 4E42A 4JQXC 4QWWC 1MLCA 1QRNE 2APFA 2Z8VC 4RAVB 4V2CB 5B4MD 2XA8H 1WWAX 2AJYL 4QRSB 5DZLA 4NT6A 4XXDA 3KYMA 3SOBH 5J57B 1NBZA 3L6FB 3BOVA 5KTEH 3ZE0E 3ZO0A 4YBHA 2NR6D 3LQAC 4OCYL 3DSFL 5F88B 3RIAF 2UUDH 1AO7A 3EO1A 3KPRE 3LVEA 3AROA 4F33B 3PL6B 4JFDB 2HFFA 3UBXG 3CLFL 2YMXL 4ZAKC 4HGKC 4FG6D 5C0CE 4WUKL 2VDNL 3X12A 5KAQG 3MNWA 5K93A 3UTPE 1GGUA 1P84K 5BZDB 5EULV 2ICWI 3T4YB 3QNZB 5I6XC 4GG8A 4L9LC 5D71L 4NKDB 3V7MA 1DQML 3KHOA 2R0LH 4LCUA 3T0EE 3DV6A 3HG1B 1HDMA 4H88H 1OGAB 1U95B 1WK0A 4HJJH 1E6JH 2OLDA 5MEPB 3QFDB 3SO5A 5SV4A 5TQ0H 2AJUL 3VFUA 4HPOL 3O9WA 1A4KA 1VHPA 2XG4A 3T08A 3HA0A 4L5FL 4X6CB 4E41D 3VE0B 3H8NA 3FO0H 3Q48A 2VDLL 5JA8B 1X6LA 3QDHA 1OGTB 1X5GA 4NNXB 2Y5TA 3PWLB 5K59F 1CU4H 4XWGH 4U1IB 4GLRH 3QEGH 3W39B 2CDGA 1MJ8H 3GRWA 4LVNB 5SWQB 4YR6B 5DS8B 4KGLA 1T66C 4LPWA 4LAQH 5GRUH 3PV6B 4UTBL 3V6ZA 4NQSB 4WI2A 3MLYH 4L4VE 4FFVD 1YN6A 4H1LB 2NMSA 4OJFL 4X8JB 1T03L 3BGMB 4BSVA 3CMGA 1EVUA 3HI1B 4EUPH 4RGNE 3HE6A 4E5XA 4XPBH 3RVTC 1L0XA 4N0UB 4YAQA 2H3NB 1J0ZA 4HBCL 1LO5B 4PJ8C 1P4BL 3IDGA 2X40A 2FWOB 4KVCH 4U6HA 1FV1A 6FABH 3WIFA 1DUZA 1FG2A 4MCYA 3WNLA 4LCWD 4YHZH 4NZTH 5BVPL 1UENA 4U1LB 1OTSD 2V2TB 5D1ZB 3PV7A 5HVFB 3S36X 3G6AA 1JK8B 4X7CC 4QY8B 1XGRA 4X6BA 2WLZA 1F97A 4CMHC 3UJIL 1YEGL 2CD0A 2HWZH 1BJ8A 1YN7B 3B9KD 3DROB 4HUMB 5DUMH 4M1GH 4LLVA 1CFTB 1NUFA 2EDLA 4DGVH 2Q76A 1OAQH 4XWOC 3WKML 3WXVH 5JHDD 5IBLD 2C3VA 4JY4B 4YBQC 3BP5B 1DBML 2YA1A 3V6OC 3WO4B 1PAMA 5F7FA 1UKTA 4M8QA 4KMQA 2ICWB 3TGXA 3HRZA 1NC2B 1BLNB 2ZCHH 2CQVA 1UYWL 3TH4T 1MWAB 1MFBH 1DQDL 1W0VB 2CSPA 4P2QB 4QHUB 3QCTH 4NWTL 4ZXBC 4L29B 1IFHL 1R3HB 5FCUL 2DQEL 4CJ0A 3QG6B 4AH2A 3QCUH 2CLZA 4ODWB 1WQVT 3MLTA 1KPRB 5CSGA 4LVOC 3PDGA 4MAUH 4MMZC 4KJQD 2BOCA 5JNYA 3IXAB 3GJFA 3EYOA 4WHDA 3TCLA 3QA3B 4MVBC 2ZNXA 4RRPA 2NXZD 2ED7A 5GGRB 1XGPA 3T04D 3G04A 4J3VA 1TMCB 1YQ2A 4DGYH 1FYTE 1V3KA 1ZVSB 2BSTA 4XMLL 4NQED 4HG4J 1BQUA 3PL6C 1VCAA 1T80A 1U92A 3LKNB 3TF7A 1JGEB 4U7MA 1G7MB 1TNNA 5DJDA 3FQWB 5JXAL 1QFWI 4G8GB 1B0GA 3ES6B 4KVNL 2ERJC 3QIUC 4RDQG 2F5BL 1X5HA 2DI7A 2DLIA 3IS1X 1ZA3B 1YPZB 4LVEA 1WSST 1NCTA 3ZHLA 5L88H 4OM0L 3GHBL 4X5WB 3HPLB 2I24N 2Y5EA 2QV2A 4WW2B 3SCMB 1HN1A 4HIEA 1FBIL 5MEND 4EUPG 5JPMB 3T77B 2GJ6A 2HJLA 1IM3B 4IRSD 4OCXL 2Y4SA 3RJDA 3RX5A 3LS4H 3QZWB 4M62L 4P3DA 2FRGP 3LSOA 5SWZB 3LKPA 4QRPA 1MAJA 5JW3H 2YD4A 4WI8A 4JO1L 5DD6A 5DFVD 4KY1L 1A5FL 4XPHL 1I8MA 1G7IB 4MXWH 1QLEH 4AM0A 5F7YC 2ITCA 4LVNC 5FV1L 2FGWL 4JRYB 4PJIE 3CNKA 4Y16D 1WV7T 5BW7C 4R3SB 4IMKA 5EBMB 4F9PC 4MXVF 3HNVH 3SGDI 2DD8L 5TE7L 3D3VA 3MROA 4FQPA 5DMGC 2VDML 4LLYA 1C5BL 3PHQA 3OKNA 1Q9LA 2F15A 4F57L 3EYFA 3IXTA 5CBEB 1FSKB 5CJXC 4DFIA 5AD0B 4PG2C 3RFZC 3D69B 1S9WB 4GKSB 4UINL 1OAXH 3E6FA 4JHWL 4UV4L 1FFRA 1FCCA 4Z7UF 4YHKL 3GMRB 3CFCH 4X8XA 1XR8A 4PRNB 3QHFH 1EXUB 3S6CA 3HI5H 1A1OA 3OKDA 5JUEH 5EOCL 3S3SA 1BX2A 1OARH 1QBMH 2V7NA 4OI7A 2WINB 1F4XL 2V2WA 1G1CA 1A2YB 2VKXA 4NYLB 3GMPB 5D1ZC 3CPLB 1BFOB 5EO9A 1F4YH 1IM9D 1A6ZA 3FO9B 1DANT 2Q7YA 2WWMC 3W5NA 3MRJA 3INUH 1GC1C 1GGBL 1QYGL 4WHTA 4GRLD 4ZPVA 2NY2C 4O2EA 4BM7A 3H3BC 4Y5YB 1P7KB 1JGVL 2UVEA 2NTFA 3BQUC 1NCDL 4LL9A 1HXMA 5D1QA 3CVHH 2VDKH 3LQAH 5CD5D 1M71A 1JNHA 2CRYA 1EBAA 1BFVH 3AS1A 4GH7B 3C60B 4JJ5B 3WO4C 1RSFA 3JVGC 4KU1A 5GS0D 4FFWC 4FNLL 1KPUB 5BQ7A 3QUYA 3UO1H 3BPOC 5D7IF 2E27L 3TIDB 4N0YL 3OR7B 3WHE0 4LCCA 3TFKA 4YXKH 2IBZY 1NH6A 3BKYH 2BNUB 2ZPKH 1JCKA 5D1XA 4D9LH 2E3VA 3BN9D 4PR5B 2VDPL 4NOBA 4U7SA 1WBZA 5I9QB 1N7MH 5IV2B 1C1EL 1OF2B 3P0YH 1WLHA 5IW1B 3OTTA 2R23B 5I17A 3PNWB 4JDZA 2EDWA 1KIQA 5CP3H 4F37F 4OB5L 3GB7A 3PUCA 1K4CB 5EU3B 1VADB 3QFJA 4JG0L 3VG0L 4ODVH 1KB9K 1D5ZA 3C6LB 3VJ6A 2PYEB 1A7NH 5C86A 2F53D 1V3LA 1HIML 4NKMB 1TFHA 4DVBA 3ULVD 4ODTH 1YNKH 4MA3B 1J8HE 5BV7B 1HE7A 3MV7B 4R4NC 3QHZL 4JFXB 4LRIA 3D0VB 1PG7W 3ZE2E 5GS1C 1IEBA 2AEIT 2PO6C 4NDMB 1DL7L 2XZQH 3KGRA 4Z78A 4EI5A 2HVKA 3L5HA 4WEUD 2HFGL 5DHXB 5FUZH 43C9B 3PWPA 3OSKA 5F7HA 4HS6A 1GZPB 4FXGB 1IKFH 4J4PD 2DBLH 1UACH 2XN9D 4WW2C 5HHPB 2I60L 4ZUUB 4JG1L 4PTUA 1PQZB 1OWRM 2IH3B 2KQNA 5FO8B 3SCMC 5I16A 3G9AB 3W2DH 5DSCB 1AXTL 2KL6A 5HY9A 4DUVA 3L3DB 1ZLUH 2I07A 3TEUA 5HGBB 1T3FB 3VCLB 3WSQH 2BMKB 5IVXF 2EIZA 4PJDF 2YD8A 4N8VB 5H35B 5J11C 3PQYE 1MHEA 3GNMH 5IHBA 3F65A 3LDBB 2AV7B 2MPAH 3PWJA 1CCZA 4L3CB 3MRGB 3O0RL 4ZFZB 2O5XL 4XCYB 4HQQH 4LIQE 3NCBB 4P46D 3ZL4H 1QFWM 1T0MA 1F45A 3CSYB 1AR1C 1M7IB 2FJFB 1LD9B 3EHBD 1A7OH 1K4DA 3STZA 3VWKB 4UOJA 5HI4C 3TZVD 4YX2H 5DUPL 4BFBD 5L2KA 3A6BH 4A6YH 2YXMA 2EICA 3EDJA 2AKRB 2XICA 4ZPTB 5GZOD 1WCBB 5J89A 5T1KD 1QBAA 4JPWL 4ELKA 2MQ3A 3X13B 1FFNA 3QUXA 1LDSA 1NGZB 4O2FB 5C0BA 4X9HA 3RX7A 3C5ZA 3SQOH 3QO1A 4H26B 5IFHH 3SEPA 5J6GA 2W38A 5ITFB 3RWJA 3QQ4B 2PXYA 5E6IC 5IESL 3NCYS 5A2KH 5FYJE 1ZLSH 1YY9C 3QWRA 3PHOA 4NKIH 3G5ZA 5J4MA 4KHTL 2CKBA 2DQFB 2DAVA 2FBJH 3QXAB 2ORBL 3TIEB 2BERA 3GUTA 1JHTA 2R0WH 2P8MA 2X4OB 2AEPL 2UZXB 1IL1A 2VC2H 4PJCF 1T1XB 1VGEL 3EIFA 4Y5YC 4XNMB 3UJJH 1ZHLB 2X10A 5F1IA 3ZHDA 3R8BB 4M48H 2IQ9H 4ZUWB 2B1HL 3UAJD 3OKOB 1KLFA 3MLUL 5EUKA 2XWTB 4Z7QF 2J2ZA 2Q20A 1EZVY 1NANI 1KN2L 4KDVA 1AO7D 4GW1A 4AL8H 5IB1A 3WN5C 4N0FA 1CICD 1I7ZA 2ED9A 1N64L 1TZHA 4PJXB 4OFPA 2NZ9C 5E7BA 4U6XB 1CGWA 1KJ3H 4PJEA 3BMWA 4H20H 5IMMB 4OGZA 3MRMA 5ITBH 1U8LB 4U0QB 3MRFB 2QADB 5HGDB 1EAJA 1RZIB 1MCWW 4YEEA 3S34H 5K9JH 4K2UH 5I9QC 4OCSH 3ARGD 1AKJB 5B38G 3W5MA 1LQVA 2BJML 4OSUL 4Q6YA 2HT4C 4JFOB 3V79C 3WE6A 3K80A 3NCEB 1GAFL 4RNRB 3C6LC 4PGCB 4Y0GA 5BRZD 2P5ED 4Y1AA 2YA2A 3AB0B 1E4XL 2VYRE 3L1OL 1GL4B 4NWUH 3IDJB 4NSKB 4PG9A 1AI1H 1AHWB 1TIUA 5BV7C 4QTIH 2UZIH 1NLDL 4ODXB 2CGRH 2ESVD 3SE8H 3U0TA 5KZCB 1NFIB 5DK2A 5C7XL 3K2MC 4ZFOA 4JZOA 3B5TA 4R4FL 3UPCA 5A2FA 5I1AA 4NM4L 3G5YA 5EO0B 5C07B 1WBYB 2Y36L 4RFEB 5A2LH 1SEQL 1FFOA 1A0QH 4YPJA 4JN2A 1MFAL 4K7PY 2GSGB 5T5FL 3R06B 4H1LH 3JTCA 1SJEB 3EGSA 3VXPA 3RL1B 5EFIB 1G9MC 3LKOB 3N1QC 3T0DA 3NIFE 4JFEA 1T7WA 4L8DA 1KELH 1VB9A 3H3PH 4Y4HD 1F11B 1CYGA 3A0OA 3HTLX 3LDBC 4Y19E 5CKGA 4J3TA 5HI5C 2ARWA 3MRQB 3U79A 3MXWH 3OAZH 3Q1SH 1CXFA 1SQ2N 5DR5L 4KQ4L 3GBNL 3VI3E 1IBGH 2OL3L 2GIYA 4OI8A 1HQRA 5HD8C 5CBAB 4JY5L 2FB4H 3SGEI 5KSUA 4J1UA 3STLB 4LDEB 2HJFB 1Y6NR 2CLVB 4HD9A 5D7SL 4HIXL 3GSRB 3VWKC 3QULA 5ESAA 3CDYA 3O11B 1MCNA 5C0IA 1YMMA 1T20A 1LWRA 1HINL 4QGTA 4JKLA 4U1NA 4GOSA 1HZHH 1PD6A 4QOKA 3VXNA 1CD0A 2JELH 4XVSH 1P7QA 1QR4A 3O45B 4HJ0C 2DRUA 1YEDB 5SX5H 5IT2H 2O5YH 2YPLA 3LAFA 4MA8H 2V9QA 2V17L 5BJTB 2K3TA 3QWOB 2FATH 5E9DD 4LRNH 1MWAH 3RGVC 3C87A 1WFNA 2NY3B 3TBTB 2HVJB 4DOHE 2ED8A 5T1DL 1BOYA 1EO8H 2X4RB 5J56B 1IT9L 5KSVB 1G6RL 3C5SB 5HGGS 4M3KB 2R1WB 1EIBA 1DJSA 3OKEB 1KT2B 2CUIA 2H41A 4KK6C 4NQDE 4XRCA 2NY1D 4RFOH 1WCQA 1QFWL 2A9NL 3S4SA 2JB6A 4BZYA 1QA9A 3VGDA 3D87B 4NQVA 5HHOD 4PRPA 1QSFE 1K6QL 5DJYB 2CIKA 1R0AH 3FQRA 2CRMA 1LO3L 4JFYB 5D70L 1P4LB 1A4JB 2WSKA 1TZGL 1UWEL 5B39B 4XP6L 4HH8A 1I8LC 1YYMH 4IMLB 5T5NF 3S35X 1DN0B 4C83B 1BQLL 3F58L 4WEBL 4AQOA 3FFDA 4CDGC 3FMGL 3H42L 4IOFC 3MV8B 4PJ9A 2CO7B 4JPVH 1DQJA 1EHNA 2QHRH 1RZ8A 4Z7VF 4U0RC 2J4WH 1WC7B 4GRMA 4L3ED 1I9JH 5I8CA 5J3HD 4JFPA 2AJSH 1U3HB 4H1LG 4OZIE 3QEHA 4PLNC 4HT1L 3AM8A 3LQZB 1NGWA 2BNRA 5TPWH 2BNQA 5LGHH 5FXCH 1KJ2B 5GISL 2AEQL 4LSVL 1ITBB 4PYHA 4OCNC 1PKQE 1OP3H 2ZSVB 2OXHA 4F8QA 3O2DL 5IB4A 4D8PB 1AFVH 1OP9A 3UBXA 2FSEB 1I1FA 1J12A 3PGCA 1MIEH 4PRAB 1NQBA 4JANA 4YDKL 2B8OT 3VFTB 1HCFX 4WUUB 4X5XB 2H32B 2YRZA 4ZMAT 3UYPA 1AHWC 1I3RB 3T2OA 2VL5A 4TNVF 3SPVA 2XZCL 4OD2A 1SJVA 1TJHH 3UYRH 2VIRA 3CZFB 3RKDC 4HFUL 3FT4A 3EYSH 1CN4A 3KLHD 3T0WA 4K7FB 1QFOA 1X7QB 4DN3L 1U91B 3GSNA 5HHME 5DUBA 3VD4A 3DNKA 2LVCA 5DTFA 5ACLA 4OI9A 1TENA 3IF1B 1Q9OA 2CH8A 4UNTA 4IOIA 2AGJL 2OXGA 1JGLL 3BIKB 2FEEI 3ZHKA 5JLZB 2R9HC 5DD0H 1GGCL 4IS6B 2K9UA 2VXVL 4JRXB 1CE1L 1I3GL 1X5FA 4QXTA 3OGCB 5I1KL 3AY4A 1W8OA 3O3EA 4V1DE 4ONGH 4X9IA 3G08A 1CVSC 2AV1B 3FCTA 3L7EB 4CNIB 4I0PA 4KAQH 3C5JB 3HZYA 4GXUN 5EU5B 3IFLL 1G9EA 3AXLA 3GBMH 3LKSA 2OS7A 3EOTH 3U7YL 4S1RH 1SVCP 5CSZB 1LHZA 4FRWA 1FIGH 1R3LA 1BZ9B 4J3WA 3THML 4U1MB 3NVQA 2H2PC 4OZGB 3WNPA 3QEQB 1VFAB 5DQJA 4G9FB 5I8KL 4DGIH 5IMKA 3MJ9A 5AAWA 1MHHB 1EEZA 4XAKE 2P24B 2R0KL 4TOYH 1T1YB 1T5WB 2FX9H 4XMPH 4YWGL 4BZ2H 1DE4B 3MUJA 2NW3B 2CKNA 2FDBP 2GTZA 5D1QD 4PRHD 3S7GA 4X6FB 1JVKA 1DBBL 5HI3D 1FQ9C 3TJEH 5F89A 2DM2A 5E00A 3U6RB 4UIKH 5D2LB 1ZS8B 4M43H 1KCRL 2H1PL 4XHJC 3QXDB 3VXMA 3NPSB 4R8WL 1T5XA 1TJIL 1HKLH 3JWDL 5EC1A 1YC8A 3CZJA 1KB5B 4C4KO 2Z4QB 3D2UA 1OAUL 4PY7B 3B3IA 4JKKA 2V2XB 4I1NB 2JE8A 3EFFB 4KI5D 1XGTA 4QRUA 5DHVB 3FONA 5DZNA 3WFEL 4CADB 2NCMA 1QTYT 4DKDC 1QFUH 4J3XA 1ND0B 4X6DA 1BQHB 3F62A 4KKBC 1EMTH 2VDRH 3QZWG 1QNZH 4BK4A 4W6YB 5E5UB 3IDNA 1NEZB 4RISH 5JO5B 4JB9H 2HTKD 1HHGB 4LIQL 2VE6B 4JFQB 3QFJD 5HHNA 1B4RA 1S7UB 4XMKH 1RIVL 4TSBH 1MJ7H 1OSZB 4BH7B 2H45A 3VXRB 2BVYA 4D0CB 4WI6A 1S7VB 1KLUB 5BV7H 1C12B 4G7VL 2DOCA 3KWWA 1I1YA 1QLFA 3BKCL 4P5MB 3LKRA 5H2BA 2YZ1A 4PRID 2XY2A 4WO4C 3SDCA 5AAMA 4CU8A 1T0NB 3OPZH 4DN4L 4YPGB 4HXAH 5DMKB 4XP4H 2CJUL 1U3HC 4PRDB 4I3GA 3O4LB 4H25B 1IGIH 2MNUA 1FVCB 4ZFFB 3DECA 2G2RB 3WFCH 1TQBB 4UU9B 5F96H 3VD5A 4OD1H 2YPVL 2E8YA 4Y4FD 1G9MH 4P23A 5FYJL 4XCCL 1Z0NA 3MCLH 3WEXA 1OQOA 1F13A 2YEZA 5FM8A 1ZT4A 1JNLH 4X6EB 3CK0H 4P2RB 4RCAA 5EU4A 3RNQB 4FOMA 4IRZH 5E2VH 4I3SH 1W72L 2X1PA 4F3FA 1LO4H 1JGDB 4U2YA 3WIIH 1MAMH 2N7BA 3FO2A 3BH9B 3HMXH 4G9DA 1XZ0B 1KPVB 3GMNA 1NBYA 5KTEL 3HZKA 1SYVB 2B7DT 4UILH 1OTTD 5J13C 4MDJA 4HC1L 1AY1H 1I7RA 2ICES 1CXHA 1JUFA 2VLJA 4KROB 1G7PA 4KI5F 1QPXA 2Z8SA 4EUPA 3WV0A 3GKZA 4RMUA 3CXDH 1MI5B 4WFED 5CUSH 3I84A 5CFHA 1V7MH 4D3CL 3MCG1 4RZCA 3JTSA 4UIMA 2EYTB 3RWHA 3DX9A 3V2AR 4MXQC 3HMWL 1FAIL 5EU6B 4RX4A 1MCEA 3UROR 2P44B 5F21B 2YSSB 5GQBA 1IE5A 1A1NB 4K7PX 4PJHB 3SKNA 3V6OE 5E8DL 4QHNA 1FDLL 1U3ZA 4H5SA 1GYAA 5KN5B 2AJXH 3BSZL 5F1SA 2NX5A 1E6JL 3DURA 2E5EA 1UKSA 2VLKB 3ARBB 1ULVA 3KDMA 1U41A 4KK8D 3TO4C 3DXAA 1RI8A 1KJMB 3UTSA 5DT1H 2PXYD 2GCYA 3ILPB 4C57C 2CO6B 1G7LB 1QBBA 5C6TH 2G5BB 1RJYB 3FO0L 1VERA 5ADPL 1LILA 5D7LA 3LV3A 3CC5A 3WD5L 1TVHA 2J5LB 4ZD3L 3QUMA 3KYNB 4FA8A 4FZ8L 1U8OA 3L3JA 4XWGL 1YECH 4NP4L 4JAMB 3QEGL 1F42A 1JIBA 4YHMH 3RBGA 3RWGB 1MJ8L 3IU4L 2VQUA 1WFOA 2X4SA 5HVHB 2H9GA 4LAQL 5JOFB 5I18H 3AS0A 4X99A 4BFEA 2EC8A 3RKPA 4NN5B 3MBEA 5ACZA 1GGIL 3FHQA 3P3YA 4FTVA 4KKCC 1PZUB 1PY9A 3NPSC 3BE1L 4U1GC 2R1XA 5CEZE 3OAUH 3QXUA 4HW6A 3HFMH 5CD3A 3IFNH 4XI5D 3W9EB 2KQMA 4XPBL 4TRPL 1CDYA 1MRFL 2G60H 4NC0B 4OD3H 4XPFL 5F6IC 4TTDC 1M1SA 3R1GH 3SDAD 4MD5A 2B0SH 3SDXA 5JW4M 4KVCL 3QIWD 2Y25A 1TPXC 3GSOB 2AXGA 3MUGB 4KUZH 3OJVC 4Y4KC 3OXRB 5MI0B 2Z91B 4C55A 2IF7A 1XAUA 4EOWH 3H7LA 3SGKC 4MX7A 3FB6A 2R2BB 4JQIL 5IGXH 3ZLQC 4N8VG 1DSFH 1MH5B 2XNAA 4ELMF 2WQ8A 1IAIH 4Y1AD 1LEIA 4U1JB 3TN0A 5KSAC 5AG9A 3VFSA 1PSKH 4RGMB 3BP6B 2CDEA 3BX7C 2D4FA 3EYVB 2MHAB 1DR9A 5INCB 3E6HA 5CJ5A 3Q6FA 1QHPA 1N0XL 1PDKA 4WWID 2BOBB 4G6AC 5CAYB 4EI6A 3MMEA 4R9HA 5FDWB 4MB4A 4JE4B 1JHLL 3PGDA 4PBVC 3TPUE 1N26A 3LKQB 2IAMA 1S7QA 2WK2A 4OBRA 5KVGL 4MQ7A 5CEXA 3LEXA 1TQBC 3T1WA 4KDWA 4KUCD 5ENWB 1NGXA 3F7VA 3K1DA 1MFBL 2IGFH 1PYWB 5JIPA 1DVFA 5CJOL 4Q58C 3DUSA 1V8HA 1WAAA 5ILTL 3G6DH 4OF7A 2GTWA 3QCUL 3BT2L 4GRWF 3DARA 4NZRH 3KLAB 1OTUD 1UXSA 1LP9E 5KVEH 3V0VB 2BK8A 3BHBA 3UXFA 1M7DA 3IJSB 4PJEF 1R5WB 4ZS6C 4XT1C 3WYRA 3WFHA 1F02I 3U0WH 4ZOCA 3RTQB 4RMWA 4U1KA 4XVUC 3N85L 1XIWD 4R4BB 1UM4L 3RVWC 4RBPK 5FYJU 1HSBB 4JZJA 1CDUA 4HEME 3FQNB 5E8OB 3P4MB 2C3WA 1YMMD 3EZJB 3KAAA 2ZCLL 4FXKA 4QHLB 4IHOA 3W0WA 5KOMC 4BFGA 3TBYA 4XC3L 4UUJA 5IWLC 5I71C 2OR9H 3UX9B 3SDDA 2P1YA 5IW3A 5JR1H 3FRUA 4U4BA 3ARBC 1TQCB 4UV7H 1FZKB 4JQXA 4CJ1A 3HC3H 4CUCA 3VFMA 2ZJSH 4MAYB 1Q72L 4Y88A 4S0SD 1UZ6E 3LS4L 3O3BA 3DMMB 3E2HB 4ONHB 1RUKL 4Z7OE 5JW3L 2P47B 4KPHH 1CXEA 3CVHA 4KZEL 2ZOLB 4X7DC 3QDMA 2BVQA 2XKUA 1YNLL 4HJGA 4Q0XH 4NO3A 1RZJC 1U8QB 1U8PA 1VDGA 4PRPD 5I73B 4ZS7H 4NPYA 4ZAKA 1OM3L 2XOTA 2WBJB 1L7TL 4KKLD 3O3UN 5EPMA 3HAEB 5HGHB 4K94C 4UQ2B 2AK4B 3I2CL 4XPAH 1G9NC 2IPTH 4NN5C 1PG7X 3HNVL 4X9BA 3FQUB 2YPKB 4G6JL 4EN3C 3HNTH 3U36A 1X5AA 2P5WE 4ODHL 1IKNC 5L6YH 5I75B 4I8DA 1NMBH 4HIIB 2DQHH 1IC5H 4LLDB 5L8KB 1U8MA 3IFOA 1EFXD 2NYYC 4PJ9D 1NUGA 1B0RB 1N5AA 1BD2D 1Q0YH 2CK0H 2CUHA 4LEXH 4WV1B 5HPMA 1P1ZB 1FC1A 3KJ6H 3TJHD 5TDPA 1INDH 3P11L 4PGEB 3L5IA 1L0QA 5C0EA 1FE8H 3HI5L 4Z77A 5JUEL 5MI0C 1KJ2H 1XF2A 1RFDH 1PGRB 2FJHA 1UVQA 1X3DA 2RCSH 1CBVL 3I75A 1JNJA 4P59L 1G0XA 5IQ9B 3MOAL 5BO1L 2NLJB 3RWDB 2QHLA 5JORA 1ZTXL 1E4KC 3O3AB 2AERT 3D39A 5F7EH 1U8IA 3LN9A 5C9JA 2FEEL 1ZHNB 1AD0B 1W0WA 4G6KH 4XCEB 5TH2A 2H32H 3M1BB 4LSSH 2LE9A 1AIFB 1FNEA 2XQBH 4IRJB 3WIHH 4ETQB 2A6IA 4RGMC 1RU9H 2WUCH 2I25N 4JHZA 4MNQB 4UDUA 4UT6H 2VDKL 1QSEE 4HUNB 2AQ3A 3T3PF 4MYWB 1IGYA 3HKFA 2HT2C 1FRGH 5B38A 4APQC 3ARDA 5HYJA 1V7NH 5BZWA 4OCRL 3ROOA 2OTPA 3MV9A 3UO1L 3WNMA 5E8EA 5I1IL 1WBXB 5IQ7H 3BZDA 3VFNA 1F8TL 2IPKB 3PQYD 2UY6A 2DF3A 3IVKA 1I4FA 4ZTPH 1EHLL 2ZPKL 5ACMA 1RULH 4KKAD 4BUGA 1Z0MA 4IEFB 4NN6C 1EGJH 3T65A 1GCFA 4LASH 2X4PB 3LPFA 4I0PD 3JV4B 1TCRA 1MELA 3CH1A 1AQDB 4HHAB 1P5VA 1JNNH 4NC1C 2HMIC 3VXUD 3DV4B 1INQA 1OW0C 5CIPB 4Y2DB 4FQ1H 4S0UC 2N7AA 4A6YA 2H26B 3IDXL 4I9WD 3MFFA 5ISZA 1RY7B 4N90D 5IVZB 3MYJB 2XXCB 4OT1L 5F1NB 1G7HB 2EZ0D 3N9GH 1LEKB 2OZ4L 2A77L 3ULUE 3ARFA 5A3ID 1TETL 4GW5A 4EBQL 1F3RB 3BD5A 2LQRA 5DHYB 5B39G 3VFWB 1QR1A 5BXFB 1MCRA 2AXFA 3PP3K 4Z76B 4R26H 3MRPA 4U1HB 3PJSB 4H0HB 4KHXH 4JO3H 5KAQF 4O4YH 4ENEC 1TQCC 3O2WH 3W2DL 4IDJL 1ZE3C 4I0CC 3ET9F 4MAYC 4JN1H 4QRSA 1QFHA 2JJSC 3DMMC 2Z31C 3L6FA 3WSQL 4KDTA 1ORSB 4KRPD 5DHVH 4C58B 5KS9E 3TV3H 3U7WH 1ORQB 2MQ0A 3O8XB 5E6YA 5F88A 2WV3A 1RPQA 3TNMB 4XXCA 4M7LL 3NZHH 4F33A 1N59A 3PL6A 4JFDA 2E7CA 3KPMB 4Q6IC 3T0AA 5I73C 2Y06L 2PUQT 2ARJA 2WBJC 3C8KA 3OV6A 1KTLB 3U2SB 1V3JA 4JPKH 1J87A 2XPGB 2YK1H 3ZL4L 3ETBF 5BZDA 1YMHB 5H8DA 1BVLB 3T4YA 3ARTA 1OP3K 3QNZA 3MLPA 1BIHA 3ZDZE 1SM3H 1FPTH 4NKDA 4NCC1 2LU3A 4ZUTB 3V4PH 1H15B 3HG1A 2XG5A 3A6BL 1U95A 5E03A 1F3JB 4AIXA 4BK5A 3MA9L 2DQGL 2J8HA 5MEPA 3QFDA 1YUHB 1JTOA 1MLCB 4K3EL 4RWHA 2ZSWB 3GJEB 4WV1C 4X6CA 3VE0A 2EH7L 5IFHL 5L0QC 2C26A 3DLQR 1R3IL 1URLA 3VXTB 2BY1A 4FQXC 4NNXA 2C1OB 3PWLA 3ZZ1A 4U1IA 1DP0A 1EBPA 2NW2A 3W39A 5FO9B 3E3QC 3ARED 3CAFA 4OZFB 4XTRC 4YR6A 1QRNA 4Z18A 1Z6JT 4M1DL 5EOTB 5BW7A 1Y18B 1DUYB 1QOKA 1ZHBB 2R0WL 3SE4C 4RIRB 1A6VL 5F9OH 4CN6A 4NQSA 2EKSB 4IRJC 1IGJB 5IEHB 4L4TE 2EE3A 3SJVE 1EHAA 4YDIH 1D5MB 4GUPB 4H1LA 1FFPB 4X8JA 3BGMA 4LCUB 1ITCA 4O51A 2F19L 3KXFE 3HI1A 1HDMB 2VLJD 3KPRA 4X7EC 1I3UA 4Y2OA 1FAKT 2X4TB 5CS7A 4CGTA 4N0UA 3O9WB 2H3NA 4X6DF 3KR3H 2Z93B 5HDOA 1BEYL 1NFDB 3QCVH 2FWOA 5CEZL 5IIEB 2ARJQ 3I3EA 1FVDB 4JGMA 4RX4D 4WFGE 4BZ1L 5KVDH 4Z7NF 4U1LA 2Y5TB 4K2UL 5D1ZA 3VWJA 1F2XK 4D9RE 3FFCE 3RA7H 5F44A 1U6AH 1F90H 1JK8A 3K3QA 1NDMB 4QY8A 1T1WA 1EUUA 1T04B 2VLRD 3DXAD 1BIIB 4KQ3L 3UTSD 4Y2DC 3MRDB 5IBTH 4OLYL 4D94A 3V6ZB 5GGRY 3DROA 1CFTA 2BFVL 3QDGE 2EIBA 3QUZC 1BQHG 2XQYG 4JY4A 3RZCB 3BP5A 5D7LD 3BXNB 5F8QC 3L7FB 3JVGA 1NEZG 4QTIL 2F8VA 3B4NA 5CGMA 12E8L 2ICWA 4YHIB 1CIUA 3RI5F 2A2QT 1MWAA 4YAQB 4GKOA 3V0AC 1VA9A 3KPSB 4LOUD 4K94H 5DA0B 1W0VA 4P2QA 4QHUA 1UM5L 1G9NH 4MD4B 4L4VA 3VH8B 4R7NB 1G7QB 4L29A 4RDQF 1R3HA 3QG6A 3RWFB 5DC4B 4FTVD 3EOYG 4HXBH 1N4XL 3KXFB 3V8CA 4ODWA 3BO8B 1KPRA 1OQXA 1J1XH 1ZT1B 2J88L 3IXAA 2Q8BL 3QA3A 1TNMA 1KELL 2GY5A 1QSFD 4OLEA 5GGRA 1V05A 5KSBE 4M6ML 5MP6H 4Y8AA 2E9BA 1TMCA 1ZVSA 2R8SL 3V0WL 1CZ8L 4LDLB 4R97B 4WWKA 2NQCA 2C1PB 5EA0H 2GT9B 4QRRE 4RWYL 3LKNA 1JGEA 2M1KA 3Q1SL 4WI4A 1G7MA 4QEGA 3FQWA 2YR3A 5D96B 4LKCB 4G8GA 1FIEA 1IBGL 3ES6A 2Y9RT 5F7DB 3V4VH 1GC1L 1NAMB 1YPZA 1ZA3A 5E56A 5D7JB 4X5WA 3TN0D 1JPSH 3X14B 3HPLA 4NKQB 2ZNWA 2PW1B 1IGMH 1I9RL 3SCMA 5FECB 5JPMA 3T77A 1KBGL 3WHXB 1XGQA 4HH9B 1IM3A 1GVIA 4DKAA 3QZWA 3FAXA 5JNYB 5SWZA 1DBKH 4HWEL 4MA1C 1RZKC 1KGCD 4PTTB 3FZUC 4G8EB 3ZE1E 2Y6SC 4LGRB 5IOPB 5J12C 2BSTB 3Q2CA 5DMIL 1G7IA 4QXGH 1U92B 1FG9C 2YD3A 4JRYA 5BS0E 5DJDB 3QDAA 4R3SA 1RUQL 2DTMH 4P9MH 4JO2L 3QPQD 4PP1D 2OMNA 5E2UH 4ZSOB 4FQJH 1JMXA 3GEWB 2E7HA 1ZVHA 4KZDH 2OL3A 2Q87A 1HXYB 4NQCB 1FYTA 4ONFL 4S1QH 3HC4H 3UDWC 4ODSH 5CBEA 1DQQB 4PGZA 4FFZL 4JVWA 5AD0A 4HCRL 3VXSB 3ARZA 2GUOB 3SDXF 3D69A 1S9WA 3D85B 3O9WC 4GKSA 4NRXB 1PJ9A 5C0AE 4DAGL 1S8DA 2FD6H 2NY5L 2FHBA 3GMRA 4P3DB 3RAJH 4PJGE 3JXAA 1KENL 4PRNA 1EXUA 3DI2B 2ENSA 3RIFF 3R8QA 5ID1B 2GAZB 2RFXB 4FS0A 4LHJB 2WINA 4NYLA 1A2YA 3O6FB 5TDOB 3ULSB 3GMPA 3CPLA 1BFOA 1S7SB 3FO9A 5EBLB 2OCFD 1MF2H 3MUHL 4QWWD 1K8IA 1XFPA 1P7KA 1W2KT 4OLZL 1J0YA 4XAKD 4HKXB 4OF6A 1KEML 3ZT6A 3SDYL 4LLYB 1TDQA 5T3ZE 4OLWL 4Z95H 5GJTH 4AEIL 1Q9LB 3C60A 4JJ5A 1ACYH 3ALXA 3HE6C 4XCFH 3UTTB 1TJHL 2Z35B 3L3KB 4X80L 1E27B 1FNGB 3TIDA 3OR7A 3R0NA 4ZAKD 1CF8L 1ZLVK 2DQDH 1WAAF 4KTDH 4HWBL 2BNUA 3S36H 2FLRT 3ZYJA 2OJEB 3MSPA 3D1MC 4PR5A 4PYGA 5DJZB 5IV2A 1OF2A 1X5IA 5IW1A 1H0DB 2R23A 5EO9B 5KANG 3PNWA 5DQ9B 4M00A 2B1AH 1K4CA 5EU3A 4F7PB 1VADA 3P4OA 2O5ZH 1OCWH 4MSWB 4O2EB 4F58L 4G7YL 3C6LA 4KAQL 5IFJB 2PYEA 4I3RH 3TBVB 2Q6WB 5DD3H 3FT3B 1HXMB 3RWCB 2ZUUA 3HN3A 4KTEL 3LOWA 4NKMA 4HKJB 3RQ3A 5F72S 4S1RL 4MA3A 25C8L 5EUOB 15C8H 3MV7A 5D96C 4JFXA 1JRHH 2HLAB 1N8ZB 4OQTL 4X4ME 4RAUB 4NDMA 3MGOB 3EYUH 5B22A 5DVOA 1NMAL 5BQ7B 2I5YH 2GJZB 1S7RB 3VGEA 1LGVA 43C9A 4Q9QL 3OAYH 2W9EH 1GZPA 4FXGA 1T66D 4HUUB 1LK3L 3ULUL 4CVUA 4TOYL 4ZUUA 5F8RC 1PQZA 3TA3B 1TTFA 3VFPB 3C2SA 5DSCA 2R0ZH 1IARB 1P9MA 5HGBA 1T3FA 4KMTH 1ZANL 3WS3A 4LLQB 1KIQB 2J8UB 4M43L 1HYSC 3RVTD 4N8VA 5H35A 3SKJL 2BY0A 2R29L 1MRCH 4PJ8D 5L2JB 2AV7A 4W4NA 3KS0J 1IC1A 1KCUL 4L3CA 3MRGA 2XACC 3HMXA 4JGUA 4PGJA 3HS0B 4JO4H 2BVOB 4V3DB 1NSNL 4XCYA 3TF7C 2VDOL 3ZYOA 1I1AB 4AY0A 4NGHH 3GI9L 4GBXB 5KBNC 3CSYA 4Z78B 1C5CH 1M7IA 2FJFA 3QDJE 1BF8A 2QQLL 3HUJB 1MNUL 4HK3N 1LD9A 5CIPH 4EXKA 3T3ME 3VWKA 4GXVH 5AEAA 2AKRA 3ZSSA 4ZPTA 1WFTA 1FH5L 1WCBA 5ISZD 3X13A 4XWOD 1J8HA 1NGZA 1YEJH 4YBQD 4NZDA 1WIOA 3S5LB 1VESA 4O2FA 5BMFL 2HKFL 4KMLB 2UV3A 4H26A 3Q5OA 5H37H 3BPNB 3HAEG 4GQ9L 4ZTOH 3QQ4A 1CLYH 3G5XB 1UH2A 5F70A 3MACH 2DQFA 5TGBB 3WFCL 2V7HB 3TIEA 3LEYL 3JUZA 4HLJA 3UTOA 4MJIB 4PJAE 3D25B 2X4OA 5F96L 1T1XA 2VOTA 4XNMA 1ZHLA 1A6AB 1FP5A 1N6VA 4ZUWA 4MVBD 3OKOA 2RR3A 3H6JA 5CJ8A 3KPQB 1M6OB 3SKOB 3U0PB 5ICZB 2X09A 2W0KA 3NGBC 3PL6D 4JFDD 1QKZH 3GO1H 4UILL 5C0BB 1MREL 4X9GA 3V4UH 3C5ZB 1CXKA 4U6XA 5HTSA 3RVVC 2W65B 5K59E 3QIUD 1IGCH 1MCCA 1U8LA 5B3NA 5DLMH 3MRFA 5HGDA 1RZIA 2R39A 3RWJB 3WJLC 7FABH 1I8IB 2NY7H 3W81A 2LU7A 4N1HB 1HHKB 1PEZA 3HG1D 3LN4B 3PHOB 5I8EB 1AKJA 1OGAD 3X3GH 1RIUH 5TJWK 2CIIB 4PJ5D 2BVTA 3SE9H 5GJSH 2DIAA 4RNRA 4PGCA 1UJTA 1ZV5A 1RZKH 4M7JH 4M3JA 2QQKH 5I2IB 2JF1A 3MLZL 3IDJA 4NSKA 4DZBB 3X3FH 1AHWA 1D6EB 4JFHD 3A67H 1NGQL 4Q9RH 4ODXA 3MPCA 5C6TL 1NL0H 2ZUYA 1NFIA 2JCCB 1MRDH 4OZFH 3QUYC 1I7ZB 4ZNEE 1NGPH 3H9SB 4LCIH 2HKHH 5EO0A 4LMQE 4PJAB 4UNVA 5C07A 1ADQH 1C7TA 1TZHB 1WBYA 2ZUXA 2AJVH 1W72A 3TFKC 5JHLL 3ZTJH 1GRWA 4G42B 1KSRA 3TA3C 2GSGA 3BUTA 3R06A 5D1XC 1KCVL 3BUYB 1SJEA 4HC1A 5DMGD 2DL9A 4S0TD 4R90L 3RL1A 4E9LA 5J06A 1FNLA 1HSAB 1SY6H 1U0QA 1L9NA 3OR6B 2CMRH 2GYSA 4ZUVB 3T8XB 1Y6KR 5T33H 5H37G 4E41E 1F11A 2APXA 2E7LC 3LD8B 3LS5H 4FP8L 3OAUL 3NAAH 3MRQA 2BRRH 4MLSA 5LWYH 3N1PC 4UT9L 3TVMB 4XVTL 3RIAK 2H6PB 2B0SL 2H2SC 2ZUVA 4LRIC 4GBXC 4X7SH 5D1ZD 5DK2B 5CBAA 3GRWH 4Z8FL 2ZCKL 4M7LT 4EI5C 1KTRL 4KUZL 4CKVX 2F8OA 2P8LA 2WWMD 3NIDF 3CLEL 4GAFB 4P57B 3BIAX 3A6CL 3OXSB 3GSRA 1XEDA 2NY2D 4MDIB 1YEEL 4NNPH 3O11A 4YFEA 4IIQB 3REVB 1S9YA 3BQUD 4X6CF 2EDFA 4FQ2H 2AK1L 3EGSB 5HYSB 1AJ7H 3O45A 3L3IB 1YEDA 4G5ZH 2BC4A 3DI3B 1JV5B 2NY0C 1BFSA 3DO3A 3QWOA 1J1OH 2X89D 1S9XB 4FFWD 4JFEB 4P4KB 3QXVA 5IG7B 1NC2D 2FR4B 5CMAB 2VZUA 3ZDXF 3VFVA 2OM5A 4K8RH 3TBTA 1OSPH 2Y07L 2HVJA 4WCYH 1LO0L 1P6FA 3ZTNL 1XF1A 3GIZH 5T3XH 2X4RA 4P2QD 3MODH 5DRWA 3GIVB 3C5SA 4LCWE 4HX1B 2R1WA 3UC0H 3BP7B 1EJOL 4QCIB 3OKEA 1KT2A 2R4SH 3IRZA 1MHPL 1RZ7L 2EDDA 4OTXH 3BKJL 2OJZL 3FB7B 1PZ5B 5L9DL 5DJYA 1E4JA 1H5BB 2JK5B 1AXIB 3PE9A 3MR9B 4JFYA 4OUUA 1HEZA 2D03L 4Y19A 4KJWC 1P4LA 1A4JA 1QACA 4JFFD 4YHPA 1P4IH 5JHDE 5B39A 3ZDYF 4IMLA 3GMOB 3OJDB 5J9PB 1LDPH 1CD8A 3QUXC 1DN0A 4OZFG 1P7QB 4C83A 4R4ND 4AMKL 3C5ZC 5JQ6L 2YPLB 3T0BA 2PO6D 4PS4H 1L6XA 4FQIL 3MV8A 1FNSH 1X4ZA 2JJUA 2WIMA 3ZTJG 5JDSB 1P6AB 1NFKA 2OTWB 1U3HA 4NFBA 1JWUB 4XPTL 2BY2A 1J1PL 5I74B 1KXQE 3LQZA 2IBGA 3SCMD 4MXVE 1KJ2A 2GHWB 1GH7A 4ZO9A 2ZSVA 4M7ZC 3S4SB 4D8PA 1NCWH 2FSEA 3AS2A 2EH8L 5SWZD 1H3XA 4X4ZA 4J3SA 3VFTA 2H32A 1NDGB 1TJGH 4PJFB 3IFPB 2QTEA 3FQTB 2XTJC 1I3RA 4R6UA 3WIHA 1FO0B 3IB4A 4Z7UE 3CZFA 4NHCL 1P53A 4EIGB 1U9KA 3K74B 5HVGB 1T4KB 4K7FA 3BYYA 1X7QA 5T3ZL 1UCBL 2W92A 4LSTH 1U91A 4UTAH 3FT2A 1QSED 4W6WB 3K7UA 1BVZA 2R56H 4UAOB 4FQCL 2DI8A 3QRGL 1RUMH 3IF1A 3MRHB 4NC1E 1K8DB 3DHJA 3BIKA 1AR1D 1ZLWH 2MSPA 4ZS7L 4QT5B 5JLZA 1PVHA 3B9KB 3O41B 1F58H 5HI4D 4KRMB 5D2NE 4X7TA 2VL4A 3MYZA 1QZ1A 4GFTB 4JRXA 3LIZH 4X98B 4XPAL 1D5XB 4IOSD 2BNRB 2IPTL 3OGCA 3CX2A 4U3XA 1ZHKB 2A6KB 2QKIB 4KTYA 2AV1A 3HNTL 4RSVA 4CNIA 1EGJA 3C5JA 5EU5A 5HHVH 4DKFH 2ZP0T 1A21A 3O6MH 1B6DA 3RGHA 2DQHL 4OGYL 4PB0L 4JREC 2FX8H 4YIQB 5CSZA 3VH8G 4LEXL 2UWEB 3EJJX 1HWGB 5D7IE 1KC5H 1BZ9A 5E6ID 4U1MA 2DICA 3MLVL 3BWUC 1YY9D 4OZGA 1YPZF 4OZ4A 3QEQA 1VFAA 5K9OB 3FT4B 4BSWB 4G9FA 1A9EB 2OI9B 3GKWH 1FE8L 4K23H 2BY3A 4WW2F 1MHHA 2HTLC 1RFDL 2ZUTA 3GSNB 4NO5B 4HS8H 2P24A 1T1YA 5DTFB 5INDB 1T5WA 4IIQC 4LGPB 4GAGH 1PKOA 1WICA 1DE4A 2NXZB 1OHQA 5TF1H 2NW3A 1F4WL 4X6FA 2ZKHH 4TUKH 1NCAL 1CTNA 1CFVL 3ARSA 2XQBL 4NQEB 1PLGH 3QT2A 3U6RA 2WBWB 3UTQB 5D2LA 1ZS8A 4P4KC 2LU4A 2KKQA 3GI8L 2CK2A 5KVFH 4UT6L 5DURB 5C2UB 5DO2C 2NZ9D 1L0YA 1RMFL 2HH0L 4KH2A 1KB5A 2Z4QA 4MJ6B 5DVNA 1V7NL 1ZEAL 2V2XA 3EFFA 2D7QA 3PGFL 2X5PA 5DHVA 2ZG3A 3FOMA 1ND0A 1BQHA 1QPPA 5MENB 4K71C 4F7CB 2B4CH 3Q6GH 1NEZA 5JO5A 2HT4D 4CU7A 1HHGA 2VE6A 4B50A 4JFQA 3QR2A 2COQA 4LASL 3C6LD 1OSZA 1R5VB 2PYED 1EO5A 3LN5B 5EIVA 2QQNL 4XPGH 3VXRA 4BH7A 5DWUH 1JNNL 1S7VA 1KLUA 5IVXE 1C12A 2A73A 4PJDE 1FN4B 4FQ1L 4YBLB 3MV7D 4P5MA 4YE4H 4I2XB 3C6SB 5FYKE 4M8VA 1MCFA 1E4WH 5JXEA 4Y16B 2P42B 3KYAA 5DC0A 3JBG7 4X4YB 1MCPH 1T5XB 1T0NA 1AP2B 4G6FB 5GIRB 4YPGA 5DMKA 1KFAH 5HJ3B 4PRDA 3L3OB 4H25A 2P43B 1FVCA 4ZFFA 2G2RA 4UU9A 5FV2A 4K9EH 1KV3A 1QUNA 1SEBB 4LU5H 1UB5B 4JZNB 4YK4B 3FN0H 2DLHA 3IDYB 3IGAB 1FHGA 4I77H 1CI5A 4LHUB 4GW4A 4O4YL 1T2QL 3S35H 4X6EA 3BZEB 3LEVL 4P2RA 3RNQA 3MRIB 4BKLB 4OZHB 3WFBL 5FYLH 2NNAB 2F53E 3BH9A 1EK3A 4OUOA 4PJBB 5HI5D 1XZ0A 1KPVA 3T1FB 4L4TD 2CXGA 3SJVD 1NKRA 1SYVA 5GRYA 4TSCL 1CQYA 4JHAH 4XVJH 3EYQC 1MFCL 4ZO7A 4Z5RB 2VXQL 1IM9B 3NZHL 5FKAB 4AT6B 2KZ1B 1AC0A 3P0VH 2Q8AH 5HD8D 4GRLB 4NHUB 3UMTA 2X05A 1A6UL 4ODUB 3ILQC 2XN9E 3DGGB 3VWKD 1FLRH 1N6QL 1JMZA 1EV2E 1GGTA 4PJCE 5EU6A 2YK1L 4FQLH 3AM8C 3LZFL 5E8NA 1R3JB 2YSSA 1FPTL 4KXZI 4KV5E 1NCNA 4JCLA 2OZ4A 5IVXB 5IB3B 3P73A 3VW3H 3V4PL 4HJ0D 5KN5A 4D9RD 2R2HB 4F37K 4Z7QE 3ARBA 2VLKA 4K3JH 3T2NH 3RGVD 2NY4C 3U4BL 4ERSL 2IG2H 4Z0XB 3ILPA 4F3FB 5IF0B 1G7LA 1RJYA 2BHZA 1OB1A 3QBTB 4C56E 3MFGB 4P99A 4NJAH 3WUWG 2YRLA 2OI9C 1II4E 2LAAA 3F8UB 2IAND 4Y5VB 3EO9H 4KK6D 3KYNA 1I75A 3MQIA 1J05A 4JAMA 5C0JB 3RWGA 3CVIH 4CN4A 1B4JL 3JTSB 5MEQB 5ICYB 1UGNA 5F9OL 2F53B 4TUJB 4J23A 3NIGF 4G6MH 2W07A 5JW4Q 4DEPC 4TQEL 3AY4C 2VDQL 5ESVB 1VGKB 3BPLB 3VMNA 3TT1H 1IAKB 4XNUH 4Z0BH 5J6HA 4PLOB 3VG9C 1JFMA 5GRWA 3EFDH 5JW4N 3W9EA 4IOFD 2V5SA 3LMJH 2LTQB 2EDRA 5ID0B 5E2WL 2D0FA 1QSZA 3QCVL 5C08B 3OWEA 2FIRT 4M93B 5GGVL 4UDTB 3GSOA 3MUGA 3IJHB 3OXRA 4HIHA 2Z91A 2W0PA 4ONOA 4XBEL 2A9ML 1IC4L 2R2BA 5KVDL 2V5YA 3NOIA 1Y0LB 5GGTH 2E6JA 2EC9U 1MH5A 1FORL 3SQBA 4LHQB 1R3KB 2LVEA 2LAGB 5D7KD 1AO7E 4YBLC 1CXIA 3EYVA 2MHAA 5GRXG 5INCA 1ZWIB 3MBEB 1JYWA 3RKDD 3STBA 2H8PB 4P46B 5FDWA 2VAAB 4FHBD 3VRJB 5DI8B 1FC2D 1RZJL 1PX3A 1UWXK 3LKQA 2AJ3A 4JM2B 5A1AA 2RJMA 4MS8A 5ENWA 4B7IA 1WWBX 3TZVB 3L5JA 1CGVA 4GMSH 2R9HD 1PYWA 4MD5B 5HPOA 2V5MA 4YK4C 4JDTH 1T6VN 5T1KB 1IC7L 1G9NL 3S5LG 4M7KH 3FOLB 3GHEH 2YBRB 2DLFH 4Q2ZB 4MX7B 3FB6B 1BQSA 1OPGL 5CINH 5BS0D 1YEIL 1T89C 2FX7H 5BRZE 3KLAA 1U42A 2I26N 5DD5L 1WZLA 2ILLA 3MLWH 3V0VA 4PJXF 4J6RL 4LVHC 3IJSA 1R5WA 3VXOB 4ISVB 4MA7H 5F6HJ 2ESVE 1KN4H 2CDEB 2D7TH 2FJGB 5AYUL 1ZSDB 4O5LL 2H2PD 3RTQA 1EJ6A 3VDAA 4FZEH 5EA0L 4R4BA 3SDCC 2NY6B 1HSBA 1IEAB 1BJ1J 3TT3H 2JIXD 1GIGL 4KRLB 3WNKA 3FQNA 5E8OA 3P4MA 3S37H 3D9AH 3U4EA 1V5JA 1FZMB 2CR3A 2NXYB 3BZFB 2EYRB 4QHLA 2A6DB 1KXVC 2BX5A 1BJ1H 5FHBL 4MQXC 5LXGH 1PEWA 2VITB 4P23C 1FCGA 3GBLA 1DQLH 3RNKB 1CICB 5E70A 5JMRA 4HDIB 1NAKH 1FZKA 4XHJD 4V2BA 1BGXH 4JKPL 4MAYA 2NY3D 4LKXB 5CZXC 1WWCA 4JR9L 3OL2A 4M6NH 3DMMA 5T3XE 1WZ1H 4M1CC 1UA6L 1MQKL 4ONHA 3E2HA 1UXSB 5TE6L 1RAMA 1LO2H 2Z8WC 5TFSL 5E99H 5CZVL 5EZOL 1A3LH 2ZOLA 1QD0A 1DBJH 4Z7VE 3ARGB 3B9VA 4KKBD 1U8QA 3ZKMC 2D0HA 2P49B 1ZGLB 4GT7A 2DB8A 1YJDL 3C08L 2OTUB 4LEOA 4K7PH 3HAEA 2WW8A 5H94B 5HGHA 4ESKA 2P5EB 1F3DJ 3ZKNC 5HHXH 1MCOL 4FQJL 3FQUA 5DVMA 2F54B 3BZ4B 2YPKA 1OL0A 3BPLC 5D72H 3V7AG 2ESVB 4S1QL 1XCQB 2BDNL 5E9DE 4HIIA 5SWSB 2J12B 3V95A 4LPCA 1B0RA 5EWIH 4N0CA 2LTQC 4WV1A 1P1ZA 1A7RL 4WIQA 3R4DA 4XNXH 2VKWA 2FD6L 3BPCB 2MMXA 3OBAA 4PGEA 3OHXB 1I9IH 1U3HD 2FLBT 1L9MA 2DWDB 4H0GA 1C08B 5K9QI 1VACB 2EDTA 5I1GL 3NPZB 3DUHA 5HDQH 5IQ9A 7CGTA 3B43A 1E6OH 5TQ2H 2NLJA 3RWDA 3PIQB 1U8PB 4Y4HB 1T2JA 1ZHNA 1AD0A 5DJAB 4XCEA 2E7BA 4HEPG 1KCSH 1AIFA 3OZ9L 4WUUD 5EPMB 3SE4A 4Y5XB 1ZAGA 4KJYB 5C6WH 4IRJA 5DK0A 4ETQA 2UVFA 4PY8I 1FO0H 3NTCH 4N68A 2YUWA 3MBEC 5GGUB 5J0BA 4KK5C 3MOBH 3ARXA 3QQ9C 2KBGA 2DMBA 1AD9A 1KEGH 3U9PH 5FUCC 4AQ1B 5B3JF 1IQDB 4POZC 5D8JL 5FK9B 4UQ3B 3U30B 4JM2C 4XNQB 3U4AA 35C8H 4ZDHB 1WBXA 2YC1B 1AE6H 1K2DB 2IPKA 1MSPA 4KI1A 2C9AA 3QH3A 3ECBB 4ZFGH 1TITA 5AWNH 3HB3C 4Q97A 3B2VH 4MXQD 5HYSG 2W9DH 4XP5H 1JPTL 3CXHJ 3S36L 3MNZA 2GJ6E 2FJHB 1CL7L 3REWB 2ADFH 5FHAL 1WEJH 2B20A 2P5WA 5GSVB 2X4PA 4QYOB 5BOZG 3JV4A 4NN7C 5E9DB 4FFYH 3V6BR 1S5IH 1AQDA 5CILL 4NCC2 1X44A 4DUWA 1RK1A 1JWSB 3TO4D 5TH2B 3DV4A 2FYYB 3TBSB 3O6KH 4Y2DA 2YA0A 4Z7WE 1A9BB 2A6IB 2H26A 2OSLB 1JYNA 4I3RL 5E5RB 5IVZA 5DMYA 3MYJA 1NCBH 5F1NA 3V52L 1G7HA 4G9FD 1LEKA 2NY6C 4U49A 2EDQA 5EORH 1EFQA 3GSNH 4HPYL 1RUPH 5GS0L 5HHOB 4AEHL 5C0NC 1H3PH 3EYUL 2IAMC 5FYKL 2K1MA 3D3VE 4JVUA 4BQ6A 2NXYC 5E8EB 5DHYA 5F97E 3VFWA 3P9WB 3RBSA 5KJRL 4PRBB 4Z76A 1CK0H 4N9GB 5HYFA 5E2TL 2EE9A 4U1HA 3PJSA 1DVFC 1AGBB 1X4XA 1YQVH 3LY6A 2VH5H 4PJ7F 2FEDC 1V3MA 5IHLB 4OGXL 4KKCD 4AG4L 4NRYB 1OP5H 4U6VL 4YHYB 1BWMA 1NCCH 3KPTA 3ZMRA 2G9HB 1HWHB 2NTSP 4L3EB 1A47A 4GS7B 5ALCL 1SVZA 1CQKA 4TTDD 3O8XA 3TNMA 3RUGE 4TNVK 3NA9L 1J86A 5IM7B 2PTVA 3LH2H 1Q9WB 4HWNA 5I1DB 5I1EL 3KPMA 4Y4KD 3BKMH 4JZJC 1KTLA 1YDPB 3ARFB 4NGHL 2OX5A 1YMHA 1BVLA 1T1ZB 4JDVB 5IJVB 4PRHE 4NUGL 3CH8A 4OKVB 4RGOH 4ZUTA 5KSAD 2OP4L 4Z7WB 1RIHL 4OKDA 1H15A 4GXVL 3GJFK 2J7LA 1CR9H 4RA3A 1A02N 1F3JA 3SDDC 2YOCA 1IGFH 4TSAH 3G5VB 1YUHA 5AZEL 4G6AD 1KXTB 5JXED 3K0WA 2ZSWA 5EZLB 3GJEA 8FABB 4OZGF 4KRNA 1UQSB 3IT8D 4ZOAA 1CLOH 3SKUD 1ZT7B 4KI5E 3O4LD 1EX0A 3P4NB 4LSRH 1FLTX 1RVFL 4ZTOL 2LABA 2BHYA 3MX0A 3VXTA 3WL9A 4JPIB 2YXFA 1CLYL 5F93C 2C1OA 3MRKA 3P77A 1N59B 1PFCA 5FO9A 4OFKA 1ZLWK 2WWKT 5DVLA 4HF5H 4OZFA 3N0PB 1JTPA 1FGNL 1BZ7B 1PG7H 2ARJB 3QFJE 2HRPH 5EOTA 1Y18A 1ADQA 3C8KB 3QG7H 1DUYA 1ZHBA 3LRSB 5CSBA 4P2RD 4LFHD 4RIRA 5JZ7C 5D2LF 1UWGH 2EKSA 1CD9B 1IGJA 5IEHA 1DTUA 4HSQA 3KNBB 3TYGH 1MJUH 1D5MA 2DQUH 4GUPA 1FFPA 3KYKH 3RUGB 4TNWK 4ZS6D 2GSIB 3UDWA 4D9QD 3MJ8B 4PRIE 3KG5A 1XH3B 2HLFC 4QXUH 2X4TA 4WTXA 1J18A 4YDVB 1SY6A 1MI5D 4XVUD 1EDQA 1IGTB 3PWPE 3WUZA 3RVWD 3T0XA 2Z93A 1NFDA 4LCYA 2HFTA 4LQ1A 2EC9T 3V4UL 3NFSH 3TBWB 5IIEA 1EA9C 1FVDA 5EU6D 5DLML 2VZVA 2ZUQB 1INEL 2AXJA 4HZLB 3EOBB 4MZ3A 2NW2B 3KLSA 2X9WA 1YEFH 1NJ9B 4LSQL 4YDLB 1NDMA 5CJQL 1D5BB 1Q1JH 3ARBD 1T04A 2C7UB 3LHPH 1QRNB 1BIIA 5C0GB 2RBLA 3MRDA 3D6GA 4PD4K 3C2AH 3IDIB 5IB2B 1ZMYA 4L8SB 1E4XI 2JTDA 3VGFA 1XGYH 1DLHB 5EN2B 3RZCA 4Y8DC 3BXNA 3L7FA 4O51B 3KPRB 3ARDC 4WFEE 2DYPB 2ITDB 4YHIA 1MRDL 5ERWB 1NGPL 4LCIL 2HKHL 3KPSA 5L2KE 4XC1H 5C0CB 1RK0B 4GAJL 4MD4A 3VH8A 4R7NA 1MLBB 1G7QA 1I1CA 4HIJA 1JF6A 2WZPD 3MRCB 5DEFB 4ELME 3WXWL 3RWFA 1Z9SA 4XAWL 3T0EB 4EN3D 2ATPB 4GMTL 3KXFA 1U93B 3VWJB 3BO8A 5TE4L 1MPAL 1ZT1A 4YHYC 3FO1B 1T1WB 5AZ2H 2NYYD 2PTTB 3OG4B 4N8CH 1JZ4A 4GS7C 5FYKU 2FL5B 1NLBL 4X4XB 3H9ZA 5FF6B 1QG3A 1UB6B 3QUKB 3LS5L 3NAAL 2C1PA 3S9DB 2C4FU 2GT9A 1RJZB 1MFDL 4Y4FB 5E1HB 3P9MB 2DQIL 3QUMH 4LHUG 4LKCA 3FFCA 3ARFC 4HKBB 1HHHA 4F80A 5F7DA 4ZQKB 4PJHF 3GRWL 3RHWF 1B0WA 4OCYH 1NAMA 1A7PL 3DSFH 5EU7C 5D7JA 5E0QA 3X14A 3ABZA 4L4JA 4WNQA 2PW1A 5DRZB 1LVEA 4L4VB 4GRWE 1T7XA 1A8JH 5FECA 5LJYH 3CLFH 2YMXH 3WHXA 2F5AL 4HH9A 2UYLB 5GS2H 4NZUL 1YYLL 4JM4H 4LLMB 4RGNB 5MHSD 2HT2D 4HGWB 4G5ZL 3F6IA 4PJEE 4U6YB 4APQD 3I6KA 1B2WH 5D71H 4KDTC 1GSMA 2VWEC 1HNFA 4M02A 4MS8D 4PTTA 2JB5L 4G8EA 4DZ8A 5JOPE 5IOPA 1JZ8A 4WTZG 4XXCC 3NH7L 5F6HI 5T3XL 4F7TA 4LF3A 4PB9H 2AJUH 4WWKB 4JFZL 1WVZA 4HPOH 5E08L 3ZKXB 2R4SL 4L5FH 5KW9L 1NGYB 4X5LA 2VDLH 4Y1AE 3N50A 2DQTL 3GMLB 4ZSOA 2VR4A 4WY7L 2HMID 3QPXH 3IAQA 3W11C 3DRTB 2XZAL 1HXYA 1YC7A 4NQCA 2VNCA 4TVSa 2EKJA 1DQQA 4OQ1A 3VXSA 5FOBB 3OB8A 2GUOA 4NO0A 1XGQB 3D85A 2X1XR 4NRXA 4K3DH 1X6NA 4UTBH 2O61B 3BVNB 4LQFL 4PS4L 4QNPF 5T1LB 2G5RA 3AC0A 4J7RA 5JIIA 5ID1A 2GAZA 1RD6A 2RFXA 1X9QA 4U31A 5DMJB 3JUYA 3O6FA 5TDOA 4I4WB 3ULSA 3D18B 5IMOB 1S7SA 3MLRL 5EBLA 4YDLC 5I1JL 1DLFL 1MIML 4HBCH 3BP4B 1RQ5A 2W0FB 4ENED 3L5WB 1XCTA 5IMLB 2ADJB 2WUBL 3FB8B 4RMQA 1CGTA 1P4BH 5F1KC 4MAYD 3CX5J 1MFEH 3DMMD 3MJGX 3U7AA 3O2VL 2Z31D 4HKXA 4L8SC 3SDAB 2EEAA 1HCVA 2IBBA 3RY4A 2OL3B 3QIWB 5GRVK 4GG6E 1FYTB 1CE6B 1JHKL 4I18B 3UTTA 2Z35A 4JGJA 3L3KA 1YEGH 4GO6B 1E27A 1FNGA 1CLCA 1EVTC 4YQXH 1B88A 1S8DB 2WBJD 3BD4A 1YMME 2AK4D 3AAZB 1J8KA 5E6ZA 3WKMH 2D2OA 2P8PB 3WJLA 2OJEA 4BJLA 4QOKE 1DBMH 5DJZA 3UYOD 3WUWA 4D0DB 2A74B 3VWJC 1H0DA 3VGGA 2J8OA 1UYWH 5DQ9A 1BFTA 3LIZL 1IEHA 5FO7B 5C0AA 4F7PA 1DQDH 1K8IB 4MSWA 3P30L 5I1HH 1FVEA 3GK8H 4DCQB 4OLUL 5IFJA 4NWTH 1FJ1B 3T3PE 1G6RB 2BSSB 5EIQA 3TBVA 2Q6WA 1IFHH 5FCUH 2DQEH 3FT3A 1Q8MA 3O6ML 1B90A 2BSRB 2QQQA 3RWCA 4EJ1C 4HKJA 4UB0L 1UADC 5EUOA 2WP3O 1VFBB 3CFBB 4FQXD 4NFCA 2HLAA 1N8ZA 1U8KB 4RAUA 1KC5L 3MGOA 2HA1A 4PRPE 2GJZA 1S7RA 5FYKD 2GW5A 2LV4A 4YLQT 4PJIB 4XTRD 4K23L 4HUUA 5EO1B 2BZDA 4XMLH 5DD1L 5C09D 4IRJD 4G59A 3QIBB 4GAGL 3TA3A 3VFPA 1FGVL 1JI1A 3F7PC 4AENB 4MNQD 5JXAH 4UOW1 1H8NA 3BGFB 5JQHC 4GG6B 4KVNH 4RGNC 1O7SA 1HOCB 2F5BH 2ICEA 1PLGL 1XIWB 4LLQA 1A6WL 2W0LA 2J8UA 1JPST 1BD2E 3GHBH 3P4OB 5KVFL 4FABL 2E7LA 5L2JA 2V5RA 5ICXB 2VZOA 4WWKC 2PN5A 3HS0A 2BVOA 2X2YA 3ZKXC 3HLAB 4OCXH 1RZFL 2JJVA 1I1AA 4M62H 4GBXA 1QFPA 5JW4R 3B8YA 4B0MM 2J3SA 3CFIC 2C3XA 3HUJA 1PW3A 4KY1H 3FN3A 4L8BA 4Y2DD 4XPHH 4LP5A 2FGWH 3KPOB 3QUZD 3MUZ1 5IUSA 3S5LA 4X4MA 1N2RB 4ZUSB 2DBJA 3I3DA 3WS3B 2DD8H 2ZUSA 3J7HA 2OR7A 4XP9H 2VDMH 1C5BH 2DMCA 2YN5A 4N5EC 1YEHL 3G5XA 3S88H 2M2DA 4F57H 1SMOA 4J8RB 4C56D 5TGBA 4UINH 2V7HA 1S3KL 1HH9B 4AZ8A 4MJIA 3D25A 5LGJB 4YHKH 1Q94B 1VEOA 3FN0L 1JE6A 1L7IH 3P9LB 1GHFL 1A6AA 4FQHB 1EFXB 3OB0K 3VXUE 4TVPH 1BD2B 4I77L 1CXLA 1IZKA 1KCLA 3S35L 2XY1A 4I9WE 3KPQA 1M6OA 4N90E 3SKOA 3U0PA 4QKXB 5ICZA 1FSKC 4HV8B 5I19L 1QYGH 2FZ3B 3CSBA 1J8HB 1YNTB 1JGVH 4ZOBA 1NCDH 5E1AB 3BRGC 1R24B 2B2XL 1D9KA 2DMKA 2F58L 2W65A 3QDJA 1I8IA 1FZOB 1G0DA 5JDJA 3GM8A 3E8UL 1HHKA 3RU8L 1FLRL 4FQQB 3LN4A 4FNLH 5I8EA 1PX4A 4D0BB 4FQLL 2E27H 4N0YH 2QSTA 3VXME 5HGAB 4R2GB 2DJSA 2CIIA 5GRJL 5GGTA 4DW2H 2HRLA 5DFTA 2P7TB 5TDNB 1T21B 2VDPH 4F8TA 1KIUA 5I2IA 3PQYB 1C1EH 4DZBA 3FZUD 5E95B 2Y6SD 1D6EA 3C60C 4X6DE 1XF5B 3CIQA 4OB5H 3ESVF 2JCCA 3H9SA 4GSDL 4PJAA 3VI4F 2P48B 4JG0H 3VG0H 2EO1A 3RPIA 1AGDB 3VMOA 4Z7NE 4GLRI 1SJHB 4G42A 3QIBC 3VXUB 1HIMH 3CVIL 1U2CA 3BUYA 3ARVA 3QHZH 4ALAH 5BVJB 4IJ3B 3CXHK 1U58B 3MC0A 3LB6C 1P69B 1J5OL 2C4FT 2HFGH 1HSAA 4PUBL 2DDQH 4P3CL 4O58L 3OR6A 3HCVB 4ZUVA 4LSPL 3F7QA 3T8XA 1L8JA 3O9WD 3TT1L 4Z0BL 2I60H 3UJTL 4JG1H 2AW2A 1T7VA 1W0YT 4O02L 5GRVL 4DVRL 3TVMA 4YXHL 5LBSL 2H6PA 1FL5B 5JW5B 1WF5A 2MJWA 4JY6B 5FGBC 1M05B 2CKBL 3NCJL 5LAXB 1MVUB 1FNHA 4P57A 5ECJE 3OXSA 4PDCE 5K9QG 4MDIA 1W72B 4LLWA 4IIQA 2UY7A 4WI9A 3REVA 4DK3A 4KRPB 4PREB 4R96B 5GGVY 5C2BL 1P5UA 2O5XH 2IFFH 2PF6A 2YN3A 1JGUH 2VLJE 5HYSA 5D5ME 3RZCD 2VISB 2DKMA 3L3IA 1P9MC 1JV5A 4XX1E 5C0FB 5DK3A 3HE6D 2XKSA 4NQXB 4DQOL 1S9XA 4P4KA 3WFDL 4XNYL 5IG7A 1OAKL 2FR4A 4ZNEA 5CMAA 5DUPH 4K8RD 4I5BB 4DKEL 3KPSD 2WBKA 3VDCA 4WHYG 2E9JA 3GIVA 5T3XD 4HUWB 4HX1A 4JPWH 2VXSL 3BP7A 4QCIA 3RDTB 5ALBL 3BAEL 4LPYA 2VXTL 3QB7C 4GMSL 5E2JA 1O5DT 2MCPH 3CJJA 3ARPA 1TLKA 2VLLA 2VLRE 2P8LB 3DXAE 3NFPB 3FB7A 4YUEL 1PZ5A 1Z9LA 3UTSE 1WIPA 1H5BA 2JK5A 3T4AB 4OCWL 5IESH 3KPPB 1S7WB 3MR9A 4J3OC 4G43B 3IS0X 2I9LB 2WM0A 2M8XA 3PF2A 2ICWJ 1S9YB 3GMOA 2RGSA 2MOVA 1NFDF 3OJDA 4TPRL 5J9PA 5D7LE 1E0OB 1JPGB 2AEPH 1VGEH 4BQBA 2MKWA 2BC4B 1DCLA 3AREB 2IPUK 2B5IB 4ZFOL 3MLXL 1DDHB 3VRLF 5JDSA 2UUDK 2D9QB 3VFVB 3MLUH 2OTWA 1EHXA 3QO0B 3TT3L 5DQDL 1EERB 4M5YL 2X42A 4HAGA 3WNNA 5DRWB 5HYQB 3QI9B 1JWUA 3RWIB 1N6UA 1RJLB 1RUAL 4FTVE 5IR1B 1X5YA 4CRPA 5D5MB 4R2GC 5IB5B 3JWDC 1MCDA 5LXGL 1A3RH 2W60B 3OKKB 2BHUA 1N5YH 5C0RL 1A7QL 3DIFB 1NAKL 1HYSD 1ERNA 1NDGA 1ZA6B 4PJFA 3IFPA 1C8PA 3FQTA 4OUUB 3DX7B 1HEZB 4Y19B 1FO0A 3S97C 4YHPB 3U48A 4OSUH 1LO2L 3VFGH 5FDYA 1T4KA 3DJ9A 1GAFH 2BVPB 1MQ8A 1WZMA 1DBJL 2HJKB 3GM0A 5EZIH 3MRHA 1MHCB 4NQTA 3RI5K 1K8DA 2QADC 1PY4A 4QT5A 3B9KA 3O41A 4K7PL 1NLDH 4IJ3C 5C7XH 4NQCD 2ID5A 4X98A 1D5XA 1J88A 1JF1B 3L5XL 2IBZX 1ZHKA 2A6KA 3VXSD 3ZYZA 2Y36H 2QKIA 2GJ6D 3D85D 5D72L 5FA4B 1MFAH 3I50L 4BFIA 3AB0C 2C3HA 1KGCE 4YIQA 4O9HL 4QRPD 1IZJA 3HRPA 5EWIL 4DOHB 2PW2B 2UWEA 1LE9B 1QEWB 3CDFA 4L3AA 4CMMA 1I9IL 2Q1EA 4YDJA 5K9OA 3H0TB 4BSWA 1WAAE 1A9EA 2OI9A 1VPOL 4NQDB 5FGCE 3FT2B 4NO5A 1HILB 3V5KB 4KK9C 5INDA 1W8NA 3TWCH 4L8CB 1QSFB 5DR5H 1BM3L 2D31B 4KQ4H 4ZO6A 3D3VD 3AVEA 4MB5A 3GBNH 2EIDA 2OL3H 4NQEA 4Q9CA 1YEKH 4X7TB 4JY5H 1B3JA 2RB8A 3UTQA 2WANA 3ARRA 5CHNB 3UTTD 5D7SH 3MOBL 4HIXH 4ZYKB 2CUMA 1J0KA 4ZO8A 2Z92B 1HINH 5L7XL 3U9PL 3TLRA 4MJ6A 3RVVD 1UM6L 2J6EL 1JF5A 32C2B 35C8L 3W0WE 1VKXA 1BAFL 4ACPA 3NABH 5D2NA 1NBVH 4ZFGL 2D7MA 4OZIB 5AWNL 5MENA 2V17H 5IK3B 43CAB 4OZ4B 2XWBB 4F7CA 1CT8B 3NCMA 4OF0A 4M6OL 5T1DH 1PKQB 4KJPC 1G84A 1WEJL 1IT9H 4OIBA 5B8CA 1G6RH 4OBSA 1R5VA 3LN5A 1AC6A 3FQXB 3HHRB 2KPNA 5C9KA 4Q7DA 1QFWH 2A9NH 2OK0L 1XF3B 1FN4A 1GPOH 3MV01 4MWFA 4I2XA 3C6SA 1DBAH 2X44D 4HK3J 5HBBA 3MRNB 3BW9B 1K6QH 1QRKA 4Y16A 1JZ6A 3QUYD 4NM8L 4X4YA 3HI6L 2NY3C 5HHMB 1AP2A 1SBSH 4OF3A 5D70H 5GIRA 1TZGH 1UWEH 1YY8B 3TFKD 5HJ3A 4XP6H 1H8OA 3BDYL 3L3OA 3QI9C 2FECL 2JJWA 3RIFK 3TA3D 1U3YA 3M8OL 3EJZC 5D1XD 1JYXA 4HG4K 4UBDC 2IQAB 1SEBA 1UB5A 1BQLH 3F58H 4JZNA 3FOMB 3FMGH 3H42H 3IGAA 4Z6AT 5F9JA 2RQ8A 2XZZA 4LHUA 3GSVB 4V1DB 3BZEA 1HI6B 4P2CG 3MRIA 4BKLA 4OZHA 1T89A 4PGBB 3AU1A 5IFAL 2A1WL 3RL2B 2NNAA 4HT1H 4R0LB 1NCCL 1S5HB 3KPNB 4PJBA 3T1FA 5GISH 2N1KA 2VXUL 3O3DB 3NN8B 4LSVH 4JQVA 1HNGA 2A73B 2YRPA 2X4QB 3O2DH 3DX6B 3EOAB 4Z5RA 2N4IA 4YHLH 1IM9A 5FKAA 2H2SD 1T7ZA 3MZGB 4AT6A 4GBXD 3SGDH 4YDKH 1EZVX 4GRLA 4NHUA 4EI5D 2XFXB 3MJ9L 5LGKA 3PWPD 4LARH 4ODUA 3DGGA 2DJUA 1ACZA 2HT3C 3JSSA 3MXVL 2APWA 3I9GL 3K81A 4HFUH 2YD1A 4WTZA 4DN3H 1R3JA 4PV8B 5IVXA 5IB3A 4PJDA 5DGRA 3QRFM 3S37X 4DTGL 4RMTA 5HYJE 2NY0D 2AGJH 2R2HA 4MLIA 1JGLH 1R5IB 3U82B 3MV9E 4GW4B 5EUOF 5E8PB 1NKOA 1GGCH 4Z0XA 2XA8L 4TULH 5CWSB 5IF0A 1CE1H 1I3GH 3SOBL 4G80B 5I1KH 4L9LB 4WFFD 5SX4I 1X5KA 5C71A 5I8OH 4Y5VA 4MJID 3IFLH 4HUVB 5C0JA 4GQPH 3TYFA 5EB9A 5SV3A 3THMH 5MEQA 5ICYA 1GZQB 2J8UF 5L2KD 2F53A 4TUJA 4YNYB 5ISZE 4KJWD 5I8KH 4NNYB 3TYGL 5J1AB 5E8NB 5ESVA 1VGKA 2R0KH 2R0LL 1IAKA 3P73B 3HZVB 3QUXD 2EXYC 3PWVB 2VLMD 4YWGH 5C0BD 3C5ZD 3QYCA 4H88L 3UPRB 1EEUA 1FFQA 4HJJL 5J8OA 2YUZA 5TQ0L 1DBBH 5ID0A 4YHNB 5C08A 1OB1B 4PJCA 4UDTA 1KCRH 3HUJF 3NFSL 5DDHA 3QWRD 2H1PH 1TVBB 3IJHA 4TYUA 4R8WH 3SKMB 1TJIH 4WEMB 1QQDB 3JWDH 3Q3GB 1Y0LA 1CU4L 1OAUH 5DEGB 1J05B 4QF1B 3RZWA 3WFEH 1R3KA 4PGDB 2OMBA 4PJ8B 4UOW0 3WLWC 5GRUL 2XTJD 5IHZB 1LK2B 1ZWIA 3MLYL 3GZKA 4JFDE 2DN7A 5JIHA 1JTTA 1MY7A 2H8PA 3IU3B 4LIQH 4P46A 3IAPA 2VAAA 4JCMA 1IMHC 5J6HB 3VRJA 1OOAA 5DI8A 2BVEA 1RIVH 2PETA 5GPRA 3WO3B 4JM2A 1B9ZA 3TZVA 4PP2B 4G7VH 2YD7A 3BKCH 3HG1E 3NIDE 4AIZB 4XC1L 5JOPD 5GRZA 3S3PA 6FABL 1OGAE 1P7HL 3F7RA 5T1KA 3DHMA 3PDOA 4RMVA 4HIHB 3PWUB 3FOLA 2CDFB 3PABB 4YHZL 2YBRA 4NZTL 4PJ5E 4Q2ZA 4DN4H 4UT7H 4X6CE 1F2QA 2CJUH 4XZUB 1ZKAA 1GJIA 1ZLUK 4R0LC 2W1NA 1QHOA 1WIUA 3AUVA 4JFHE 2HWZL 2KH2B 4N8CL 2YPVH 3VXOA 3IDMB 1A64A 4ISVA 5FYJH 3ZDXE 4XCCH 2FJGA 1ZSDA 4M1GL 5DUML 4ZXBB 4DGVL 1BOGB 3DRQB 5JXEC 1OAQL 3WXVL 4POYA 5GHWH 5LG1A 1IEAA 4JKMA 1J11A 2HTLD 1W72H 2EO9A 4TTGA 3QUML 4LVOB 3MTRA 2A6JA 4RQQB 2AJ3B 1FZMA 2ZCHL 3BZFA 3QQ3B 2K7QA 5A40E 1RHHB 2K7PA 2EYRA 2A6DA 3N1FC 4HC1H 4OAWB 3CD4A 2X7LB 3MRRB 2VITA 3P2TA 4JLRA 3EO0B 3QCTL 3RNKA 1CICA 5DJ0B 4HDIA 1WWWX 4N0UE 4JFED 4D3CH 4P4KD 1KOAA 5F71A 3ZDYE 3BFOA 1BMGA 5D6DA 4LKXA 2JCCF 3HMWH 1ED3B 2ERJB 2GITB 2VB5A 3QIUB 4JM4L 1FAIH 1LE5A 5DO2D 1S7TB 4MAUL 5E24E 1B2WL 4PJAF 1ETZB 5CJBA 4UI2A 4F9LA 5E8DH 4OFIA 3BGAA 1FDLH 4KROC 3BJ91 3BSZH 1DEEB 3ARGA 5ABDE 4DGYL 1H3UA 5C3LD 3U1SH 1NEUA 4PB9L 1ZGLA 3HR5B 2EXWC 4EZMA 2ADIB 2BP3A 4PJ5B 2OTUA 1NANH 5H94A 5BRZA 2P5EA 1CG9B 3U4EB 5ADPH 4L9DA 1OWWA 4CVXA 3WD5H 2F54A 3BZ4A 4ZD3H 5L88L 1EEQA 4QOKD 3QPXL 3K8MA 4FZ8H 2ESVA 4NP4H 1P7QD 1XCQA 2AI0H 4OLXH 4W68A 1K3ZA 3IU4H 1DN2A 2YPLD 5SWSA 4WHCA 3RP1A 1C7SA 3QNYB 4P2QE 4K3DL 3BPCA