4MQAA

Human beta-tryptase co-crystal structure with {(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bis[5-(methylsulfanyl)benzene-3,1-diyl]}bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Target-directed self-assembly of homodimeric drugs
rcsb
total genus 54
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA01
5C67A 1NT1A 3G01A 3GCOA 1MTSA 3KF2A 1GCTC 2Y81A 4XBBA 2STBE 1OWEA 1NS3A 1CT4E 1GDNA 3PTBA 1LDTT 3F9GA 4AYVB 1OP8A 2PWXA 1J17T 1Y5BT 2QF0A 4UONA 1BBRE 4CRGA 1DDJA 3ZYDA 3RU4D 4ISHH 3KIDU 1A5HA 4NA7A 2BDBA 2V3HH 2BVXH 1DS2E 1O2MA 2FOBA 1BUIA 3I29A 3MU1A 5JBBS 1O3NA 2P3TB 3SJKA 2FP7B 1EB1H 4ABJA 4QT8C 1KXAA 2GDEH 2Z9GA 1FY8E 2FODA 1SSXA 5AHGH 5FXLA 3MNBA 1W11U 2PGBB 2VIWA 4Y8XA 5K7RA 1W13U 1FJSA 1DY9A 2BY7X 4XFQA 3TGIE 4BAMB 2UUJB 2GV6A 3UR6A 2HALA 4H6SB 4YZUA 1XVMA 1O32A 2P3UB 3A8DA 1IHSH 5AFZH 3SNBA 2C8ZB 2ZG0H 1S84A 1B0FA 4GLYA 5A0CA 4NCYA 2Z9KA 1UCYH 2AIQA 4MNYA 1OP0A 1HRTH 2GT7A 2WINI 3PLKA 5GCHF 1ELCA 3TH4H 2UWPA 3EA9A 2QXHA 1FNIA 2ANKH 2QAAA 1TE0A 4D7FA 1GHBF 5IDKA 1K1JA 1O2KA 2R0LA 1DY8A 3HATH 1HFDA 1O2OA 3E3TA 4XBDA 5EW2H 1DWCH 3TK6A 1GJ5H 1DWDH 3LOXA 2XTTB 2ZECA 2GDDA 4DG4A 1C1UH 1QL7A 4WVPE 7GCHG 4X2XA 4X8VH 3U8OH 5IYTA 3SZNA 1ORFA 3BEUA 2R0KA 3ATWA 1SGEE 5E0HA 2ZCHP 1TPOA 3ATKA 2BX3A 1UJ1A 2SGAA 3RMMH 2BVRH 1UTOA 1O3BA 2F9NA 1K1IA 2AS9A 3TVJB 2R2MB 3D49H 1WQVH 1K28D 1C1RA 2AFQB 3SJ9A 4INKA 4I8HA 3ZVGA 2FXRA 1Z1IA 4FUBA 1IQHA 1CHOG 3RLWH 1WTHD 2GCTB 1EJNA 1V2TT 2P16A 5H4IB 1YPMH 1Z8JB 3GDSA 5FX6A 3ZZ5A 1ANDA 2FOMB 5FPYA 1FY4A 1T4UH 3ESTA 1V2QT 1GJ9B 1CHGA 4U2WA 5CHAB 3TK5A 1C1NA 3TH3H 4F49A 1XUIA 4BXSA 5JPMH 5EW1H 3CS7A 5C1YA 2AH4X 2JKHA 1CBWB 3JZ2B 3LC5A 1O5EH 4A7IB 3RC4A 2ZTZA 2Y5FA 1QL8A 3NZIA 3IG6B 1EAXA 1OWIA 2EA3A 1GI5A 2BY5X 3P6ZB 1EATA 2OLGA 1ZJKA 1OP2A 3RXCA 1WAYB 1GI3A 4U32A 3AW1A 4GHQA 4B71A 4AB8A 4GUXA 2Z94A 2F83A 2YNBA 3FZZA 5T6GA 1Y3UA 3FAOA 2F9VA 3KHVA 1TMUH 1RGQA 2QIQA 2O8UA 3GY3A 4SGAE 1PPCE 4H4FA 5ABWA 2ANWA 1PFXC 1QB6A 2ILNA 5AFYH 1A61H 3GCTG 2ZGCA 3F9FA 1C9PA 1J15A 4YLUA 4Y71A 2CMYA 2ZKSA 2QGRA 2GMTC 3OU0A 4ISOA 1UK2A 2W26A 4J1YA 5GPIB 3TLOA 2BDAA 1YPHE 1GGDC 1NU9A 6GCHF 1IHTH 4WWYA 5BPEA 1WSSH 5DPAA 1GJBB 2ZFTA 3TIUA 1RS0A 4MTBA 4VGCC 4NZLA 1F0SA 4ZXYH 3T2NA 2R3YA 4LXBH 1P0SH 1DX5M 5HXFA 2ZDAH 1H8DH 3RMNH 1LO6A 1EAUA 1Y3XA 3RXUA 1TNGA 5SGAE 3QTVH 1BIOA 1MAYA 4IN2A 1BDAA 3SORA 4UD9H 2PUXB 1EZXC 1EPTA 1CQQA 1DVAH 2XC0A 2ZA5A 2QY0B 4Q80A 3RXSA 3BTFE 4FU9A 2BB4A 1BCUH 3PV4A 3SU2A 1F92A 4FUIA 1Z8RA 1KYNA 3GY4A 2HRVA 2PSYA 3VB4A 1MCVA 1AB9C 4B2AA 1P09A 1EOJA 1BRCE 3BIUH 3SW2B 3HPTB 3BSQA 4X2YA 3HKIB 1KSNA 2ZP0H 1TPAE 2RA3A 1YF4A 5ESBA 1EZQA 3L33A 2JH5D 4OS2A 3W95A 2HLCA 3EYDA 3QN7A 1L1JA 1VITF 3S9AA 1KTTB 2G00A 4WJG2 3ZZ9A 1THRH 7KMEH 3U98H 1S6HA 1FY5A 1HAXB 4CR5A 2Y6TA 1O2JA 1K2I1 1OSSA 1CU1A 2FS9A 2QA9E 1QQ4A 1LHEH 1P8VC 5DG6A 1IQEA 1RIWB 1GI8B 1O3PB 2KAIB 1P3CA 1TRYA 4BXWA 1P9UA 3AAUA 1W8BH 3KQBA 4BAKB 1CGHA 4OGYA 5JYIA 1C2JA 3A8AA 2XWBI 1JRTA 3CP7A 3SV9A 5A8ZA 1GBKA 3MU8A 3QO6A 1HJ8A 1HV7A 1MKWH 1QJ1B 1VZQH 1XM1A 6GCHG 2FESH 3RXOA 4JCNA 3SUFA 4DGJA 3UNSA 1KTSB 2Z9IA 3A7YA 1ZRKA 2BLWA 2QN5T 1Z7KA 3GCHB 2Z3EA 1MCTA 1YPKH 5DO4H 4JYUH 2WPKS 1ARCA 1UVTH 2ZFPH 2ZU4A 3A84A 1BMNH 5T3HA 1QB1A 4K69A 1H9LB 3SGQE 5E0GA 4X1RU 3SU4A 3M5MA 3UFAA 2UWLA 4UE7H 1TFXA 1FN6A 2H9HA 2Z9JA 1KXEA 2A32A 1O5CB 1VR1H 1QRWA 1BRUP 3A87A 1HAGE 1GBMA 3A8CA 2BVSH 2ZPQA 4ZH8A 2AMDA 4I7YH 1FZZA 4D9QA 2BMGB 2B9LA 5GIBA 2PKAB 5EQRA 1HCGA 2DUCA 2P93A 5L30H 2TGTA 5EODA 5DP8A 2XC4A 2NU0E 4I33A 3UTUH 2EEKA 2H6MA 2C90B 1TOMH 4X6NA 3V3MA 3SOSA 1O39A 1QTFA 3HKJB 1W0ZU 1H9HE 1G32B 3VPKA 1LVOA 1GBJA 1EZSC 2JH0D 1LPKB 1DLKB 4ABBA 4CHAB 1O3HA 1UTQA 1GBBA 2ODPA 4AYYB 1GMCG 3QWCH 2R3UA 2BZAA 2PKSC 4D7GA 3MO6A 2GX4A 1GCDA 1V2VT 1V2MT 2SFAA 1AE8H 3FANA 4Y7BA 1W12U 1ZLRA 3OSYA 1SGIB 3RXVA 4BANB 1BTXA 2B8OH 2SGFE 4E06H 1DSUA 3M36A 3SJIA 4MNWA 3TJVA 2XBYA 1Y3WA 1C2LA 3NUMA 3RXFA 1B5GH 1CGIE 1FN8A 2C3SA 1GGDB 3UREA 4HGCA 1C2IA 4OS7A 2VINA 2AEIH 1TAWA 3NPSA 1CA0C 1KLTA 3A7VA 3Q3XA 4KP0A 1BTWA 3O8DA 2CJIA 3Q76A 5C3NA 1E36B 1T31A 3H7TA 2ZQ1A 1VJ9U 5JBTA 1G37A 2ZO3H 1UVOA 1DOJA 1EJAA 1BBRK 1TRNA 3QGJA 1VITG 3RC6A 1GG6B 1ZSJA 4JK6A 2A5IA 3S7HB 3SQHE 1PPGE 2GKVE 2KAIA 1A0LA 1MTWA 3WY8A 1TQ7B 2ANYA 3EDXB 3OTJE 3S7KB 2OQ5A 1EQ9A 1RTFB 1HJAC 1YGCH 2XCNA 2HOBA 4KTUA 4I8LA 1OXGA 1GHAG 3P70B 1C4U2 4CH8B 3PO1B 3SO3A 1DFPA 3TGJE 1O2LA 1O3DA 2BDIA 2GCTC 3SHAH 1HAHH 1HGTH 1MUEB 1YPGH 3UPEA 1AUTC 3A89A 1TWXB 5DJ7A 3RMLH 5EPNA 1NN6A 3DHKH 2GTBA 1AFQB 1HLTH 1AN1E 4IGDA 1EUFA 3RXKA 1RIWC 3LU9B 1LKAA 1FUJA 1NRRH 2FPZA 2TRMA 3MNSA 1ELBA 2ALPA 2VH6A 1LHFH 4I8KA 3LJOA 1BTYA 1HIAB 4U01A 5GJ4B 2NU1E 1C2HA 1IQMA 1W10U 2A5AA 4INLA 1W7XH 4Y0ZE 2O8LA 3T29A 1FV9A 3MHWU 3LPRA 1MU6B 3AW0A 1LCYA 1UTNA 2BOKA 3BG8A 4AGKA 2FX4A 4THNH 3MU4A 2OBOA 1BTZA 3RXTA 5I46H 2AMQA 4Y7AA 2G5NA 2H9TH 2FYQA 1FAXA 2D2DA 4B74A 4JYTA 1BRAA 1TGNA 2NU4E 1GBCA 2P8OB 4ISIH 3BTGE 1A0JA 5J4QA 2FM2A 2V6NA 1BJVA 2OBQA 1TA6A 5DP6A 1NFUA 3RM0H 2P3FH 4ABAA 1RXPA 1V2KT 2ODYB 1ZR0A 2G55A 2A31A 1ZHMA 1HUTH 1ACBE 4MPUA 3T27A 3M5LA 4BTUB 4JMYA 3VB5A 2ZHWH 2J2UA 4TWWA 1JMOH 1SGYE 1H8IH 1D3TB 1V2ST 1K9OE 1WU1A 3OY5U 3P8FA 2TBSA 1RRKA 1XVOA 4B75A 5EOKA 1O3LA 1LPZB 4WH6A 3RP2A 2W7UA 3ATIA 3RXPA 1WOFA 2ZTXA 1QBOA 1C5RA 4NG9H 4AFSA 3KQCA 1DANH 2AIPA 1GMHF 5LH8A 2BQWB 3BTME 3PM3A 4VGCB 2XC5A 3GDUA 2CGAA 3QUMP 4KGAA 4Q2KA 4RSPA 1QJ6B 3IITA 5DP3A 2H9EH 1YPJH 2IN2A 3GYMA 3LONA 4NGAH 2NWNA 1GMDG 2Q1JA 4YOGA 2A7JA 1KDQA 4YTAA 1UCYE 2LNCA 5F03A 4F4OC 5I25A 3ATMA 2P95A 1KY9A 1UK3A 1C1SA 2PFEA 5A0AE 3PWCA 2OC8A 2VB0A 2Q6GA 1GHBG 1N8OB 1UTPA 4X1NU 3GOVB 2WV5A 6ESTA 4GSOA 1J16A 1C9TA 1PQAA 5GCHG 1N6YA 1E34B 5FBEA 4YOJA 1GHZA 4DT7B 3U1JB 1DUEA 1QJ7B 1O34A 2FI5E 1D6RA 3RLYH 1MTVA 1SI5H 2CHAC 1FXYA 4Y8YA 1GHWH 2A2QH 1AZZA 2ZFFH 4ZXXH 1FQ3A 1SQAA 2SGDE 4FUFA 4OGXA 1SHYA 1S83A 3RXQA 2J4IA 1Y5AT 1V2JT 2VVCA 1KLIH 2BQ6B 2PGQB 1VCWA 3KGPA 1ANEA 4MNXA 1GI4A 1GJDB 1C5PA 4YOIA 1MQ6A 3P17H 1NM6A 1G36A 1MU8B 1QB9A 3E0PB 2Z3CA 1K1NA 1T8NA 1NZQH 4Y0YE 4PROA 1GHXH 4K5ZA 1L1NA 4D8NA 3M37A 3ZZDA 1EJMA 3SJ8A 1GPZA 1MH0A 2YOLA 3RXJA 3FP7E 3TGKE 1K1PA 3RU4E 3RXGA 1O3IA 1PQ7A 2ZPRA 2FI3E 1Z8IB 3OX7U 1K1MA 1YKTA 1F5KU 3ODDA 4D9RA 2ZGHA 1CT0E 1AFEH 1FI8A 3W94A 1A0HB 2OCVB 1LMWB 1UVUH 3DFLA 3M5OA 4AG2A 1QGFA 1W0YH 5DP5A 2EI7A 2H5DA 1IQIA 1L4ZA 2FZZA 1C5LH 3SV7A 1BT7A 3EA8A 4FUJA 1O5GH 1XX9A 5FHTA 4NIXA 4A92A 3SV6A 1D3QB 1QCPA 4DCDA 2J95A 3RXHA 1TNLA 1HDTH 2Q6FA 3E8LA 4Y76A 4O3TA 1Z1JA 1Y3YA 1YM0A 1DITH 1ZJDA 2XBVA 3UOUA 2ZDKA 3GCNA 1GG6C 2XWAA 3M61U 1JRSA 2BD4A 4B2BA 1YYY1 4NFEA 1C1TA 2WYJA 3MH5A 2GZ9A 4DY7B 2VWNA 5L6NH 4AGJA 3C27B 1XUFA 3I77A 1O31A 5AVDA 1ANBA 1F2SE 1YLDA 1OWHA 1S0RA 1GBIA 2WPMS 4K60A 3SI4H 1BA8B 3K6YA 2V0BA 2ZCLP 5EPYA 1TGBA 2O8WA 3SNDA 1AWHB 1NRSH 1RTLA 1B0EA 2NU2E 1AVGH 2QCYA 2WPHS 2QC2A 1EB2A 1GCTB 3SU6A 2ZQ2A 3ZVFA 1SGRE 3A88A 4JZFH 4HI3A 5A8XA 2BLQA 4RN6A 2JETB 1KXDA 4IMQA 3SBKA 1FLEE 3R3GB 4OS6A 1K1LA 5JBCS 5K0HA 1M9UA 1HB0B 5EU8A 1O3OA 1SFQB 1MBQA 3MO9A 3F1SB 2XYAA 2RDLA 1ZZZA 3ZZ4A 5HYOA 2XBWA 1F0RA 1O2TA 3RXAA 3DA9B 4E7NA 3MWIU 3QLPH 1T8MA 5EXLA 1Y3VA 3BIVH 1BITA 4IC5A 4OS1A 4ABHA 1Q2WA 1GI1A 2FX6A 4MPVA 4D76A 1O3FA 2R2WU 1VCQA 4LZ1H 3CS0A 5F6MA 1BOQA 1D9IA 2J94A 2BD9A 4ASHA 2FIRH 1THSH 2BD2A 1JXPA 3M3VA 2FWWA 4MPWA 3RXLA 1ZMJA 3QZRA 3ZZ8A 2AERH 2O8MA 1EASA 1TALA 1TNKA 1NFWA 1S0QA 1XXDA 4ZAEA 4H6TA 3UIRA 3RXIA 3E16B 1MAXA 4IN1A 2AGEX 1PPFE 1SVPA 1TPPA 5EG4A 1AKSB 4ZKSU 3KN2A 2ZIQH 7ESTE 1FPHH 1TNJA 1QY6A 5LPFA 1MKXK 3AAVA 1RJXB 2IPHA 3HGNA 3OYPA 1JIRA 1FMGA 3VFEA 4CRDA 4JK5A 1SLVB 4NZQA 3MFJA 1TX6A 1OWDA 1LKBA 3U69H 3F6UH 4TY6A 2EI8A 1HNEE 4OS5A 1TABE 3ZZ7A 2WV4A 3B9FH 1C2FA 1C5UA 1BMLA 1DWBH 2D1JA 4MNVA 1FIZA 2FOFA 3KNXA 2BDCA 4K1EA 1UTMA 1BTUA 1G3CA 4SGBE 1IAUA 4O3UA 3DFJA 3BTQE 2VVUA 3R0FA 3QZQA 1O5AB 3LGIA 1V2LT 2RG3A 3MTYA 3AVZA 3T25A 3S69A 3MI4A 3PO1C 1UTLM 2XXLA 1O2UA 3T26A 4IBLH 1SC8U 3K65B 3BEFB 1GVZA 2QXGA 1QRZA 2GCHF 2CHAB 3ZV8A 4NIYA 3BV9B 1AE5A 1O2SA 4JYVH 1WUNH 1ZHRA 1KIGH 3QX5H 2ZHEH 3SQEE 1ETRH 2F9OA 4WF8A 1C2DA 4MDSA 2PUQH 2Z6BD 1F0TA 2BZ6H 2RCEA 3PMHB 2OD3B 5TCAA 2VNTA 4FUDA 1KXFA 1ZHPA 4Y8ZA 4TYDA 2JETC 4TPIZ 1UVSH 2D26C 3TJOA 3U9AH 1Z6EA 4AORA 1UMAH 3SGAE 4CRCA 1P10A 1VGCC 3H5CB 5LGOA 5JDUB 2ZFSA 1ZSLA 3ZVCA 5FCRA 1NU7B 2G51A 4ISNA 5DP7A 2O8TA 1HAIH 3EGKH 4KTCA 2C93B 3PYHA 3BG4C 4O9VA 2W3IA 4A1TA 2F3CE 1NROH 1W2KH 2H2ZA 5ETXA 3SUDA 4ABGA 3P8NA 1VGCB 4TY7A 4R8TB 1C1QA 1TGTA 1GL0E 2ESTE 1CSOE 3B23B 1WCZA 5F8ZA 3M35A 1A5IA 1X7AC 4XSKU 3PTNA 1O3MA 1QIXB 3RUOA 1DPOA 3P92A 2VIVA 5C2ZA 1KXCA 2ZZUH 2DE9A 1V2PT 1NTPA 2EI6A 5C5NA 1TGCA 4WH8A 4LOYH 4DVAU 4K1TA 1PPHE 3SN8A 5FPTA 4IW4E 2BYAX 2IJOB 1GBAA 1NRNH 3ZZ6A 2OTVA 2HWLB 4K2YA 1O2HA 1O2QA 3SGBE 2AMPA 2Z9LA 3A83A 2ZDNA 1N1LA 2CN0H 1SQOA 1C5XB 4NSVA 1TRMA 2BD7A 1OS8A 1WYKA 4K8BA 3RM2H 4AOQA 1H4WA 1C5WB 1SQTA 1P03A 3E1XB 2ZPSA 2FLRH 8GCHF 1YC0A 2R9PA 2ZDMA 3EA7A 1XUHA 2PSXA 2OQUA 1WV7H 1A4WH 1DXPA 1AQ7A 1F5LA 1UTKA 3SU3A 5EQSA 3EE0B 1ESAA 3M7TA 5LPEA 4UFEH 4A5TS 4JZIA 3SV2H 3KQEA 3O8BA 3E91A 1GBDA 1C2KA 2PTNA 3ATLA 2A0QB 4DW2U 4NIVA 1HPGA 4ZHLU 4WY3A 1HAZB 1SGFA 1DT2A 2ZDLA 2C8XB 3VB3A 1YPLH 3RXMA 1IQFA 1CA8B 1QFKH 1FY1A 4FUHA 2FDAA 2GV7A 1LTOA 1SHHB 1AY6H 2BTCE 3FVFB 2A4QA 1F7ZA 1SOTA 2ZEBA 2BHGA 1ZGIA 1P2KA 2A1DB 3K6ZA 1MQ5A 1AKSA 4X8UH 5A09A 2OC1A 1TIOA 2B7DH 1ID5H 2G8TA 4YT6H 1A46H 3SV8A 1SGQE 2BXUH 2ZWLH 1ZPCA 5DGJA 4UFFH 4WMDA 1BBRH 1A2CH 1P2MA 3D65E 2TGPZ 4HTCH 4NA8A 3SU5A 1P01A 2ZU1A 1ELDE 4FUEA 1GVLA 2FOEA 4X2WA 2HPPH 3GISB 2ZFRH 4DURA 1GI7B 1QNJA 2EC9H 2HVXA 3F9HA 4IMZA 4Y10E 3PWBA 1XUGA 1GBTA 2ZDVH 5L2YH 1QA7A 1O2RA 4X6MA 1VCPA 5GWZA 4BOHA 1SG8B 3MMGA 2WUCA 4RKOB 2C4FH 2THFB 2FLBH 1ARBA 1AWFH 1TB6H 1G30B 4GCHG 1NO9H 1QQUA 2PKSB 1QRXA 3EQ0H 4CRFA 3Q3YA 1BQYA 2BM2A 2J34A 1ANCA 8ESTE 1HXEH 1MD7A 1XMNB 2GGVB 4CHAC 1EP6A 3TK9A 1GL1A 4GAWA 3SUGA 1ZPZA 3RXRA 1FY3A 4NFFA 5DP9A 1V2UT 3BF6H 1SLXB 1MKXH 1O3EA 5GXPA 1TONA 5C20A 3ENSB 4CBOA 2PHBA 3O8RA 4FVBA 3UOPA 1T7CA 1GBFA 1O36A 5A0BA 3BTKE 3HK6B 3TJUA 2VIQA 2A4OA 3LJJA 3VB6A 1PPEE 3QDZB 4CH2B 3UNQA 1UCYK 1O33A 2OC0A 4B2CA 1LQEA 5EXNA 4I8JA 1KLJH 1NFXA 3S9CA 1VJAU 2ANMH 2BX4A 3IWMA 3V13A 1G2LA 1AMHA 1HAOH 1A7SA 2FYRA 1CBWC 2HNTE 1SB1H 2UUFB 1TQ0B 2F91A 1MD8A 5FCKA 1S5SA 4UFDH 1MMJN 3UWJH 1EX3A 1BJUA 1YPHC 3Q00A 3DD2H 3I78A 1TMBH 1P12E 2BOHB 1C1MA 1TBZH 1O5BB 3F9EA 3T62A 4Q7ZA 1P11E 3URCA 5FAHA 2WPJS 2ALVA 3VGCC 1YLCA 2ZFQH 1A1RA 3ZVDA 2P8OC 5E2OA 1O5FH 1CT2E 3BTHE 4A1XA 4ZROA 1BRBE 3RC5A 3TNTA 2VGCC 1PJPA 1GJ8B 4X2VA 2HNTF 2CF8H 1G2MA 3HK3B 5HMAA 3SJOA 1XKAC 4FVDA 3F68H 2ZHFH 3PMBB 3PB1E 4FUCA 1O3KA 4A6LA 3KCGH 3URDA 2YNAA 1GJ6A 1YCPH 5HM9A 4O97A 4MLFB 4AG1A 3D62A 1GMHG 1GI9B 1IQJA 1ELGA 1YP9A 4FXGH 2ZNKH 4Z6AH 1O3CA 2VIPA 1C5MD 1E38B 1SGFG 4DOQA 1K21H 1N6XA 1TLDA 3JZ1B 1ETTH 2UUYA 2PW8H 4KKDA 3LH1A 4I8GA 5DKMA 1MZAA 2BDYA 1YCPK 4DIHH 4IS5A 1SMFE 1XUKA 1G3BA 2PKAA 5L2ZH 1C5VA 3M7UA 2P59A 1KXBA 1AVWA 1HJAB 5EGMA 4R0IA 3BTTE 2FOHA 1HAVA 1C1VH 1XKBC 5A2MH 1EZUC 1C5YB 5FPSA 1PQ5A 2ZC9H 5FX5A 1SGTA 1QHRB 3U1IB 3D23A 1F0UA 3ODFA 2QXJA 4BAOB 5BRRE 1DUAA 4FUGA 2GVFA 2XRCA 3ZV9A 2BDHA 1O30A 1K22H 1YBWA 1C1OA 2DE8A 2BDGA 3A85A 1FAKH 4ZMAH 2SNWA 1ZMNA 3A7TA 2JH6D 3ZZBA 2OP9A 1ABJH 2OINA 4B76A 1SBWA 3S9BA 3VEQB 1GWAA 3LT3A 1H9IE 3UR9A 4NSYA 1L1GA 4DJZB 3A7ZA 4AFZA 2GMTB 1EAIA 3MH6A 1CVWH 1WQSA 3MH7A 1ZTJA 3LGUA 1VITH 2ZU2A 3K9XB 1O2PA 4GPGA 5EXMA 2PLXA 1OYTH 3DUXH 1A3EH 1ELEE 4AN7A 4GHTA 9ESTA 1C5OH 1P05A 1T8OA 4JZEH 1IQLA 1QBNA 3FZDA 4M7GA 2V3OH 2I6QA 3A7WA 1ESBA 1LHGH 1TOCB 1PYTD 3LKWA 4K1SA 1ZTLA 2BY6X 2FOCA 3BTEE 5E8EH 3A82A 3E90B 1P2JA 3OY6U 1C4V2 4RKJB 4KELA 1GHAF 2WYGA 1O2VA 1GHVH 1O2GH 4FU8A 2J92A 4KTSA 5AF9H 1GJCB 4CRBA 3GICB 2BLVA 2VH0A 2ZU5A 4O03A 1B7XB 1YCPM 2H1UA 1TNHA 2B5TB 4HZHA 2WPIS 3VXFH 2G5VA 2FO9A 3BN9A 1SL3A 2OXSA 1MTUA 1BB0B 2BY9X 3UNRA 1OWJA 5TJXA 5J4SA 4DIIH 3STIA 4ISLA 5G4BA 2O9QA 1T4VH 4ZKNU 1P2NA 1V3XA 1Z71A 2ASUB 2IOTA 1GMDF 3GCHC 5DK1A 3RMOH 1LQDB 1TNIA 1AI8H 1DE7H 4ABEA 2Y5GA 1V2NT 3GYLB 1P02A 4YLQH 5E0JA 4MVNA 3PMAB 4NIWA 2VGCB 4JZ1A 1G3DA 2Y7ZA 4X1SU 2VWLA 3PROA 1SGCA 2VIOA 2ZF0H 1HAVB 8KME2 2VU8E 2FTMA 1C2GA 1GI6A 1ELFA 1GBEA 1HBTH 4K3JA 3FP6E 4GCHF 4NWKA 5JB8S 2W7SA 1C5SA 2J9NA 2Y5HA 3RDZA 1DM4B 3V7TA 1TA2A 4CBNA 1AGJA 4WXVA 3TU7H 2M5TA 2BD5A 3ZYEA 1AFQC 4TPYA 3UQOA 3SUEA 3TITA 1L4DA 4ESTE 1QURH 1MTNB 2GD4B 3O8CA 3TJNA 2SNVA 1NESE 3T28A 3RU4T 1EXFA 3E6PH 1Y5UT 1EPTB 1L2EA 1EKBB 1GDQA 2H5CA 1THPB 2W3KA 1V6DA 1V2RT 4E7RG 3P95A 2W5EA 1SGPE 4X8SH 3A80A 3QK1A 4A1VA 1UO6A 2VWOA 4ZHAA 4XE4A 3MOCA 1BMAA 1GJ4H 1UHBB 2BY8X 3ZVBA 1ZGVA 4UDWH 2A5KA 1O2YA 3GDVA 1TYNA 3SU0A 2WUBA 1O38A 3KQDA 2GCHG 1E0FD 1OPHB 4YESB 2VVVA 2FS8A 4MPXA 3N7OA 1O3GA 1AIXH 2SGPE 1A5GH 4INHA 1LVMA 1GI0A 1QA0A 1SFIA 3QGNB 1D3DB 5HM2A 3GY5A 1GI2A 3ZZAA 1AO5A 4XDEA 2F9BH 2VIDA 1O2WA 3ITIA 4ABDA 4Q7XA 4BTTB 3LGYA 5FBIA 5GDSH 2QXIA 1C5QA 2Q6DA 1FDPA 2PTCE 5A8YA 4B1TA 8GCHG 4WXIA 3BG4B 1O2ZA 1HAYB 1J14A 4X1QU 2G81E 4AX9H 5LPRA 1OWKA 1S85A 3VXEH 5DP4A 3L3TA 2QYIA 1BHXB 3LGWA 3A8BA 4CR9A 2UUKB 2ZI2H 1MTNC 2GZ7A 1OOKB 3SNEA 1NRQH 3FP8E 1BTPA 1XUJA 1GJ7B 3SU1A 1AUJA 1O35A 1O2XA 2ZGXH 5HGGA 1O5DH 4YM9A 4WMEA 4XOJA 2BD3A 1NRPH 1U6QA 2CV3A 1GDUA 2D8WA 4NWLA 1E37B 2J38A 2VWMA 2PV9B 1P2QA 3UY9A 3FFGA 1LHDH 4X1PU 1C1WH 1EPTC 2ZCKP 1OKXA 2LPRA 3ZVAA 1SPJA 1RTKA 2XCFA 1NY22 1QBVH 2BXTH 1NFYA 1HYLA 5T6FA 1ABIH 2A2XH 2TPIZ 1C1PA 2XBXA 2FOGA 4BNRA 5CHAC 4BTIB 1CO7E 1XXFA 1TPSA 4LK4A 1NPMA 4BAQB 1C5ZB 1GHYH 3UWIA 4Y11E 5C1XA 3V0XA 4Z0KA 1CGJE 1WBGB 2BQ7B 3Q77A 4ABFA 2SGEE 1T32A 4J2YB 3BEIB 3BTWE 3PLPA 1Q3XA 2STAE 3T5FH 1RFNA 2QV1A 2C8WB 1GMCF 2G52A 4JZDH 2FOAA 3Q3KA 3GCTF 4TWYA 3A81A 1P57B 3K2UA 4I32A 1S82A 3ELAH 3MYWA 1P3EA 2A7CA 3E0NB 3S0NA 3PMJA 5C5OA 4X0WU 1O2NA 1AB9B 3SI3H 3NK8A 3M3SA 1W3CA 1W7GH 2ZGJA 4FU7A 9LPRA 2F9UA 2FMJA 1G9IE 2ZU3A 1Q31A 2K1QA 5F8XA 1W14U 3M7QA 2P94A 1A3BH 1H1BA 3NWUA 1BTHH 3P8OA 3TPIZ 4Q7YA 1L0ZA 4AFUA 2Y7XA 4ZKOU 2ZGBH 4XBCA 3P8GA 3GY6A 1TMTH 3SNAA 4WMFA 1T8LA 2AGIX 2F9PA 1LHCH 1GBLA 2G4TA 3UUZA 1N8OC 3A86A 1JWTA 2A4GA 1WTGH 4UEHH 1TX7A 4OS4A 3KL6A 3TH2H 1P9SA 4CRAA 1ZYOA 4YT7H 1FONA 1KDQB 5JBAS 1CHOF 1BMMH 1DXWA 4B73A 1V2WT 3NXPA 3C1KA 4I31A 1C4Y2 1O3JA 1C2MA 1Z6JH 1ELVA 1TBRH 3AASA 3LH3A 4AB9A 1EP5A 1EOLA 1UHBA 1E35B 3RXEA 1HXFH 2GP9B 4X8TH 1SGNE 3MH4A 2TGAA 1UK4A 4CREA 1P04A 1ETSH 3MNCA 1UVPA 4IC6A 5T6DA 2HPQH 1Y8TA 4ABIA 1C5NH 4U30A 6CHAC 2I6SA 2QF3A 1IOEA 3MNXA 2B0FA 2GZ8A 6CHAB 2AGGX 1AU8A 1ZPBA 1YPEH 1GJAB 3SHCH 7GCHF 1JOUB 1TBQH 2ZHDA 3GY2A 1SLWB 1DICA 1SGDE 2A4RA 1D4PB 1IQGA 1SOZA 3PLBA 1AD8H 1GVKB 1JIMA 4AFQA 1ESTA 1S81A 1O2IA 3U8RH 1SR5C 4AZ2B 8LPRA 1DSTA 1G3EA 1LVYA 2FTLE 3VB7A 5CE1A 1OX1A 3BTDE 1QL9A 1O0DH 3A7XA 4Y6DA 1TX8A 1O37A 2FEQH 3LGVA 2ZHQH 5B6OA 3MO3A 1DLEA 1K1OA 2GT8A 4HFPB 2OC7A 3NKKA 3LIWA 2WPLS 1LVBA 2V35A 2PR3A 4BAHB 1V2OT 5EQQA 2CF9H 3ZVEA 7LPRA 1HIAA 2SGQE 1C5TA 1DWEH 3ZZ3A 3L6PA 3HGPA 1D6WA 1HJ9A 1UTJA 4H42U 2G4UA 3ZZCA 5E2PA 4GVUA 1ZTKA 4E05H 3LGTA 3KEEA 2ZTYA 2OUAA 1LPGB 2Z3DA 3M3TA 1ZMLA 1IQKA 1EAWA 1O3AA 4ZUHA 5PTPA 3M5NA 1TGSZ 3MU5A 2A7HA 5ESTE 2XW9A 5TCCA 3LC3A 1PPBH 1D3PB 4ZHMU 1J9CH 3QTOH 1FIWA 4X6PA 3DT0H 1Y59T 2HNTC 3H7OA 4K8YA 5JB9S 2Y82A 3GY7A 1P2OA 1HAPH 2RA0A 1C2EA 1QR3E 3U8TH 2C8YB 2BLOA 1IQNA 1J8AA 1F5RA 1FPCH 5C1UA 4Y79A 3V12A 1CE5A 3RXDA 2Z7FE 3LDXH 3MU0A 4MG3A 2BD8A 2TIOA 4LZ4B 3VGCB 2ODQA 1MZDA 2XNIA 3B8JA 4UFGH 4NA9H 1PPZA 6LPRA 3CENA 1INCA 1AVXA 1AZ8A 1PQ8A 2A45B 2AYWA 1ELTA 1BZXE 3UQVA 2Y80A 4YO9A 1Z8GA 2UWOA 1P06A 3GY8A 3SNCA 1GBHA 1AHTH 1ELAA 5F8TA 2FI4E 1JBUH 2HGTH 1ZRBA 3RXBA 5CMXH 2NU3E 1MBMA 3TNSA 1PYTC 4X6OA 3EAJA 1MKWK 1BHXF 1NC6A 1SLUB 1P2IA 3STJA 4ZKRU 1ZSKA 1RD3B 2ULLA 2VJ1A 1S6FA 1CA0B 2TGDA 2CXVA 1OYQA 3NCLA 4MQAA 1ZOMA
chains in the Genus database with same CATH superfamily
5C67A 1NT1A 3G01A 3GCOA 4M9FA 1MTSA 3KF2A 1GCTC 1MABB 2Y81A 4XBBA 2STBE 1OWEA 1NS3A 1CT4E 1GDNA 3FO8D 3PTBA 1S6LA 1WXRA 1LDTT 3GS9A 3F9GA 4AYVB 1OP8A 2PWXA 5C0UA 1J17T 1VKYA 1Y5BT 2QF0A 4UONA 1BBRE 4CRGA 1DDJA 3ZYDA 3RU4D 4ISHH 4TT3D 3KIDU 1A5HA 5C0TA 4NA7A 2BDBA 2V3HH 2BVXH 1DS2E 1O2MA 2FOBA 1BUIA 3I29A 3MU1A 5JBBS 1O3NA 1QZ8A 2P3TB 3SJKA 2FP7B 1EB1H 4ABJA 4QT8C 1KXAA 2GDEH 2Z9GA 1FY8E 2FODA 1SSXA 5AHGH 5FXLA 3MNBA 2RFKC 1W11U 2PGBB 2VIWA 4Y8XA 5K7RA 1W13U 1FJSA 1DY9A 2BY7X 4XFQA 4FOUC 3TGIE 4BAMB 2UUJB 2GV6A 3UR6A 2HALA 4H6SB 4YZUA 1XVMA 1O32A 2P3UB 3A8DA 1IHSH 5AFZH 3SNBA 2C8ZB 2ZG0H 1S84A 1B0FA 4GLYA 5A0CA 4NCYA 2Z9KA 1UCYH 2AIQA 4MNYA 1OP0A 1HRTH 2GT7A 2WINI 3PLKA 5GCHF 1ELCA 3TH4H 2UWPA 3EA9A 2QXHA 1FNIA 2ANKH 2QAAA 1TE0A 4D7FA 1GHBF 5IDKA 1K1JA 1O2KA 2R0LA 1DY8A 3HATH 1HFDA 5CHBA 1O2OA 3E3TA 4XBDA 5EW2H 1DWCH 2KCAA 3TK6A 1GJ5H 1DWDH 3LOXA 2XTTB 2ZECA 2GDDA 4DG4A 1C1UH 1QL7A 3SZEA 4WVPE 7GCHG 4X2XA 4X8VH 3U8OH 5IYTA 3SZNA 1ORFA 3BEUA 2R0KA 3ATWA 1SGEE 5E0HA 2ZCHP 4XRNA 1TPOA 3ATKA 2BX3A 1UJ1A 2SGAA 3RMMH 2BVRH 1UTOA 1O3BA 2F9NA 1K1IA 3F0OA 2AS9A 3TVJB 2R2MB 3D49H 1WQVH 1K28D 1C1RA 2AFQB 3SJ9A 4INKA 4I8HA 3KYGA 3ZVGA 2FXRA 2WPDD 1Z1IA 4FUBA 1IQHA 1CHOG 3RLWH 1WTHD 2GCTB 1EJNA 1V2TT 2V3MA 2P16A 5H4IB 1YPMH 1Z8JB 3GDSA 5FX6A 3ZZ5A 1ANDA 2FOMB 5FPYA 1FY4A 1T4UH 3ESTA 1V2QT 1GJ9B 1CHGA 4U2WA 5CHAB 3TK5A 1C1NA 4RI0A 3TH3H 4F49A 1XUIA 4BXSA 5JPMH 5EW1H 3CS7A 5C1YA 5C94A 2AH4X 2JKHA 1CBWB 3JZ2B 3LC5A 1O5EH 4A7IB 3OAAD 3RC4A 2ZTZA 2Y5FA 1QL8A 3NZIA 3IG6B 1EAXA 1OWIA 2EA3A 1GI5A 2BY5X 3P6ZB 3OEED 1EATA 2OLGA 1ZJKA 1OP2A 3RXCA 1WAYB 1GI3A 4U32A 3AW1A 4GHQA 4B71A 4AB8A 4GUXA 2Z94A 1COWD 5EJLA 2F83A 2YNBA 3FZZA 5T6GA 1Y3UA 3FAOA 2F9VA 3KHVA 1TMUH 1RGQA 2QIQA 2O8UA 3GY3A 4SGAE 1PPCE 4H4FA 5ABWA 3ZIAD 2ANWA 1PFXC 1QB6A 2ILNA 5AFYH 1A61H 3GCTG 2ZGCA 3F9FA 1C9PA 1J15A 4YLUA 4Y71A 2CMYA 2ZKSA 2L6OA 2QGRA 2GMTC 3OU0A 4ISOA 1UK2A 2W26A 4J1YA 5GPIB 3TLOA 2BDAA 1YPHE 1GGDC 2JJ1D 4Q4LA 1NU9A 6GCHF 1IHTH 4WWYA 5BPEA 1WSSH 5DPAA 1GJBB 2ZFTA 3TIUA 1RS0A 4MTBA 4VGCC 4NZLA 1F0SA 4ZXYH 3T2NA 2R3YA 4LXBH 1P0SH 5EJ1A 1DX5M 5HXFA 2ZDAH 1H8DH 3RMNH 1LO6A 1EAUA 1Y3XA 3RXUA 1TNGA 5SGAE 3QTVH 1BIOA 1MAYA 4IN2A 1BDAA 3SORA 4UD9H 2PUXB 1EZXC 1EPTA 1CQQA 1DVAH 2XC0A 2ZA5A 2QY0B 4Q80A 3RXSA 4XD7D 3BTFE 4FU9A 2BB4A 1BCUH 3PV4A 3SU2A 2WV9A 1F92A 4FUIA 2JJ2D 1Z8RA 1KYNA 3GY4A 2HRVA 2PSYA 3VB4A 1MCVA 1AB9C 4B2AA 1P09A 2KFWA 1EOJA 1BRCE 3BIUH 3SW2B 3HPTB 3BSQA 4X2YA 3HKIB 1KSNA 2ZP0H 1TPAE 2RA3A 1YF4A 5ESBA 1EZQA 3L33A 2JH5D 4OS2A 3W95A 2HLCA 3EYDA 3QN7A 1L1JA 1VITF 3S9AA 1KTTB 2G00A 4WJG2 3ZZ9A 1THRH 7KMEH 3U98H 1S6HA 1FY5A 1HAXB 4CR5A 1O2JA 1K2I1 2Y6TA 1OSSA 1CU1A 2FS9A 2QA9E 1QQ4A 1LHEH 1P8VC 1YY3A 5DG6A 1IQEA 1RIWB 1GI8B 1O3PB 2KAIB 1P3CA 1TRYA 4BXWA 1P9UA 3AAUA 1W8BH 3KQBA 4BAKB 1CGHA 4OGYA 5JYIA 1C2JA 3A8AA 2XWBI 1JRTA 3CP7A 3SV9A 5A8ZA 1GBKA 3MU8A 3QO6A 1HJ8A 1HV7A 1MKWH 1QJ1B 1VZQH 1XM1A 6GCHG 2FESH 3RXOA 4JCNA 3SUFA 4DGJA 3UNSA 1KTSB 2Z9IA 3A7YA 1ZRKA 2BLWA 2QN5T 1Z7KA 3GCHB 2Z3EA 4ZCNA 1MCTA 1YPKH 5DO4H 4JYUH 2JIZD 2WPKS 1ARCA 1UVTH 2ZFPH 2ZU4A 3A84A 1BMNH 5T3HA 1QB1A 4K69A 1H9LB 3SGQE 5E0GA 4X1RU 3SU4A 3M5MA 3UFAA 2UWLA 4UE7H 1TFXA 1FN6A 2H9HA 2Z9JA 1KXEA 2A32A 1O5CB 1VR1H 2M2AA 1QRWA 1BRUP 3A87A 2L74A 1HAGE 1GBMA 3A8CA 2BVSH 2ZPQA 4ZH8A 2AMDA 4I7YH 1FZZA 4D9QA 2BMGB 2B9LA 5GIBA 2PKAB 5EQRA 1HCGA 2DUCA 2P93A 5L30H 2TGTA 5EODA 5DP8A 2XC4A 2J5UA 2NU0E 4I33A 3UTUH 2EEKA 2H6MA 2C90B 1TOMH 4X6NA 3OFND 3V3MA 2JDID 3SOSA 1O39A 1QTFA 3HKJB 1W0ZU 1H9HE 1G32B 3VPKA 1LVOA 1GBJA 1EZSC 2JH0D 1LPKB 1DLKB 4ABBA 4CHAB 1O3HA 1UTQA 1GBBA 2ODPA 4AYYB 1GMCG 3QWCH 2R3UA 2BZAA 2PKSC 4D7GA 3MO6A 2GX4A 1GCDA 1V2VT 1V2MT 2SFAA 1AE8H 3FANA 4Y7BA 3F3BA 1W12U 1ZLRA 3OSYA 1SGIB 3RXVA 4BANB 1BTXA 1E79D 2B8OH 2SGFE 4E06H 1DSUA 3M36A 3SJIA 4MNWA 3TJVA 2XBYA 1Y3WA 1C2LA 3NUMA 3RXFA 1B5GH 1CGIE 1FN8A 2C3SA 1GGDB 3UREA 4HGCA 1C2IA 4OS7A 2VINA 2AEIH 1TAWA 3NPSA 1CA0C 1KLTA 3A7VA 3Q3XA 4KP0A 1BTWA 2YMSC 3O8DA 2CJIA 3Q76A 5C3NA 1E36B 1T31A 3H7TA 2ZQ1A 1VJ9U 5JBTA 1G37A 2ZO3H 1UVOA 1DOJA 1EJAA 1BBRK 1TRNA 3QGJA 1VITG 3RC6A 1GG6B 1ZSJA 4JK6A 2A5IA 3S7HB 3FOAA 3SQHE 1PPGE 2GKVE 2KAIA 1A0LA 1MTWA 3WY8A 1TQ7B 2ANYA 3EDXB 3OTJE 3S7KB 2OQ5A 1EQ9A 1RTFB 1HJAC 1YGCH 2XCNA 5T1VA 2HOBA 4KTUA 4I8LA 1OXGA 1GHAG 3P70B 1C4U2 4CH8B 3PO1B 3SO3A 1DFPA 3TGJE 1O2LA 1O3DA 2BDIA 2GCTC 3SHAH 1HAHH 1HGTH 1MUEB 1YPGH 3UPEA 1AUTC 3A89A 1TWXB 5DJ7A 3RMLH 3KQ5A 5EPNA 1NN6A 3DHKH 2GTBA 1AFQB 2KM0A 1HLTH 1AN1E 4IGDA 1EUFA 3RXKA 1RIWC 3LU9B 1LKAA 1FUJA 1NRRH 2FPZA 2TRMA 3MNSA 1ELBA 2ALPA 2VH6A 1LHFH 4I8KA 3LJOA 1BTYA 1HIAB 4U01A 5GJ4B 2NU1E 1C2HA 1IQMA 1W10U 2A5AA 4INLA 1W7XH 4Y0ZE 4B6FA 2O8LA 3T29A 1FV9A 3MHWU 3LPRA 1MU6B 3AW0A 1LCYA 1UTNA 2BOKA 3BG8A 4AGKA 2FX4A 4THNH 3MU4A 2OBOA 1BTZA 2QE7D 3RXTA 2F4LA 5I46H 2AMQA 4Y7AA 2G5NA 2H9TH 1YWUA 2FYQA 1FAXA 2D2DA 4B74A 4JYTA 1BRAA 1TGNA 2NU4E 1GBCA 2P8OB 4ISIH 3BTGE 1A0JA 5J4QA 2FM2A 2V6NA 1BJVA 2OBQA 1TA6A 5DP6A 1NFUA 1NBME 3RM0H 2P3FH 4ABAA 1RXPA 1V2KT 2ODYB 1ZR0A 2G55A 2A31A 1E1QD 1ZHMA 1HUTH 1ACBE 2WZQA 4MPUA 3T27A 3M5LA 4BTUB 4JMYA 3VB5A 2ZHWH 2J2UA 4TWWA 1JMOH 1SGYE 1H8IH 1D3TB 1V2ST 1K9OE 1WU1A 3OY5U 3P8FA 2OK5A 2TBSA 1RRKA 1XVOA 4B75A 5EOKA 1O3LA 1LPZB 4WH6A 3RP2A 2W7UA 3ATIA 3RXPA 1WOFA 2ZTXA 1QBOA 1C5RA 4NG9H 4AFSA 3KQCA 1DANH 2AIPA 1GMHF 5LH8A 2BQWB 3BTME 3PM3A 4VGCB 2XC5A 3GDUA 2CGAA 3QUMP 4KGAA 4Q2KA 4RSPA 1QJ6B 3IITA 5DP3A 2H9EH 1YPJH 2IN2A 4FETA 3GYMA 3LONA 4NGAH 2NWNA 1GMDG 2Q1JA 4YOGA 2A7JA 1KDQA 1BMFD 1UCYE 2LNCA 4YTAA 5F03A 4F4OC 5I25A 3ATMA 2P95A 1KY9A 1UK3A 1C1SA 2PFEA 5A0AE 3PWCA 2OC8A 2VB0A 2Q6GA 1GHBG 1N8OB 1UTPA 4X1NU 3GOVB 2WV5A 6ESTA 4GSOA 1J16A 1C9TA 1PQAA 5GCHG 1N6YA 1E34B 5FBEA 4YOJA 1GHZA 4DT7B 3U1JB 1DUEA 1QJ7B 1O34A 2FI5E 1D6RA 3RLYH 1MTVA 1SI5H 2CHAC 1FXYA 4Y8YA 1GHWH 2A2QH 1AZZA 2ZFFH 4P00A 1FQ3A 1SQAA 4ZXXH 2SGDE 4FUFA 4OGXA 1SHYA 3H09A 1OHHD 1S83A 3RXQA 2J4IA 1Y5AT 1V2JT 2VVCA 3W1EA 1KLIH 2BQ6B 2PGQB 1VCWA 3KGPA 1ANEA 4MNXA 1GI4A 1GJDB 1C5PA 2EQNA 4YOIA 1MQ6A 3WWFA 3P17H 1NM6A 1G36A 1MU8B 1QB9A 3E0PB 2Z3CA 1K1NA 1T8NA 1NZQH 4Y0YE 4PROA 1GHXH 4K5ZA 1L1NA 4D8NA 3M37A 3ZZDA 1EJMA 3SJ8A 1GPZA 1MH0A 2YOLA 3RXJA 3FP7E 3TGKE 1K1PA 3RU4E 3RXGA 1O3IA 1PQ7A 2ZPRA 2FI3E 1Z8IB 3DCLA 3OX7U 1K1MA 1YKTA 1F5KU 3ODDA 4D9RA 2ZGHA 1CT0E 1AFEH 1FI8A 3KYFA 3W94A 1A0HB 2OCVB 1LMWB 1UVUH 3DFLA 3M5OA 4AG2A 1QGFA 1W0YH 5DP5A 2EI7A 2H5DA 1IQIA 1L4ZA 2FZZA 1C5LH 3SV7A 1BT7A 3EA8A 4FUJA 1O5GH 1XX9A 5FHTA 4NIXA 4A92A 4ASUD 3SV6A 1D3QB 1QCPA 4DCDA 2J95A 3RXHA 1TNLA 1HDTH 2Q6FA 3E8LA 2J98A 4Y76A 4O3TA 1Z1JA 1Y3YA 2XOKD 1YM0A 1DITH 1ZJDA 2XBVA 3UOUA 2ZDKA 3GCNA 1GG6C 2XWAA 3M61U 1JRSA 2BD4A 4B2BA 1YYY1 4NFEA 1C1TA 2WYJA 3MH5A 2GZ9A 4DY7B 2VWNA 5L6NH 4AGJA 3C27B 1XUFA 3I77A 1O31A 5AVDA 1ANBA 1F2SE 1YLDA 1OWHA 1S0RA 1GBIA 2WPMS 4K60A 5FL7D 3SI4H 1BA8B 3K6YA 2V0BA 5EJZA 2ZCLP 5EPYA 1TGBA 2O8WA 3SNDA 1AWHB 1NRSH 1RTLA 2W6ID 1B0EA 2NU2E 1AVGH 2QCYA 2WPHS 2QC2A 1EB2A 1GCTB 3SU6A 1SKYE 2ZQ2A 3ZVFA 1SGRE 3A88A 4JZFH 4HI3A 5A8XA 2BLQA 4RN6A 2JETB 1KXDA 4IMQA 3SBKA 1FLEE 3R3GB 4OS6A 1K1LA 5JBCS 5K0HA 1M9UA 1HB0B 5C17A 5EU8A 1O3OA 1SFQB 1MBQA 3MO9A 3F1SB 2XYAA 2RDLA 1ZZZA 3ZZ4A 5HYOA 2XBWA 1F0RA 1O2TA 3RXAA 3DA9B 4E7NA 3MWIU 3QLPH 1T8MA 5EXLA 1Y3VA 3BIVH 1BITA 4IC5A 4OS1A 4ABHA 1Q2WA 1GI1A 2FX6A 4MPVA 4D76A 1O3FA 2R2WU 1VCQA 4LZ1H 3CS0A 5F6MA 1BOQA 1D9IA 2J94A 2BD9A 4ASHA 2FIRH 1THSH 2BD2A 4RT1A 1JXPA 3M3VA 2FWWA 4MPWA 3RXLA 1ZMJA 3QZRA 3ZZ8A 2AERH 2O8MA 1EASA 1TALA 1TNKA 1NFWA 1S0QA 1XXDA 4ZAEA 4H6TA 3UIRA 3RXIA 3E16B 1MAXA 4IN1A 2AGEX 1PPFE 1SVPA 1TPPA 5EG4A 1AKSB 3PV2A 4ZKSU 3KN2A 2ZIQH 7ESTE 1FPHH 1TNJA 1QY6A 2LP6A 5LPFA 1MKXK 3AAVA 1RJXB 2IPHA 3HGNA 3OYPA 1JIRA 1FMGA 3VFEA 4CRDA 4JK5A 1SLVB 4NZQA 3MFJA 1TX6A 1OWDA 1LKBA 3U69H 3F6UH 4TY6A 2EI8A 1HNEE 4OS5A 1TABE 3ZZ7A 2WV4A 3B9FH 1C2FA 1C5UA 1BMLA 1DWBH 2D1JA 4MNVA 1FIZA 2FOFA 3KNXA 2BDCA 5KECA 4K1EA 1UTMA 1BTUA 1G3CA 4SGBE 1IAUA 3EE7A 3DFJA 4O3UA 3BTQE 2VVUA 3R0FA 3QZQA 1O5AB 3LGIA 1V2LT 2RG3A 4ACBA 3MTYA 2K0QA 3AVZA 3T25A 3S69A 3F2FA 3MI4A 3PO1C 1UTLM 4RT0A 2XXLA 1O2UA 3T26A 4IBLH 1SC8U 3K65B 3BEFB 1GVZA 2QXGA 1QRZA 2GCHF 2CHAB 3ZV8A 4NIYA 5EIYA 3BV9B 1AE5A 1O2SA 4JYVH 1WUNH 1ZHRA 1KIGH 3QX5H 2ZHEH 3SQEE 1ETRH 2F9OA 4WF8A 1C2DA 4MDSA 2PUQH 2Z6BD 1F0TA 2BZ6H 2RCEA 3PMHB 2OD3B 5TCAA 2VNTA 4FUDA 1KXFA 1ZHPA 4Y8ZA 4TYDA 2JETC 4TPIZ 2EY4C 1UVSH 2D26C 1K0HA 3TJOA 1KMHB 3U9AH 1Z6EA 4AORA 1UMAH 3SGAE 4CRCA 1P10A 1VGCC 3H5CB 4TSFD 5LGOA 5JDUB 2ZFSA 1ZSLA 3ZVCA 5FCRA 2PP6A 1NU7B 2G51A 4ISNA 5DP7A 2W6JD 2O8TA 1HAIH 3EGKH 2GJGA 4KTCA 2C93B 3PYHA 3BG4C 4O9VA 2W3IA 4A1TA 2F3CE 1NROH 1W2KH 2H2ZA 5ETXA 3SUDA 4ABGA 1FX0B 3P8NA 1VGCB 4TY7A 4R8TB 1C1QA 1TGTA 1GL0E 2ESTE 1CSOE 3B23B 4B6EA 1WCZA 5F8ZA 3M35A 1A5IA 1X7AC 4XSKU 3PTNA 1O3MA 1QIXB 3RUOA 1DPOA 3P92A 2VIVA 5C2ZA 1KXCA 2ZZUH 2DE9A 1V2PT 1NTPA 2HVYB 2EI6A 5C5NA 1TGCA 4WH8A 4LOYH 4DVAU 4K1TA 1PPHE 3SN8A 5FPTA 4IW4E 2BYAX 2IJOB 1GBAA 1NRNH 3ZZ6A 2OTVA 2HWLB 4K2YA 1O2HA 1O2QA 3SGBE 2AMPA 2Z9LA 3A83A 2ZDNA 1N1LA 2CN0H 1SQOA 1C5XB 4NSVA 1TRMA 2BD7A 1OS8A 1WYKA 4K8BA 3RM2H 4AOQA 1H4WA 1C5WB 1SQTA 2YMSD 1P03A 3E1XB 2ZPSA 2FLRH 8GCHF 1YC0A 1UW7A 2R9PA 2ZDMA 3EA7A 1XUHA 2PSXA 1H8HD 2OQUA 1WV7H 1A4WH 1DXPA 1AQ7A 1F5LA 1UTKA 3SU3A 5EQSA 3EE0B 1ESAA 3M7TA 5LPEA 4UFEH 4A5TS 3N7DA 4JZIA 3SV2H 3KQEA 3O8BA 3F2GA 3E91A 1GBDA 1C2KA 2PTNA 3ATLA 2A0QB 4DW2U 4NIVA 1HPGA 4ZHLU 4WY3A 1HAZB 1SGFA 1DT2A 2ZDLA 2C8XB 3VB3A 1YPLH 3RXMA 2KCPA 1IQFA 1CA8B 1QFKH 1FY1A 4FUHA 2FDAA 2GV7A 1LTOA 1SHHB 1AY6H 2BTCE 3FVFB 2A4QA 1F7ZA 1SOTA 2ZEBA 1E1RD 2BHGA 1ZGIA 1P2KA 2A1DB 3K6ZA 1MQ5A 1AKSA 4X8UH 5A09A 2OC1A 1TIOA 2B7DH 1ID5H 2G8TA 4YT6H 1A46H 3SV8A 1SGQE 2BXUH 2ZWLH 1ZPCA 5DGJA 4UFFH 4WMDA 1BBRH 1A2CH 3SYJA 1P2MA 3D65E 2TGPZ 4HTCH 4NA8A 3SU5A 1P01A 2ZU1A 1ELDE 4FUEA 1GVLA 2FOEA 4X2WA 2HPPH 3GISB 2ZFRH 4DURA 1GI7B 1QNJA 2EC9H 2HVXA 3F9HA 4IMZA 4Y10E 3PWBA 1XUGA 1GBTA 2ZDVH 5L2YH 1QA7A 1O2RA 4X6MA 1VCPA 5GWZA 4BOHA 1SG8B 3MMGA 2WUCA 4RKOB 2C4FH 2THFB 2FLBH 1ARBA 1AWFH 1TB6H 1G30B 4GCHG 3FKSD 1NO9H 1QQUA 2PKSB 1QRXA 3EQ0H 3NRLA 4CRFA 3Q3YA 1BQYA 2BM2A 2J34A 1ANCA 8ESTE 1HXEH 1MD7A 1XMNB 2GGVB 2YMSB 4CHAC 1EP6A 3TK9A 1GL1A 4GAWA 3SUGA 1ZPZA 3RXRA 1FY3A 4NFFA 5DP9A 1V2UT 1W0JD 3BF6H 1SLXB 1MKXH 1O3EA 5GXPA 1TONA 5C20A 3ENSB 4CBOA 2PHBA 3OEHD 3O8RA 4FVBA 3UOPA 1T7CA 3VG8A 1GBFA 1O36A 5A0BA 3BTKE 3HK6B 3TJUA 2VIQA 2A4OA 3LJJA 3F0PA 3VB6A 1PPEE 3QDZB 4CH2B 3UNQA 1UCYK 1O33A 2OC0A 4B2CA 1LQEA 5EXNA 4I8JA 1KLJH 1NFXA 3S9CA 1VJAU 2ANMH 2BX4A 3IWMA 3V13A 1G2LA 1AMHA 1HAOH 1A7SA 2FYRA 1CBWC 2HNTE 1SB1H 2UUFB 1TQ0B 2F91A 1MD8A 5FCKA 1S5SA 4UFDH 1MMJN 3UWJH 1EX3A 1BJUA 1YPHC 3Q00A 3DD2H 3I78A 1TMBH 1P12E 2BOHB 1C1MA 1TBZH 1O5BB 3F9EA 3T62A 4Q7ZA 1P11E 2HLDD 3URCA 5HIZA 5FAHA 2WPJS 2ALVA 5DSFA 2QF4A 3VGCC 1YLCA 2ZFQH 1A1RA 3ZVDA 2P8OC 5E2OA 1O5FH 1CT2E 3BTHE 4A1XA 4ZROA 3PRDA 1BRBE 3RC5A 1NBMD 3TNTA 2VGCC 1PJPA 1GJ8B 4X2VA 2HNTF 2CF8H 1G2MA 3HK3B 5HMAA 3SJOA 1XKAC 4FVDA 3F68H 2KX4A 2ZHFH 3PB1E 3PMBB 4FUCA 1O3KA 4A6LA 3KCGH 3URDA 2YNAA 1GJ6A 1YCPH 5HM9A 4O97A 4MLFB 4AG1A 3D62A 1GMHG 1GI9B 1IQJA 1ELGA 3UAIC 1YP9A 4FXGH 2ZNKH 4Z6AH 1O3CA 2WHXA 2VIPA 1C5MD 1E38B 1SGFG 4DOQA 1K21H 1N6XA 1TLDA 3JZ1B 1ETTH 5F53A 2UUYA 3U28C 2PW8H 4KKDA 3LH1A 4I8GA 5DKMA 1MZAA 2BDYA 1YCPK 4DIHH 4IS5A 1SMFE 1XUKA 1G3BA 2PKAA 5L2ZH 1C5VA 3M7UA 2P59A 1KXBA 1AVWA 2VBCA 1HJAB 5EGMA 4R0IA 3BTTE 2FOHA 1HAVA 1C1VH 1XKBC 5A2MH 1EZUC 1C5YB 5FPSA 1PQ5A 2ZC9H 5FX5A 1SGTA 1QHRB 3U1IB 3D23A 1F0UA 3ODFA 2QXJA 4BAOB 5BRRE 1DUAA 4FUGA 2GVFA 2XRCA 3ZV9A 2BDHA 1O30A 1K22H 1YBWA 1C1OA 2DE8A 2BDGA 3A85A 1FAKH 4ZMAH 2SNWA 1ZMNA 3A7TA 2JH6D 3ZZBA 2OP9A 1ABJH 2OINA 4B76A 1SBWA 3S9BA 3VEQB 1GWAA 3LT3A 1H9IE 3UR9A 4NSYA 1L1GA 4DJZB 3AK5A 3A7ZA 4AFZA 2GMTB 1EAIA 3MH6A 1CVWH 4YXWD 4Q63A 1WQSA 3MH7A 1ZTJA 3LGUA 1VITH 2ZU2A 3K9XB 1O2PA 4GPGA 5EXMA 2PLXA 1OYTH 3DUXH 4AC9A 1A3EH 1ELEE 4AN7A 4GHTA 9ESTA 1C5OH 1P05A 1T8OA 4JZEH 1IQLA 1QBNA 3FZDA 4M7GA 2V3OH 2I6QA 3A7WA 1ESBA 1LHGH 1TOCB 1PYTD 3LKWA 4K1SA 1ZTLA 2BY6X 2FOCA 3BTEE 5E8EH 3A82A 3E90B 1P2JA 3OY6U 1C4V2 1EFRD 4RKJB 4KELA 1GHAF 2WYGA 1O2VA 1GHVH 1O2GH 4FU8A 2J92A 4KTSA 5AF9H 1GJCB 4CRBA 3GICB 2BLVA 2VH0A 2ZU5A 4O03A 1B7XB 1W0KD 1YCPM 2H1UA 1TNHA 2B5TB 4HZHA 2WPIS 3VXFH 2G5VA 2FO9A 3BN9A 1SL3A 2OXSA 3DSGA 1MTUA 1BB0B 2BY9X 3UNRA 1OWJA 5TJXA 5J4SA 4DIIH 3STIA 4ISLA 5G4BA 2O9QA 1T4VH 4ZKNU 1P2NA 1V3XA 1Z71A 2ASUB 2IOTA 1GMDF 3GCHC 5DK1A 3RMOH 1LQDB 1TNIA 3UB0A 1AI8H 1DE7H 4ABEA 1WDIA 1V2NT 2Y5GA 1P02A 3GYLB 1H8ED 4YLQH 2IPQX 4MVNA 5E0JA 3PMAB 4NIWA 2VGCB 4JZ1A 1G3DA 2Y7ZA 4X1SU 2VWLA 3PROA 1SGCA 2VIOA 2ZF0H 1HAVB 8KME2 2VU8E 2FTMA 1C2GA 1GI6A 1ELFA 1GBEA 1HBTH 4K3JA 3FP6E 4GCHF 4NWKA 5KGOA 5JB8S 2W7SA 5HIYA 1C5SA 5B6LA 2J9NA 2Y5HA 3RDZA 1DM4B 3V7TA 1TA2A 4CBNA 1AGJA 4WXVA 3TU7H 2M5TA 2BD5A 3ZYEA 1AFQC 4TPYA 3UQOA 3SUEA 3TITA 1L4DA 4ESTE 1QURH 1MTNB 2GD4B 3O8CA 3TJNA 2SNVA 1NESE 3T28A 3RU4T 1EXFA 3E6PH 1Y5UT 1EPTB 1L2EA 1EKBB 1GDQA 2H5CA 1THPB 4Z1MD 2W3KA 1V6DA 2J98B 1V2RT 4E7RG 3P95A 2W5EA 1SGPE 4X8SH 3A80A 3DSOA 4ACAA 3QK1A 4A1VA 1UO6A 2VWOA 4ZHAA 4XE4A 3MOCA 1BMAA 1GJ4H 1UHBB 2BY8X 3ZVBA 1ZGVA 3PRBA 4UDWH 2A5KA 1O2YA 3GDVA 1TYNA 3PV5A 1YLNA 3SU0A 2WUBA 1O38A 3KQDA 2KCYA 2GCHG 2J97A 1E0FD 1OPHB 4YESB 2VVVA 2FS8A 4MPXA 3N7OA 1O3GA 1AIXH 4DT4A 2SGPE 1A5GH 4INHA 1LVMA 1GI0A 1QA0A 1SFIA 3QGNB 3CNRA 1D3DB 5HM2A 3GY5A 1GI2A 3ZZAA 1AO5A 4XDEA 2F9BH 2VIDA 1O2WA 3ITIA 4ABDA 4Q7XA 4BTTB 3LGYA 5FBIA 5GDSH 2QXIA 2V7QD 5CDFE 1C5QA 2Q6DA 3N99A 1FDPA 2PTCE 5A8YA 4B1TA 8GCHG 4WXIA 4F48B 5IK2D 3BG4B 1O2ZA 1HAYB 1J14A 4X1QU 2G81E 4AX9H 5LPRA 1OWKA 1S85A 3VXEH 5DP4A 3L3TA 2QYIA 1BHXB 3LGWA 3A8BA 4CR9A 2UUKB 2ZI2H 1MTNC 2GZ7A 1OOKB 3SNEA 1NRQH 3FP8E 1BTPA 1XUJA 1GJ7B 3SU1A 1AUJA 1O35A 1O2XA 2ZGXH 5HGGA 1O5DH 3FN8A 4YM9A 4WMEA 4XOJA 2BD3A 1NRPH 1U6QA 2CV3A 2XNDD 1GDUA 2D8WA 4NWLA 1E37B 2J38A 2VWMA 2PV9B 1P2QA 3UY9A 2F43B 3FFGA 1LHDH 4X1PU 1C1WH 1EPTC 2ZCKP 1OKXA 2LPRA 3ZVAA 1SPJA 1RTKA 2XCFA 1NY22 1QBVH 2BXTH 1NFYA 1HYLA 3DSPA 5T6FA 1ABIH 2A2XH 2TPIZ 1C1PA 2XBXA 2FOGA 4BNRA 5CHAC 4BTIB 1CO7E 3WW7A 1XXFA 1TPSA 4LK4A 1NPMA 4BAQB 1C5ZB 1GHYH 3UWIA 4Y11E 5C1XA 3V0XA 4Z0KA 1CGJE 1WBGB 2BQ7B 3Q77A 4ABFA 2SGEE 1T32A 4J2YB 3BEIB 3BTWE 3PLPA 1Q3XA 4HG6A 2STAE 3T5FH 1RFNA 2QV1A 2C8WB 1GMCF 2G52A 4JZDH 2FOAA 3Q3KA 3GCTF 4TWYA 3A81A 2QF5A 1P57B 3K2UA 4I32A 1S82A 3ELAH 3MYWA 1P3EA 2A7CA 3E0NB 3S0NA 3PMJA 5C5OA 4X0WU 1O2NA 1AB9B 3SI3H 3NK8A 3M3SA 1W3CA 1W7GH 2ZGJA 4FU7A 9LPRA 2F9UA 2FMJA 1G9IE 2ZU3A 1Q31A 2K1QA 5F8XA 3OTPA 1W14U 3M7QA 2P94A 1A3BH 1H1BA 3NWUA 1BTHH 3P8OA 3TPIZ 4Q7YA 1L0ZA 2RDEA 4AFUA 2Y7XA 4ZKOU 2ZGBH 4XBCA 3P8GA 3GY6A 1TMTH 3SNAA 4WMFA 1T8LA 2AGIX 2F9PA 1LHCH 1GBLA 2G4TA 3UUZA 1N8OC 3A86A 1JWTA 2A4GA 2AHME 1WTGH 4UEHH 1TX7A 4OS4A 3KL6A 3TH2H 1P9SA 4CRAA 1ZYOA 4YT7H 1FONA 1KDQB 3WWBA 5JBAS 1CHOF 1SQRA 1BMMH 1DXWA 4B73A 1V2WT 3NXPA 2WSSD 3C1KA 4I31A 5GNDA 1C4Y2 1O3JA 1C2MA 1Z6JH 1ELVA 1TBRH 3AASA 3LH3A 4AB9A 1EP5A 1EOLA 1UHBA 1E35B 3N7EA 3RXEA 1HXFH 2GP9B 4X8TH 1SGNE 3MH4A 2TGAA 1UK4A 4CREA 1P04A 1ETSH 2K8IA 3MNCA 1UVPA 4IC6A 5T6DA 2HPQH 1Y8TA 4ABIA 1C5NH 4U30A 5HKKD 6CHAC 2I6SA 2QF3A 1IOEA 3MNXA 2B0FA 2GZ8A 6CHAB 2AGGX 1AU8A 1ZPBA 1YPEH 1GJAB 3SHCH 7GCHF 4OM9A 1JOUB 1TBQH 2ZHDA 3GY2A 1SLWB 1DICA 1SGDE 2A4RA 1D4PB 1IQGA 1SOZA 3PLBA 1AD8H 1GVKB 1JIMA 4AFQA 1ESTA 1S81A 1O2IA 3U8RH 1SR5C 4AZ2B 8LPRA 1DSTA 1G3EA 1LVYA 2FTLE 3VB7A 5CE1A 1OX1A 3BTDE 1QL9A 1O0DH 3A7XA 4Y6DA 1TX8A 1O37A 2FEQH 3LGVA 2ZHQH 5B6OA 3MO3A 2KR7A 1DLEA 1K1OA 2GT8A 4HFPB 2OC7A 3NKKA 2CK3D 3F2HA 3LIWA 2WPLS 1LVBA 2V35A 2PR3A 4BAHB 1V2OT 5EQQA 2CF9H 3ZVEA 7LPRA 1HIAA 2SGQE 1C5TA 1DWEH 3ZZ3A 3L6PA 3HGPA 1D6WA 1HJ9A 1UTJA 4H42U 2G4UA 3ZZCA 5E2PA 4GVUA 1ZTKA 4E05H 3LGTA 3KEEA 2ZTYA 2OUAA 1LPGB 2Z3DA 3M3TA 1ZMLA 1IQKA 1EAWA 1O3AA 4ZUHA 5PTPA 3M5NA 3MQKC 1TGSZ 3MU5A 2A7HA 5ESTE 2XW9A 5TCCA 3LC3A 1PPBH 1D3PB 4ZHMU 4P02A 1J9CH 3QTOH 1FIWA 2KZ4A 3DT0H 1Y59T 4X6PA 2HNTC 3H7OA 4K8YA 5JB9S 2Y82A 3GY7A 2IJD1 5KEDA 1P2OA 1HAPH 2RA0A 1C2EA 1QR3E 3U8TH 2C8YB 2BLOA 1IQNA 1J8AA 1F5RA 1FPCH 5C1UA 4Y79A 3V12A 1CE5A 3RXDA 2Z7FE 3LDXH 3MU0A 4MG3A 2BD8A 2TIOA 4LZ4B 3VGCB 2ODQA 1MZDA 2XNIA 3B8JA 4UFGH 4NA9H 1PPZA 6LPRA 3CENA 1INCA 1AVXA 1AZ8A 4F55A 1PQ8A 2A45B 2AYWA 2KCOA 1ELTA 1BZXE 3UQVA 2Y80A 4YO9A 1Z8GA 2UWOA 1P06A 3GY8A 3SNCA 1GBHA 1AHTH 1ELAA 5F8TA 2FI4E 1JBUH 2HGTH 4I86A 1ZRBA 3RXBA 5CMXH 3OE7D 2NU3E 1MBMA 2LELA 3TNSA 1PYTC 4X6OA 3EAJA 1MKWK 1BHXF 1NC6A 1SLUB 5DN6D 1P2IA 3STJA 4ZKRU 1ZSKA 1RD3B 2ULLA 2VJ1A 1S6FA 1CA0B 2TGDA 2CXVA 1OYQA 3NCLA 4MQAA 1ZOMA
chains in the Genus database with same CATH topology
5C67A 1NT1A 3G01A 3GCOA 1MTSA 3KF2A 1GCTC 2Y81A 4XBBA 2STBE 1OWEA 1NS3A 1CT4E 1GDNA 3PTBA 1LDTT 3F9GA 4AYVB 1OP8A 2PWXA 1J17T 1Y5BT 2QF0A 4UONA 1BBRE 4CRGA 1DDJA 3ZYDA 3RU4D 4ISHH 3KIDU 1A5HA 4NA7A 2BDBA 2V3HH 2BVXH 1DS2E 1O2MA 2FOBA 1BUIA 3I29A 3MU1A 5JBBS 1O3NA 2P3TB 3SJKA 2FP7B 1EB1H 4ABJA 4QT8C 1KXAA 2GDEH 2Z9GA 1FY8E 2FODA 1SSXA 5AHGH 5FXLA 3MNBA 1W11U 2PGBB 2VIWA 4Y8XA 5K7RA 1W13U 1FJSA 1DY9A 2BY7X 4XFQA 3TGIE 4BAMB 2UUJB 2GV6A 3UR6A 2HALA 4H6SB 4YZUA 1XVMA 1O32A 2P3UB 3A8DA 1IHSH 5AFZH 3SNBA 2C8ZB 2ZG0H 1S84A 1B0FA 4GLYA 5A0CA 4NCYA 2Z9KA 1UCYH 2AIQA 4MNYA 1OP0A 1HRTH 2GT7A 2WINI 3PLKA 5GCHF 1ELCA 3TH4H 2UWPA 3EA9A 2QXHA 1FNIA 2ANKH 2QAAA 1TE0A 4D7FA 1GHBF 5IDKA 1K1JA 1O2KA 2R0LA 1DY8A 3HATH 1HFDA 1O2OA 3E3TA 4XBDA 5EW2H 1DWCH 3TK6A 1GJ5H 1DWDH 3LOXA 2XTTB 2ZECA 2GDDA 4DG4A 1C1UH 1QL7A 4WVPE 7GCHG 4X2XA 4X8VH 3U8OH 5IYTA 3SZNA 1ORFA 3BEUA 2R0KA 3ATWA 1SGEE 5E0HA 2ZCHP 1TPOA 3ATKA 2BX3A 1UJ1A 2SGAA 3RMMH 2BVRH 1UTOA 1O3BA 2F9NA 1K1IA 2AS9A 3TVJB 2R2MB 3D49H 1WQVH 1K28D 1C1RA 2AFQB 3SJ9A 4INKA 4I8HA 3ZVGA 2FXRA 1Z1IA 4FUBA 1IQHA 1CHOG 3RLWH 1WTHD 2GCTB 1EJNA 1V2TT 2P16A 5H4IB 1YPMH 1Z8JB 3GDSA 5FX6A 3ZZ5A 1ANDA 2FOMB 5FPYA 1FY4A 1T4UH 3ESTA 1V2QT 1GJ9B 1CHGA 4U2WA 5CHAB 3TK5A 1C1NA 3TH3H 4F49A 1XUIA 4BXSA 5JPMH 5EW1H 3CS7A 5C1YA 2AH4X 2JKHA 1CBWB 3JZ2B 3LC5A 1O5EH 4A7IB 3RC4A 2ZTZA 2Y5FA 1QL8A 3NZIA 3IG6B 1EAXA 1OWIA 2EA3A 1GI5A 2BY5X 3P6ZB 1EATA 2OLGA 1ZJKA 1OP2A 3RXCA 1WAYB 1GI3A 4U32A 3AW1A 4GHQA 4B71A 4AB8A 4GUXA 2Z94A 2F83A 2YNBA 3FZZA 5T6GA 1Y3UA 3FAOA 2F9VA 3KHVA 1TMUH 1RGQA 2QIQA 2O8UA 3GY3A 4SGAE 1PPCE 4H4FA 5ABWA 2ANWA 1PFXC 1QB6A 2ILNA 5AFYH 1A61H 3GCTG 2ZGCA 3F9FA 1C9PA 1J15A 4YLUA 4Y71A 2CMYA 2ZKSA 2QGRA 2GMTC 3OU0A 4ISOA 1UK2A 2W26A 4J1YA 5GPIB 3TLOA 2BDAA 1YPHE 1GGDC 1NU9A 6GCHF 1IHTH 4WWYA 5BPEA 1WSSH 5DPAA 1GJBB 2ZFTA 3TIUA 1RS0A 4MTBA 4VGCC 4NZLA 1F0SA 4ZXYH 3T2NA 2R3YA 4LXBH 1P0SH 1DX5M 5HXFA 2ZDAH 1H8DH 3RMNH 1LO6A 1EAUA 1Y3XA 3RXUA 1TNGA 5SGAE 3QTVH 1BIOA 1MAYA 4IN2A 1BDAA 3SORA 4UD9H 2PUXB 1EZXC 1EPTA 1CQQA 1DVAH 2XC0A 2ZA5A 2QY0B 4Q80A 3RXSA 3BTFE 4FU9A 2BB4A 1BCUH 3PV4A 3SU2A 1F92A 4FUIA 1Z8RA 1KYNA 3GY4A 2HRVA 2PSYA 3VB4A 1MCVA 1AB9C 4B2AA 1P09A 1EOJA 1BRCE 3BIUH 3SW2B 3HPTB 3BSQA 4X2YA 3HKIB 1KSNA 2ZP0H 1TPAE 2RA3A 1YF4A 5ESBA 1EZQA 3L33A 2JH5D 4OS2A 3W95A 2HLCA 3EYDA 3QN7A 1L1JA 1VITF 3S9AA 1KTTB 2G00A 4WJG2 3ZZ9A 1THRH 7KMEH 3U98H 1S6HA 1FY5A 1HAXB 4CR5A 2Y6TA 1O2JA 1K2I1 1OSSA 1CU1A 2FS9A 2QA9E 1QQ4A 1LHEH 1P8VC 5DG6A 1IQEA 1RIWB 1GI8B 1O3PB 2KAIB 1P3CA 1TRYA 4BXWA 1P9UA 3AAUA 1W8BH 3KQBA 4BAKB 1CGHA 4OGYA 5JYIA 1C2JA 3A8AA 2XWBI 1JRTA 3CP7A 3SV9A 5A8ZA 1GBKA 3MU8A 3QO6A 1HJ8A 1HV7A 1MKWH 1QJ1B 1VZQH 1XM1A 6GCHG 2FESH 3RXOA 4JCNA 3SUFA 4DGJA 3UNSA 1KTSB 2Z9IA 3A7YA 1ZRKA 2BLWA 2QN5T 1Z7KA 3GCHB 2Z3EA 1MCTA 1YPKH 5DO4H 4JYUH 2WPKS 1ARCA 1UVTH 2ZFPH 2ZU4A 3A84A 1BMNH 5T3HA 1QB1A 4K69A 1H9LB 3SGQE 5E0GA 4X1RU 3SU4A 3M5MA 3UFAA 2UWLA 4UE7H 1TFXA 1FN6A 2H9HA 2Z9JA 1KXEA 2A32A 1O5CB 1VR1H 1QRWA 1BRUP 3A87A 1HAGE 1GBMA 3A8CA 2BVSH 2ZPQA 4ZH8A 2AMDA 4I7YH 1FZZA 4D9QA 2BMGB 2B9LA 5GIBA 2PKAB 5EQRA 1HCGA 2DUCA 2P93A 5L30H 2TGTA 5EODA 5DP8A 2XC4A 2NU0E 4I33A 3UTUH 2EEKA 2H6MA 2C90B 1TOMH 4X6NA 3V3MA 3SOSA 1O39A 1QTFA 3HKJB 1W0ZU 1H9HE 1G32B 3VPKA 1LVOA 1GBJA 1EZSC 2JH0D 1LPKB 1DLKB 4ABBA 4CHAB 1O3HA 1UTQA 1GBBA 2ODPA 4AYYB 1GMCG 3QWCH 2R3UA 2BZAA 2PKSC 4D7GA 3MO6A 2GX4A 1GCDA 1V2VT 1V2MT 2SFAA 1AE8H 3FANA 4Y7BA 1W12U 1ZLRA 3OSYA 1SGIB 3RXVA 4BANB 1BTXA 2B8OH 2SGFE 4E06H 1DSUA 3M36A 3SJIA 4MNWA 3TJVA 2XBYA 1Y3WA 1C2LA 3NUMA 3RXFA 1B5GH 1CGIE 1FN8A 2C3SA 1GGDB 3UREA 4HGCA 1C2IA 4OS7A 2VINA 2AEIH 1TAWA 3NPSA 1CA0C 1KLTA 3A7VA 3Q3XA 4KP0A 1BTWA 3O8DA 2CJIA 3Q76A 5C3NA 1E36B 1T31A 3H7TA 2ZQ1A 1VJ9U 5JBTA 1G37A 2ZO3H 1UVOA 1DOJA 1EJAA 1BBRK 1TRNA 3QGJA 1VITG 3RC6A 1GG6B 1ZSJA 4JK6A 2A5IA 3S7HB 3SQHE 1PPGE 2GKVE 2KAIA 1A0LA 1MTWA 3WY8A 1TQ7B 2ANYA 3EDXB 3OTJE 3S7KB 2OQ5A 1EQ9A 1RTFB 1HJAC 1YGCH 2XCNA 2HOBA 4KTUA 4I8LA 1OXGA 1GHAG 3P70B 1C4U2 4CH8B 3PO1B 3SO3A 1DFPA 3TGJE 1O2LA 1O3DA 2BDIA 2GCTC 3SHAH 1HAHH 1HGTH 1MUEB 1YPGH 3UPEA 1AUTC 3A89A 1TWXB 5DJ7A 3RMLH 5EPNA 1NN6A 3DHKH 2GTBA 1AFQB 1HLTH 1AN1E 4IGDA 1EUFA 3RXKA 1RIWC 3LU9B 1LKAA 1FUJA 1NRRH 2FPZA 2TRMA 3MNSA 1ELBA 2ALPA 2VH6A 1LHFH 4I8KA 3LJOA 1BTYA 1HIAB 4U01A 5GJ4B 2NU1E 1C2HA 1IQMA 1W10U 2A5AA 4INLA 1W7XH 4Y0ZE 2O8LA 3T29A 1FV9A 3MHWU 3LPRA 1MU6B 3AW0A 1LCYA 1UTNA 2BOKA 3BG8A 4AGKA 2FX4A 4THNH 3MU4A 2OBOA 1BTZA 3RXTA 5I46H 2AMQA 4Y7AA 2G5NA 2H9TH 2FYQA 1FAXA 2D2DA 4B74A 4JYTA 1BRAA 1TGNA 2NU4E 1GBCA 2P8OB 4ISIH 3BTGE 1A0JA 5J4QA 2FM2A 2V6NA 1BJVA 2OBQA 1TA6A 5DP6A 1NFUA 3RM0H 2P3FH 4ABAA 1RXPA 1V2KT 2ODYB 1ZR0A 2G55A 2A31A 1ZHMA 1HUTH 1ACBE 4MPUA 3T27A 3M5LA 4BTUB 4JMYA 3VB5A 2ZHWH 2J2UA 4TWWA 1JMOH 1SGYE 1H8IH 1D3TB 1V2ST 1K9OE 1WU1A 3OY5U 3P8FA 2TBSA 1RRKA 1XVOA 4B75A 5EOKA 1O3LA 1LPZB 4WH6A 3RP2A 2W7UA 3ATIA 3RXPA 1WOFA 2ZTXA 1QBOA 1C5RA 4NG9H 4AFSA 3KQCA 1DANH 2AIPA 1GMHF 5LH8A 2BQWB 3BTME 3PM3A 4VGCB 2XC5A 3GDUA 2CGAA 3QUMP 4KGAA 4Q2KA 4RSPA 1QJ6B 3IITA 5DP3A 2H9EH 1YPJH 2IN2A 3GYMA 3LONA 4NGAH 2NWNA 1GMDG 2Q1JA 4YOGA 2A7JA 1KDQA 4YTAA 1UCYE 2LNCA 5F03A 4F4OC 5I25A 3ATMA 2P95A 1KY9A 1UK3A 1C1SA 2PFEA 5A0AE 3PWCA 2OC8A 2VB0A 2Q6GA 1GHBG 1N8OB 1UTPA 4X1NU 3GOVB 2WV5A 6ESTA 4GSOA 1J16A 1C9TA 1PQAA 5GCHG 1N6YA 1E34B 5FBEA 4YOJA 1GHZA 4DT7B 3U1JB 1DUEA 1QJ7B 1O34A 2FI5E 1D6RA 3RLYH 1MTVA 1SI5H 2CHAC 1FXYA 4Y8YA 1GHWH 2A2QH 1AZZA 2ZFFH 4ZXXH 1FQ3A 1SQAA 2SGDE 4FUFA 4OGXA 1SHYA 1S83A 3RXQA 2J4IA 1Y5AT 1V2JT 2VVCA 1KLIH 2BQ6B 2PGQB 1VCWA 3KGPA 1ANEA 4MNXA 1GI4A 1GJDB 1C5PA 4YOIA 1MQ6A 3P17H 1NM6A 1G36A 1MU8B 1QB9A 3E0PB 2Z3CA 1K1NA 1T8NA 1NZQH 4Y0YE 4PROA 1GHXH 4K5ZA 1L1NA 4D8NA 3M37A 3ZZDA 1EJMA 3SJ8A 1GPZA 1MH0A 2YOLA 3RXJA 3FP7E 3TGKE 1K1PA 3RU4E 3RXGA 1O3IA 1PQ7A 2ZPRA 2FI3E 1Z8IB 3OX7U 1K1MA 1YKTA 1F5KU 3ODDA 4D9RA 2ZGHA 1CT0E 1AFEH 1FI8A 3W94A 1A0HB 2OCVB 1LMWB 1UVUH 3DFLA 3M5OA 4AG2A 1QGFA 1W0YH 5DP5A 2EI7A 2H5DA 1IQIA 1L4ZA 2FZZA 1C5LH 3SV7A 1BT7A 3EA8A 4FUJA 1O5GH 1XX9A 5FHTA 4NIXA 4A92A 3SV6A 1D3QB 1QCPA 4DCDA 2J95A 3RXHA 1TNLA 1HDTH 2Q6FA 3E8LA 4Y76A 4O3TA 1Z1JA 1Y3YA 1YM0A 1DITH 1ZJDA 2XBVA 3UOUA 2ZDKA 3GCNA 1GG6C 2XWAA 3M61U 1JRSA 2BD4A 4B2BA 1YYY1 4NFEA 1C1TA 2WYJA 3MH5A 2GZ9A 4DY7B 2VWNA 5L6NH 4AGJA 3C27B 1XUFA 3I77A 1O31A 5AVDA 1ANBA 1F2SE 1YLDA 1OWHA 1S0RA 1GBIA 2WPMS 4K60A 3SI4H 1BA8B 3K6YA 2V0BA 2ZCLP 5EPYA 1TGBA 2O8WA 3SNDA 1AWHB 1NRSH 1RTLA 1B0EA 2NU2E 1AVGH 2QCYA 2WPHS 2QC2A 1EB2A 1GCTB 3SU6A 2ZQ2A 3ZVFA 1SGRE 3A88A 4JZFH 4HI3A 5A8XA 2BLQA 4RN6A 2JETB 1KXDA 4IMQA 3SBKA 1FLEE 3R3GB 4OS6A 1K1LA 5JBCS 5K0HA 1M9UA 1HB0B 5EU8A 1O3OA 1SFQB 1MBQA 3MO9A 3F1SB 2XYAA 2RDLA 1ZZZA 3ZZ4A 5HYOA 2XBWA 1F0RA 1O2TA 3RXAA 3DA9B 4E7NA 3MWIU 3QLPH 1T8MA 5EXLA 1Y3VA 3BIVH 1BITA 4IC5A 4OS1A 4ABHA 1Q2WA 1GI1A 2FX6A 4MPVA 4D76A 1O3FA 2R2WU 1VCQA 4LZ1H 3CS0A 5F6MA 1BOQA 1D9IA 2J94A 2BD9A 4ASHA 2FIRH 1THSH 2BD2A 1JXPA 3M3VA 2FWWA 4MPWA 3RXLA 1ZMJA 3QZRA 3ZZ8A 2AERH 2O8MA 1EASA 1TALA 1TNKA 1NFWA 1S0QA 1XXDA 4ZAEA 4H6TA 3UIRA 3RXIA 3E16B 1MAXA 4IN1A 2AGEX 1PPFE 1SVPA 1TPPA 5EG4A 1AKSB 4ZKSU 3KN2A 2ZIQH 7ESTE 1FPHH 1TNJA 1QY6A 5LPFA 1MKXK 3AAVA 1RJXB 2IPHA 3HGNA 3OYPA 1JIRA 1FMGA 3VFEA 4CRDA 4JK5A 1SLVB 4NZQA 3MFJA 1TX6A 1OWDA 1LKBA 3U69H 3F6UH 4TY6A 2EI8A 1HNEE 4OS5A 1TABE 3ZZ7A 2WV4A 3B9FH 1C2FA 1C5UA 1BMLA 1DWBH 2D1JA 4MNVA 1FIZA 2FOFA 3KNXA 2BDCA 4K1EA 1UTMA 1BTUA 1G3CA 4SGBE 1IAUA 4O3UA 3DFJA 3BTQE 2VVUA 3R0FA 3QZQA 1O5AB 3LGIA 1V2LT 2RG3A 3MTYA 3AVZA 3T25A 3S69A 3MI4A 3PO1C 1UTLM 2XXLA 1O2UA 3T26A 4IBLH 1SC8U 3K65B 3BEFB 1GVZA 2QXGA 1QRZA 2GCHF 2CHAB 3ZV8A 4NIYA 3BV9B 1AE5A 1O2SA 4JYVH 1WUNH 1ZHRA 1KIGH 3QX5H 2ZHEH 3SQEE 1ETRH 2F9OA 4WF8A 1C2DA 4MDSA 2PUQH 2Z6BD 1F0TA 2BZ6H 2RCEA 3PMHB 2OD3B 5TCAA 2VNTA 4FUDA 1KXFA 1ZHPA 4Y8ZA 4TYDA 2JETC 4TPIZ 1UVSH 2D26C 3TJOA 3U9AH 1Z6E