4MQAA

Human beta-tryptase co-crystal structure with {(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bis[5-(methylsulfanyl)benzene-3,1-diyl]}bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Tryptase alpha/beta-1
total genus 54
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA01
2XBXA 2UUJB 2HALA 3KEEA 4JZFH 2O8MA 1NRSH 1LCYA 1BRBE 2H9TH 1IOEA 1GJCB 1W7XH 5ESBA 5C1XA 1IHSH 2Q6DA 3PROA 3GDVA 1K22H 1TGTA 2ZA5A 1FPHH 1P2IA 3HGPA 2PTCE 2V35A 2BQ7B 2ZIQH 2GCHG 4Z6AH 1SBWA 2BX4A 1ZTJA 2KAIA 3NWUA 1EAXA 5GIBA 5TCCA 1EASA 2XBVA 4ABAA 2PTNA 5FCRA 3UREA 3TGJE 2IPHA 3T28A 3LGYA 4LK4A 1ZSKA 4X2VA 3RXOA 2G5VA 1UK2A 1TWXB 4GUXA 3ATMA 2GX4A 1LHDH 1GHZA 1O2TA 1NC6A 1GI3A 2Q1JA 2BY9X 4YOGA 1KTSB 1H8IH 2A45B 2O8UA 1ZSJA 5ETXA 3BEIB 1BBRH 4MTBA 3S0NA 5FX6A 5A8YA 2ZI2H 3UWIA 3BIUH 1OKXA 4NA9H 1AO5A 4JZDH 3RLYH 2GCTC 2QA9E 1C9TA 4D7FA 1U6QA 1AI8H 1O34A 1S84A 1HAOH 5GJ4B 4Y8YA 3AAUA 2FPZA 3CS0A 4A5TS 1C4Y2 1W2KH 3H5CB 1QBOA 2QGRA 3MWIU 1Z8GA 2WINI 3HGNA 1JXPA 1VITH 1YPMH 2STAE 4DT7B 1A5IA 4JK6A 1MQ5A 1P01A 2TGAA 1D3TB 3EAJA 4X6PA 4BOHA 1Y3YA 1AUJA 3U1IB 3V7TA 2JETB 3FZZA 2UWLA 1V2VT 1C5SA 1GVZA 3F6UH 3MO3A 2AERH 3DFJA 1G3CA 2OP9A 3BSQA 4J2YB 2NU1E 3RXKA 3AW0A 2ZU2A 1W0ZU 1XXDA 1GBFA 1CGJE 1ACBE 8GCHF 3ZZBA 2O8WA 2CN0H 3MO6A 5TCAA 1MU6B 2VVCA 4MNXA 1YKTA 5K7RA 3FP6E 1AFQC 3OY6U 4FUJA 3BIVH 1GJ5H 1LQDB 3SI3H 1S0RA 3HKJB 3M3VA 1C5WB 1W14U 1TQ0B 1V2JT 5F6MA 3ZZ6A 1O30A 1UTOA 2HPPH 1CHOG 3S9BA 1HFDA 1SLWB 3F1SB 4OS2A 1GBLA 2H6MA 2BDYA 3UPEA 2OQUA 2VIPA 3U9AH 4GAWA 4OGXA 1TBQH 1QB9A 5PTPA 5ESTE 3QO6A 1HIAA 2ANWA 1O3MA 5DJ7A 4B76A 1EX3A 1TNLA 1GI2A 3KQBA 4UFGH 4CBNA 2BD3A 3FAOA 3A83A 6ESTA 1O2KA 1C1TA 1RTKA 1UVUH 4RKJB 3M7UA 2BD4A 1ZPBA 1G3BA 2ZECA 3LGUA 1G3EA 5FPTA 1K9OE 2ZTZA 2P94A 5AF9H 2Z3CA 1ZMNA 2F9PA 3A7XA 3KIDU 1WTGH 1E38B 1QJ7B 3M5NA 1O3PB 1NRRH 3MU8A 1THSH 3TH4H 4CH2B 2D2DA 1PPEE 3UOUA 3MYWA 3NUMA 1UO6A 2CGAA 5DO4H 1WYKA 3SUFA 1EPTA 1SGCA 1BITA 1IAUA 4CBOA 3NK8A 1GBMA 1SOTA 1XUFA 1O5AB 2A32A 1FY3A 1TFXA 2A5KA 3PV4A 4JZEH 1LHFH 1TNJA 3LGVA 1QCPA 2RA0A 4Y10E 1O31A 2FS9A 3BTEE 1KYNA 1UTJA 2P3FH 2BOKA 1TMBH 2ZCHP 5JPMH 1C1UH 2Y5HA 2OC8A 3GCHB 2BY5X 1SB1H 8KME2 2FX4A 1XVOA 2UWOA 5HM9A 1GGDB 2VIWA 1GBIA 1BBRK 1QRXA 3TK5A 7ESTE 1TBRH 4UE7H 1ESTA 4U01A 2O8TA 1NROH 4DW2U 1JBUH 4FU9A 2C93B 3P95A 3RU4D 3ZVGA 4WF8A 1BHXB 3D65E 2ESTE 1V2LT 2ZPSA 2G4UA 2FOMB 4TPYA 1GWAA 1G37A 3A8AA 1T8OA 3AW1A 1WU1A 2VIQA 4D7GA 3QZQA 4DVAU 1UVSH 2BZ6H 3PB1E 3F9HA 4XOJA 5EQQA 1DS2E 4GHQA 2R9PA 1WUNH 3B9FH 1H1BA 2A7HA 1ETRH 1O2LA 2BDBA 5L30H 3D49H 3PMHB 3RXJA 3FVFB 4IS5A 3SU0A 1GDQA 1XXFA 2B8OH 1Y3UA 3BV9B 1Y5BT 4Q7ZA 4X8TH 1INCA 3V12A 2GT8A 1Z8RA 3A88A 5HM2A 1ZR0A 2Y7XA 4NWKA 2G8TA 2W26A 2HWLB 1A5GH 1E0FD 4AYYB 4Y8XA 1LHGH 2ZP0H 4YLUA 1C5ZB 1E36B 3UNSA 3A8DA 2TGTA 1ZHPA 1QRZA 1ORFA 5DK1A 4J1YA 3BEFB 1PPZA 1FAKH 1P10A 4Y11E 4WXIA 3VPKA 1ZHRA 4Y76A 1BTPA 1LKBA 2W3KA 2F9VA 5E0GA 5JBAS 1OS8A 5F8ZA 2ZC9H 3C27B 4BAKB 1AN1E 3JZ1B 4FUEA 4AFZA 4OS7A 1GHBF 2FO9A 4YT7H 3RMMH 3BTGE 2YNBA 2JH5D 1A5HA 5G4BA 1E34B 2QXHA 1Z7KA 3NZIA 3DD2H 1CSOE 1FUJA 2TGPZ 3MH5A 2ANKH 5E8EH 1UJ1A 2Z9LA 3UIRA 5EW1H 2A4QA 3A81A 2ZU1A 3SNCA 5CE1A 3D62A 2Z9KA 2A4GA 2BVXH 1C5UA 2FODA 2PW8H 2C8WB 1UCYE 5AHGH 1OWJA 1SR5C 2ALVA 5C2ZA 1QL8A 4WXVA 4FUIA 1YCPM 1RTLA 2ALPA 2Y5FA 1SGFA 1Q31A 1UTMA 1P2QA 3FANA 4KTSA 1BBRE 3PLPA 2GGVB 1TPPA 2P3TB 3M3TA 4NA7A 1ZYOA 3PYHA 1FQ3A 2B0FA 3ITIA 1LTOA 1V2MT 4GPGA 1P09A 1BRCE 1FNIA 1TX7A 1S6FA 2XYAA 1ZGVA 1BOQA 2AMDA 8ESTE 3U1JB 1QB1A 4YZUA 4AG2A 2R3UA 3G01A 2XBYA 4RN6A 1UTKA 1GHYH 2GD4B 1HGTH 1SGQE 4AFUA 1O3DA 4F4OC 3MU0A 5FCKA 2FOCA 1W12U 1NZQH 3O8CA 3T25A 1BIOA 2VWOA 1UCYK 2YOLA 2VJ1A 1GDUA 2UUKB 3RMOH 3UOPA 1C1NA 1S81A 1MAXA 4JZ1A 3F9EA 5DP5A 1OOKB 5GDSH 1O2RA 4AOQA 4WMFA 3RC6A 1H9LB 1H8DH 3ATWA 1GI1A 4F49A 1Y5AT 1TRMA 2HPQH 1GL1A 7LPRA 3KN2A 3QN7A 1MBQA 1JIMA 2V6NA 1GCTC 2C4FH 5IYTA 1HAHH 2BD8A 1CGIE 1ELCA 1C1WH 2PUQH 3E16B 1AY6H 3KQDA 1ZZZA 1V6DA 1ZMLA 2GMTB 2PV9B 3GY2A 3MO9A 4IW4E 3TVJB 4AORA 1TLDA 2W7UA 1GHAF 2WPJS 1ZLRA 3BN9A 1BB0B 1C2KA 4WY3A 1BRAA 1UTPA 6LPRA 2F83A 1UK3A 1BTUA 4NSVA 4YM9A 2ZFTA 1DT2A 3SO3A 5DP7A 1KTTB 1PYTD 1YPGH 2VNTA 4Y7AA 3UNRA 1OWDA 4JYTA 7KMEH 2CJIA 3RUOA 2A2XH 1B0EA 2G55A 3GY7A 2PKAA 1O3EA 1NFUA 1K1MA 1CT4E 3SZNA 3VGCC 2ZHFH 1TOCB 2OD3B 4X1SU 5J4SA 1AFEH 4JMYA 2V3HH 1G2MA 3STJA 1GBJA 1GBEA 3ZZCA 3K6ZA 1CO7E 1O3NA 2XC0A 4X1PU 5GCHG 1HJ9A 1K1PA 3LJOA 3GCTF 1YPLH 4D9QA 1PPBH 1O2YA 3LKWA 5DPAA 4M7GA 1FY8E 2DUCA 3BG4B 2PLXA 1Z6EA 3TH2H 2ZO3H 3SJOA 3RXCA 5I46H 4I8HA 1AD8H 1L0ZA 3P8GA 2FM2A 3PWBA 4D8NA 3K65B 4ZXXH 3EE0B 3RXPA 1P02A 1DWEH 2R2MB 5JYIA 3BTME 1N1LA 1P2JA 3RM2H 5EOKA 3GCHC 5LPEA 1D3DB 2QC2A 4FUFA 1N6XA 3VB5A 5T6GA 1AVXA 2FTLE 1TA6A 4X1NU 1SGTA 1SVPA 5EU8A 3VB3A 1PPCE 2BQ6B 4FU8A 4MVNA 4ESTE 1GG6B 2SGPE 3M5OA 2IN2A 2CHAC 4Y0ZE 1TONA 1O3LA 1LVBA 5GXPA 3RXFA 4KTUA 2TGDA 3ZZ5A 2AIQA 1BHXF 4K1SA 5GPIB 1OX1A 1YYY1 2AGIX 2V3OH 4ZAEA 3A87A 3RXUA 3E6PH 2Q6FA 3SQHE 1F5RA 2OLGA 2VU8E 1QQ4A 2W5EA 4VGCB 1FLEE 4ABBA 1V2OT 4FUCA 4Y8ZA 3GISB 2HRVA 3M5LA 1F0SA 3IITA 2A31A 1GJBB 1GMDF 1MTNC 3GCOA 4MG3A 2VGCB 2XRCA 3QZRA 2GTBA 2ZNKH 3SI4H 4B2CA 2Q6GA 3RC4A 3ZVAA 4AGKA 4Q2KA 1O38A 3LGIA 3URCA 4AX9H 1HNEE 1C5QA 5DP9A 7GCHF 1O5BB 4BAQB 5EXMA 3V0XA 3RXTA 4LOYH 1DLEA 2Z94A 1LHCH 1TX6A 1A0HB 2BDHA 3ZZDA 2ODPA 4CR5A 4JZIA 2BLWA 1QBNA 1AWHB 1GI0A 2SGAA 3K2UA 3U8TH 3UR9A 1EJAA 1UHBA 4ZMAH 2SNWA 4FVBA 2TIOA 2FOBA 3SU5A 2BDAA 1K1OA 3LGWA 1GHXH 1ID5H 5F8XA 3IWMA 1TNGA 2OC7A 5LH8A 3SNDA 5LGOA 2RA3A 3LIWA 1KIGH 1ZRKA 2A7JA 2WV5A 3RDZA 4FVDA 2FOAA 1O5GH 4MPUA 2TRMA 4O3UA 2ZPRA 1C1RA 4E05H 1A4WH 5T6DA 1SGEE 4B75A 2VH6A 5EW2H 4E06H 4DOQA 1QBVH 3KL6A 1D6WA 1C1MA 1RRKA 1M9UA 1O2UA 3ZVFA 1C2HA 4KP0A 4X1RU 4NGAH 5GCHF 1V2KT 2WPMS 1VR1H 4WVPE 1FI8A 3T5FH 1DITH 1VCQA 4ZHAA 4TYDA 1IQEA 1DVAH 1EQ9A 1YBWA 1H9IE 2VIOA 1AHTH 1DICA 1NRNH 2BVSH 3F68H 2QF3A 3TNTA 4NCYA 3QTOH 1LKAA 1C5OH 5L2ZH 3UUZA 4KKDA 1LVOA 4MNWA 2F91A 3QLPH 1AIXH 1YCPH 3PTBA 3SORA 5E0JA 2GCTB 1O5CB 2FOHA 2JKHA 4CHAC 1UTNA 4GHTA 1VITG 5LPFA 1O2HA 2EI8A 1SLUB 2P59A 3K6YA 1P0SH 3SU2A 4X6OA 1VCWA 2ZCKP 2UWPA 2ZHWH 1GI5A 1KY9A 3BTDE 1PQ7A 4X2WA 1MKXK 1O3IA 2OUAA 1O2JA 3HKIB 1V2PT 1XUKA 5C20A 2ZFFH 3P92A 3DT0H 1Y59T 3RXAA 3TGIE 4ISLA 1HAPH 1N8OC 1XUHA 2BDIA 3LU9B 4I8GA 1L2EA 1EXFA 3DUXH 1O2OA 1ZTLA 1TALA 5EPYA 4XFQA 5C5OA 3RXGA 4CRFA 1ZTKA 1W7GH 1HLTH 4X2XA 3UTUH 1ELEE 3RXBA 3RXEA 1EZXC 2FZZA 1SGFG 4Y71A 1XKBC 1DSTA 1FY5A 4NIWA 1O37A 5DP6A 4I8LA 5DP3A 1YC0A 4A92A 1VJ9U 4ABHA 2BD7A 1GI7B 1DOJA 2H9EH 3EA9A 1SQAA 4JK5A 2OQ5A 1V2UT 3PLKA 1V2NT 4Z0KA 3SNAA 4KTCA 1P06A 1GGDC 4X8UH 4K1TA 3I77A 1GBAA 3O8RA 4B71A 1TIOA 1GHWH 5I25A 3UR6A 4I7YH 4MNYA 5FBEA 2SGQE 3GY3A 4HTCH 5DKMA 1W10U 3ZV9A 3SV7A 4A1TA 2XCNA 1DWCH 2VIDA 1LDTT 5F8TA 1S83A 4GCHF 1SGPE 1NFYA 3VGCB 2YNAA 1AFQB 1TQ7B 3A8BA 4WMEA 5E0HA 1KLJH 3SOSA 1BJUA 2BLVA 1HJAB 1C1OA 4NIXA 1TGNA 1AB9B 4GVUA 1O3FA 1A0JA 2C8XB 3T62A 3U98H 4JYVH 4UFFH 2HGTH 1RD3B 4H42U 2FWWA 3A84A 2R0LA 3MU4A 1O32A 1GJ9B 2BY8X 2A1DB 1AQ7A 2GZ8A 3O8DA 1W8BH 2ZFPH 1S82A 3M5MA 2VWMA 2ZPQA 4BTUB 1K1NA 4B2AA 1IQNA 2WV4A 4A6LA 1FIWA 2HNTF 2VIVA 4AZ2B 3T29A 2IOTA 1T4UH 3GICB 4O3TA 4SGAE 3BTWE 3QWCH 1MAYA 4ZKNU 3RXSA 3VXFH 1WOFA 2GDEH 4BAMB 1EJNA 1S6HA 1NU7B 1TOMH 3TU7H 2BXTH 4HGCA 1TGCA 2PWXA 3OY5U 2I6SA 4CRAA 3Q3YA 1T31A 3TITA 1O2ZA 1TPOA 3A82A 3K9XB 1SFIA 1VITF 2FIRH 1HXEH 1IQFA 3I78A 1EJMA 1RS0A 1HUTH 1GL0E 3RM0H 2QIQA 1PJPA 4DGJA 4Y7BA 1CT2E 3RXQA 2FEQH 2A5AA 3LC3A 1QTFA 2BLQA 1GMCF 1AKSA 1ELDE 1O2NA 2AS9A 4UFDH 1ELBA 2PGBB 3DHKH 1GI6A 2ZGJA 4K2YA 4UFEH 1P57B 1ESBA 2BLOA 1DE7H 3NPSA 1BTYA 1O2SA 1C2IA 2XCFA 3L3TA 3MH6A 5L2YH 3R3GB 1IQHA 2C8ZB 1KXAA 3FP8E 3ZVEA 1N8OB 2Y81A 2DE8A 3NKKA 1AE5A 1O36A 2BY7X 4AGJA 3RU4T 1P11E 2XNIA 3MU5A 3QGNB 3MNCA 1EATA 3U69H 2G4TA 1GJ4H 1PYTC 3PMBB 1GG6C 1B7XB 1IQJA 2Z9JA 1CBWB 2G00A 1JOUB 3RXVA 4LZ4B 1ZOMA 2PSYA 1G2LA 1J9CH 1GI8B 1OXGA 1TRYA 2F3CE 2VH0A 1GJ7B 3SU6A 3A8CA 3Q77A 2ULLA 1BMNH 3U8RH 1Y5UT 2A0QB 1GBBA 6CHAB 4O9VA 4U32A 1XUIA 4A1XA 2O8LA 1K1IA 1TGSZ 4GLYA 3V13A 1BQYA 1XVMA 1WQSA 3BTHE 4YO9A 1SHHB 3SQEE 4E7RG 1H9HE 5EODA 3VB6A 2NU2E 5BPEA 1B5GH 1DDJA 3BG4C 1EP5A 2AYWA 3A7ZA 3T26A 1GJDB 2AH4X 3GOVB 1LQEA 1BJVA 1HAGE 1DXPA 4ISHH 4BAOB 1EAWA 1A0LA 1ELTA 1GJ6A 2VINA 1EP6A 3SV2H 3FP7E 4TPIZ 1AMHA 2Y80A 4LZ1H 3PM3A 3F9GA 1Y3VA 3M7TA 1MKXH 2QXJA 5HXFA 1NFWA 2J94A 3MU1A 2Z3EA 3OTJE 4NZLA 2ZHQH 1J15A 2CHAB 4XE4A 2A4RA 1GBCA 1QFKH 4BANB 1A7SA 5EPNA 4NSYA 1NPMA 1BTHH 2A2QH 1ARBA 2BQWB 5JBBS 2SGEE 5JB9S 3E0NB 3KNXA 4ZKOU 1OWIA 1P2MA 3EGKH 3A7TA 3A7YA 4HFPB 4ABIA 4AB9A 2ZWLH 1UK4A 3MI4A 1C5XB 4I33A 3RMLH 5FPYA 3Q3XA 2H1UA 1HV7A 1QNJA 4YESB 2F9NA 1BMMH 1GBDA 2RCEA 1QHRB 1T8NA 3RXDA 1MMJN 4B73A 2VB0A 1RJXB 5EQRA 3B23B 1Y3WA 3CS7A 3SJKA 4DJZB 4K1EA 3HK6B 1O39A 3SHCH 1VGCC 1Z8JB 1C4U2 1O3BA 1FY4A 1HIAB 3EQ0H 6CHAC 1TMUH 1J14A 1P8VC 4BXWA 2GVFA 3LONA 1QJ6B 1GVLA 3AAVA 1O5FH 1GMDG 2R3YA 5HGGA 2CXVA 5DGJA 1ELGA 1GBHA 2VGCC 1SMFE 1GVKB 1K28D 2CMYA 1ABIH 2FLRH 2AGEX 2FI5E 4H4FA 4R8TB 2OC1A 1Z1JA 3P8OA 5F03A 2FYRA 2STBE 1QR3E 1EOLA 4KGAA 4MLFB 1ANBA 3GY6A 2QXIA 4NFEA 1AUTC 2Z3DA 3MHWU 2ZCLP 2BX3A 4TY7A 1AVGH 1V2RT 2D1JA 2A5IA 2FX6A 3OYPA 1BTZA 2ZFQH 3H7OA 1P03A 5JDUB 4BAHB 2HNTE 5AFZH 5E2PA 2ZQ1A 1EPTC 3TIUA 2XTTB 1F0TA 1OYQA 4K8BA 1ZSLA 1KXBA 3SU3A 3ZVBA 1GCTB 3AVZA 3MOCA 3T2NA 1O2WA 2GZ7A 1C2JA 5FBIA 1CA0C 1RIWC 2ZF0H 4GCHG 2OTVA 3RU4E 2ZDAH 1T8LA 5SGAE 3TPIZ 1CVWH 1WSSH 4I8KA 5A0AE 3SJ8A 2WYJA 3OU0A 4U2WA 3KHVA 1ZMJA 1O3HA 3GCTG 1G9IE 1TAWA 3MH4A 3KF2A 1ZRBA 1F5LA 7GCHG 1OSSA 3ELAH 3LGTA 4CRDA 2O9QA 2WUBA 2HVXA 5EXLA 2ZHDA 3HK3B 1O2MA 1Z8IB 4JCNA 2C8YB 4NA8A 2V0BA 4IGDA 4OS1A 1T7CA 1KXEA 3CP7A 4TY6A 3SGQE 3SJIA 3UQOA 2GT7A 1EZUC 3TJUA 1ELVA 4FUBA 3AASA 2PGQB 2G52A 1DWDH 1HAVA 1KLIH 5A2MH 2HLCA 3KQEA 9ESTA 1WQVH 2HOBA 3ATLA 3LDXH 2WPKS 2ZGCA 3GYLB 4YTAA 1C2EA 4FUDA 1DANH 1JMOH 1GMHF 4MPVA 3RXRA 3TH3H 2QAAA 1A61H 3LC5A 1UVOA 3RXIA 1TPSA 4XSKU 4MPXA 2H2ZA 2PKSB 5H4IB 1F5KU 1C1PA 1PPFE 3S7HB 1IQKA 2ZGBH 6GCHG 1QGFA 1SLVB 1O3CA 1C5PA 3TJNA 3NCLA 2JETC 1C5TA 2FTMA 2Y82A 1O33A 2ZU3A 3E0PB 4X6MA 2NU0E 2WPLS 1TB6H 2B5TB 1FXYA 2ODQA 1ZHMA 3MFJA 3N7OA 1GBKA 1FN6A 1SGIB 2OINA 3OSYA 2KAIB 2PFEA 4R0IA 2FXRA 2ZEBA 1P2OA 1IHTH 1MD7A 3SNBA 2OXSA 2PR3A 1YGCH 1EAUA 5TJXA 1UTQA 1L1GA 1SI5H 2WPHS 1LPGB 1CHOF 1LO6A 2H5CA 1A46H 1FV9A 2FYQA 2RG3A 1Z71A 3SUDA 3M35A 3MH7A 5JB8S 1C5MD 4AFSA 1KDQA 1PQ5A 1XX9A 1SGRE 1AGJA 1MTSA 1JRSA 3A7WA 1H4WA 2CF8H 3BTQE 1VZQH 3TJOA 4ASHA 1WV7H 3KQCA 1FMGA 3MNBA 1Z6JH 2J92A 2XW9A 4K5ZA 2Y6TA 3SGAE 1MBMA 2JH6D 1C2GA 3MMGA 5EGMA 3HPTB 1C2LA 4BNRA 1V3XA 1TX8A 5FAHA 1C5RA 2ASUB 2PHBA 1TBZH 3E8LA 2ZDLA 4OS5A 1DPOA 2VWLA 3PO1B 1P04A 1ANCA 1ARCA 5CMXH 4Y6DA 4JYUH 1GI9B 1C2MA 4I31A 3KGPA 1P3EA 1GPZA 3ZZ8A 2OBOA 5AVDA 2FMJA 3ATIA 2TPIZ 3I29A 4B74A 1GI4A 3ZZAA 2ZKSA 3BG8A 4XBCA 5T3HA 1F92A 3TNSA 2FP7B 1NRPH 1YLCA 4THNH 1G36A 3QTVH 1P2NA 4XBBA 1AE8H 2AIPA 3S9AA 3A7VA 3GY8A 1A1RA 2AMPA 5FHTA 1HDTH 3IG6B 4E7NA 3RP2A 3E3TA 4TWWA 1ANDA 2ZG0H 1AZZA 1MU8B 2EC9H 2EEKA 3EA7A 2EA3A 3PLBA 4LXBH 4A1VA 2BB4A 3L33A 2ZU4A 3C1KA 1DSUA 2BD2A 1HAVB 5A8XA 1C2DA 3E1XB 3GCNA 5HMAA 1DM4B 1QRWA 1UHBB 1J17T 4ZKSU 2ZDKA 3TK9A 3LH3A 1OP8A 4B2BA 1CQQA 4ISNA 4DY7B 5K0HA 1FZZA 2FDAA 1YPKH 2P8OC 1FPCH 4IMZA 3UWJH 1EUFA 3T27A 1MTVA 4X6NA 2GZ9A 3UNQA 2XC5A 5A09A 3SUGA 3VXEH 2FESH 2ZGHA 2BZAA 4YOJA 1CU1A 4INKA 4HI3A 1WAYB 4ZHLU 4BTIB 1T32A 1WCZA 2QCYA 2XWBI 1UVTH 2ZTXA 1TMTH 2VWNA 1MQ6A 2P93A 2UUYA 1F0RA 1DUAA 2C3SA 4ABDA 1KLTA 2PKAB 4IC6A 1NY22 3A89A 3M7QA 4UONA 2J9NA 2FI3E 3M37A 4BTTB 1CBWC 1QB6A 4CR9A 1L1JA 1MD8A 3GDUA 1DFPA 2BY6X 5LPRA 4MDSA 2GKVE 1D3QB 1RFNA 1YLDA 4OS4A 4X1QU 3P17H 3Q76A 2AMQA 4INHA 1W13U 3EA8A 4K3JA 1YPJH 3ZVDA 2C90B 1HAXB 2BYAX 2DE9A 2LPRA 1HB0B 1O2IA 1QY6A 1HBTH 1P9UA 3FFGA 3RLWH 3V3MA 4H6SB 3F9FA 1JIRA 1KDQB 2ZFRH 1XUJA 4CRBA 4IN2A 5AFYH 4Q7YA 5C1UA 5T6FA 5C67A 1Y8TA 1EB1H 4OGYA 4H6TA 1VJAU 1D3PB 1DWBH 1HCGA 1F2SE 2BM2A 1D6RA 1TE0A 1KSNA 2QXGA 2FI4E 1SL3A 1K1JA 1F7ZA 1S5SA 3M61U 1TNIA 3EYDA 1FIZA 1YP9A 1UVPA 2BXUH 2Y5GA 2ZHEH 4AN7A 4ZUHA 1HAYB 4INLA 2GP9B 4MNVA 1MKWK 3L6PA 4O03A 1LVMA 2AFQB 1L4ZA 1OWEA 2EI7A 4CHAB 4O97A 3SHAH 1S0QA 3A80A 4NZQA 4IN1A 2GDDA 5C5NA 1QA7A 1C5YB 1BRUP 1O2PA 1SHYA 1BZXE 2ZGXH 1DUEA 3UY9A 2Y7ZA 1BA8B 3P8FA 1UMAH 2Z9IA 1C9PA 4ZXYH 1T8MA 2CF9H 2NU4E 2XC4A 1NO9H 4WMDA 1NT1A 2J38A 3QDZB 1K1LA 3M3SA 1TGBA 4ABFA 9LPRA 1NRQH 1GMHG 1SG8B 4GSOA 1W3CA 1HYLA 1SFQB 1NU9A 4DCDA 1S85A 1YPEH 2NWNA 4IMQA 4YOIA 3ZV8A 1YM0A 1GCDA 3A86A 2F9BH 1DLKB 2W7SA 2GV6A 1V2QT 1OYTH 1CHGA 1F0UA 3ZZ9A 1HJAC 2ZU5A 4RSPA 1HRTH 4WH8A 1O5EH 1ZJKA 2BMGB 3P8NA 4I32A 1SQTA 1TNKA 3P70B 3VFEA 4ABEA 3PTNA 2P8OB 4ZROA 3DA9B 4K69A 1FAXA 3ODDA 2P16A 1YPHE 1HPGA 1WTHD 2QYIA 1NESE 1P9SA 2LNCA 5B6OA 4Y0YE 1O2XA 1G30B 1LPKB 1GHVH 1HJ8A 1TABE 2QV1A 2VVVA 1DXWA 1BMLA 2A4OA 2HNTC 3SN8A 3ODFA 3PWCA 2Z6BD 5J4QA 1GDNA 3SUEA 4UDWH 2F9OA 3U8OH 2BD5A 1C4V2 3E90B 2GCHF 4WWYA 1MCVA 1C5VA 1MTUA 4TWYA 1W11U 3SV9A 4XBDA 1MUEB 1LMWB 4PROA 2ZDMA 4XDEA 2J34A 2NU3E 1SGNE 4K8YA 4NG9H 3SV8A 1O3GA 1BCUH 5DP8A 5GWZA 3P6ZB 1BTWA 3TLOA 4AFQA 1BDAA 1G32B 1ETTH 2GMTC 1ETSH 1O3JA 4ZKRU 4NIVA 1C1QA 4DURA 3MNXA 1AVWA 1XKAC 2ANMH 1AWFH 1UTLM 4CH8B 4AG1A 1CA0B 1RIWB 3S7KB 3S69A 1V2ST 1B0FA 4Q7XA 1GJ8B 2D26C 4IBLH 2D8WA 2R0KA 3SNEA 2WYGA 3D23A 1NN6A 1TNHA 4ABJA 5FPSA 1ELAA 1WBGB 1P05A 1BTXA 4ZH8A 1GJAB 1SPJA 3A85A 3LPRA 3SJ9A 4CRGA 3ESTA 1C1SA 4ABGA 3BEUA 1P12E 1RXPA 3R0FA 2XWAA 2CV3A 2GV7A 1JRTA 1V2TT 2B7DH 3GY5A 2ILNA 3BTTE 4AB8A 2P95A 3ZZ3A 1XMNB 3BTKE 1MTWA 1ANEA 2EI6A 2K1QA 4MQAA 1PQ8A 4YLQH 3RMNH 3RXLA 1Z1IA 1LVYA 3E91A 1EZSC 1OWKA 1MZDA 1D4PB 4HZHA 4AYVB 3CENA 5L6NH 4VGCC 1OP2A 3ZZ4A 2J4IA 3LJJA 1DY8A 4B1TA 4D76A 2I6QA 3Q00A 3H7TA 2OCVB 1KXFA 1LHEH 1BMAA 1MKWH 1QQUA 3O8BA 1G3DA 1SSXA 4Q80A 1TPAE 2SFAA 1DY9A 4WJG2 1MH0A 1K2I1 3STIA 1EOJA 2ZDVH 3TGKE 4X2YA 6GCHF 2W3IA 1NS3A 3JZ2B 4SGBE 4DIHH 1TRNA 1A2CH 1CA8B 4MPWA 4RKOB 3RXMA 2AEIH 2G51A 3RXHA 1EAIA 2SNVA 4X0WU 3W94A 3W95A 2THFB 5HYOA 4U30A 1GBTA 2B9LA 4D9RA 2FOGA 3ENSB 2G81E 3URDA 1Q3XA 5JBCS 1D9IA 4ISIH 4FXGH 1QURH 5BRRE 3QUMP 1CE5A 3LH1A 2BDGA 2VVUA 1EZQA 3Q3KA 1SGDE 3LOXA 1HXFH 3SU4A 3KCGH 8LPRA 2BHGA 1LPZB 2SGDE 4BXSA 2FOFA 5FX5A 1J16A 3QK1A 3MNSA 2A7CA 1FY1A 1ZGIA 1TA2A 3ZZ7A 1Q2WA 3M36A 1GHBG 1FDPA 1ESAA 4NIYA 5CHAC 1NFXA 2QY0B 1KXDA 2ZQ2A 3TK6A 1YCPK 2OBQA 2WUCA 1UCYH 5A8ZA 4A7IB 4NWLA 2PUXB 2ZZUH 1O5DH 1K21H 5CHAB 1QJ1B 4X8SH 3B8JA 1YF4A 1CGHA 4KELA 2R2WU 3BTFE 2JH0D 1X7AC 3VB4A 1IQIA 1C5LH 3WY8A 1O0DH 2P3UB 1JWTA 3TJVA 1FONA 1ZPZA 4ZHMU 5IDKA 1P2KA 1MCTA 1W0YH 1XUGA 2QN5T 1AZ8A 1OP0A 1SQOA 2FLBH 5JBTA 2G5NA 2XXLA 1AU8A 1DX5M 1FJSA 1E35B 3ZVCA 1SLXB 1THRH 4X8VH 3UFAA 3QX5H 1MTNB 3ZYDA 1IQGA 1O35A 1HAIH 2OC0A 2H5DA 3BF6H 4WH6A 5C3NA 1L1NA 2WPIS 2BOHB 1J8AA 1THPB 4UEHH 3UQVA 3GY4A 3QGJA 5ABWA 1O3OA 1P3CA 1HAZB 3PO1C 1SOZA 2BDCA 3PMJA 2FS8A 3GDSA 1BT7A 4YT6H 2J95A 1EPTB 5C1YA 1MZAA 2Z7FE 8GCHG 2BTCE 3MTYA 4DIIH 2UUFB 4CRCA 4OS6A 1QL9A 1TYNA 3LT3A 1O3KA 1NTPA 2TBSA 1RTFB 2Z9GA 1PPGE 1PQAA 1FN8A 4ISOA 1GHAG 2ANYA 1PPHE 2ODYB 1CT0E 1O2QA 4I8JA 1N6YA 3SU1A 1GMCG 2F9UA 4K60A 2RDLA 1ZJDA 4FUGA 4FUHA 3EDXB 1A3BH 1QA0A 5EQSA 1ABJH 2FOEA 5A0CA 1AB9C 2J2UA 1KXCA 1EB2A 1V2WT 1NM6A 3RC5A 4CREA 1L4DA 1BUIA 1SGYE 4Y79A 1C2FA 1YPHC 2IJOB 5DP4A 1VGCB 1A3EH 2ZDNA 3FZDA 2ZFSA 1ZPCA 3SW2B 2QF0A 2AGGX 4DG4A 3SV6A 3SGBE 5FXLA 2BVRH 1E37B 1QIXB 3NXPA 4NFFA 2ZTYA 1O2VA 1RGQA 3DFLA 1QL7A 1OWHA 3GYMA 3HATH 1C5NH 1EKBB 3S9CA 3PMAB 2PSXA 5DG6A 1O3AA 4UD9H 1Y3XA 2M5TA 3VB7A 5E2OA 1PFXC 3VEQB 3ATKA 5A0BA 1IQLA 4IC5A 2BD9A 3ZYEA 3OX7U 1AKSB 1SC8U 3SBKA 1VCPA 4QT8C 1ELFA 1T4VH 4FU7A 1C1VH 1OPHB 1XM1A 2PKSC 5EG4A 5EXNA 2XBWA 2SGFE 1O2GH 1IQMA 2H9HA
chains in the Genus database with same CATH superfamily
2XBXA 2UUJB 2HALA 3KEEA 4JZFH 2O8MA 1NRSH 2KFWA 1LCYA 1BRBE 2H9TH 1IOEA 1GJCB 1W7XH 3UB0A 5ESBA 5C1XA 1IHSH 2Q6DA 3PROA 3GDVA 1K22H 1TGTA 2ZA5A 1FPHH 4M9FA 1P2IA 3HGPA 2PTCE 2V35A 2BQ7B 2ZIQH 2GCHG 4Z6AH 1SBWA 2BX4A 1ZTJA 2KAIA 3NWUA 1EAXA 5GIBA 5TCCA 1EASA 2XBVA 4ABAA 3H09A 2PTNA 5FCRA 3UREA 3TGJE 2IPHA 3T28A 3LGYA 4LK4A 1ZSKA 4X2VA 3RXOA 2G5VA 1UK2A 1TWXB 4GUXA 3ATMA 2GX4A 1LHDH 1GHZA 1O2TA 2K8IA 1NC6A 1GI3A 2Q1JA 2WZQA 2BY9X 4YOGA 1KTSB 1H8IH 2A45B 2O8UA 1ZSJA 5ETXA 3BEIB 1OHHD 1BBRH 4MTBA 3S0NA 5FX6A 5A8YA 2ZI2H 3UWIA 3BIUH 1OKXA 4NA9H 1AO5A 4JZDH 3RLYH 2GCTC 2QA9E 1C9TA 2IPQX 4D7FA 1U6QA 1AI8H 1O34A 1S84A 1HAOH 5GJ4B 4Y8YA 3AAUA 2FPZA 3CS0A 4A5TS 1C4Y2 2RDEA 1W2KH 3H5CB 1QBOA 2QGRA 3MWIU 1Z8GA 2WINI 3HGNA 1JXPA 1VITH 1YPMH 2STAE 4DT7B 1A5IA 4JK6A 1MQ5A 1P01A 2TGAA 1D3TB 3EAJA 4X6PA 4BOHA 1Y3YA 1AUJA 3U1IB 3V7TA 2JETB 2JIZD 3FZZA 2UWLA 2OK5A 1V2VT 3NRLA 1C5SA 1GVZA 3F6UH 3MO3A 1NBMD 2AERH 3DFJA 1G3CA 2OP9A 3BSQA 4J2YB 2NU1E 3RXKA 3AW0A 2ZU2A 1W0ZU 1XXDA 2EY4C 1GBFA 1CGJE 1ACBE 8GCHF 3ZZBA 2O8WA 2CN0H 3MO6A 5TCAA 1MU6B 2VVCA 4MNXA 1YKTA 5K7RA 3FP6E 1AFQC 3OY6U 4FUJA 3BIVH 1GJ5H 1LQDB 3SI3H 3FO8D 1S0RA 3HKJB 3M3VA 1C5WB 1KMHB 1W14U 1TQ0B 1V2JT 2XNDD 5F6MA 3ZZ6A 1O30A 1UTOA 2HPPH 1CHOG 3S9BA 1HFDA 1SLWB 3F1SB 4OS2A 1GBLA 2H6MA 2BDYA 3UPEA 2OQUA 2VIPA 3U9AH 4GAWA 4OGXA 1TBQH 1QB9A 5PTPA 5ESTE 3QO6A 4ZCNA 4Z1MD 1HIAA 2ANWA 2WSSD 1O3MA 5DJ7A 4B76A 3F2FA 1EX3A 1TNLA 1GI2A 3KQBA 4UFGH 4CBNA 3UAIC 2BD3A 3FAOA 3A83A 6ESTA 5EJ1A 1O2KA 1C1TA 1RTKA 1UVUH 4RKJB 3M7UA 3PRDA 2BD4A 1ZPBA 1G3BA 2ZECA 3LGUA 1G3EA 5FPTA 1K9OE 2ZTZA 2P94A 5AF9H 2Z3CA 1ZMNA 2F9PA 3A7XA 4RI0A 3KIDU 1WTGH 1E38B 1QJ7B 3M5NA 1O3PB 1NRRH 3MU8A 1THSH 3TH4H 4CH2B 2D2DA 1PPEE 3UOUA 3MYWA 3NUMA 1UO6A 2CGAA 5DO4H 1WYKA 3SUFA 1EPTA 1SGCA 1BITA 1IAUA 4CBOA 3NK8A 1GBMA 1SOTA 1XUFA 5KEDA 1O5AB 2A32A 1FY3A 1TFXA 2A5KA 3PV4A 4JZEH 1LHFH 1TNJA 3LGVA 2QF5A 1QCPA 2RA0A 4Y10E 1O31A 2FS9A 3BTEE 1KYNA 1UTJA 2P3FH 1SQRA 2BOKA 1TMBH 2JDID 2ZCHP 5JPMH 1C1UH 2Y5HA 2OC8A 3GCHB 2BY5X 1SB1H 8KME2 2FX4A 1XVOA 2UWOA 5HM9A 1GGDB 2VIWA 1GBIA 1BBRK 1QRXA 3TK5A 7ESTE 1TBRH 4UE7H 1ESTA 4U01A 2O8TA 1NROH 4DW2U 1JBUH 4FU9A 2C93B 3P95A 3RU4D 3ZVGA 4WF8A 1BHXB 3N7EA 3D65E 2ESTE 1V2LT 2ZPSA 2G4UA 2FOMB 4TPYA 1GWAA 1G37A 3A8AA 1T8OA 3AW1A 1WU1A 2VIQA 4D7GA 3QZQA 4DVAU 1UVSH 2BZ6H 3PB1E 3F9HA 4XOJA 5EQQA 1DS2E 4GHQA 2R9PA 1WUNH 3B9FH 1H1BA 2A7HA 1ETRH 1O2LA 2BDBA 5FL7D 5L30H 3D49H 3PMHB 3RXJA 3FVFB 4IS5A 3SU0A 1GDQA 1XXFA 2B8OH 1Y3UA 3BV9B 1Y5BT 4Q7ZA 4X8TH 1INCA 3V12A 2GT8A 1Z8RA 3W1EA 3A88A 5HM2A 1ZR0A 2Y7XA 3EE7A 2G8TA 4NWKA 2W26A 2HWLB 1A5GH 1E0FD 4AYYB 4Y8XA 1LHGH 2ZP0H 3VG8A 4YLUA 1C5ZB 1E36B 3UNSA 3A8DA 2TGTA 1ZHPA 2YMSC 1QRZA 1ORFA 5DK1A 4J1YA 3BEFB 1PPZA 3ZIAD 1FAKH 1P10A 5F53A 4Y11E 4WXIA 3VPKA 1ZHRA 4Y76A 1BTPA 1LKBA 2W3KA 3F3BA 2F9VA 5E0GA 5JBAS 1OS8A 5F8ZA 2ZC9H 3C27B 4BAKB 1AN1E 3JZ1B 4FUEA 4AFZA 3U28C 4OS7A 1GHBF 5DSFA 2FO9A 4YT7H 3DSOA 3RMMH 3BTGE 2YNBA 2JH5D 1A5HA 5G4BA 1E34B 2QXHA 1Z7KA 3NZIA 5EJLA 3DD2H 1CSOE 1FUJA 2TGPZ 3MH5A 2ANKH 5E8EH 1UJ1A 2Z9LA 3UIRA 5EW1H 2A4QA 3A81A 2ZU1A 3SNCA 5CE1A 3D62A 2Z9KA 2A4GA 2BVXH 1C5UA 2FODA 2PW8H 2C8WB 1UCYE 5AHGH 1OWJA 1SR5C 2ALVA 5C2ZA 1QL8A 4WXVA 4FUIA 1YCPM 1RTLA 2ALPA 2Y5FA 1SGFA 1Q31A 1UTMA 1P2QA 3FANA 4KTSA 1BBRE 3PLPA 2GGVB 1TPPA 2P3TB 3M3TA 4NA7A 1ZYOA 3PYHA 1FQ3A 2B0FA 3ITIA 1LTOA 1V2MT 4GPGA 1P09A 1BRCE 1FNIA 1TX7A 1S6FA 2XYAA 1ZGVA 1BOQA 2AMDA 8ESTE 3U1JB 1QB1A 4YZUA 4AG2A 2R3UA 3G01A 2XBYA 4RN6A 1UTKA 1GHYH 2GD4B 1HGTH 1SGQE 4AFUA 1O3DA 4F4OC 3MU0A 5FCKA 2FOCA 1W12U 1NZQH 3O8CA 3T25A 1BIOA 3OFND 2VWOA 1UCYK 2YOLA 2WV9A 2VJ1A 1GDUA 2UUKB 3RMOH 3UOPA 1C1NA 1S81A 1MAXA 4JZ1A 3F9EA 5DP5A 1OOKB 5GDSH 1O2RA 4AOQA 1COWD 4WMFA 3RC6A 1H9LB 1H8DH 3ATWA 1GI1A 4F49A 1Y5AT 1TRMA 2HPQH 1GL1A 7LPRA 3KN2A 3QN7A 1MBQA 1JIMA 2V6NA 1GCTC 2C4FH 5IYTA 1HAHH 2BD8A 1CGIE 1ELCA 1C1WH 2PUQH 3E16B 1AY6H 3KQDA 2PV9B 1V6DA 1ZMLA 1ZZZA 2GMTB 3GS9A 3GY2A 3MO9A 4IW4E 3TVJB 4AORA 1TLDA 2W7UA 1GHAF 2WPJS 1ZLRA 3BN9A 1BB0B 1C2KA 4WY3A 1BRAA 1UTPA 6LPRA 2F83A 1UK3A 1BTUA 4NSVA 4YM9A 2ZFTA 1DT2A 3SO3A 5DP7A 1KTTB 1PYTD 1YPGH 2VNTA 4Y7AA 3UNRA 1OWDA 4JYTA 7KMEH 2CJIA 3KQ5A 3RUOA 2A2XH 1B0EA 2G55A 3GY7A 2PKAA 1O3EA 1NFUA 1K1MA 1CT4E 3SZNA 3VGCC 2ZHFH 1TOCB 2OD3B 4X1SU 5J4SA 1K0HA 1AFEH 4JMYA 2V3HH 1G2MA 3STJA 1GBJA 1GBEA 3ZZCA 3K6ZA 1CO7E 1O3NA 2XC0A 4X1PU 5GCHG 1HJ9A 1K1PA 3LJOA 3GCTF 1YPLH 4D9QA 1PPBH 1O2YA 3LKWA 5DPAA 4M7GA 1FY8E 2DUCA 3BG4B 1YWUA 2PLXA 1Z6EA 3TH2H 4XD7D 2ZO3H 3DCLA 3SJOA 3RXCA 5I46H 4I8HA 1AD8H 1L0ZA 3P8GA 2FM2A 3PWBA 1YY3A 4D8NA 3MQKC 3K65B 4ZXXH 3EE0B 3RXPA 1P02A 1DWEH 2R2MB 5JYIA 3BTME 1N1LA 1P2JA 3RM2H 5EOKA 3GCHC 5LPEA 1D3DB 2QC2A 4FUFA 1N6XA 3VB5A 5T6GA 1AVXA 2FTLE 1TA6A 4X1NU 1SGTA 1SVPA 5EU8A 3VB3A 1PPCE 2BQ6B 4FU8A 3FOAA 4MVNA 4ESTE 1GG6B 2SGPE 3M5OA 2IN2A 2CHAC 4TSFD 4Y0ZE 1TONA 1O3LA 1LVBA 5GXPA 3RXFA 4KTUA 2TGDA 3ZZ5A 2AIQA 1BHXF 4K1SA 5GPIB 2LP6A 1OX1A 1YYY1 2AGIX 2V3OH 4ZAEA 3A87A 3RXUA 1WXRA 3E6PH 2KR7A 2Q6FA 4F48B 3SQHE 1F5RA 2OLGA 2VU8E 1QQ4A 2W5EA 4VGCB 1FLEE 4ABBA 1V2OT 4FUCA 4Y8ZA 3GISB 2HRVA 3M5LA 1F0SA 3IITA 2A31A 1GJBB 1GMDF 1MTNC 3GCOA 2W6JD 4MG3A 2VGCB 2XRCA 3QZRA 2GTBA 2ZNKH 3SI4H 4B2CA 2Q6GA 3RC4A 3ZVAA 4AGKA 4Q2KA 1E1RD 1O38A 2HVYB 3LGIA 3URCA 4AX9H 1HNEE 1C5QA 2YMSD 5DP9A 7GCHF 1O5BB 4BAQB 5EXMA 3V0XA 3RXTA 4LOYH 1DLEA 2Z94A 1LHCH 1MABB 1TX6A 1A0HB 2BDHA 3OE7D 3ZZDA 2ODPA 4CR5A 4JZIA 2BLWA 1QBNA 1AWHB 1GI0A 2SGAA 3K2UA 3U8TH 3UR9A 1EJAA 1UHBA 4ZMAH 2SNWA 4FVBA 2TIOA 2FOBA 3SU5A 2BDAA 1K1OA 3LGWA 1GHXH 1ID5H 5F8XA 5KECA 3IWMA 1TNGA 3F0PA 2OC7A 5LH8A 3SNDA 5LGOA 2RA3A 3LIWA 1KIGH 1ZRKA 3OEED 2A7JA 2KCOA 2WV5A 4FVDA 2FOAA 3RDZA 1O5GH 4MPUA 2TRMA 4O3UA 2ZPRA 1C1RA 4E05H 1A4WH 5T6DA 1SGEE 4B75A 2VH6A 5EW2H 4E06H 4DOQA 1QBVH 3KL6A 1D6WA 1C1MA 1RRKA 1M9UA 1O2UA 3ZVFA 1C2HA 4KP0A 4HG6A 4X1RU 4NGAH 5GCHF 1V2KT 2WPMS 1VR1H 2PP6A 1FI8A 4WVPE 5CHBA 3T5FH 1DITH 1VCQA 4ZHAA 4TYDA 1IQEA 1DVAH 1EQ9A 1YBWA 1H9IE 2VIOA 2IJD1 1AHTH 1DICA 1NRNH 2BVSH 3F68H 2QF3A 3TNTA 4NCYA 3QTOH 1LKAA 1C5OH 5L2ZH 3UUZA 4KKDA 1LVOA 4MNWA 2F91A 3QLPH 1AIXH 1YCPH 3PTBA 3SORA 4ASUD 5E0JA 2GCTB 1O5CB 2FOHA 2JKHA 4CHAC 1UTNA 4GHTA 1VITG 5LPFA 1O2HA 2EI8A 1SLUB 2P59A 3K6YA 1P0SH 3SU2A 4X6OA 2J97A 1VCWA 2ZCKP 2UWPA 2ZHWH 1GI5A 2L6OA 1KY9A 3BTDE 1PQ7A 4X2WA 1MKXK 1O3IA 2OUAA 1O2JA 3HKIB 1V2PT 1XUKA 5C20A 2ZFFH 3P92A 3DT0H 1Y59T 3RXAA 3TGIE 4ISLA 1HAPH 1N8OC 1XUHA 2BDIA 3LU9B 4I8GA 1L2EA 1EXFA 4OM9A 1S6LA 5HKKD 3DUXH 1O2OA 1ZTLA 1TALA 5EPYA 4XFQA 5C5OA 3RXGA 4CRFA 1ZTKA 1W7GH 1HLTH 4X2XA 3UTUH 1ELEE 3RXBA 3RXEA 1EZXC 2FZZA 1SGFG 4Y71A 1XKBC 1DSTA 1FY5A 4NIWA 1O37A 5DP6A 4I8LA 5DP3A 1YC0A 4A92A 1VJ9U 4ABHA 2BD7A 1GI7B 1DOJA 2H9EH 3EA9A 1SQAA 4JK5A 2OQ5A 1V2UT 3PLKA 1V2NT 4Z0KA 3SNAA 4KTCA 1P06A 1GGDC 4X8UH 4K1TA 3I77A 1GBAA 3O8RA 4B71A 1TIOA 1GHWH 5I25A 3PRBA 3UR6A 4I7YH 4MNYA 5FBEA 2SGQE 3GY3A 4HTCH 5DKMA 1W10U 3ZV9A 3SV7A 4A1TA 2XCNA 1DWCH 2VIDA 1LDTT 5F8TA 1S83A 4GCHF 1SGPE 1NFYA 3VGCB 2YNAA 1AFQB 3KYGA 1TQ7B 3A8BA 4WMEA 5E0HA 1KLJH 3SOSA 1BJUA 2BLVA 1HJAB 1C1OA 4NIXA 4FETA 1TGNA 1AB9B 4GVUA 1O3FA 1A0JA 2C8XB 3T62A 3U98H 4JYVH 4UFFH 2HGTH 1RD3B 4H42U 2FWWA 3A84A 2R0LA 3MU4A 1O32A 2KCYA 1GJ9B 2BY8X 2A1DB 1AQ7A 2GZ8A 3O8DA 1W8BH 2ZFPH 1S82A 3M5MA 2VWMA 2ZPQA 3N7DA 4BTUB 1K1NA 4B2AA 1IQNA 2WV4A 4A6LA 1FIWA 2HNTF 2VIVA 4AZ2B 3T29A 2IOTA 3FKSD 1T4UH 3GICB 4O3TA 4SGAE 3BTWE 3QWCH 1MAYA 4ZKNU 3RXSA 3VXFH 1WOFA 2GDEH 4BAMB 3SYJA 1EJNA 1S6HA 1NU7B 1TOMH 3TU7H 2BXTH 4HGCA 1TGCA 2PWXA 3OY5U 2I6SA 4CRAA 3Q3YA 1T31A 3TITA 1O2ZA 1TPOA 3A82A 3K9XB 1SFIA 1VITF 1YLNA 2FIRH 1HXEH 1IQFA 5EIYA 3I78A 1EJMA 1RS0A 1HUTH 1GL0E 3RM0H 2QIQA 1PJPA 4RT0A 4Y7BA 4DGJA 1CT2E 3RXQA 2FEQH 2A5AA 3LC3A 1QTFA 2BLQA 1GMCF 1AKSA 1ELDE 5CDFE 1O2NA 2AS9A 4UFDH 1ELBA 2PGBB 3DHKH 1GI6A 2ZGJA 4B6EA 4K2YA 4UFEH 1P57B 1ESBA 2BLOA 1DE7H 3NPSA 1BTYA 1O2SA 1C2IA 2XCFA 3L3TA 3MH6A 5L2YH 3R3GB 1IQHA 2C8ZB 1E79D 1KXAA 3FP8E 3ZVEA 1N8OB 2RFKC 2Y81A 2DE8A 3NKKA 1AE5A 1O36A 2BY7X 4AGJA 3RU4T 1P11E 2XNIA 3MU5A 3QGNB 3MNCA 1EATA 2KCAA 3U69H 2G4TA 1GJ4H 1PYTC 3PMBB 1GG6C 1B7XB 1IQJA 2Z9JA 1CBWB 2G00A 1JOUB 3RXVA 4LZ4B 1ZOMA 2PSYA 1G2LA 1J9CH 1GI8B 1OXGA 1TRYA 2F3CE 2VH0A 1GJ7B 3SU6A 3A8CA 3Q77A 2ULLA 1BMNH 3U8RH 1Y5UT 2A0QB 1GBBA 6CHAB 4O9VA 4U32A 1XUIA 4A1XA 2O8LA 1K1IA 1TGSZ 4GLYA 3V13A 1BQYA 1XVMA 1WQSA 1VKYA 3BTHE 4YO9A 1SHHB 3SQEE 4E7RG 1H9HE 5EODA 3VB6A 2NU2E 5BPEA 1B5GH 1DDJA 3BG4C 5T1VA 1EP5A 2AYWA 3A7ZA 3T26A 1GJDB 2AH4X 3GOVB 1LQEA 1BJVA 1HAGE 1DXPA 4ISHH 1NBME 4BAOB 1EAWA 1A0LA 1ELTA 1GJ6A 2VINA 1EP6A 3SV2H 3FP7E 4TPIZ 1AMHA 2Y80A 4LZ1H 3PM3A 3F9GA 1W0KD 1Y3VA 3M7TA 1MKXH 2QXJA 4P02A 5HXFA 5C0UA 1NFWA 2J94A 3MU1A 2Z3EA 3OTJE 4NZLA 2ZHQH 1J15A 2CHAB 4XE4A 2A4RA 1GBCA 1QFKH 3WW7A 4BANB 1A7SA 5EPNA 4NSYA 1NPMA 1BTHH 2A2QH 1ARBA 2BQWB 5JBBS 4B6FA 2SGEE 5JB9S 3E0NB 3KNXA 4ZKOU 1OWIA 1P2MA 3EGKH 3A7TA 3A7YA 4HFPB 4ABIA 4AB9A 2ZWLH 1UK4A 3MI4A 1C5XB 4I33A 3RMLH 5FPYA 3Q3XA 2H1UA 1HV7A 1QNJA 4YESB 2F9NA 1BMMH 1GBDA 2RCEA 1QHRB 1T8NA 3RXDA 1MMJN 4B73A 2VB0A 1RJXB 5EQRA 3B23B 1Y3WA 2XOKD 3CS7A 3SJKA 4DJZB 4K1EA 3HK6B 1O39A 3SHCH 1VGCC 1Z8JB 1C4U2 1O3BA 1FY4A 1HIAB 3EQ0H 6CHAC 1TMUH 1J14A 1P8VC 4BXWA 2GVFA 3LONA 1QJ6B 1GVLA 3F2GA 3AAVA 1O5FH 1GMDG 2R3YA 5HGGA 2CXVA 5DGJA 1ELGA 1GBHA 2VGCC 1SMFE 1UW7A 1GVKB 1K28D 2CMYA 4XRNA 1ABIH 2FLRH 2AGEX 2FI5E 4H4FA 4R8TB 2OC1A 1Z1JA 3P8OA 5F03A 2FYRA 2STBE 1QR3E 1EOLA 4KGAA 4MLFB 1ANBA 3GY6A 2QXIA 4NFEA 2V7QD 1AUTC 2Z3DA 3MHWU 2ZCLP 2BX3A 4TY7A 1AVGH 1V2RT 2D1JA 2A5IA 2FX6A 3OYPA 1BTZA 2ZFQH 3H7OA 1P03A 5JDUB 4BAHB 2HNTE 5AFZH 5E2PA 2ZQ1A 1EPTC 3TIUA 2XTTB 1F0TA 1OYQA 4K8BA 1ZSLA 1KXBA 3SU3A 3ZVBA 4AC9A 1GCTB 3AVZA 3MOCA 3T2NA 1O2WA 2GZ7A 1C2JA 5FBIA 1CA0C 1RIWC 2ZF0H 4GCHG 2OTVA 4P00A 2ZDAH 3RU4E 1T8LA 5SGAE 3TPIZ 4YXWD 1CVWH 1WSSH 4I8KA 5A0AE 3SJ8A 2WYJA 3OU0A 4U2WA 3KHVA 1ZMJA 1O3HA 3GCTG 1G9IE 1TAWA 3MH4A 3KF2A 1ZRBA 1F5LA 7GCHG 1OSSA 3ELAH 3LGTA 4CRDA 2O9QA 2WUBA 2HVXA 5EXLA 2J98B 2ZHDA 3FN8A 1W0JD 3HK3B 1O2MA 1Z8IB 4JCNA 2C8YB 4NA8A 2V0BA 4IGDA 4OS1A 1T7CA 1KXEA 3CP7A 4TY6A 3SGQE 3SJIA 3UQOA 2GT7A 1EZUC 3TJUA 3CNRA 1ELVA 4FUBA 3AASA 2PGQB 2G52A 2VBCA 1DWDH 1HAVA 1KLIH 5A2MH 2HLCA 3KQEA 9ESTA 1WQVH 2HOBA 3ATLA 4DT4A 3LDXH 2WPKS 2ZGCA 3GYLB 4YTAA 1C2EA 4FUDA 2JJ2D 1DANH 1JMOH 1GMHF 4MPVA 1SKYE 3RXRA 3TH3H 2QAAA 1A61H 3LC5A 1UVOA 3RXIA 1TPSA 4XSKU 2JJ1D 4MPXA 2H2ZA 2PKSB 5H4IB 1F5KU 1C1PA 2J5UA 1PPFE 3S7HB 1IQKA 2ZGBH 6GCHG 1QGFA 1SLVB 1O3CA 1C5PA 3TJNA 3NCLA 2JETC 1C5TA 2FTMA 2Y82A 1O33A 2ZU3A 3DSPA 3E0PB 4Q4LA 2NU0E 4X6MA 2WPLS 1TB6H 2B5TB 1FXYA 2ODQA 1ZHMA 3MFJA 3N7OA 1GBKA 1FN6A 1SGIB 2OINA 3OSYA 2KAIB 2PFEA 4R0IA 2FXRA 2ZEBA 1P2OA 1IHTH 1MD7A 5C94A 3SNBA 2OXSA 2PR3A 1YGCH 1QZ8A 1EAUA 5TJXA 1UTQA 5HIYA 3DSGA 1L1GA 1SI5H 2WPHS 1LPGB 1CHOF 1LO6A 2H5CA 1A46H 1FV9A 2FYQA 2RG3A 1Z71A 3SUDA 3M35A 3MH7A 5JB8S 1C5MD 2QE7D 5C17A 4AFSA 1KDQA 1PQ5A 1XX9A 1SGRE 1AGJA 1MTSA 1JRSA 3A7WA 1H4WA 2CF8H 3BTQE 1VZQH 3TJOA 4ASHA 1WV7H 2GJGA 5HIZA 3KQCA 1FMGA 3MNBA 2HLDD 1Z6JH 2J92A 2XW9A 4K5ZA 2Y6TA 3SGAE 1MBMA 2JH6D 1C2GA 3MMGA 5EGMA 3HPTB 1C2LA 4BNRA 1V3XA 1TX8A 3WWBA 1C5RA 5FAHA 2ASUB 2PHBA 1TBZH 2L74A 3E8LA 2ZDLA 4OS5A 1DPOA 2VWLA 3PO1B 1P04A 1ANCA 1ARCA 2F4LA 4Y6DA 5CMXH 4JYUH 1GI9B 1C2MA 4I31A 3KGPA 1P3EA 1GPZA 2EQNA 3ZZ8A 4F55A 2OBOA 5AVDA 2FMJA 3ATIA 2TPIZ 3I29A 4B74A 1GI4A 3ZZAA 2ZKSA 3BG8A 1BMFD 4XBCA 5T3HA 1F92A 2QF4A 3TNSA 2FP7B 1NRPH 1YLCA 4THNH 1G36A 3QTVH 1P2NA 4XBBA 1AE8H 2AIPA 3S9AA 3A7VA 3GY8A 1A1RA 2AMPA 5FHTA 1HDTH 3IG6B 4E7NA 1H8ED 3RP2A 3E3TA 4TWWA 1ANDA 2ZG0H 1AZZA 1MU8B 2EC9H 2EEKA 3EA7A 2EA3A 3PLBA 4LXBH 4A1VA 2BB4A 3SZEA 3L33A 2ZU4A 3C1KA 1DSUA 2BD2A 1HAVB 5A8XA 1C2DA 3E1XB 3GCNA 5HMAA 1DM4B 1QRWA 1UHBB 1J17T 4ZKSU 2ZDKA 3TK9A 3LH3A 1OP8A 4B2BA 1CQQA 4ISNA 4DY7B 5K0HA 1FZZA 2FDAA 1YPKH 2P8OC 1FPCH 4IMZA 3UWJH 1EUFA 3T27A 1MTVA 4X6NA 2GZ9A 3UNQA 2XC5A 5A09A 3SUGA 3VXEH 2FESH 2ZGHA 2BZAA 4YOJA 1CU1A 4INKA 4HI3A 1WAYB 4ZHLU 4BTIB 1T32A 1WCZA 2QCYA 2XWBI 1UVTH 2ZTXA 1TMTH 2VWNA 1MQ6A 2P93A 2UUYA 1F0RA 1DUAA 2C3SA 4ABDA 1KLTA 2PKAB 4IC6A 1NY22 3A89A 3M7QA 4UONA 2J9NA 2FI3E 3M37A 4BTTB 1CBWC 1QB6A 4CR9A 1L1JA 1MD8A 3GDUA 1DFPA 2BY6X 5LPRA 4MDSA 2GKVE 1D3QB 1RFNA 1YLDA 4OS4A 4X1QU 3P17H 3Q76A 2AMQA 4INHA 1W13U 3EA8A 4K3JA 1YPJH 4Q63A 3ZVDA 2C90B 1HAXB 2BYAX 2DE9A 5KGOA 2LPRA 1HB0B 1O2IA 4ACBA 1QY6A 1HBTH 1P9UA 3FFGA 3RLWH 3V3MA 4H6SB 3F9FA 1JIRA 1KDQB 2ZFRH 1XUJA 4CRBA 4IN2A 5AFYH 4Q7YA 5C1UA 5T6FA 5C67A 1Y8TA 1EB1H 4OGYA 4H6TA 1VJAU 1D3PB 1DWBH 1HCGA 1F2SE 2BM2A 1D6RA 1TE0A 1KSNA 2QXGA 2FI4E 1SL3A 2WHXA 1K1JA 1F7ZA 1S5SA 3M61U 1TNIA 3EYDA 1FIZA 1YP9A 1UVPA 2BXUH 2Y5GA 2ZHEH 4AN7A 4ZUHA 1HAYB 4INLA 2GP9B 3PV2A 1MKWK 4MNVA 3L6PA 4O03A 1LVMA 2AFQB 1L4ZA 1OWEA 3F2HA 2EI7A 5C0TA 4CHAB 4O97A 3SHAH 1S0QA 3A80A 4NZQA 4IN1A 2GDDA 5C5NA 1QA7A 1C5YB 1BRUP 1O2PA 1SHYA 1BZXE 3OEHD 2ZGXH 1DUEA 3UY9A 2Y7ZA 1BA8B 3P8FA 1UMAH 2Z9IA 1C9PA 4ZXYH 1T8MA 2CF9H 2NU4E 2XC4A 1NO9H 4WMDA 1NT1A 3WWFA 2J38A 3QDZB 1K1LA 3M3SA 1TGBA 4ABFA 9LPRA 1NRQH 1GMHG 1SG8B 4GSOA 1W3CA 1HYLA 1SFQB 5GNDA 1NU9A 4DCDA 1S85A 1YPEH 2NWNA 4IMQA 4YOIA 3ZV8A 1YM0A 1GCDA 3A86A 2F9BH 1DLKB 2W7SA 2GV6A 1V2QT 1OYTH 1CHGA 1F0UA 3ZZ9A 1HJAC 2ZU5A 4RSPA 1HRTH 4WH8A 1O5EH 1ZJKA 2BMGB 3P8NA 4I32A 1SQTA 1TNKA 3P70B 3VFEA 4ABEA 1EFRD 3PTNA 2P8OB 4I86A 4ZROA 3DA9B 4K69A 5EJZA 1FAXA 3ODDA 2P16A 1YPHE 1HPGA 1WTHD 2QYIA 1NESE 1P9SA 2LNCA 5B6OA 4Y0YE 1O2XA 1G30B 1LPKB 1GHVH 1HJ8A 2KM0A 4ACAA 1TABE 2AHME 2QV1A 2VVVA 1DXWA 1BMLA 2A4OA 2HNTC 3SN8A 3ODFA 3N99A 2Z6BD 3PWCA 1GDNA 5J4QA 3SUEA 4UDWH 2F9OA 3U8OH 2BD5A 1C4V2 3E90B 2GCHF 4WWYA 1MCVA 3AK5A 1C5VA 1MTUA 4TWYA 1W11U 3SV9A 4XBDA 1MUEB 1LMWB 4PROA 2ZDMA 4XDEA 2J34A 2NU3E 1SGNE 4K8YA 4NG9H 3SV8A 1O3GA 1BCUH 2K0QA 5DP8A 3OAAD 5GWZA 3P6ZB 1BTWA 3TLOA 4AFQA 1BDAA 1G32B 5B6LA 1ETTH 2GMTC 1ETSH 1O3JA 4ZKRU 4NIVA 1C1QA 4DURA 3MNXA 1AVWA 1XKAC 2ANMH 1AWFH 1UTLM 4CH8B 2V3MA 4AG1A 1CA0B 1RIWB 3S7KB 3S69A 1V2ST 1B0FA 4Q7XA 1GJ8B 2D26C 4IBLH 2D8WA 2R0KA 3SNEA 2WYGA 3D23A 1H8HD 1NN6A 1TNHA 4ABJA 5FPSA 1ELAA 1WBGB 1P05A 1BTXA 4ZH8A 1GJAB 1SPJA 3A85A 3PV5A 3LPRA 3SJ9A 4CRGA 3ESTA 1C1SA 4ABGA 2CK3D 3BEUA 2LELA 1P12E 1RXPA 3R0FA 2XWAA 2CV3A 2GV7A 1JRTA 1V2TT 2B7DH 3GY5A 2ILNA 3BTTE 4AB8A 2P95A 3ZZ3A 1XMNB 3BTKE 1MTWA 1ANEA 2EI6A 2K1QA 4MQAA 1PQ8A 4YLQH 3RMNH 3RXLA 1Z1IA 1LVYA 3E91A 1EZSC 1OWKA 1MZDA 1D4PB 4HZHA 4AYVB 3CENA 5L6NH 4VGCC 1E1QD 1OP2A 3ZZ4A 2J4IA 3LJJA 1DY8A 4B1TA 4D76A 2I6QA 3Q00A 3H7TA 2OCVB 1KXFA 1LHEH 1BMAA 1MKWH 1QQUA 3O8BA 1G3DA 1SSXA 4Q80A 4RT1A 1TPAE 2SFAA 1DY9A 4WJG2 1MH0A 1K2I1 3STIA 1EOJA 2ZDVH 3TGKE 4X2YA 6GCHF 2W3IA 1NS3A 3JZ2B 4SGBE 4DIHH 1TRNA 1A2CH 1CA8B 4MPWA 4RKOB 3RXMA 2AEIH 2G51A 3RXHA 1EAIA 5DN6D 2SNVA 4X0WU 3W94A 3W95A 2THFB 5HYOA 4U30A 1GBTA 4TT3D 2B9LA 4D9RA 2FOGA 3ENSB 2G81E 3URDA 1Q3XA 5JBCS 1D9IA 4ISIH 4FXGH 1QURH 5BRRE 3QUMP 1CE5A 3LH1A 2BDGA 2VVUA 1EZQA 3Q3KA 1SGDE 3LOXA 1HXFH 3SU4A 3KCGH 8LPRA 2BHGA 1LPZB 2SGDE 4BXSA 2FOFA 5FX5A 1J16A 3QK1A 3MNSA 2A7CA 1FY1A 1ZGIA 1TA2A 3ZZ7A 1Q2WA 3M36A 1GHBG 1FDPA 1ESAA 4NIYA 5CHAC 1NFXA 2QY0B 1KXDA 2ZQ2A 2YMSB 3TK6A 1YCPK 2OBQA 2WUCA 1UCYH 5A8ZA 4A7IB 4NWLA 2PUXB 2ZZUH 3KYFA 1O5DH 1K21H 5CHAB 1QJ1B 4X8SH 3B8JA 1YF4A 1CGHA 1FX0B 2KCPA 4KELA 2R2WU 3BTFE 2JH0D 1X7AC 3VB4A 1IQIA 1C5LH 3WY8A 1O0DH 2P3UB 1JWTA 3TJVA 1FONA 1ZPZA 4ZHMU 5IDKA 1P2KA 1MCTA 1W0YH 1XUGA 2QN5T 1AZ8A 1OP0A 1SQOA 2FLBH 5JBTA 2G5NA 2XXLA 1AU8A 1DX5M 1FJSA 1E35B 2KX4A 3ZVCA 1SLXB 1THRH 4X8VH 3UFAA 3QX5H 1MTNB 3ZYDA 1IQGA 1O35A 1HAIH 2OC0A 2H5DA 3BF6H 4WH6A 3F0OA 4FOUC 5C3NA 1L1NA 2WPIS 2BOHB 1J8AA 1THPB 4UEHH 3UQVA 2W6ID 3GY4A 3QGJA 5ABWA 1O3OA 1P3CA 1HAZB 3PO1C 1SOZA 2BDCA 2WPDD 2FS8A 3PMJA 3GDSA 1BT7A 4YT6H 2J95A 1EPTB 5C1YA 1MZAA 2Z7FE 8GCHG 2BTCE 3MTYA 4DIIH 2UUFB 4CRCA 4OS6A 1QL9A 1TYNA 3LT3A 1O3KA 1NTPA 2TBSA 1RTFB 2Z9GA 1PPGE 1PQAA 1FN8A 4ISOA 1GHAG 2ANYA 1PPHE 2ODYB 1CT0E 1O2QA 4I8JA 1N6YA 3SU1A 1GMCG 2F9UA 4K60A 2RDLA 1ZJDA 4FUGA 4FUHA 3EDXB 1A3BH 1QA0A 5EQSA 1ABJH 2FOEA 5A0CA 1AB9C 2J2UA 1KXCA 1EB2A 1V2WT 1NM6A 3RC5A 4CREA 1L4DA 1BUIA 1SGYE 4Y79A 5IK2D 1C2FA 2J98A 1YPHC 2IJOB 5DP4A 1VGCB 1A3EH 2ZDNA 3FZDA 2ZFSA 1ZPCA 2KZ4A 2QF0A 2AGGX 2F43B 3SW2B 4DG4A 3SGBE 3SV6A 5FXLA 2BVRH 1E37B 1QIXB 3NXPA 4NFFA 2ZTYA 1O2VA 1RGQA 2M2AA 3DFLA 1QL7A 1OWHA 3GYMA 3HATH 1C5NH 1WDIA 1EKBB 3S9CA 3PMAB 2PSXA 5DG6A 1O3AA 4UD9H 1Y3XA 2M5TA 3VB7A 5E2OA 1PFXC 3VEQB 3ATKA 5A0BA 1IQLA 4IC5A 2BD9A 3ZYEA 3OX7U 1AKSB 1SC8U 3SBKA 1VCPA 4QT8C 1ELFA 1T4VH 4FU7A 1C1VH 1OPHB 1XM1A 2PKSC 3OTPA 5EG4A 5EXNA 2XBWA 2SGFE 1O2GH 1IQMA 2H9HA
chains in the Genus database with same CATH topology
2XBXA 2UUJB 2HALA 3KEEA 4JZFH 2O8MA 1NRSH 1LCYA 1BRBE 2H9TH 1IOEA 1GJCB 1W7XH 5ESBA 5C1XA 1IHSH 2Q6DA 3PROA 3GDVA 1K22H 1TGTA 2ZA5A 1FPHH 1P2IA 3HGPA 2PTCE 2V35A 2BQ7B 2ZIQH 2GCHG 4Z6AH 1SBWA 2BX4A 1ZTJA 2KAIA 3NWUA 1EAXA 5GIBA 5TCCA 1EASA 2XBVA 4ABAA 2PTNA 5FCRA 3UREA 3TGJE 2IPHA 3T28A 3LGYA 4LK4A 1ZSKA 4X2VA 3RXOA 2G5VA 1UK2A 1TWXB 4GUXA 3ATMA 2GX4A 1LHDH 1GHZA 1O2TA 1NC6A 1GI3A 2Q1JA 2BY9X 4YOGA 1KTSB 1H8IH 2A45B 2O8UA 1ZSJA 5ETXA 3BEIB 1BBRH 4MTBA 3S0NA 5FX6A 5A8YA 2ZI2H 3UWIA 3BIUH 1OKXA 4NA9H 1AO5A 4JZDH 3RLYH 2GCTC 2QA9E 1C9TA 4D7FA 1U6QA 1AI8H 1O34A 1S84A 1HAOH 5GJ4B 4Y8YA 3AAUA 2FPZA 3CS0A 4A5TS 1C4Y2 1W2KH 3H5CB 1QBOA 2QGRA 3MWIU 1Z8GA 2WINI 3HGNA 1JXPA 1VITH 1YPMH 2STAE 4DT7B 1A5IA 4JK6A 1MQ5A 1P01A 2TGAA 1D3TB 3EAJA 4X6PA 4BOHA 1Y3YA 1AUJA 3U1IB 3V7TA 2JETB 3FZZA 2UWLA 1V2VT 1C5SA 1GVZA 3F6UH 3MO3A 2AERH 3DFJA 1G3CA 2OP9A 3BSQA 4J2YB 2NU1E 3RXKA 3AW0A 2ZU2A 1W0ZU 1XXDA 1GBFA 1CGJE 1ACBE 8GCHF 3ZZBA 2O8WA 2CN0H 3MO6A 5TCAA 1MU6B 2VVCA 4MNXA 1YKTA 5K7RA 3FP6E 1AFQC 3OY6U 4FUJA 3BIVH 1GJ5H 1LQDB 3SI3H 1S0RA 3HKJB 3M3VA 1C5WB 1W14U 1TQ0B 1V2JT 5F6MA 3ZZ6A 1O30A 1UTOA 2HPPH 1CHOG 3S9BA 1HFDA 1SLWB 3F1SB 4OS2A 1GBLA 2H6MA 2BDYA 3UPEA 2OQUA 2VIPA 3U9AH 4GAWA 4OGXA 1TBQH 1QB9A 5PTPA 5ESTE 3QO6A 1HIAA 2ANWA 1O3MA 5DJ7A 4B76A 1EX3A 1TNLA 1GI2A 3KQBA 4UFGH 4CBNA 2BD3A 3FAOA 3A83A 6ESTA 1O2KA 1C1TA 1RTKA 1UVUH 4RKJB 3M7UA 2BD4A 1ZPBA 1G3BA 2ZECA 3LGUA 1G3EA 5FPTA 1K9OE 2ZTZA 2P94A 5AF9H 2Z3CA 1ZMNA 2F9PA 3A7XA 3KIDU 1WTGH 1E38B 1QJ7B 3M5NA 1O3PB 1NRRH 3MU8A 1THSH 3TH4H 4CH2B 2D2DA 1PPEE 3UOUA 3MYWA 3NUMA 1UO6A 2CGAA 5DO4H 1WYKA 3SUFA 1EPTA 1SGCA 1BITA 1IAUA 4CBOA 3NK8A 1GBMA 1SOTA 1XUFA 1O5AB 2A32A 1FY3A 1TFXA 2A5KA 3PV4A 4JZEH 1LHFH 1TNJA 3LGVA 1QCPA 2RA0A 4Y10E 1O31A 2FS9A 3BTEE 1KYNA 1UTJA 2P3FH 2BOKA 1TMBH 2ZCHP 5JPMH 1C1UH 2Y5HA 2OC8A 3GCHB 2BY5X 1SB1H 8KME2 2FX4A 1XVOA 2UWOA 5HM9A 1GGDB 2VIWA 1GBIA 1BBRK 1QRXA 3TK5A 7ESTE 1TBRH 4UE7H 1ESTA 4U01A 2O8TA 1NROH 4DW2U 1JBUH 4FU9A 2C93B 3P95A 3RU4D 3ZVGA 4WF8A 1BHXB 3D65E 2ESTE 1V2LT 2ZPSA 2G4UA 2FOMB 4TPYA 1GWAA 1G37A 3A8AA 1T8OA 3AW1A 1WU1A 2VIQA 4D7GA 3QZQA 4DVAU 1UVSH 2BZ6H 3PB1E 3F9HA 4XOJA 5EQQA 1DS2E 4GHQA 2R9PA 1WUNH 3B9FH 1H1BA 2A7HA 1ETRH 1O2LA 2BDBA 5L30H 3D49H 3PMHB 3RXJA 3FVFB 4IS5A 3SU0A 1GDQA 1XXFA 2B8OH 1Y3UA 3BV9B 1Y5BT 4Q7ZA 4X8TH 1INCA 3V12A 2GT8A 1Z8RA 3A88A 5HM2A 1ZR0A 2Y7XA 4NWKA 2G8TA 2W26A 2HWLB 1A5GH 1E0FD 4AYYB 4Y8XA 1LHGH 2ZP0H 4YLUA 1C5ZB 1E36B 3UNSA 3A8DA 2TGTA 1ZHPA 1QRZA 1ORFA 5DK1A 4J1YA 3BEFB 1PPZA 1FAKH 1P10A 4Y11E 4WXIA 3VPKA 1ZHRA 4Y76A 1BTPA 1LKBA 2W3KA 2F9VA 5E0GA 5JBAS 1OS8A 5F8ZA 2ZC9H 3C27B 4BAKB 1AN1E 3JZ1B 4FUEA 4AFZA 4OS7A 1GHBF 2FO9A 4YT7H 3RMMH 3BTGE 2YNBA 2JH5D 1A5HA 5G4BA 1E34B 2QXHA 1Z7KA 3NZIA 3DD2H 1CSOE 1FUJA 2TGPZ 3MH5A 2ANKH 5E8EH 1UJ1A 2Z9LA 3UIRA 5EW1H 2A4QA 3A81A 2ZU1A 3SNCA 5CE1A 3D62A 2Z9KA 2A4GA 2BVXH 1C5UA 2FODA 2PW8H 2C8WB 1UCYE 5AHGH 1OWJA 1SR5C 2ALVA 5C2ZA 1QL8A 4WXVA 4FUIA 1YCPM 1RTLA 2ALPA 2Y5FA 1SGFA 1Q31A 1UTMA 1P2QA 3FANA 4KTSA 1BBRE 3PLPA 2GGVB 1TPPA 2P3TB 3M3TA 4NA7A 1ZYOA 3PYHA 1FQ3A 2B0FA 3ITIA 1LTOA 1V2MT 4GPGA 1P09A 1BRCE 1FNIA 1TX7A 1S6FA 2XYAA 1ZGVA 1BOQA 2AMDA 8ESTE 3U1JB 1QB1A 4YZUA 4AG2A 2R3UA 3G01A 2XBYA 4RN6A 1UTKA 1GHYH 2GD4B 1HGTH 1SGQE 4AFUA 1O3DA 4F4OC 3MU0A 5FCKA 2FOCA 1W12U 1NZQH 3O8CA 3T25A 1BIOA 2VWOA 1UCYK 2YOLA 2VJ1A 1GDUA 2UUKB 3RMOH 3UOPA 1C1NA 1S81A 1MAXA 4JZ1A 3F9EA 5DP5A 1OOKB 5GDSH 1O2RA 4AOQA 4WMFA 3RC6A 1H9LB 1H8DH 3ATWA 1GI1A 4F49A 1Y5AT 1TRMA 2HPQH 1GL1A 7LPRA 3KN2A 3QN7A 1MBQA 1JIMA 2V6NA 1GCTC 2C4FH 5IYTA 1HAHH 2BD8A 1CGIE 1ELCA 1C1WH 2PUQH 3E16B 1AY6H 3KQDA 1ZZZA 1V6DA 1ZMLA 2GMTB 2PV9B 3GY2A 3MO9A 4IW4E 3TVJB 4AORA 1TLDA 2W7UA 1GHAF 2WPJS 1ZLRA 3BN9A 1BB0B 1C2KA 4WY3A 1BRAA 1UTPA 6LPRA 2F83A 1UK3A 1BTUA 4NSVA 4YM9A 2ZFTA 1DT2A 3SO3A 5DP7A 1KTTB 1PYTD 1YPGH 2VNTA 4Y7AA 3UNRA 1OWDA 4JYTA 7KMEH 2CJIA 3RUOA 2A2XH 1B0EA 2G55A 3GY7A 2PKAA 1O3EA 1NFUA 1K1MA 1CT4E 3SZNA 3VGCC 2ZHFH 1TOCB 2OD3B 4X1SU 5J4SA 1AFEH 4JMYA 2V3HH 1G2MA 3STJA 1GBJA 1GBEA 3ZZCA 3K6ZA 1CO7E 1O3NA 2XC0A 4X1PU 5GCHG 1HJ9A 1K1PA 3LJOA 3GCTF 1YPLH 4D9QA 1PPBH 1O2YA 3LKWA 5DPAA 4M7GA 1FY8E 2DUCA 3BG4B 2PLXA 1Z6EA 3TH2H 2ZO3H 3SJOA 3RXCA 5I46H 4I8HA 1AD8H 1L0ZA 3P8GA 2FM2A 3PWBA 4D8NA 3K65B 4ZXXH 3EE0B 3RXPA 1P02A 1DWEH 2R2MB 5JYIA 3BTME 1N1LA 1P2JA 3RM2H 5EOKA 3GCHC 5LPEA 1D3DB 2QC2A 4FUFA 1N6XA 3VB5A 5T6GA 1AVXA 2FTLE 1TA6A 4X1NU 1SGTA 1SVPA 5EU8A 3VB3A 1PPCE 2BQ6B 4FU8A 4MVNA 4ESTE 1GG6B 2SGPE 3M5OA 2IN2A 2CHAC 4Y0ZE 1TONA 1O3LA 1LVBA 5GXPA 3RXFA 4KTUA 2TGDA 3ZZ5A 2AIQA 1BHXF 4K1SA 5GPIB 1OX1A 1YYY1 2AGIX 2V3OH 4ZAEA 3A87A 3RXUA 3E6PH 2Q6FA 3SQHE 1F5RA 2OLGA 2VU8E 1QQ4A 2W5EA 4VGCB 1FLEE 4ABBA 1V2OT 4FUCA 4Y8ZA 3GISB 2HRVA 3M5LA 1F0SA 3IITA 2A31A 1GJBB 1GMDF 1MTNC 3GCOA 4MG3A 2VGCB 2XRCA 3QZRA 2GTBA 2ZNKH 3SI4H 4B2CA 2Q6GA 3RC4A 3ZVAA 4AGKA 4Q2KA 1O38A 3LGIA 3URCA 4AX9H 1HNEE 1C5QA 5DP9A 7GCHF 1O5BB 4BAQB 5EXMA 3V0XA 3RXTA 4LOYH 1DLEA 2Z94A 1LHCH 1TX6A 1A0HB 2BDHA 3ZZDA 2ODPA 4CR5A 4JZIA 2BLWA 1QBNA 1AWHB 1GI0A 2SGAA 3K2UA 3U8TH 3UR9A 1EJAA 1UHBA 4ZMAH 2SNWA 4FVBA 2TIOA 2FOBA 3SU5A 2BDAA 1K1OA 3LGWA 1GHXH 1ID5H 5F8XA 3IWMA 1TNGA 2OC7A 5LH8A 3SNDA 5LGOA 2RA3A 3LIWA 1KIGH 1ZRKA 2A7JA 2WV5A 3RDZA 4FVDA 2FOAA 1O5GH 4MPUA 2TRMA 4O3UA 2ZPRA 1C1RA 4E05H 1A4WH 5T6DA 1SGEE 4B75A 2VH6A 5EW2H 4E06H 4DOQA 1QBVH 3KL6A 1D6WA 1C1MA 1RRKA 1M9UA 1O2UA 3ZVFA 1C2HA 4KP0A 4X1RU 4NGAH 5GCHF 1V2KT 2WPMS 1VR1H 4WVPE 1FI8A 3T5FH 1DITH 1VCQA 4ZHAA 4TYDA 1IQEA 1DVAH 1EQ9A 1YBWA 1H9IE 2VIOA 1AHTH 1DICA 1NRNH 2BVSH 3F68H 2QF3A 3TNTA 4NCYA 3QTOH 1LKAA 1C5OH 5L2ZH 3UUZA 4KKDA 1LVOA 4MNWA 2F91A 3QLPH 1AIXH 1YCPH 3PTBA 3SORA 5E0JA 2GCTB 1O5CB 2FOHA 2JKHA 4CHAC 1UTNA 4GHTA 1VITG 5LPFA 1O2HA 2EI8A 1SLUB 2P59A 3K6YA 1P0SH 3SU2A 4X6OA 1VCWA 2ZCKP 2UWPA 2ZHWH 1GI5A 1KY9A 3BTDE 1PQ7A 4X2WA 1MKXK 1O3IA 2OUAA 1O2JA 3HKIB 1V2PT 1XUKA 5C20A 2ZFFH 3P92A 3DT0H 1Y59T 3RXAA 3TGIE 4ISLA 1HAPH 1N8OC 1XUHA 2BDIA 3LU9B 4I8GA 1L2EA 1EXFA 3DUXH 1O2OA 1ZTLA 1TALA 5EPYA 4XFQA 5C5OA 3RXGA 4CRFA 1ZTKA 1W7GH 1HLTH 4X2XA 3UTUH 1ELEE 3RXBA 3RXEA 1EZXC 2FZZA 1SGFG 4Y71A 1XKBC 1DSTA 1FY5A 4NIWA 1O37A 5DP6A 4I8LA 5DP3A 1YC0A 4A92A 1VJ9U 4ABHA 2BD7A 1GI7B 1DOJA 2H9EH 3EA9A 1SQAA 4JK5A 2OQ5A 1V2UT 3PLKA 1V2NT 4Z0KA 3SNAA 4KTCA 1P06A 1GGDC 4X8UH 4K1TA 3I77A 1GBAA 3O8RA 4B71A 1TIOA 1GHWH 5I25A 3UR6A 4I7YH 4MNYA 5FBEA 2SGQE 3GY3A 4HTCH 5DKMA 1W10U 3ZV9A 3SV7A 4A1TA 2XCNA 1DWCH 2VIDA 1LDTT 5F8TA 1S83A 4GCHF 1SGPE 1NFYA 3VGCB 2YNAA 1AFQB 1TQ7B 3A8BA 4WMEA 5E0HA 1KLJH 3SOSA 1BJUA 2BLVA 1HJAB 1C1OA 4NIXA 1TGNA 1AB9B 4GVUA 1O3FA 1A0JA 2C8XB 3T62A 3U98H 4JYVH 4UFFH 2HGTH 1RD3B 4H42U 2FWWA 3A84A 2R0LA 3MU4A 1O32A 1GJ9B 2BY8X 2A1DB 1AQ7A 2GZ8A 3O8DA 1W8BH 2ZFPH 1S82A 3M5MA 2VWMA 2ZPQA 4BTUB 1K1NA 4B2AA 1IQNA 2WV4A 4A6LA 1FIWA 2HNTF 2VIVA 4AZ2B 3T29A 2IOTA 1T4UH 3GICB 4O3TA 4SGAE 3BTWE 3QWCH 1MAYA 4ZKNU 3RXSA 3VXFH 1WOFA 2GDEH 4BAMB 1EJNA 1S6HA 1NU7B 1TOMH 3TU7H 2BXTH 4HGCA 1TGCA 2PWXA 3OY5U 2I6SA 4CRAA 3Q3YA 1T31A 3TITA 1O2ZA 1TPOA 3A82A 3K9XB 1SFIA 1VITF 2FIRH 1HXEH 1IQFA 3I78A 1EJMA 1RS0A 1HUTH 1GL0E 3RM0H 2QIQA 1PJPA 4DGJA 4Y7BA 1CT2E 3RXQA 2FEQH 2A5AA 3LC3A 1QTFA 2BLQA 1GMCF 1AKSA 1ELDE 1O2NA 2AS9A 4UFDH 1ELBA 2PGBB 3DHKH 1GI6A 2ZGJA 4K2YA 4UFEH 1P57B 1ESBA 2BLOA 1DE7H 3NPSA 1BTYA 1O2SA 1C2IA 2XCFA 3L3TA 3MH6A 5L2YH 3R3GB 1IQHA 2C8ZB 1KXAA 3FP8E 3ZVEA 1N8OB 2Y81A 2DE8A 3NKKA 1AE5A 1O36A 2BY7X 4AGJA 3RU4T 1P11E 2XNIA 3MU5A 3QGNB 3MNCA 1EATA 3U69H 2G4TA 1GJ4H 1PYTC 3PMBB 1GG6C 1B7XB 1IQJA 2Z9JA 1CBWB 2G00A 1JOUB 3RXVA 4LZ4B 1ZOMA 2PSYA 1G2LA 1J9CH 1GI8B 1OXGA 1TRYA 2F3CE 2VH0A 1GJ7B 3SU6A 3A8CA 3Q77A 2ULLA 1BMNH 3U8RH 1Y5UT 2A0QB 1GBBA 6CHAB 4O9VA 4U32A 1XUIA 4A1XA 2O8LA 1K1IA 1TGSZ 4GLYA 3V13A 1BQYA 1XVMA 1WQSA 3BTHE 4YO9A 1SHHB 3SQEE 4E7RG 1H9HE 5EODA 3VB6A 2NU2E 5BPEA 1B5GH 1DDJA 3BG4C 1EP5A 2AYWA