4MQAA

Human beta-tryptase co-crystal structure with {(1,1,3,3-tetramethyldisiloxane-1,3-diyl)bis[5-(methylsulfanyl)benzene-3,1-diyl]}bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mqaA01
4NWKA 1V2QT 4Y6DA 1GJ9B 4WH8A 4NG9H 4NZQA 3ZV9A 1TBRH 4X2XA 5I25A 4FUBA 1E38B 2TGDA 5JB9S 1HAZB 5TCAA 3SV9A 2ZDLA 1O2RA 2OC1A 1SGTA 2BLQA 5A8XA 4X8SH 2A5KA 3P8OA 2F9VA 2F9OA 1OKXA 3BG4C 2EI7A 1Z8JB 3KN2A 3SI3H 1QBOA 2VJ1A 2C8WB 2B8OH 4DT7B 1GBHA 1A7SA 3E3TA 4ABBA 1W0ZU 4NIWA 4AYVB 1A61H 1GI4A 1W2KH 2GMTC 2A4QA 4ZXXH 1A3EH 1TX7A 2CF9H 3PROA 2A4OA 2ANYA 1GHYH 2BY5X 1O2GH 2ZFQH 3RXBA 2Z9GA 1TNJA 2FX4A 5LPFA 3T28A 2ZGJA 1RGQA 4ZKSU 5DJ7A 5FBEA 3GISB 1Y3XA 1TQ7B 1OP8A 1C4Y2 1V2LT 1QRWA 1KIGH 5EQSA 2WYJA 1NESE 5E0HA 3D62A 1Z8RA 1QA0A 4WMEA 3W94A 2W26A 1HFDA 5A0BA 3MO9A 1DY9A 2KAIB 3LONA 2BDBA 1GGDB 2VIPA 2SGDE 1HJ9A 1GDUA 4IMZA 1FXYA 1ZHMA 3OSYA 4I7YH 3GYMA 1O2LA 1VZQH 3SQHE 2J38A 2XYAA 3MU1A 2H9TH 2GCHF 1NRQH 3EA8A 1GMHF 2BQWB 3UNQA 1Y3VA 2TRMA 1FDPA 2A1DB 1SL3A 3HGNA 5C1YA 2B7DH 5L6NH 1DY8A 1FUJA 1W13U 3ZZ4A 1IQJA 1GMDF 1SQTA 1AY6H 1L1NA 2BHGA 3S7KB 3B9FH 3MH6A 2ZKSA 3TJUA 3BTQE 1YPGH 2HRVA 3G01A 3LJJA 4M7GA 3ZV8A 1GBAA 4MLFB 1GI2A 2C4FH 1QURH 1ZJDA 1ZZZA 4HGCA 2TPIZ 1IQGA 4ABDA 5BRRE 5SGAE 3S7HB 4D7GA 3H7OA 1EZXC 1NU9A 3NXPA 3O8RA 3QX5H 2R3YA 2G00A 1ZMJA 1YP9A 1O2OA 1SVPA 4FUEA 4I32A 4Y71A 3U8TH 3UTUH 2ILNA 1FONA 2BVSH 1C1QA 2BLVA 2O8TA 2J95A 1O5FH 6ESTA 3Q77A 2BY7X 3ZZBA 1UVPA 1V3XA 2ZTYA 7LPRA 4BAQB 1AKSB 4DCDA 2FLRH 3RXEA 1KXDA 2ZZUH 4FUIA 1FY4A 1FPHH 1Y3WA 2QN5T 4INLA 1AGJA 2C93B 4ISOA 2EC9H 1UTMA 1FMGA 4AFUA 2V3OH 4D8NA 2BTCE 1ANEA 1Z6EA 2OD3B 3CENA 2GDDA 1WUNH 3JZ1B 3URCA 2Q6DA 4A1VA 3SJIA 1B7XB 1Z8GA 2J92A 4ZXYH 3A8DA 1O32A 3UIRA 5CHAB 1XUFA 3I78A 1ETRH 3UQOA 2B9LA 1DWEH 1GHAG 1GI3A 1J17T 3DD2H 3VGCC 1IQIA 1NTPA 2J4IA 3RMNH 2XNIA 1O3OA 2FOEA 1MCVA 2FESH 2PKSB 2ZDAH 3T2NA 3D23A 1HAYB 1G36A 8ESTE 1QL7A 5HM2A 4B76A 2FODA 1EP5A 1MU8B 3SUEA 1AQ7A 1T8NA 1HJAB 1Z71A 1BJVA 2NU3E 2UWOA 3ITIA 3KF2A 1QIXB 4GCHG 3RXJA 1YF4A 2QAAA 1HAVA 2PSXA 2VIOA 3CP7A 3PTBA 1JBUH 3PMAB 3ZZ3A 1C5SA 4JMYA 2YNBA 3C27B 2ZHDA 1W7XH 4KGAA 3IG6B 2Y7ZA 1P2OA 3A7XA 3A84A 2OQUA 2GT7A 1G30B 1EB2A 1MH0A 3AAVA 4SGBE 4E05H 1MTSA 1UVOA 4K1EA 4UE7H 1WU1A 2JETB 1MKXH 2C8XB 3SNCA 1GJ4H 1QB6A 1QBNA 1ZSLA 2ZFRH 3LH1A 2VIDA 4ZUHA 1GBIA 1HAIH 1D6WA 2SNWA 1SHHB 4FU7A 1C5MD 2PTNA 2XTTB 1G37A 3K65B 1T4VH 4K8BA 4B71A 2B0FA 1LPGB 3LJOA 1NRPH 3SV8A 5C3NA 2R2MB 1PFXC 1MTVA 1WYKA 5F03A 3STIA 2VWMA 3TVJB 2DUCA 1MTUA 2I6SA 4INKA 1W12U 2F9BH 1D3DB 2BM2A 3GY3A 4ZAEA 1AVWA 4OS1A 1O3MA 2BD5A 3JZ2B 4XE4A 3UR9A 4K3JA 2BDYA 4JYUH 3RLYH 2ZG0H 1NRSH 1TNHA 1YYY1 3VXEH 5LPEA 3BTFE 2HGTH 3K6YA 2ALVA 2B5TB 4K1TA 1TOMH 4MVNA 2ZU3A 1OX1A 2QYIA 3HKJB 4O97A 1CA0C 4Y8ZA 1QBVH 2GDEH 3FAOA 1C5LH 1ELTA 1C5VA 2G5NA 5FCKA 1SLUB 3ZZ5A 5FBIA 1YPMH 1SG8B 4WMFA 3PMHB 3F1SB 8LPRA 1J9CH 1S81A 4BAMB 1A0HB 3M5OA 3MNXA 4CHAB 3CS7A 5IDKA 4LXBH 1TRMA 1GJ8B 1TALA 3F68H 4O3UA 1O2MA 3A88A 5EQRA 3BTTE 1P0SH 3H7TA 3K6ZA 1YPLH 2Z3EA 3KQEA 1GHAF 1O3LA 2BVXH 1DSUA 1MZAA 2BDAA 1BBRE 1FZZA 1LVMA 2OUAA 1LTOA 5C5NA 4GPGA 3RXMA 4JK6A 1P9SA 1GJAB 4A6LA 3UREA 2XC5A 2ANMH 4AFQA 3A7ZA 1DANH 1AFQB 2VINA 4YTAA 2DE8A 1YKTA 4K5ZA 2H5CA 1JRSA 3BN9A 3RXHA 3OTJE 4GCHF 1TRNA 1Y5AT 5FAHA 5JBAS 4ASHA 1J8AA 5LGOA 1VR1H 4WXIA 5DP5A 2R9PA 1G3BA 3LU9B 1G2LA 4NWLA 5GPIB 4AB9A 1BT7A 3RDZA 1EAIA 1O33A 2BOHB 2G8TA 3HKIB 2SNVA 2BD4A 3RMOH 1TE0A 2ZQ2A 5CE1A 1HAPH 1Y3YA 3F9FA 5JDUB 1Z1JA 1PPFE 4YOGA 4NA7A 4CRFA 4LZ1H 1LHCH 1KXCA 5ETXA 5DPAA 2OP9A 3FANA 3U69H 2BZAA 3ODDA 4A92A 1GG6C 2OXSA 3GY6A 1UK3A 2BD9A 2F9UA 2A0QB 1K9OE 1KTSB 1UTNA 1ZTLA 1O2ZA 1TPPA 1TABE 2A7HA 2QXIA 1HBTH 4ABIA 1PQAA 1GBDA 3E8LA 1O36A 4X1QU 1QTFA 3PTNA 3SU1A 4DY7B 4Y7AA 5L2YH 3M7UA 3MTYA 4WH6A 5FPSA 3SORA 4LOYH 2Y5GA 4FXGH 1GCDA 1AO5A 2FMJA 1KLTA 2F91A 1BTUA 3QGJA 3P70B 2UUKB 1QFKH 1CVWH 2ALPA 1FV9A 1UVUH 1CSOE 3KQBA 4FUFA 4IS5A 1ZPBA 3TGJE 3DT0H 1BHXF 1QCPA 3S9BA 5C2ZA 2GKVE 4MPVA 3ZZ8A 1C1RA 4UFGH 1AWHB 1C2GA 1P3EA 4Z6AH 1C5UA 1SGYE 1OWJA 3V13A 1IQLA 3KCGH 1YGCH 1K22H 3FVFB 1BRBE 2AYWA 4DJZB 1MKWK 5DP6A 4ABHA 1BRCE 2ZIQH 1SFQB 1BMAA 2QXHA 1GBLA 3NKKA 1H9HE 1SPJA 3EA7A 3E16B 3LC3A 2BQ7B 5TCCA 1IQKA 1HUTH 3RXTA 4SGAE 1GVKB 2O8WA 4TYDA 3FP7E 4NA9H 1CO7E 1EKBB 1OPHB 2F9NA 1AB9C 1PYTC 1F5RA 4YZUA 3BEUA 1ARBA 4I8KA 3HPTB 1O3JA 1UTOA 1O3KA 3RC6A 4X6PA 3ZZ6A 2VWOA 4HTCH 1U6QA 1ORFA 5E0JA 3VPKA 2VVCA 1D3TB 1NFXA 2ZPSA 3LT3A 1O3BA 1S85A 2HNTF 2VVUA 4ESTE 1F0UA 1AU8A 4RKOB 1P09A 1B0FA 4LK4A 4ZROA 1CGJE 5DP9A 1HAGE 3K2UA 2Z9LA 3A8AA 4KTUA 3U8RH 1BTWA 1TONA 2CV3A 1EQ9A 1UCYE 4FUGA 3URDA 1YPEH 3SGAE 1TRYA 3QGNB 1THSH 1IQMA 2IPHA 3Q3YA 5K7RA 2Y82A 1S0RA 2AS9A 2AIPA 1C2LA 3V3MA 1IOEA 1TX8A 2ZA5A 4Q7ZA 1KY9A 5HGGA 1EZQA 3BIUH 2HALA 3KEEA 1N6YA 2FO9A 3GY2A 1MMJN 5EXMA 2HVXA 1HAVB 2H1UA 2Z6BD 1O2XA 3TK9A 2ODQA 3MI4A 2TIOA 3RXKA 2CN0H 1AZ8A 2IJOB 3GCOA 1YPHC 1GHBF 2ODPA 2P95A 4YESB 2C8ZB 4NFEA 3IWMA 1RIWB 4CREA 2FI4E 2PR3A 3GCHC 2QCYA 2SGQE 1TGNA 3LDXH 2WV4A 4X2VA 1VITG 3HATH 1G3CA 1QRZA 1W0YH 4DIHH 3GYLB 4OGXA 1LQEA 1XKBC 4NIYA 3MH5A 1BZXE 4X8TH 5L2ZH 2GT8A 1EPTC 1IQNA 1FAXA 4A7IB 1YCPM 1ELBA 2FP7B 1MD7A 1UTQA 1QL9A 1MTNC 2ANWA 2XCNA 3MO3A 1Z1IA 4IN1A 4XBDA 1ZR0A 5FX5A 2XCFA 2VIVA 4NFFA 5T6FA 3RXLA 2C90B 3MU0A 1G9IE 1AVGH 1NPMA 2VGCC 4QT8C 4UEHH 2ESTE 3GDVA 5T6DA 5EOKA 1P2JA 1EOLA 3LIWA 1YCPK 2ZGHA 4U01A 1VGCC 2ZGXH 1UTPA 4H6TA 5C5OA 3SHCH 1GBMA 2WYGA 1N8OB 1DWCH 5JBCS 1UTKA 3VB3A 3VB4A 3TGKE 1FY1A 2W7UA 3U1IB 2PV9B 3BTGE 5J4QA 1DOJA 1D3QB 1O5BB 2HWLB 3OY6U 4NGAH 3UY9A 2A5AA 1KTTB 1OP0A 5EPNA 3E0PB 3MU8A 4B2BA 5HXFA 2DE9A 3GY4A 1CQQA 1HXFH 2CHAC 2ZU2A 2OINA 2AIQA 4I33A 2GVFA 4H6SB 5E8EH 1ELGA 1MTWA 2Z3DA 3FFGA 1AWFH 1SGFG 3HK3B 5T6GA 1XUHA 1TFXA 2A2XH 2XWAA 3ZYEA 2ZWLH 4ZHAA 2ZHQH 4Y0ZE 2AGGX 1PPGE 4B75A 3RXOA 3DFLA 1PYTD 1E36B 4DGJA 2GCTC 1T8LA 3TIUA 2IN2A 3QLPH 3CS0A 3PO1C 3Q76A 4AOQA 3UPEA 1BJUA 2G4TA 3A82A 2XBYA 4FUJA 2PUQH 1WQSA 1WV7H 1NFWA 1P9UA 1O2HA 1TNIA 3SUDA 4CH2B 4BXSA 2C8YB 4B1TA 4Y10E 2PFEA 1BQYA 3T27A 4IN2A 5DG6A 4UONA 2A2QH 2ZFFH 3PLPA 1ANDA 1SSXA 1GI5A 1LO6A 2THFB 1C2IA 2FS8A 3VB5A 1UVTH 1GCTC 2PUXB 2UWPA 2AMQA 1P3CA 1F0SA 3A8CA 1MKWH 4X2YA 4FUHA 2PSYA 5ESTE 1UK4A 1AI8H 1VITF 1SQOA 4X6OA 4BTIB 3MH7A 2BX4A 4DW2U 4VGCB 2WPIS 2R0KA 1C5ZB 1DWDH 3O8DA 3L33A 1GDNA 1W8BH 3EDXB 1DSTA 1O3IA 5B6OA 3I77A 4Q80A 2STBE 4JYVH 3F9EA 4DIIH 1KLIH 4MPUA 3TITA 4LZ4B 1P8VC 4WMDA 5EU8A 3RMMH 1C1NA 1A1RA 4X1PU 2WPMS 4JZEH 1HIAA 1QJ7B 1L1GA 1P2MA 9ESTA 1HYLA 1MBQA 1MAYA 4AZ2B 3R0FA 1QB1A 4RSPA 4GVUA 4TY7A 4YO9A 3DUXH 3RXQA 1O37A 3B8JA 3LGTA 1GJ6A 1NS3A 2XBXA 3TH4H 1FJSA 1S6HA 4ISIH 1FN8A 1SI5H 3A7WA 4FUDA 3LKWA 1NO9H 4XFQA 3V7TA 3LGYA 4GHTA 1C5NH 1CA0B 3ZZDA 1O2TA 1O3NA 3ZVDA 1P10A 1QQUA 3GY8A 3DA9B 4K1SA 2XC4A 1GGDC 1GBBA 2H9EH 1JXPA 1SOZA 2VWNA 2Z9KA 1GHXH 1CBWC 1S0QA 3RU4D 3E6PH 1PQ7A 2V35A 1W3CA 2P3TB 3EE0B 1DXWA 2EEKA 1AE5A 1ELAA 1TWXB 2OBOA 1W11U 3A89A 2FI3E 4MTBA 3SBKA 2BD8A 3RXUA 2LPRA 3MYWA 4ABFA 6CHAB 2WV5A 1C1SA 1HGTH 2CMYA 1NT1A 1O2IA 1GL0E 3LC5A 1C1UH 2FPZA 3RXIA 2P3FH 1O5EH 2W3KA 1SR5C 1LPKB 1CT2E 2A45B 4H42U 5C20A 1LCYA 4IMQA 4ZKNU 1UTLM 4I8GA 1QHRB 2P8OB 5C1XA 5TJXA 4IC6A 1OP2A 1W14U 1TPSA 3T25A 3BTDE 4AGJA 1QL8A 3ZZ7A 1VJ9U 1C2JA 4FU9A 4Y8XA 5EW2H 2FLBH 3D49H 1C4U2 1ELFA 5GJ4B 7GCHG 5J4SA 1PPBH 3BEFB 2YOLA 4U32A 1YCPH 4HI3A 4UFEH 2HLCA 3HK6B 3P8NA 1P2QA 3QO6A 4YOIA 2FWWA 5CHAC 1AFEH 1P04A 1YLDA 1C5PA 3M7TA 1BMNH 1HV7A 1O3PB 2V0BA 2VU8E 1SOTA 5DK1A 1V2MT 1JIMA 3ZZ9A 1O3FA 3ZZCA 5C67A 3NCLA 3VEQB 1BRUP 1WQVH 2ODYB 1LHGH 4U30A 2H5DA 4JZDH 2A31A 2AGEX 1QQ4A 4XSKU 3SI4H 4AX9H 2ZDNA 4YT6H 1ETSH 4YOJA 4D7FA 1UK2A 3QWCH 2PKSC 1C4V2 1FN6A 1DUEA 5E2PA 1NFYA 1FAKH 1LQDB 4IGDA 3EQ0H 5T3HA 1F5KU 2FOBA 3M3SA 2FEQH 3A86A 4K60A 3M36A 2W7SA 2FOMB 1HJAC 6GCHG 2PKAA 4K8YA 3UWJH 1C1OA 2SGPE 1J14A 1F7ZA 2RG3A 1S84A 5BPEA 1SGNE 3Q00A 3EAJA 2AERH 3RM2H 1FIZA 1H9LB 3AVZA 3MU5A 3NPSA 1EX3A 3IITA 5ESBA 3PB1E 2IOTA 3RXCA 1KXBA 2ZO3H 2QGRA 4X8UH 1YM0A 1XUKA 2JETC 5GCHG 4BXWA 3V12A 5DO4H 1KYNA 1O5AB 1ZRBA 2FYRA 1D3PB 2Y5HA 3RMLH 1ZYOA 1DWBH 5GDSH 4B74A 1B5GH 3F9GA 4UFDH 1E37B 3SJKA 4ISLA 2Z9JA 1G3DA 2VWLA 3MHWU 4MQAA 1EUFA 2AGIX 1GBEA 1M9UA 1PPHE 1Y8TA 4AFSA 5H4IB 3NK8A 2QC2A 2ZP0H 9LPRA 2BD7A 1UJ1A 4Y7BA 5E2OA 4YM9A 1NRNH 3PWCA 1SQAA 1H1BA 1P57B 1C2KA 2P59A 3PMBB 1TYNA 5GIBA 2G4UA 1XVOA 1KXAA 1O2YA 1O2NA 2BD3A 4A1TA 1OWDA 2A4RA 1EAUA 1EOJA 4FVDA 1JRTA 1DLEA 1RD3B 1VITH 5GWZA 1IQHA 3BTKE 1LKBA 2OCVB 5C1UA 3LOXA 5EXLA 1L2EA 2XBWA 1XX9A 3P8FA 1UVSH 1SLWB 3ENSB 4TPIZ 4MNWA 3OU0A 4JZIA 3ZVGA 1FLEE 7GCHF 2SGEE 4INHA 3PWBA 2O8MA 1DLKB 1ZPZA 4D76A 3F9HA 1HJ8A 2G52A 3U8OH 3ZVBA 4CHAC 1BBRH 3QZRA 1SGEE 2GTBA 1K1MA 4IC5A 4AG1A 1QY6A 3ESTA 1QR3E 3PLBA 4ABEA 1W10U 1B0EA 3UNSA 1N1LA 1T31A 3A80A 4UDWH 5HM9A 1O30A 1MQ5A 3SNBA 2JH5D 3UWIA 1FY5A 1Z6JH 4E06H 3SZNA 1LHFH 3LPRA 3AAUA 3UFAA 5LH8A 1EASA 2NWNA 1BUIA 1L4ZA 2H6MA 4A1XA 5F6MA 1LKAA 2UUJB 1A3BH 2ZFTA 1PPZA 1AUTC 2PGBB 1C5QA 1OOKB 3P6ZB 3AW0A 2I6QA 3QUMP 1AFQC 1ANBA 2QY0B 3NUMA 3A83A 3GCHB 4AORA 2XW9A 4ZHLU 1HLTH 3FP8E 1KDQB 3BIVH 4MNXA 1HDTH 5DP7A 6GCHF 1ANCA 1DX5M 2Z3CA 4ISHH 4JZFH 5GXPA 2NU4E 2R2WU 2ZFSA 3MH4A 2F3CE 3FZZA 4I8HA 1EATA 1XMNB 2P94A 1NROH 3BTWE 2Z9IA 2RA0A 3GOVB 4BAKB 1GJDB 1V2PT 1V2OT 2JH0D 1C5WB 1A5IA 1HPGA 1O2KA 2OBQA 1MCTA 4HZHA 3TNSA 4BANB 1C1WH 1HNEE 4YLUA 1FI8A 4CBNA 1V2NT 2ZCHP 2QV1A 2ZC9H 1WOFA 3BEIB 1HIAB 2Y6TA 1SLVB 3VB7A 3D65E 5GCHF 5EQQA 2Z94A 1TPAE 3TH3H 1LDTT 4R8TB 3UOUA 2V6NA 2VGCB 2SGFE 1SB1H 3TK5A 1AHTH 1A2CH 3RXAA 1J15A 1Y5UT 4NZLA 3SJOA 1ESBA 1NY22 3SNDA 1EXFA 1XVMA 1QJ6B 1V2TT 2RA3A 2G81E 1BTHH 5FXLA 1QGFA 1KXFA 3VXFH 1RJXB 3BG4B 4X1RU 5EPYA 3GICB 3QTVH 4F4OC 1C2DA 1G2MA 3V0XA 1S82A 4Y76A 2ZPRA 3MFJA 1AZZA 3S0NA 3MNCA 4FUCA 1A5HA 2PWXA 1V2JT 2Y7XA 2GMTB 2LNCA 5FCRA 1GMCG 4AFZA 2RDLA 1EZSC 1E35B 1ABJH 1WCZA 3M37A 1SGPE 4RKJB 3SGBE 1ZTJA 4UFFH 1PJPA 4KTCA 3L6PA 1C2EA 1XKAC 1HB0B 2AFQB 2VB0A 2FS9A 2H9HA 2FXRA 1ETTH 1C2FA 2GGVB 2Q6GA 5JBBS 4MPWA 1GMDG 3A7TA 2GZ7A 1G32B 1O2VA 1KXEA 4B2CA 1RTLA 4MDSA 1DS2E 3SU0A 4I8JA 4OS4A 4K2YA 3ATKA 1K28D 2BX3A 1Y59T 1JMOH 1CE5A 1ELEE 1O5CB 3SNAA 3DFJA 3TJNA 4KP0A 1DE7H 3SU5A 1T7CA 1GHWH 1NRRH 2RCEA 1H8DH 2GV7A 3SV6A 1RTKA 2FOHA 1WSSH 2D2DA 1TMBH 3KL6A 3O8BA 1ZLRA 1LVYA 1ZHPA 5EW1H 1NN6A 1BDAA 4PROA 3LH3A 1HRTH 1X7AC 4D9RA 4ABAA 3U1JB 5E0GA 1IHTH 2UWLA 3BF6H 2BLWA 3ATWA 4TWYA 1XXFA 2GX4A 3T62A 3ZYDA 1GCTB 2PGQB 2ZTZA 2HOBA 2C3SA 1QJ1B 2JH6D 1V2WT 3TPIZ 1SLXB 5DP8A 3SGQE 2TGPZ 1W7GH 3MO6A 3M3TA 3SN8A 3RP2A 1L1JA 1XXDA 3E91A 3C1KA 2BDHA 5AHGH 3NWUA 3M5NA 2QXGA 3M7QA 5F8TA 1GJ7B 1TOCB 1DICA 1OSSA 1QRXA 1OWIA 3AW1A 1ZGVA 1P05A 1OXGA 1A0JA 1A0LA 2P16A 7ESTE 3BTME 2EA3A 3HGPA 1TBZH 3EGKH 2BD2A 1UHBB 5AVDA 4NIXA 2A32A 4AN7A 1DVAH 4TY6A 3R3GB 1D4PB 1RRKA 1WAYB 1O35A 1AMHA 5JB8S 2Y5FA 4YLQH 1DUAA 1E0FD 1SGRE 1GWAA 1TGSZ 2K1QA 3TLOA 4DVAU 2PKAB 1AE8H 4Y8YA 1CHOG 1V2VT 1V6DA 4AYYB 2A4GA 3FP6E 3VGCB 4WJG2 5FHTA 2G5VA 1F0RA 1WTHD 2OQ5A 1C5YB 1BTYA 4XOJA 2ZDMA 3E1XB 2ULLA 4RN6A 3VB6A 3M5LA 3M61U 5EXNA 1OWHA 1UO6A 1UTJA 4MNYA 1YLCA 2O8LA 1K1PA 1GJCB 1SGDE 1TA2A 1Q2WA 1K1OA 1RIWC 3T5FH 3P17H 1O3AA 2AMPA 4WXVA 1MD8A 3MNBA 1CBWB 1TQ0B 1ZMLA 2G55A 1GMCF 4GAWA 4FU8A 2ZHEH 2HNTE 5A0AE 1CU1A 1PQ8A 1F0TA 4J1YA 3ELAH 1GVZA 2JKHA 2GV6A 1CT0E 2D1JA 1VCPA 1FY8E 1K21H 2FX6A 4BNRA 1QNJA 1TGBA 1C1TA 2QXJA 4A5TS 2VIWA 1Q31A 1ZMNA 3A87A 2FTMA 3SUFA 3SO3A 1KDQA 2FOCA 2FTLE 1DDJA 3OYPA 3SJ8A 2PW8H 1GHVH 3O8CA 3ATLA 3TJOA 4Z0KA 2D8WA 3P8GA 1GBTA 3U98H 1K1NA 1BTPA 2ZHFH 3BV9B 1IHSH 1EPTA 4KKDA 4F49A 1O3DA 1EP6A 1K1IA 4OS5A 1SMFE 1P11E 4BTUB 1CGIE 2CF8H 4ISNA 1V2UT 1EJMA 1N8OC 2ZCKP 5PTPA 1BIOA 4R0IA 2M5TA 2EI6A 1PPCE 1SFIA 5HYOA 3MOCA 3SV2H 1EZUC 3QK1A 2ANKH 2WPJS 1O5DH 1EJNA 1HAXB 2ZGCA 2VVVA 1BA8B 2ZU5A 1S83A 4ABJA 1GJ5H 1BBRK 4Y79A 1K2I1 4ZKRU 4NIVA 1ZSKA 2ZFPH 1ARCA 1GI8B 2CGAA 1ZRKA 4X6NA 1SBWA 2ZDVH 1A46H 1MU6B 1L0ZA 2O9QA 3KQCA 3S69A 4OS7A 2J94A 5DGJA 1C5TA 5K0HA 4XBBA 3M5MA 2R0LA 2XC0A 4Q7XA 2ZU1A 1DM4B 3EYDA 4DG4A 2A5IA 1INCA 1OWKA 2BDIA 3RXRA 2PLXA 1TA6A 5F8ZA 4THNH 3PLKA 4TWWA 2BDCA 1CHOF 2CXVA 3ATMA 3RXPA 1C2HA 3SW2B 4FVBA 1MZDA 1GPZA 2BDGA 5AF9H 1P2IA 1BCUH 2J9NA 2P3UB 1RXPA 3E90B 3SU6A 1OS8A 1Y5BT 4TPYA 1AN1E 2BVRH 2W3IA 1SHYA 1CHGA 1FNIA 1GL1A 3SOSA 2O8UA 1ZHRA 1O5GH 4U2WA 4X1NU 1YPHE 5DP4A 5FX6A 2J2UA 2UUFB 3GY5A 3MU4A 4Q7YA 1YBWA 1Z7KA 4Q2KA 5HMAA 1FPCH 2GP9B 1ZTKA 1BHXB 4HFPB 2VNTA 2FM2A 3MNSA 2ZPQA 1GI7B 1WBGB 1E34B 1JOUB 4VGCC 3ZVFA 1IQFA 4Y0YE 1GBCA 5DKMA 1ELDE 2ZTXA 1TIOA 2ZGBH 1ZPCA 3A7YA 4KTSA 3M3VA 3ODFA 1NC6A 1H8IH 2F9PA 1O3GA 4WY3A 1LVBA 1SGFA 1Q3XA 1LPZB 2ZCLP 1T8MA 2SFAA 1P02A 1LMWB 1C5XB 3RU4E 2OC7A 1GHZA 3QTOH 4B2AA 4CRDA 1BRAA 2WPHS 3ZVAA 3A81A 2G51A 2WUCA 1ABIH 4XBCA 3SNEA 3F6UH 5EGMA 1EAWA 1GVLA 1D6RA 1TPOA 1GG6B 1ID5H 1TB6H 1O34A 1CGHA 3A85A 1F5LA 2HPPH 4J2YB 1TGCA 1YPJH 2WINI 1GI0A 3P92A 1KSNA 3TGIE 1S6FA 2PHBA 1FQ3A 1OYTH 1O2PA 1MBMA 1GI6A 1UHBA 1PPEE 1ELCA 2FDAA 2ZF0H 1XUJA 1XUIA 1GI1A 4O03A 1JIRA 5L30H 2Y80A 2BZ6H 4X2WA 5FPYA 2R3UA 5A2MH 1ZJKA 1A4WH 4O3TA 1TNKA 2AEIH 1QA7A 2GZ9A 2VH0A 3B23B 1NU7B 2OTVA 2TGAA 1G3EA 3NZIA 2WPKS 2Y81A 1T4UH 1C9TA 1S5SA 4IBLH 1GBFA 3SV7A 3UR6A 3VFEA 2BYAX 1V2RT 4BAHB 3RLWH 3SU3A 2KAIA 2A7JA 4BOHA 4CRGA 3SU2A 5CMXH 1J16A 2QIQA 1P2NA 6CHAC 2BY6X 3DHKH 3Q3KA 1SGIB 3FZDA 3N7OA 5IYTA 2BXUH 3WY8A 5A0CA 5ABWA 3KHVA 2FOFA 1C5OH 1HAHH 1UCYK 3KNXA 3PYHA 3TNTA 1C2MA 3T29A 3KGPA 5F8XA 1Y3UA 2D26C 2HPQH 1LHEH 1MUEB 2FYQA 2P8OC 2XRCA 4MNVA 2AMDA 1AB9B 4KELA 1AUJA 1LHDH 4IW4E 4X0WU 4CR5A 4NSYA 5DP3A 3BTEE 1O2WA 3SU4A 3SJ9A 1K1LA 3UNRA 3K9XB 2H2ZA 1O3HA 1SGCA 3RUOA 2Q6FA 1HXEH 2QF3A 1MAXA 5EODA 3RC4A 1P03A 1A5GH 1O3EA 2BXTH 3UQVA 1O2UA 4CRCA 1C1VH 3EA9A 2F83A 2ZQ1A 1XM1A 2P93A 1DPOA 1BMLA 4GLYA 1AKSA 1CA8B 2W5EA 2CJIA 2XWBI 4CRAA 1RFNA 1NM6A 4GHQA 1DFPA 3UUZA 4OGYA 1DXPA 2GD4B 1O3CA 1VCWA 1BTZA 1O2SA 2YNAA 4GSOA 2FI5E 1HCGA 2NU2E 1GBJA 4XDEA 1AVXA 2BMGB 4JYTA 2TGTA 1GHBG 1YC0A 1ZGIA 5G4BA 4JK5A 2SGAA 3GCTG 3QDZB 2FIRH 3L3TA 1TLDA 1PQ5A 2HNTC 5FPTA 8GCHG 4Y11E 3SQEE 4H4FA 3ZVCA 1UMAH 4NSVA 1IQEA 2ZNKH 4K69A 1C1PA 3U9AH 4CH8B 2ZU4A 3LGVA 1SGQE 1O2QA 1QB9A 4DURA 2BB4A 3KQDA 1NZQH 1RS0A 2NU1E 2XBVA 3GDSA 3QN7A 1HAOH 3PM3A 1TAWA 4ZH8A 3ZZAA 2WPLS 1LVOA 1OWEA 1H4WA 1NFUA 2WUBA 2ASUB 3Q3XA 4GUXA 1BTXA 1THPB 1FIWA 4X6MA 2A7CA 4JCNA 2V3HH 1T32A 3H5CB 3TU7H 1O0DH 1KLJH 4NA8A 1EPTB 3LGIA 2ZEBA 2BQ6B 1MTNB 5AFZH 3M35A 1BB0B 1P01A 3QZQA 1SC8U 2BY9X 1F92A 6LPRA 1P2KA 4X1SU 4D9QA 3P95A 3RXDA 1DITH 4AB8A 3BSQA 1BITA 3TJVA 4ZKOU 4CR9A 2FOAA 2J34A 3A8BA 7KMEH 1O38A 1TMUH 3UOPA 2OLGA 3SUGA 4WWYA 1Z8IB 3LGWA 1L4DA 8KME2 3RXVA 1MQ6A 1VGCB 4OS2A 3MWIU 2NU0E 2Z7FE 1BMMH 2ZHWH 3T26A 3MMGA 5AFYH 3S9CA 1CT4E 1T8OA 1TNGA 4YT7H 1TGTA 1THRH 4OS6A 4UD9H 1C9PA 1RTFB 2UUYA 2AH4X 3RXSA 1GI9B 1TX6A 5A8YA 2XXLA 3RU4T 1GDQA 3W95A 5JBTA 1P06A 3RM0H 4CBOA 3SHAH 5I46H 3PMJA 2ZDKA 4ABGA 2CHAB 1VJAU 1ESTA 1GBKA 3ZVEA 2STAE 3STJA 2GCHG 4WVPE 4WF8A 1GMHG 1ACBE 1F2SE 2TBSA 1FY3A 1DT2A 1GJBB 2VIQA 3AASA 5EG4A 4BAOB 1ZOMA 4AG2A 1C5RA 3RXGA 1TNLA 4I8LA 3LGUA 3TK6A 2Q1JA 4E7NA 3I29A 1TBQH 3PV4A 3OX7U 1WTGH 4DOQA 5A09A 5A8ZA 4AGKA 1ELVA 2BY8X 4E7RG 2GCTB 4JZ1A 4O9VA 3PO1B 4BTTB 2ZI2H 3GCTF 4ZHMU 5LPRA 1MKXK 1AD8H 1K1JA 1AIXH 3KIDU 8GCHF 4MPXA 1EJAA 3S9AA 1D9IA 1O2JA 3OY5U 1IAUA 1VCQA 1C1MA 1H9IE 2QA9E 4B73A 1O39A 3E0NB 1P12E 3GDUA 4ZMAH 1V2ST 1ESAA 4X8VH 3GY7A 2PTCE 1JWTA 2FOGA 2BOKA 2QF0A 2VH6A 2GZ8A 3A7VA 1V2KT 4CRBA 1O31A 1OYQA 1XUGA 1EB1H 1BOQA 3ATIA 4MG3A 4I31A 5JPMH 2FZZA 3BG8A 1TMTH 2OC8A 1EAXA 3GCNA 2OC0A 3RC5A 3RXFA 5JYIA 4NCYA 2EI8A 3TH2H 2BLOA 3BTHE 1UCYH 1YPKH 1ZSJA 2ZECA 1N6XA
chains in the Genus database with same CATH superfamily
4NWKA 1V2QT 4Y6DA 1GJ9B 3PRBA 4WH8A 4NG9H 4NZQA 3ZV9A 1TBRH 4X2XA 5I25A 4FUBA 1E38B 2TGDA 5JB9S 1HAZB 5TCAA 3SV9A 2ZDLA 3PV2A 1O2RA 2OC1A 1SGTA 2BLQA 5A8XA 4X8SH 2A5KA 1W0JD 3P8OA 2F9VA 2F9OA 1OKXA 3BG4C 2EI7A 1Z8JB 3KN2A 3SI3H 1QBOA 2VJ1A 2C8WB 2B8OH 3PRDA 4DT4A 4DT7B 1GBHA 1A7SA 3E3TA 4ABBA 1W0ZU 4NIWA 4AYVB 1A61H 1GI4A 1W2KH 2GMTC 2A4QA 3F0OA 4ZXXH 1A3EH 1TX7A 2CF9H 3PROA 2A4OA 3FN8A 2ANYA 1GHYH 2BY5X 1O2GH 2ZFQH 3RXBA 2Z9GA 1TNJA 2FX4A 5LPFA 3T28A 2ZGJA 1RGQA 4ZKSU 5DJ7A 5FBEA 3GISB 1Y3XA 1TQ7B 1QZ8A 1OP8A 1C4Y2 1V2LT 1QRWA 1KIGH 3F2HA 5EQSA 2WYJA 1NESE 5E0HA 3D62A 1Z8RA 1QA0A 4WMEA 3W94A 2W26A 1HFDA 5A0BA 2KFWA 1DY9A 3MO9A 2KAIB 3LONA 2BDBA 1GGDB 2VIPA 2SGDE 1HJ9A 1GDUA 4IMZA 1FXYA 1ZHMA 3OSYA 4I7YH 5DN6D 1E1QD 3GYMA 1O2LA 1VZQH 3SQHE 2J38A 2XYAA 3MU1A 2H9TH 2GCHF 1NRQH 3EA8A 1GMHF 2BQWB 3UNQA 1Y3VA 2TRMA 1FDPA 2A1DB 1SL3A 3HGNA 5C1YA 2B7DH 5L6NH 1DY8A 1FUJA 2JIZD 2KR7A 1W13U 3ZZ4A 1IQJA 1GMDF 1SQTA 1AY6H 1L1NA 2BHGA 3S7KB 3B9FH 3MH6A 2ZKSA 3TJUA 3BTQE 1YPGH 2HRVA 3G01A 3LJJA 4M7GA 3ZV8A 1GBAA 4MLFB 4Z1MD 1GI2A 2C4FH 1QURH 1ZJDA 1ZZZA 4HGCA 2TPIZ 1IQGA 4ABDA 5BRRE 5SGAE 3S7HB 4D7GA 3H7OA 1EZXC 1NU9A 3NXPA 3O8RA 3QX5H 2R3YA 2G00A 1ZMJA 1YP9A 4XRNA 1O2OA 1SVPA 4FUEA 4I32A 4Y71A 3U8TH 3UTUH 2ILNA 1FONA 2BVSH 1C1QA 2BLVA 2O8TA 2J5UA 2J95A 1O5FH 6ESTA 3Q77A 2BY7X 3ZZBA 1UVPA 1V3XA 2ZTYA 7LPRA 4BAQB 1AKSB 4DCDA 2FLRH 2J98A 3RXEA 1KXDA 2ZZUH 4FUIA 1FY4A 1FPHH 1Y3WA 2QN5T 4INLA 1AGJA 2C93B 4ISOA 2EC9H 1UTMA 1FMGA 4AFUA 2V3OH 4D8NA 2BTCE 1ANEA 1Z6EA 2OD3B 3CENA 2GDDA 1WUNH 3JZ1B 3URCA 2Q6DA 4A1VA 2WSSD 3SJIA 1B7XB 1UW7A 1Z8GA 2J92A 4ZXYH 3A8DA 1O32A 3UIRA 5CHAB 1XUFA 3I78A 1ETRH 3UQOA 2B9LA 1DWEH 1GHAG 1GI3A 1J17T 3DD2H 4F48B 3VGCC 1IQIA 1NTPA 2J4IA 3RMNH 1WDIA 1O3OA 2FOEA 1MCVA 2XNIA 4P00A 2FESH 2KCOA 2PKSB 2ZDAH 3T2NA 3D23A 1HAYB 1G36A 8ESTE 1QL7A 5HM2A 2KM0A 4B76A 2FODA 1EP5A 1MU8B 3SUEA 1AQ7A 1T8NA 1HJAB 1Z71A 1BJVA 2NU3E 2UWOA 2WV9A 3ITIA 3KF2A 1QIXB 4GCHG 3RXJA 1YF4A 2QAAA 1HAVA 2PSXA 2VIOA 3CP7A 3PTBA 1JBUH 3PMAB 3ZZ3A 1C5SA 3OFND 1W0KD 2YNBA 3F2GA 3C27B 4JMYA 2ZHDA 1W7XH 4KGAA 3IG6B 2Y7ZA 1P2OA 3A7XA 3A84A 2OQUA 2GT7A 1G30B 1EB2A 1MH0A 3AAVA 4SGBE 4E05H 1MTSA 1UVOA 4K1EA 2K8IA 4UE7H 1WU1A 2JETB 1MKXH 2C8XB 3SNCA 1GJ4H 1QB6A 1QBNA 1ZSLA 2IJD1 2ZFRH 3LH1A 2VIDA 4ZUHA 1GBIA 1HAIH 1D6WA 2SNWA 1SHHB 4FU7A 1C5MD 1H8ED 2PTNA 2XTTB 1G37A 3DSPA 3K65B 1T4VH 4K8BA 4B71A 2B0FA 1LPGB 3LJOA 3WW7A 1NRPH 3SV8A 5C3NA 2R2MB 1PFXC 1MTVA 1WYKA 5F03A 3STIA 2VWMA 3TVJB 2DUCA 1MTUA 2I6SA 4INKA 1W12U 2F9BH 1D3DB 2BM2A 3GY3A 4ZAEA 1AVWA 4OS1A 1O3MA 2BD5A 3JZ2B 4XE4A 3UR9A 4K3JA 2BDYA 4JYUH 3RLYH 2ZG0H 1NRSH 1TNHA 1YYY1 3VXEH 5LPEA 3BTFE 2HGTH 3K6YA 5F53A 2ALVA 2B5TB 4K1TA 1TOMH 4MVNA 2ZU3A 5EJ1A 1OX1A 2QYIA 3HKJB 3AK5A 3SYJA 4O97A 1CA0C 4Y8ZA 1QBVH 2GDEH 3FAOA 1C5LH 1ELTA 1C5VA 2G5NA 5FCKA 1SLUB 3ZZ5A 5FBIA 1YPMH 1SG8B 4WMFA 3PMHB 3F1SB 8LPRA 1J9CH 1S81A 4BAMB 1A0HB 3M5OA 3MNXA 4CHAB 3CS7A 5IDKA 4LXBH 1TRMA 1GJ8B 1TALA 3F68H 4O3UA 1O2MA 3A88A 5EQRA 3BTTE 1P0SH 3H7TA 3K6ZA 1YPLH 2Z3EA 3KQEA 1GHAF 1O3LA 2BVXH 1YY3A 1DSUA 1MZAA 2BDAA 1BBRE 1FZZA 1LVMA 2OUAA 1LTOA 5C5NA 4TSFD 4GPGA 3RXMA 4JK6A 1P9SA 1GJAB 4A6LA 3UREA 2XC5A 2ANMH 4AFQA 3A7ZA 1DANH 1AFQB 2VINA 2KCYA 4YTAA 2DE8A 1YKTA 4K5ZA 2H5CA 1JRSA 3BN9A 3RXHA 3OTJE 4GCHF 1TRNA 1Y5AT 5FAHA 5JBAS 4ASHA 1J8AA 5LGOA 1VR1H 1YWUA 4WXIA 3ZIAD 3EE7A 5DP5A 2R9PA 1G3BA 3LU9B 1G2LA 4NWLA 5GPIB 4AB9A 1BT7A 3RDZA 1EAIA 1O33A 2BOHB 2G8TA 3HKIB 2SNVA 2BD4A 3RMOH 1TE0A 2ZQ2A 5CE1A 1HAPH 1Y3YA 3F9FA 5JDUB 1Z1JA 1PPFE 4YOGA 4NA7A 4CRFA 4LZ1H 1LHCH 1KXCA 5ETXA 5DPAA 2OP9A 3FANA 3U69H 2BZAA 3ODDA 4A92A 1GG6C 2OXSA 3GY6A 1UK3A 2BD9A 2F9UA 2A0QB 1K9OE 1KTSB 1UTNA 1ZTLA 1O2ZA 1TPPA 1TABE 2A7HA 2QXIA 1HBTH 4ABIA 1PQAA 1GBDA 3E8LA 1O36A 4X1QU 1QTFA 3PTNA 3SU1A 4DY7B 4Y7AA 5L2YH 3M7UA 3MTYA 4WH6A 5FPSA 3SORA 4LOYH 2Y5GA 4FXGH 1GCDA 1AO5A 4Q63A 2FMJA 1KLTA 2F91A 1BTUA 3QGJA 3P70B 1NBMD 2UUKB 1QFKH 1CVWH 2ALPA 1FV9A 1UVUH 1CSOE 3KQBA 4FUFA 4IS5A 1ZPBA 3TGJE 4HG6A 3DT0H 1BHXF 1QCPA 3S9BA 5C2ZA 2GKVE 4MPVA 3ZZ8A 1C1RA 4UFGH 1AWHB 1C2GA 1P3EA 4Z6AH 2AHME 1C5UA 3SZEA 1SGYE 1OWJA 3V13A 1IQLA 3KCGH 3KYFA 1YGCH 1K0HA 1K22H 3FVFB 1BRBE 2AYWA 4DJZB 1MKWK 5DP6A 4ABHA 1BRCE 2ZIQH 1SFQB 1BMAA 2LELA 2QXHA 1GBLA 3NKKA 1H9HE 1SPJA 2KX4A 3EA7A 3E16B 3LC3A 2BQ7B 5TCCA 1IQKA 1HUTH 3RXTA 4SGAE 1GVKB 2HLDD 2O8WA 4TYDA 3FP7E 4NA9H 1CO7E 1EKBB 1OPHB 2F9NA 1AB9C 3OEHD 1PYTC 1F5RA 4YZUA 3BEUA 1ARBA 4I8KA 3HPTB 1O3JA 1UTOA 1O3KA 3RC6A 2EQNA 4X6PA 3ZZ6A 2VWOA 4HTCH 1U6QA 1ORFA 5E0JA 2IPQX 4Q4LA 3VPKA 2VVCA 1D3TB 1NFXA 2ZPSA 3LT3A 1O3BA 1S85A 2HNTF 2VVUA 4ESTE 1F0UA 1AU8A 4RKOB 1P09A 1B0FA 4LK4A 4ZROA 1CGJE 5DP9A 1HAGE 4ZCNA 3K2UA 2Z9LA 3A8AA 4KTUA 3U8RH 1BTWA 1TONA 2CV3A 1EQ9A 1UCYE 4FUGA 3URDA 1YPEH 3SGAE 1TRYA 3QGNB 1THSH 1IQMA 2IPHA 3Q3YA 5K7RA 2Y82A 1S0RA 2AS9A 2AIPA 1C2LA 3V3MA 1IOEA 1TX8A 2ZA5A 4Q7ZA 1KY9A 5HGGA 1EZQA 3BIUH 2HALA 3KEEA 1N6YA 2FO9A 3GY2A 1MMJN 5EXMA 2HVXA 1HAVB 2H1UA 2Z6BD 1O2XA 3TK9A 2ODQA 3MI4A 2TIOA 3RXKA 2CN0H 1AZ8A 2IJOB 3GCOA 1YPHC 1GHBF 2ODPA 2P95A 4YESB 2C8ZB 4NFEA 3IWMA 1RIWB 4CREA 2FI4E 2PR3A 3GCHC 1E1RD 2QCYA 2SGQE 1TGNA 3LDXH 2WV4A 4X2VA 1VITG 3HATH 1G3CA 1QRZA 1W0YH 4DIHH 3GYLB 4OGXA 3W1EA 1LQEA 1XKBC 4NIYA 4XD7D 3MH5A 1BZXE 4X8TH 5L2ZH 2GT8A 1EPTC 5CHBA 1IQNA 1FAXA 4A7IB 1VKYA 1YCPM 1ELBA 2FP7B 1MD7A 1UTQA 1QL9A 1MTNC 2ANWA 2XCNA 3MO3A 1Z1IA 4IN1A 4XBDA 5KGOA 1ZR0A 5FX5A 2XCFA 2VIVA 4NFFA 5T6FA 3RXLA 2C90B 3MU0A 1G9IE 1AVGH 3PV5A 1NPMA 2VGCC 4QT8C 4UEHH 2ESTE 3GDVA 5T6DA 5EOKA 1P2JA 1EOLA 3LIWA 1YCPK 2ZGHA 4U01A 2KCAA 1VGCC 2ZGXH 1UTPA 4H6TA 5C5OA 3SHCH 5KEDA 1GBMA 2WYGA 5C17A 1N8OB 1DWCH 5JBCS 1UTKA 3VB3A 3VB4A 3TGKE 1FY1A 2W7UA 3U1IB 2PV9B 3BTGE 5J4QA 1DOJA 1D3QB 1O5BB 2HWLB 3OY6U 4NGAH 5GNDA 3UY9A 2A5AA 1KTTB 1OP0A 5EPNA 3E0PB 3MU8A 4ACBA 4B2BA 5HXFA 2DE9A 3GY4A 1CQQA 1HXFH 2CHAC 2ZU2A 2OINA 2AIQA 4I33A 2GVFA 4RI0A 4H6SB 5E8EH 3VG8A 1ELGA 1MTWA 2Z3DA 3FFGA 1AWFH 1SGFG 3HK3B 5T6GA 1XUHA 1TFXA 2A2XH 2XWAA 3ZYEA 2ZWLH 2RFKC 3DSOA 4ZHAA 2ZHQH 4Y0ZE 2AGGX 1PPGE 4B75A 3RXOA 3DFLA 1PYTD 4FETA 1E36B 4DGJA 2GCTC 1T8LA 3TIUA 2IN2A 3QLPH 3CS0A 3PO1C 3Q76A 4AOQA 3UPEA 1BJUA 2G4TA 3A82A 2XBYA 4FUJA 2PUQH 1WQSA 1WV7H 1NFWA 1P9UA 2L74A 1O2HA 1TNIA 3SUDA 4CH2B 4BXSA 2C8YB 4B1TA 4Y10E 2PFEA 1BQYA 3T27A 4IN2A 5DG6A 4UONA 2A2QH 2ZFFH 3PLPA 1ANDA 1SSXA 1GI5A 1LO6A 2THFB 1C2IA 2FS8A 3VB5A 1UVTH 1GCTC 2PUXB 2UWPA 2AMQA 1P3CA 1F0SA 3A8CA 1MKWH 4X2YA 4FUHA 2PSYA 5ESTE 1UK4A 1AI8H 1VITF 1SQOA 4X6OA 4BTIB 3MH7A 2BX4A 4DW2U 4VGCB 2WPIS 2R0KA 1C5ZB 1DWDH 1BMFD 3O8DA 3L33A 1GDNA 1W8BH 3EDXB 1DSTA 1O3IA 5B6OA 3FKSD 3I77A 4Q80A 2STBE 4JYVH 3F9EA 4DIIH 1KLIH 4MPUA 3TITA 4LZ4B 1P8VC 4WMDA 5EU8A 3RMMH 1C1NA 1A1RA 4X1PU 2WPMS 4JZEH 1HIAA 1QJ7B 1L1GA 1P2MA 9ESTA 1HYLA 1MBQA 1MAYA 4AZ2B 3CNRA 3R0FA 1QB1A 4RSPA 4GVUA 4TY7A 4YO9A 3DUXH 3RXQA 4RT1A 3OAAD 1O37A 3B8JA 3LGTA 1GJ6A 2YMSB 1NS3A 2XBXA 4F55A 2PP6A 3TH4H 1FJSA 1S6HA 3NRLA 5DSFA 4ISIH 1FN8A 1SI5H 3A7WA 4FUDA 3LKWA 1NO9H 4XFQA 3V7TA 3LGYA 4GHTA 1C5NH 1CA0B 3ZZDA 1O2TA 1O3NA 3ZVDA 1P10A 1QQUA 3GY8A 3DA9B 4K1SA 2XC4A 1GGDC 1GBBA 2H9EH 1JXPA 1SOZA 2VWNA 2Z9KA 1GHXH 1CBWC 1S0QA 3RU4D 4B6FA 3E6PH 1PQ7A 2V35A 1W3CA 2P3TB 3EE0B 1DXWA 2EEKA 1AE5A 1ELAA 4M9FA 1TWXB 2OBOA 1W11U 3F3BA 3A89A 3N7DA 2FI3E 4MTBA 3SBKA 2BD8A 3RXUA 2KCPA 2LPRA 3MYWA 4ABFA 6CHAB 2WV5A 1C1SA 1HGTH 2CMYA 1NT1A 1O2IA 1GL0E 3LC5A 1C1UH 2FPZA 3RXIA 2P3FH 1O5EH 2W3KA 1SR5C 1FX0B 1LPKB 1CT2E 2A45B 4H42U 5C20A 1LCYA 4IMQA 4ZKNU 1UTLM 4I8GA 1QHRB 2P8OB 5C1XA 5TJXA 4IC6A 1OP2A 1W14U 1TPSA 3T25A 3BTDE 4AGJA 1QL8A 3ZZ7A 3FOAA 1VJ9U 1C2JA 4FU9A 4Y8XA 5EW2H 2FLBH 3D49H 3F2FA 1C4U2 1ELFA 5GJ4B 7GCHG 5J4SA 1PPBH 3BEFB 2YOLA 4U32A 1YCPH 4HI3A 4UFEH 2HLCA 3HK6B 3P8NA 1P2QA 3QO6A 4YOIA 2FWWA 5CHAC 1AFEH 1P04A 1YLDA 1C5PA 3M7TA 1BMNH 1HV7A 1O3PB 2V0BA 2VU8E 1SOTA 5DK1A 1V2MT 1JIMA 3ZZ9A 1O3FA 3ZZCA 5C67A 3NCLA 3VEQB 1BRUP 1WQVH 2ODYB 1LHGH 2HVYB 4U30A 2H5DA 4JZDH 2A31A 2AGEX 1QQ4A 4XSKU 3SI4H 4AX9H 2ZDNA 4YT6H 1ETSH 4YOJA 4D7FA 1UK2A 3QWCH 2PKSC 1C4V2 1FN6A 1DUEA 5E2PA 1NFYA 1FAKH 1LQDB 4IGDA 3EQ0H 5T3HA 1F5KU 2FOBA 3M3SA 2FEQH 3A86A 4K60A 3M36A 2W7SA 2FOMB 1HJAC 6GCHG 2PKAA 4K8YA 3UWJH 1C1OA 2SGPE 1J14A 1F7ZA 2RG3A 1S84A 5BPEA 1SGNE 3Q00A 3EAJA 2AERH 3RM2H 1FIZA 2J97A 1H9LB 3AVZA 3MU5A 2RDEA 3NPSA 1EX3A 3IITA 5ESBA 3PB1E 2IOTA 3RXCA 1KXBA 2ZO3H 2QGRA 4X8UH 2F4LA 1YM0A 1XUKA 2JETC 5GCHG 4BXWA 3V12A 5DO4H 1KYNA 1O5AB 1ZRBA 2FYRA 1D3PB 2Y5HA 3RMLH 1ZYOA 1DWBH 5GDSH 4B74A 1B5GH 3F9GA 4UFDH 1E37B 3SJKA 4ISLA 2Z9JA 3DSGA 1G3DA 2VWLA 3MHWU 4MQAA 1EUFA 4ASUD 2AGIX 1GBEA 1M9UA 1PPHE 1Y8TA 4AFSA 5H4IB 3NK8A 2QC2A 2ZP0H 3F0PA 2BD7A 9LPRA 1UJ1A 4Y7BA 5E2OA 4YM9A 1NRNH 3PWCA 1SQAA 1H1BA 3WWFA 1P57B 1C2KA 2P59A 3PMBB 1TYNA 5GIBA 2G4UA 1XVOA 1KXAA 1O2YA 5EJZA 1O2NA 2BD3A 4A1TA 1OWDA 2A4RA 1EAUA 1EOJA 4FVDA 1JRTA 2OK5A 1DLEA 1RD3B 1VITH 5GWZA 1IQHA 3BTKE 1LKBA 2OCVB 5C1UA 3LOXA 5EXLA 1L2EA 2XBWA 1XX9A 3P8FA 1UVSH 1SLWB 2XNDD 3ENSB 4TPIZ 4MNWA 3OU0A 4JZIA 3ZVGA 1FLEE 7GCHF 2SGEE 4INHA 3PWBA 2O8MA 1DLKB 1ZPZA 4D76A 3F9HA 1HJ8A 2G52A 3U8OH 3ZVBA 4CHAC 1BBRH 4P02A 3QZRA 1SGEE 2GTBA 1K1MA 4IC5A 4AG1A 1QY6A 3ESTA 1QR3E 3PLBA 4ABEA 1W10U 1B0EA 3UNSA 1N1LA 1T31A 3A80A 4UDWH 5EIYA 5HM9A 1O30A 1MQ5A 3SNBA 2KZ4A 2JH5D 3UWIA 1FY5A 1Z6JH 4E06H 3SZNA 1LHFH 3LPRA 3AAUA 3UFAA 5LH8A 1EASA 2NWNA 1BUIA 1L4ZA 2H6MA 4A1XA 5F6MA 1LKAA 2UUJB 1A3BH 2ZFTA 1PPZA 1AUTC 2PGBB 1C5QA 1OOKB 3P6ZB 5FL7D 3AW0A 2I6QA 3QUMP 1AFQC 1ANBA 2QY0B 3NUMA 3A83A 3GCHB 4AORA 2XW9A 4ZHLU 1HLTH 3FP8E 1KDQB 3BIVH 4MNXA 1HDTH 5DP7A 6GCHF 1ANCA 1DX5M 2Z3CA 4ISHH 4JZFH 5GXPA 2NU4E 2R2WU 2ZFSA 3MH4A 2F3CE 3FZZA 4I8HA 1EATA 1XMNB 2P94A 1NROH 3BTWE 2Z9IA 2RA0A 3GOVB 4BAKB 1GJDB 1V2PT 1V2OT 2GJGA 2JH0D 1C5WB 1A5IA 1HPGA 1O2KA 2OBQA 1MCTA 4HZHA 3TNSA 4BANB 1C1WH 1HNEE 4YLUA 1FI8A 4CBNA 1V2NT 2ZCHP 2QV1A 2ZC9H 1WOFA 3BEIB 1HIAB 2Y6TA 1SLVB 3VB7A 3D65E 5GCHF 5EQQA 2Z94A 2XOKD 1TPAE 3TH3H 1LDTT 4R8TB 3UOUA 2V6NA 2VGCB 2SGFE 1SB1H 3TK5A 1AHTH 1A2CH 1E79D 3RXAA 1J15A 1Y5UT 4NZLA 3SJOA 1NBME 1ESBA 1NY22 3SNDA 1EXFA 1XVMA 1QJ6B 2JDID 1V2TT 2RA3A 2G81E 1BTHH 5FXLA 1QGFA 1KXFA 3VXFH 1RJXB 3BG4B 4X1RU 5EPYA 3GICB 3QTVH 4F4OC 1C2DA 1G2MA 3V0XA 1S82A 4Y76A 2ZPRA 3DCLA 3MFJA 1AZZA 3S0NA 3MNCA 4FUCA 1A5HA 2PWXA 1V2JT 2Y7XA 2GMTB 4OM9A 3UB0A 2LNCA 5FCRA 1GMCG 4AFZA 2RDLA 1EZSC 1E35B 4AC9A 2V7QD 1ABJH 1WCZA 3M37A 1SGPE 4RKJB 3SGBE 1ZTJA 4UFFH 1PJPA 4KTCA 3L6PA 1C2EA 1XKAC 1HB0B 2AFQB 2VB0A 2FS9A 2H9HA 2FXRA 1ETTH 1C2FA 2GGVB 2Q6GA 5JBBS 4MPWA 1GMDG 3A7TA 2GZ7A 1G32B 3MQKC 1O2VA 1KXEA 4B2CA 1RTLA 4MDSA 1DS2E 3SU0A 4I8JA 4OS4A 4K2YA 3ATKA 1K28D 2BX3A 1Y59T 4YXWD 1JMOH 1CE5A 1ELEE 1O5CB 3SNAA 3DFJA 3TJNA 2WPDD 4KP0A 1DE7H 3SU5A 1T7CA 1GHWH 3KYGA 1NRRH 2RCEA 1H8DH 2GV7A 3SV6A 1RTKA 2FOHA 1WSSH 2D2DA 1TMBH 3KL6A 3O8BA 1ZLRA 1LVYA 1ZHPA 5EW1H 1NN6A 1BDAA 4PROA 3LH3A 1HRTH 1X7AC 4D9RA 4ABAA 3U1JB 5E0GA 1IHTH 2UWLA 3BF6H 2BLWA 3ATWA 4TWYA 1XXFA 2GX4A 3T62A 3ZYDA 1GCTB 2PGQB 2ZTZA 2HOBA 2CK3D 2C3SA 1QJ1B 2JH6D 1V2WT 3TPIZ 1SLXB 5DP8A 3SGQE 2TGPZ 1W7GH 3MO6A 3M3TA 3SN8A 3RP2A 1L1JA 1XXDA 3E91A 3C1KA 2BDHA 5AHGH 3NWUA 3M5NA 2QXGA 3M7QA 5F8TA 1GJ7B 1TOCB 1DICA 1OSSA 4RT0A 5HKKD 1QRXA 1OWIA 2W6ID 3AW1A 1ZGVA 1P05A 1OXGA 1A0JA 1A0LA 2P16A 7ESTE 3BTME 2EA3A 3HGPA 1TBZH 3EGKH 2BD2A 1UHBB 5AVDA 4NIXA 2A32A 4AN7A 1DVAH 4TY6A 3R3GB 1D4PB 1RRKA 1WAYB 1O35A 1AMHA 5JB8S 2W6JD 2Y5FA 4YLQH 1DUAA 1E0FD 1SGRE 1GWAA 1TGSZ 2K1QA 3TLOA 4DVAU 2PKAB 1AE8H 4Y8YA 1CHOG 1V2VT 1V6DA 4AYYB 2A4GA 3FP6E 3VGCB 4WJG2 5FHTA 2G5VA 3OTPA 2F43B 1F0RA 1WTHD 2OQ5A 1C5YB 1BTYA 4XOJA 3UAIC 2ZDMA 3E1XB 2ULLA 4RN6A 3VB6A 3M5LA 3M61U 5EXNA 1OWHA 1UO6A 1UTJA 4MNYA 1YLCA 2O8LA 1K1PA 1GJCB 1SGDE 1TA2A 1Q2WA 1K1OA 1RIWC 3T5FH 3P17H 1O3AA 2AMPA 4WXVA 1MD8A 3MNBA 4B6EA 1CBWB 1TQ0B 1ZMLA 2G55A 1GMCF 4GAWA 4FU8A 2ZHEH 2HNTE 5A0AE 1CU1A 1PQ8A 1F0TA 4J1YA 2WZQA 3ELAH 1GVZA 2JKHA 2GV6A 1CT0E 2D1JA 1VCPA 1FY8E 1K21H 2FX6A 4BNRA 1QNJA 1TGBA 1C1TA 2QXJA 4A5TS 2VIWA 3N99A 1Q31A 1ZMNA 3A87A 2FTMA 3SUFA 3SO3A 1KDQA 2FOCA 2FTLE 1DDJA 3OYPA 3OEED 3SJ8A 2PW8H 1GHVH 3O8CA 3ATLA 3TJOA 4Z0KA 2D8WA 3P8GA 4ACAA 1GBTA 3U98H 1K1NA 1BTPA 2ZHFH 3BV9B 1IHSH 1EPTA 4KKDA 4F49A 1O3DA 1EP6A 1K1IA 4OS5A 2VBCA 1SMFE 1P11E 4BTUB 1CGIE 2CF8H 4ISNA 1MABB 1V2UT 1EJMA 1N8OC 2ZCKP 5PTPA 1BIOA 4R0IA 2M5TA 2EI6A 1PPCE 1EFRD 1SFIA 1SQRA 3MOCA 3SV2H 5HYOA 1EZUC 3QK1A 2ANKH 2WPJS 1O5DH 1EJNA 1HAXB 2ZGCA 2M2AA 2VVVA 1BA8B 2ZU5A 1S83A 4ABJA 1GJ5H 1BBRK 4Y79A 1K2I1 4ZKRU 4NIVA 1ZSKA 2ZFPH 1ARCA 1GI8B 2CGAA 1ZRKA 4X6NA 1SBWA 2ZDVH 1A46H 1MU6B 1L0ZA 2O9QA 3KQCA 3S69A 4OS7A 2J94A 5DGJA 1C5TA 5K0HA 3WWBA 4XBBA 3M5MA 2R0LA 2XC0A 4Q7XA 2ZU1A 3KQ5A 1DM4B 3EYDA 4DG4A 2A5IA 1INCA 1OWKA 2BDIA 3RXRA 2PLXA 1TA6A 5F8ZA 4THNH 3PLKA 4TWWA 2BDCA 1CHOF 2CXVA 3ATMA 3RXPA 1C2HA 3SW2B 4FVBA 1MZDA 1GPZA 2BDGA 5AF9H 1P2IA 1BCUH 2J9NA 2P3UB 1RXPA 3E90B 3SU6A 1OS8A 1Y5BT 4TPYA 1AN1E 2BVRH 2W3IA 1SHYA 1CHGA 1FNIA 1GL1A 3SOSA 2O8UA 1ZHRA 1O5GH 4U2WA 4X1NU 1YPHE 5DP4A 5FX6A 3FO8D 2J2UA 2UUFB 3GY5A 3MU4A 4Q7YA 1YBWA 1Z7KA 4Q2KA 5HMAA 1FPCH 2GP9B 1ZTKA 1BHXB 4HFPB 2VNTA 2FM2A 3MNSA 2ZPQA 1GI7B 1WBGB 1E34B 1JOUB 4VGCC 3ZVFA 1IQFA 4Y0YE 1GBCA 5DKMA 1ELDE 2ZTXA 1TIOA 2ZGBH 1ZPCA 2EY4C 3A7YA 4KTSA 3M3VA 3ODFA 1NC6A 1H8IH 2F9PA 1O3GA 2QE7D 4WY3A 1LVBA 1SGFA 1Q3XA 2QF5A 1LPZB 2ZCLP 1T8MA 2SFAA 1P02A 1SKYE 4FOUC 1LMWB 1C5XB 3RU4E 5C94A 2OC7A 1GHZA 3QTOH 4B2AA 4CRDA 1BRAA 2WPHS 3ZVAA 3A81A 2G51A 2WUCA 1ABIH 4XBCA 3SNEA 3F6UH 5EGMA 1EAWA 1GVLA 1D6RA 1TPOA 1GG6B 1ID5H 1TB6H 1O34A 1CGHA 3A85A 1F5LA 2HPPH 4J2YB 1TGCA 1YPJH 2WINI 1GI0A 3P92A 1KSNA 3TGIE 1S6FA 2YMSC 2PHBA 1FQ3A 1OYTH 1O2PA 1MBMA 1GI6A 1UHBA 5C0UA 1PPEE 1ELCA 2FDAA 2ZF0H 1XUJA 3GS9A 2V3MA 1XUIA 1GI1A 5CDFE 4O03A 1JIRA 5L30H 2Y80A 2BZ6H 4X2WA 5FPYA 2R3UA 5A2MH 1ZJKA 1A4WH 4O3TA 1TNKA 2QF4A 2AEIH 1QA7A 2GZ9A 2VH0A 3B23B 1NU7B 2OTVA 2TGAA 1G3EA 3NZIA 2WPKS 2Y81A 1T4UH 1C9TA 1S5SA 4IBLH 1GBFA 3SV7A 3UR6A 3VFEA 2BYAX 1V2RT 4BAHB 3RLWH 3SU3A 2KAIA 2A7JA 4BOHA 4CRGA 3SU2A 5CMXH 1J16A 2QIQA 1P2NA 6CHAC 2BY6X 3DHKH 3Q3KA 1SGIB 3FZDA 3N7OA 5IYTA 2BXUH 3WY8A 5A0CA 5ABWA 3KHVA 2FOFA 1C5OH 1HAHH 1UCYK 5C0TA 3KNXA 3PYHA 3TNTA 1C2MA 3T29A 3KGPA 5HIZA 5F8XA 1Y3UA 2D26C 2HPQH 1LHEH 1MUEB 2FYQA 2P8OC 2XRCA 4MNVA 2AMDA 1AB9B 4KELA 1AUJA 1LHDH 4IW4E 4X0WU 4CR5A 4NSYA 5DP3A 3BTEE 1O2WA 3SU4A 3SJ9A 2LP6A 1K1LA 3UNRA 3K9XB 2H2ZA 1O3HA 1SGCA 3RUOA 1S6LA 2Q6FA 1HXEH 2QF3A 1MAXA 5EODA 3RC4A 1P03A 1A5GH 1O3EA 2BXTH 3UQVA 1O2UA 4CRCA 1C1VH 4I86A 3EA9A 2F83A 2ZQ1A 1XM1A 2P93A 1DPOA 1BMLA 4GLYA 1AKSA 1CA8B 2W5EA 2CJIA 2XWBI 4CRAA 1RFNA 1NM6A 4GHQA 1DFPA 3UUZA 4OGYA 1DXPA 2GD4B 1O3CA 1VCWA 1BTZA 1O2SA 2YNAA 4GSOA 2FI5E 1HCGA 2NU2E 1GBJA 4XDEA 1AVXA 2BMGB 4JYTA 2TGTA 1GHBG 1YC0A 1ZGIA 5G4BA 4JK5A 2SGAA 3GCTG 3QDZB 2FIRH 3L3TA 1TLDA 1PQ5A 1H8HD 2HNTC 5FPTA 8GCHG 4Y11E 3SQEE 4H4FA 3ZVCA 1UMAH 4NSVA 1IQEA 2ZNKH 4K69A 1C1PA 3U9AH 4CH8B 2JJ1D 2ZU4A 3LGVA 1SGQE 1O2QA 1QB9A 4DURA 2BB4A 3KQDA 1NZQH 1RS0A 2NU1E 2WHXA 2XBVA 3GDSA 3QN7A 1HAOH 1WXRA 3PM3A 1TAWA 4ZH8A 3ZZAA 2WPLS 1LVOA 1OHHD 1OWEA 1H4WA 1NFUA 2WUBA 2ASUB 3Q3XA 4GUXA 3OE7D 1BTXA 1THPB 1FIWA 1KMHB 4X6MA 2A7CA 4JCNA 2V3HH 1T32A 3H5CB 3TU7H 1O0DH 1KLJH 4NA8A 1EPTB 3LGIA 2ZEBA 2BQ6B 1COWD 1MTNB 5AFZH 3M35A 1BB0B 1P01A 3QZQA 1SC8U 2BY9X 1F92A 6LPRA 5KECA 1P2KA 4X1SU 4D9QA 3P95A 3RXDA 5EJLA 1DITH 4AB8A 2YMSD 3BSQA 3H09A 1BITA 3TJVA 4ZKOU 4CR9A 2FOAA 2J34A 3A8BA 7KMEH 1O38A 1TMUH 2J98B 3UOPA 2OLGA 3SUGA 4WWYA 1Z8IB 3LGWA 1L4DA 2L6OA 8KME2 3RXVA 1MQ6A 1VGCB 4OS2A 3MWIU 2NU0E 2Z7FE 5B6LA 1BMMH 2ZHWH 3T26A 3MMGA 5AFYH 3S9CA 1CT4E 1T8OA 1TNGA 4YT7H 1TGTA 1THRH 4OS6A 2JJ2D 4UD9H 1C9PA 1RTFB 2UUYA 2AH4X 3RXSA 1GI9B 1TX6A 5A8YA 2XXLA 3RU4T 1GDQA 3W95A 5JBTA 1P06A 3RM0H 4CBOA 3SHAH 5I46H 3PMJA 2ZDKA 4ABGA 2CHAB 1VJAU 1ESTA 1GBKA 3ZVEA 2STAE 3STJA 3U28C 2GCHG 4WVPE 4WF8A 1GMHG 1ACBE 1F2SE 2TBSA 1FY3A 1DT2A 1GJBB 2VIQA 3AASA 5EG4A 4BAOB 1ZOMA 4AG2A 1C5RA 3RXGA 1TNLA 4I8LA 5IK2D 3LGUA 3TK6A 2Q1JA 4E7NA 5HIYA 3I29A 1TBQH 3PV4A 3OX7U 1WTGH 4DOQA 5A09A 5A8ZA 4AGKA 1ELVA 2BY8X 5T1VA 4E7RG 4TT3D 2GCTB 4JZ1A 4O9VA 3PO1B 4BTTB 2ZI2H 3GCTF 4ZHMU 5LPRA 1MKXK 1AD8H 1K1JA 1AIXH 1YLNA 3KIDU 8GCHF 4MPXA 1EJAA 3S9AA 1D9IA 1O2JA 3OY5U 1IAUA 1VCQA 1C1MA 1H9IE 2QA9E 4B73A 1O39A 3E0NB 1P12E 3GDUA 4ZMAH 1V2ST 2K0QA 1ESAA 4X8VH 3GY7A 2PTCE 1JWTA 2FOGA 2BOKA 2QF0A 2VH6A 2GZ8A 3N7EA 3A7VA 1V2KT 4CRBA 1O31A 1OYQA 1XUGA 1EB1H 1BOQA 3ATIA 4MG3A 4I31A 5JPMH 2FZZA 3BG8A 1TMTH 2OC8A 1EAXA 3GCNA 2OC0A 3RC5A 3RXFA 5JYIA 4NCYA 2EI8A 3TH2H 2BLOA 3BTHE 1UCYH 1YPKH 1ZSJA 2ZECA 1N6XA
chains in the Genus database with same CATH topology
4NWKA 1V2QT 4Y6DA 1GJ9B 4WH8A 4NG9H 4NZQA 3ZV9A 1TBRH 4X2XA 5I25A 4FUBA 1E38B 2TGDA 5JB9S 1HAZB 5TCAA 3SV9A 2ZDLA 1O2RA 2OC1A 1SGTA 2BLQA 5A8XA 4X8SH 2A5KA 3P8OA 2F9VA 2F9OA 1OKXA 3BG4C 2EI7A 1Z8JB 3KN2A 3SI3H 1QBOA 2VJ1A 2C8WB 2B8OH 4DT7B 1GBHA 1A7SA 3E3TA 4ABBA 1W0ZU 4NIWA 4AYVB 1A61H 1GI4A 1W2KH 2GMTC 2A4QA 4ZXXH 1A3EH 1TX7A 2CF9H 3PROA 2A4OA 2ANYA 1GHYH 2BY5X 1O2GH 2ZFQH 3RXBA 2Z9GA 1TNJA 2FX4A 5LPFA 3T28A 2ZGJA 1RGQA 4ZKSU 5DJ7A 5FBEA 3GISB 1Y3XA 1TQ7B 1OP8A 1C4Y2 1V2LT 1QRWA 1KIGH 5EQSA 2WYJA 1NESE 5E0HA 3D62A 1Z8RA 1QA0A 4WMEA 3W94A 2W26A 1HFDA 5A0BA 3MO9A 1DY9A 2KAIB 3LONA 2BDBA 1GGDB 2VIPA 2SGDE 1HJ9A 1GDUA 4IMZA 1FXYA 1ZHMA 3OSYA 4I7YH 3GYMA 1O2LA 1VZQH 3SQHE 2J38A 2XYAA 3MU1A 2H9TH 2GCHF 1NRQH 3EA8A 1GMHF 2BQWB 3UNQA 1Y3VA 2TRMA 1FDPA 2A1DB 1SL3A 3HGNA 5C1YA 2B7DH 5L6NH 1DY8A 1FUJA 1W13U 3ZZ4A 1IQJA 1GMDF 1SQTA 1AY6H 1L1NA 2BHGA 3S7KB 3B9FH 3MH6A 2ZKSA 3TJUA 3BTQE 1YPGH 2HRVA 3G01A 3LJJA 4M7GA 3ZV8A 1GBAA 4MLFB 1GI2A 2C4FH 1QURH 1ZJDA 1ZZZA 4HGCA 2TPIZ 1IQGA 4ABDA 5BRRE 5SGAE 3S7HB 4D7GA 3H7OA 1EZXC 1NU9A 3NXPA 3O8RA 3QX5H 2R3YA 2G00A 1ZMJA 1YP9A 1O2OA 1SVPA 4FUEA 4I32A 4Y71A 3U8TH 3UTUH 2ILNA 1FONA 2BVSH 1C1QA 2BLVA 2O8TA 2J95A 1O5FH 6ESTA 3Q77A 2BY7X 3ZZBA 1UVPA 1V3XA 2ZTYA 7LPRA 4BAQB 1AKSB 4DCDA 2FLRH 3RXEA 1KXDA 2ZZUH 4FUIA 1FY4A 1FPHH 1Y3WA 2QN5T 4INLA 1AGJA 2C93B 4ISOA 2EC9H 1UTMA 1FMGA 4AFUA 2V3OH 4D8NA 2BTCE 1ANEA 1Z6EA 2OD3B 3CENA 2GDDA 1WUNH 3JZ1B 3URCA 2Q6DA 4A1VA 3SJIA 1B7XB 1Z8GA 2J92A 4ZXYH 3A8DA 1O32A 3UIRA 5CHAB 1XUFA 3I78A 1ETRH 3UQOA 2B9LA 1DWEH 1GHAG 1GI3A 1J17T 3DD2H 3VGCC 1IQIA 1NTPA 2J4IA 3RMNH 2XNIA 1O3OA 2FOEA 1MCVA 2FESH 2PKSB 2ZDAH 3T2NA 3D23A 1HAYB 1G36A 8ESTE 1QL7A 5HM2A 4B76A 2FODA 1EP5A 1MU8B 3SUEA 1AQ7A 1T8NA 1HJAB 1Z71A 1BJVA 2NU3E 2UWOA 3ITIA 3KF2A 1QIXB 4GCHG 3RXJA 1YF4A 2QAAA 1HAVA 2PSXA 2VIOA 3CP7A 3PTBA 1JBUH 3PMAB 3ZZ3A 1C5SA 4JMYA 2YNBA 3C27B 2ZHDA 1W7XH 4KGAA 3IG6B 2Y7ZA 1P2OA 3A7XA 3A84A 2OQUA 2GT7A 1G30B 1EB2A 1MH0A 3AAVA 4SGBE 4E05H 1MTSA 1UVOA 4K1EA 4UE7H 1WU1A 2JETB 1MKXH 2C8XB 3SNCA 1GJ4H 1QB6A 1QBNA 1ZSLA 2ZFRH 3LH1A 2VIDA 4ZUHA 1GBIA 1HAIH 1D6WA 2SNWA 1SHHB 4FU7A 1C5MD 2PTNA 2XTTB 1G37A 3K65B 1T4VH 4K8BA 4B71A 2B0FA 1LPGB 3LJOA 1NRPH 3SV8A 5C3NA 2R2MB 1PFXC 1MTVA 1WYKA 5F03A 3STIA 2VWMA 3TVJB 2DUCA 1MTUA 2I6SA 4INKA 1W12U 2F9BH 1D3DB 2BM2A 3GY3A 4ZAEA 1AVWA 4OS1A 1O3MA 2BD5A 3JZ2B 4XE4A 3UR9A 4K3JA 2BDYA 4JYUH 3RLYH 2ZG0H 1NRSH 1TNHA 1YYY1 3VXEH 5LPEA 3BTFE 2HGTH 3K6YA 2ALVA 2B5TB 4K1TA 1TOMH 4MVNA 2ZU3A 1OX1A 2QYIA 3HKJB 4O97A 1CA0C 4Y8ZA 1QBVH 2GDEH 3FAOA 1C5LH 1ELTA 1C5VA 2G5NA 5FCKA 1SLUB 3ZZ5A 5FBIA 1YPMH 1SG8B 4WMFA 3PMHB 3F1SB 8LPRA 1J9CH 1S81A 4BAMB 1A0HB 3M5OA 3MNXA 4CHAB 3CS7A 5IDKA 4LXBH 1TRMA 1GJ8B 1TALA 3F68H 4O3UA 1O2MA 3A88A 5EQRA 3BTTE 1P0SH 3H7TA 3K6ZA 1YPLH 2Z3EA 3KQEA 1GHAF 1O3LA 2BVXH 1DSUA 1MZAA 2BDAA 1BBRE 1FZZA 1LVMA 2OUAA 1LTOA 5C5NA 4GPGA 3RXMA 4JK6A 1P9SA 1GJAB 4A6LA 3UREA 2XC5A 2ANMH 4AFQA 3A7ZA 1DANH 1AFQB 2VINA 4YTAA 2DE8A 1YKTA 4K5ZA 2H5CA 1JRSA 3BN9A 3RXHA 3OTJE 4GCHF 1TRNA 1Y5AT 5FAHA 5JBAS 4ASHA 1J8AA 5LGOA 1VR1H 4WXIA 5DP5A 2R9PA 1G3BA 3LU9B 1G2LA 4NWLA 5GPIB 4AB9A 1BT7A 3RDZA 1EAIA 1O33A 2BOHB 2G8TA 3HKIB 2SNVA 2BD4A 3RMOH 1TE0A 2ZQ2A 5CE1A 1HAPH 1Y3YA 3F9FA 5JDUB 1Z1JA 1PPFE 4YOGA 4NA7A 4CRFA 4LZ1H 1LHCH 1KXCA 5ETXA 5DPAA 2OP9A 3FANA 3U69H 2BZAA 3ODDA 4A92A 1GG6C 2OXSA 3GY6A 1UK3A 2BD9A 2F9UA 2A0QB 1K9OE 1KTSB 1UTNA 1ZTLA 1O2ZA 1TPPA 1TABE 2A7HA 2QXIA 1HBTH 4ABIA 1PQAA 1GBDA 3E8LA 1O36A 4X1QU 1QTFA 3PTNA 3SU1A 4DY7B 4Y7AA 5L2YH 3M7UA 3MTYA 4WH6A 5FPSA 3SORA 4LOYH 2Y5GA 4FXGH 1GCDA 1AO5A 2FMJA 1KLTA 2F91A 1BTUA 3QGJA 3P70B 2UUKB 1QFKH 1CVWH 2ALPA 1FV9A 1UVUH 1CSOE 3KQBA 4FUFA 4IS5A 1ZPBA 3TGJE 3DT0H 1BHXF 1QCPA 3S9BA 5C2ZA 2GKVE 4MPVA 3ZZ8A 1C1RA 4UFGH 1AWHB 1C2GA 1P3EA 4Z6AH 1C5UA 1SGYE 1OWJA 3V13A 1IQLA 3KCGH 1YGCH 1K22H 3FVFB 1BRBE 2AYWA 4DJZB 1MKWK 5DP6A 4ABHA 1BRCE 2ZIQH 1SFQB 1BMAA 2QXHA 1GBLA 3NKKA 1H9HE 1SPJA 3EA7A 3E16B 3LC3A 2BQ7B 5TCCA 1IQKA 1HUTH 3RXTA 4SGAE 1GVKB 2O8WA 4TYDA 3FP7E 4NA9H 1CO7E 1EKBB 1OPHB 2F9NA 1AB9C 1PYTC 1F5RA 4YZUA 3BEUA 1ARBA 4I8KA 3HPTB 1O3JA 1UTOA 1O3KA 3RC6A 4X6PA 3ZZ6A 2VWOA 4HTCH 1U6QA 1ORFA 5E0JA 3VPKA 2VVCA 1D3TB 1NFXA 2ZPSA 3LT3A 1O3BA 1S85A 2HNTF 2VVUA 4ESTE 1F0UA 1AU8A 4RKOB 1P09A 1B0FA 4LK4A 4ZROA 1CGJE 5DP9A 1HAGE 3K2UA 2Z9LA 3A8AA 4KTUA 3U8RH 1BTWA 1TONA 2CV3A 1EQ9A 1UCYE 4FUGA 3URDA 1YPEH 3SGAE 1TRYA 3QGNB 1THSH 1IQMA 2IPHA 3Q3YA 5K7RA 2Y82A 1S0RA 2AS9A 2AIPA 1C2LA 3V3MA 1IOEA 1TX8A 2ZA5A 4Q7ZA 1KY9A 5HGGA 1EZQA 3BIUH 2HALA 3KEEA 1N6YA 2FO9A 3GY2A 1MMJN 5EXMA 2HVXA 1HAVB 2H1UA 2Z6BD 1O2XA 3TK9A 2ODQA 3MI4A 2TIOA 3RXKA 2CN0H 1AZ8A 2IJOB 3GCOA 1YPHC 1GHBF 2ODPA 2P95A 4YESB 2C8ZB 4NFEA 3IWMA 1RIWB 4CREA 2FI4E 2PR3A 3GCHC 2QCYA 2SGQE 1TGNA 3LDXH 2WV4A 4X2VA 1VITG 3HATH 1G3CA 1QRZA 1W0YH 4DIHH 3GYLB 4OGXA 1LQEA 1XKBC 4NIYA 3MH5A 1BZXE 4X8TH 5L2ZH 2GT8A 1EPTC 1IQNA 1FAXA 4A7IB 1YCPM 1ELBA 2FP7B 1MD7A 1UTQA 1QL9A 1MTNC 2ANWA 2XCNA 3MO3A 1Z1IA 4IN1A 4XBDA 1ZR0A 5FX5A 2XCFA 2VIVA 4NFFA 5T6FA 3RXLA 2C90B 3MU0A 1G9IE 1AVGH 1NPMA 2VGCC 4QT8C 4UEHH 2ESTE 3GDVA 5T6DA 5EOKA 1P2JA 1EOLA 3LIWA 1YCPK 2ZGHA 4U01A 1VGCC 2ZGXH 1UTPA 4H6TA 5C5OA 3SHCH 1GBMA 2WYGA 1N8OB 1DWCH 5JBCS 1UTKA 3VB3A 3VB4A 3TGKE 1FY1A 2W7UA 3U1IB 2PV9B 3BTGE 5J4QA 1DOJA 1D3QB 1O5BB 2HWLB 3OY6U 4NGAH 3UY9A 2A5AA 1KTTB 1OP0A 5EPNA 3E0PB 3MU8A 4B2BA 5HXFA 2DE9A 3GY4A 1CQQA 1HXFH 2CHAC 2ZU2A 2OINA 2AIQA 4I33A 2GVFA 4H6SB 5E8EH 1ELGA 1MTWA 2Z3DA 3FFGA 1AWFH 1SGFG 3HK3B 5T6GA 1XUHA 1TFXA 2A2XH 2XWAA 3ZYEA 2ZWLH 4ZHAA 2ZHQH 4Y0ZE 2AGGX 1PPGE 4B75A 3RXOA 3DFLA 1PYTD 1E36B 4DGJA 2GCTC 1T8LA 3TIUA 2IN2A 3QLPH 3CS0A 3PO1C 3Q76A 4AOQA 3UPEA 1BJUA 2G4TA 3A82A 2XBYA 4FUJA 2PUQH 1WQSA 1WV7H 1NFWA 1P9UA 1O2HA 1TNIA 3SUDA 4CH2B 4BXSA 2C8YB 4B1TA 4Y10E 2PFEA 1BQYA 3T27A 4IN2A 5DG6A 4UONA 2A2QH 2ZFFH 3PLPA 1ANDA 1SSXA 1GI5A 1LO6A 2THFB 1C2IA 2FS8A 3VB5A 1UVTH 1GCTC 2PUXB 2UWPA 2AMQA 1P3CA 1F0SA 3A8CA 1MKWH 4X2YA 4FUHA 2PSYA 5ESTE 1UK4A 1AI8H 1VITF 1SQOA 4X6OA 4BTIB 3MH7A 2BX4A 4DW2U 4VGCB 2WPIS 2R0KA 1C5ZB 1DWDH 3O8DA 3L33A 1GDNA 1W8BH 3EDXB 1DSTA 1O3IA 5B6OA 3I77A 4Q80A 2STBE 4JYVH 3F9EA 4DIIH 1KLIH 4MPUA 3TITA 4LZ4B 1P8VC 4WMDA 5EU8A 3RMMH 1C1NA 1A1RA 4X1PU 2WPMS 4JZEH 1HIAA 1QJ7B 1L1GA 1P2MA 9ESTA 1HYLA 1MBQA 1MAYA 4AZ2B 3R0FA 1QB1A 4RSPA 4GVUA 4TY7A 4YO9A 3DUXH 3RXQA 1O37A 3B8JA 3LGTA 1GJ6A 1NS3A 2XBXA 3TH4H 1FJSA 1S6HA 4ISIH 1FN8A 1SI5H 3A7WA 4FUDA 3LKWA 1NO9H 4XFQA 3V7TA 3LGYA 4GHTA 1C5NH 1CA0B 3ZZDA 1O2TA 1O3NA 3ZVDA 1P10A 1QQUA 3GY8A 3DA9B 4K1SA 2XC4A 1GGDC 1GBBA 2H9EH 1JXPA 1SOZA 2VWNA 2Z9KA 1GHXH 1CBWC 1S0QA 3RU4D 3E6PH 1PQ7A 2V35A 1W3CA 2P3TB 3EE0B 1DXWA 2EEKA 1AE5A 1ELAA 1TWXB 2OBOA 1W11U 3A89A 2FI3E 4MTBA 3SBKA 2BD8A 3RXUA 2LPRA 3MYWA 4ABFA 6CHAB 2WV5A 1C1SA 1HGTH 2CMYA 1NT1A 1O2IA 1GL0E 3LC5A 1C1UH 2FPZA 3RXIA 2P3FH 1O5EH 2W3KA 1SR5C 1LPKB 1CT2E 2A45B 4H42U 5C20A 1LCYA 4IMQA 4ZKNU 1UTLM 4I8GA 1QHRB 2P8OB 5C1XA 5TJXA 4IC6A 1OP2A 1W14U 1TPSA 3T25A 3BTDE 4AGJA 1QL8A 3ZZ7A 1VJ9U 1C2JA 4FU9A 4Y8XA 5EW2H 2FLBH 3D49H 1C4U2 1ELFA 5GJ4B 7GCHG 5J4SA 1PPBH 3BEFB 2YOLA 4U32A 1YCPH 4HI3A 4UFEH 2HLCA 3HK6B 3P8NA 1P2QA 3QO6A 4YOIA 2FWWA 5CHAC 1AFEH 1P04A 1YLDA 1C5PA 3M7TA 1BMNH 1HV7A 1O3PB 2V0BA 2VU8E 1SOTA 5DK1A 1V2MT 1JIMA 3ZZ9A 1O3FA 3ZZCA 5C67A 3NCLA 3VEQB 1BRUP 1WQVH 2ODYB 1LHGH 4U30A 2H5DA 4JZDH 2A31A 2AGEX 1QQ4A 4XSKU 3SI4H 4AX9H 2ZDNA 4YT6H 1ETSH 4YOJA 4D7FA 1UK2A 3QWCH 2PKSC 1C4V2 1FN6A 1DUEA 5E2PA 1NFYA 1FAKH 1LQDB 4IGDA 3EQ0H 5T3HA 1F5KU 2FOBA 3M3SA 2FEQH 3A86A 4K60A 3M36A 2W7SA 2FOMB 1HJAC 6GCHG 2PKAA 4K8YA 3UWJH 1C1OA 2SGPE 1J14A 1F7ZA 2RG3A 1S84A 5BPEA 1SGNE 3Q00A 3EAJA 2AERH 3RM2H 1FIZA 1H9LB 3AVZA 3MU5A 3NPSA 1EX3A 3IITA 5ESBA 3PB1E 2IOTA 3RXCA 1KXBA 2ZO3H 2QGRA 4X8UH 1YM0A 1XUKA 2JETC 5GCHG 4BXWA 3V12A 5DO4H 1KYNA 1O5AB 1ZRBA 2FYRA 1D3PB 2Y5HA 3RMLH 1ZYOA