4MQBA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with 2-(n-morpholino)ethanesulfonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
205
structure length
203
Chain Sequence
b'MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of thymidylate kinase from Staphylococcus aureus in complex with 2-(N-morpholino)ethanesulfonic acid
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 82
structure length 203
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mqbA00
2OFWA 1Z83A 4I1SA 4N0DA 3CWZA 2BMFA 3N70A 3VU9B 5EP1A 1TPZA 1CR2A 2J41A 4MA4A 4NYIR 1XRJA 2GF9A 3DVLA 1F60A 4PSAA 4Q7KA 3X2SA 1E1QD 1XJQA 3THYB 1E79D 1RW4A 2PZGA 3NEJA 4AYXA 2WWXA 3H84A 4R2IA 2LCFA 1ANKA 1E2QA 3D31A 4PC2A 2CMKA 3K0SA 4I81A 5F3WB 1IHUA 3K70C 1VECA 3CUEF 4A36A 1ZCBA 1SVLA 721PA 1KI7A 3VHXA 3C4JA 3QUSA 2REXB 4JBYA 2HJGA 1A2BA 2WWIA 2CL6X 4X8MA 2NPFA 2VRWA 1DAEA 1TU4A 2EYUA 4ACBA 4PO9A 3QXCA 4RFSB 2ZM5A 3QVUA 4HZUA 4AC9A 2YJTD 2GXUA 1DG1G 2ZI3A 4HLUA 2OO7A 4Z54A 4FCWA 4GOXA 3FVQA 5J40A 2I3BA 2XNDD 3UWKA 4QHYA 3I92A 1NY5A 1KTVA 2MSEB 3N2IA 3OESA 2WBLC 1DO2A 4TT3D 5FPSA 2JLQA 4PQFA 1FX0B 1U94A 2FEOA 1UKZA 5EE0A 3FPAA 2PLRA 3S1AA 2BBOA 1FZQA 1JI0A 3KFXA 3THWA 1GSIA 1NVVR 2D2FA 3PUVA 4LHWA 1S3SA 4GOJA 4Q1BA 3QKSB 1DE0A 4DCTA 1SKYB 4M1TA 3SJZA 1NMZA 3B85A 3TR5A 4Q9IA 4DLUA 2IWHA 2G0TA 3IPXA 1RIFA 1Z0FA 2GXAA 4JLMA 1R0WA 3EZ9A 2WAXA 1PVOA 3H86A 1KKMA 1MO6A 2EFGA 1N3BA 1JR3A 3NKVA 2H1LA 3U4QB 4K8OA 3QIAA 2OFXA 3R8FA 3QKUA 5D3QA 4L9SA 2OAP1 2P6NA 5DNYB 3BB4A 3EZFA 1R6BX 1IAQA 1NVUQ 2ZRIA 4MRVA 4EFMA 3NBZC 1RJ9A 2OBMA 2HF9A 5CM8B 2GJKA 3QXXA 4XJXA 5EXXA 3VHLB 4OK3A 5SZIA 2NTYC 2JLVA 2PMDA 1M34E 2IC5A 3H2YA 4QKQA 1A5TA 2FGJA 5P21A 3LW8A 2J0UA 1F48A 1X1RA 4LJ8A 2XTZA 4W5WA 1SKYE 1AQYA 1KK2A 3K53A 1N0UA 3T15A 3UXMA 2ZR9A 1GVNB 4FCTA 3QBVA 1OFIA 2ZUDA 5BN4A 2AXNA 4DIDA 2AKYA 2VPPA 2C9CA 2DWOA 3BBPA 4ZIRA 2O0HA 5B2ZA 3IQXA 1RKBA 4ZPXA 3P27A 4NYJR 5L3QA 2F3TA 5GJVC 2A5YB 5C2JB 2XXAA 2JCSA 5CK4A 3AP3A 3FMIA 1QF9A 4L16A 4DDUA 2CJWB 1W36C 5FUXA 2NPIA 4QGGA 3K9GA 2GCOA 3RS2A 1QHSA 2LKCA 3PUXA 4BFTA 4LJ7A 4JSTA 4CF7A 2NQ2C 2BMDA 1AZSC 1VCMA 5DI9A 4GP7A 3BE4A 5ELXA 1TUIA 3A4MA 4HZIA 3TE6A 4LPSA 3FE2A 4FXPA 1ZNWA 3EIQA 4O2LA 4UXIA 1SZPA 1AKYA 1FQKA 3RSOA 5KPDA 2J7PA 1RPZA 5TXGA 2H18A 3LWNA 3AF4A 4DT1A 4I1UA 1UAAA 4PAQA 1NLYA 2XB2A 1II0A 3A37A 2IYRA 4DCUA 5HE9A 1Q0UA 5FBVB 1JXOA 3FDIA 4OHZA 4M21A 2NGRA 1HYQA 1YRBA 1AS0A 1KZGB 3EG5A 1P73A 1WE2A 4DLZA 4CEIA 3IKJA 4AY2A 3IHWA 1NN0A 3MJRA 4QM6A 1E32A 1NN3A 3AUYA 1KI1A 1NVWQ 2VHTA 3VQTA 2GJSA 3A8TA 4P4TA 4Q1DA 5AWFC 2ZJ5A 1ZC3A 2J1LA 3B1XA 3WRXC 1YKSA 4UNRA 2KBEA 2AK2A 3KB1A 4NH0A 3T5GA 5FUWA 8OHMA 2UKDA 3CF6R 3W6PA 2ZRNA 4B6EA 2IW3A 5J4KA 4BLRA 2W83A 4Q4JB 5TY0A 5E3HA 1U98A 3ND9A 1T5LA 5IHPA 3IO3A 4E07A 2WKQA 4A2WA 3CW2A 4TTPA 4OK6A 4F4IA 5KSYA 4B74A 3RS7A 1AZTA 2RKOA 1O87A 3TBKA 3SYKA 3OIUA 3IPYA 2D7DA 2C98A 2RGXA 1KIMA 4C4PA 4URYR 4D82A 1ZM4A 2OCAA 4PHHA 4O2RA 4WZBE 3AVYA 4MGKR 3RANA 1GL6A 3QBTA 3X1YA 2FFBA 3I5XA 4Q01A 1HY3A 3HJNA 3DL0A 1LB1B 4OQMA 3TQCA 2QPAA 1FMLA 1WP9A 3OAAD 5KUTA 1KO7A 3L0OA 2QAGB 2O8CB 1AGPA 1R4AA 4GZMA 2O8BB 1N6OA 4JL6A 3BH7A 3QEOA 1GWNA 2FFHA 5AUNB 2YINC 1P9NA 1YR8A 2MMCA 3QNUA 4BQSA 1E79A 1DAIA 1KDTA 1KAGA 1E99A 1G3RA 2JJ2D 5J4HA 4GFDA 4G0NA 1CLUA 2VSOA 1KNQA 3NBXX 2Z6VA 3IBGA 5DI3B 3FOZA 1P4SA 1KO5A 2QUZA 3VR6A 2ATVA 1II8B 1G64A 1XXHE 5AJVB 3KXLA 2PL3A 4OHXA 2ZRMA 1ZM7A 4Q19A 2X1VA 5FBRB 1WBDA 4QGHA 1HE1C 1HTWA 2MMGA 3G0HA 3KB2A 3U7FB 3SYLA 3TSZA 3H1TA 1NJFA 3EC2A 1JPNA 1HH4A 1JR6A 1KMHB 1TNDA 4OQNA 1DAMA 4TL6A 4DBLC 3R8CA 2PT5A 1W36D 3MJHA 2XNDA 5FL7A 1Z2AA 3MD0A 3WXMA 3EZ7A 3A1TA 3U2QA 4P3YA 3R9XA 3THXB 4G3XA 1YZGA 2CK3D 4HLQB 5IK2D 4TQAA 1NJGA 2QPTA 1G8GA 1UBFA 2XJ9A 3TVTA 4DSOA 1E9BA 1UJ2A 1H8EA 2JLUA 3NG1A 4F93B 4QHSA 4JZKA 1HV8A 4CRWB 4PAMA 1EFRA 3MUFA 1UFQA 1N5JA 2IYQA 1NSTA 121PA 3FHCB 3BERA 5C46F 4D25A 4NKRA 2GVZC 4ZDIA 2A78A 5H1YA 3T35A 1YZUA 1XXHA 3GFOA 3I8XA 4M2LA 4RCYA 3AVWA 1LY1A 1QHYA 1RRGA 4TMZA 3VKWA 5KTYA 2R6AA 1GRRA 4R2HA 3U3OA 4LGMA 1TADA 3TW8B 4ZI2A 3DDCA 1P75A 1NBMA 2P3SA 1OW3B 2VP4A 3FYHA 4LV5B 5DISB 5TVKA 4EPYA 3AVUA 1GZSA 2FSFA 3EPKA 4HDQB 2IYZA 2QP3A 3AH8A 4RZ2A 3W5JA 3BOSA 2PZEA 2YC2C 2QI9C 3TAUA 5L3SA 3PEVA 2IK8A 4G5GA 1Z0JA 1E9AA 1E2KA 1U2RA 1XJCA 2OBNA 4NCJA 3U6KA 4KFUA 1COWD 1D2NA 3BH6A 2X77A 3SOPA 4QGAA 2C77A 2FFQA 3SBEA 3VR1A 2CCGA 2GRJA 3LLUA 3KKPA 1AK2A 1J99A 2R6CA 2F3RA 3QKRB 1QHIA 3ETLA 1E2PA 3RSLA 1E2JA 1X86B 3PEYA 4QM7A 2QTFA 2E9SA 2VP6A 2ODNA 5IT5A 2A5FA 2IYXA 5J5CA 2VIIA 3GJ6A 1G8YA 4EAQA 3EIEA 4B43A 3MWKA 1G20E 2IXEA 5FBWB 4RZUA 4MRRA 5FPHA 2DR3A 5FTLA 3H0KA 2OV2A 1XNJA 3QF7A 4JT4A 2V3CC 4I1VA 2D4HA 4LJAA 5DO9A 1CS4C 4PXAA 4TMWA 3C8UA 5JS7A 3K0FA 2F7SA 2G3YA 3EAQA 4JLVA 1ZP6A 3CB4A 4G01B 3IDQA 3ZH9B 5KYKA 3ND8A 1KDRA 2BMJA 2L0XA 2NO0A 4AYWA 2REOA 2ZE8A 3QG5A 5AJZA 4DLVA 2O8FB 1Z0AA 2FPKA 1Z0IA 4MKIA 2YYZA 2JLSA 2CBZA 1SXJB 3TUZC 1Y3AA 1E2LA 3AP1A 4AIIA 4D4LA 3GLFB 4RD0A 5L8VA 2GJ9A 5EJEA 1EX7A 4JIMA 3CRRA 4LC0A 1NNEA 2ZYUX 1LS1A 2W6ID 3UATA 3QI2A 3NH6A 3VFDA 4LBZA 1KDOA 2CHVA 2GAOA 4QBIA 3TLXA 3WYGA 2Z4SA 4AD8A 4DC9A 1IY2A 3RS5A 1GKUB 1C4OA 1DO0A 2AWOA 3GLHB 1NG9A 1E9RA 1KSJA 2Z83A 2ERYA 2R44A 1P7CA 5EQTA 2ZRLA 2GJAA 3QF4B 4A2QA 4C0AC 2B8TA 2VTKA 3L8YA 1FW6A 1GTVA 1Z28A 4E5UA 5LD2B 4NDZA 2OLJA 1DELA 1E96A 5HR5A 1CU1A 2PJRA 3SEAA 1NSFA 5EXPA 2ZUBA 2WWWA 5HCIA 2VSFA 3GLGB 4Q21A 1FPMA 2ZRGA 5BQ5A 5JWHA 5JEDA 3KKQA 2BKEA 1G8HA 5HZKA 1S4QA 1SXJE 3K09A 3WNBA 1PZNA 1VG0B 1G16A 3DOEA 3M1IA 5FPKA 3CO5A 3U7EB 1XMJA 3FFAA 4JLJA 3UMRA 3GLFE 1KYIA 5AK0A 3AEZA 2C5LA 3VR2A 1TX4B 4IFBA 2ZSBA 3IGFA 3BFVA 1P72A 1N0VC 1YJ5A 3L0SA 5JJIA 1BH2A 4M1YA 3VNVA 3RWOA 1N0WA 4LYFA 4EPRA 3GFTA 2FE4A 4JLPA 3GLHE 1KMQA 4B47A 4V0NA 5F98A 4AKGA 5FTMA 4F92B 5HZHA 1JALA 1WF3A 3OZXA 2IYWA 2H92A 2DFNA 1CR0A 3DO6A 3PR1A 1DTSA 1R7RA 5EE9A 1SHZA 1TF2A 3CRQA 3WRYC 1GAJA 1KGDA 1Q1EA 2ZTSA 3CF2A 2FSGA 1XD8A 2ZRJA 2GDJA 3VNUA 2ZJOA 1E0SA 3HU3A 2GBLC 5EZ6B 3REGA 5K8TA 4O25A 3DPUA 2ZSDA 3HYRA 3KTAB 3EA5A 4PC7A 4YXWD 1JNYA 5A5GA 3QE0A 4D4JA 2F1JA 3GLGE 1EFCA 3OAAA 2JIZD 3SJAA 4HUTA 4R71A 1SULA 3B9QA 4TSFD 1S8FA 1CF4A 1ZU4A 2GCPA 1KSHA 1SVOA 1XTIA 3NXSA 1W49A 3CPEA 5EE1A 4UQOA 4DEYA 3AB3A 5BN3A 4Q03A 4QBFA 1NMXA 2GK6A 2VYFA 4A82A 1I4DD 2R8RA 4C3ZA 2Q6TA 2IS6A 3K0CC 2EFHB 2JJ2A 5JWRA 4B34A 1GFIA 1E1RD 2PT7A 4ARZA 4JL5A 5DH9A 3SDZA 1C1YA 1IJFA 1BYIA 4PC1A 1PUJA 2ZU0C 4MYUA 4YMUA 4BPBA 3F3YA 1R8SA 5BW8A 3ZYCA 2PX3A 2RMKA 5TV2A 3B13B 1CIPA 3UMSA 4E09A 1SVMA 3RS0A 2OBLA 2IX3A 3BS4A 4C0BA 1N6PA 2B7CA 5IDVA 4BLPA 1O3YA 2A5DA 1AJEA 4IOLA 5FTJA 1M7GA 1F2UA 5DIFA 4Q4HA 1OXXK 2J45A 1T91A 2WM9B 2QTVB 1VDZA 1AM4D 3Q9LA 2ZS7A 1ZYUA 2JASA 4UXHA 1JPJA 1Z3IX 1GUAA 3KDSE 4C0HA 3HPQA 3IEVA 2B21A 2QBYA 1QG4A 4RKFA 3TUJC 2CK3A 4BUJA 2MSCB 5IK2A 3KQNA 2OM2A 1G17A 4BECA 1OIWA 4ERNA 5KSOA 4OYHA 1IM2A 3EASA 3VR4A 1S1CA 4BLQA 1DADA 4M9QA 2OXRA 4M0LA 3U44A 3KQUA 4KAXA 1GM5A 3AP2A 4ZDWA 4NZYA 1XMVA 1Z08A 4HDCA 3RDPA 3PXGA 4KODA 1Z07A 3L2OB 5EE5B 3FTQA 1IY0A 2V4ZA 3CX6A 2BHRA 1S9DA 1US8A 1VCOA 2B7BA 4HZUB 1ZIOA 4ESHA 3JVVA 2C9OA 5LDDC 5DHAA 4W5HA 6Q21A 2ZI6A 3SYNA 3D8BA 2FA9A 4V0MA 4GL2A 1KI6B 4TTRA 4HYYA 2R9VA 4PPNA 1OYYA 4IHQA 1EXMA 4DHEA 4TQUS 2H5EA 1UKYA 3S1AB 4B3XA 5CM9C 2Q21A 4M9ZA 1K8RA 2GEDA 4URVR 1COWA 2DFTA 4PPFA 3THWB 3SS8A 3ZIAD 4PR0A 1KNXA 2FZLA 4X8LA 4EIWA 2F1IA 3O8RA 2JLYA 1KI2A 3LXXA 2BBWA 4KFTA 1SGWA 2HCJB 4PANA 4DSTA 2Y8EA 4P31A 4G5RA 1XEXA 4TLCA 5KDLA 2P0EA 4I99A 3PVSA 4A92A 3PFIA 4S2EA 2QGNA 2QGZA 1UBCA 4PTLA 4B75A 3NDBB 1MH1A 1XJ0A 4OI1A 1U0JA 2QZ4A 2N1BA 1JAIA 4EDHA 2ZRCA 4MYHA 1JQLB 1SVSA 2A3RA 2DWQA 4PZLA 4B33A 1ZUNB 1E2GA 1W5SA 3LXRA 1UADA 2AR7A 1KO4A 2NO7A 5A4JA 2CHQA 2IYLD 4LDJA 1X8KA 5D3MA 1KY3A 1EGAA 2HF8A 4PFSA 4Q7JB 1DG3A 4LZZA 2JJ1D 1D2EA 3F5FA 4F4CA 1RJ9B 2EU8A 2R6FA 5JSZB 4OJKA 2O8EA 3BRWD 2QROA 5FOVA 3X1WA 1OHHD 4ZCIA 3K1JA 2J0UB 1F2TA 3SU8A 1Z29A 4WA7A 1DBSA 1OH8A 3GQBA 4Q47A 4JSYA 2K5UA 2ZS8A 1YR7A 2GA8A 1DOAA 1HEIA 2IEZA 4Z8YA 1GNQA 2W6IA 3ZQ6A 2F1RA 1QG2A 4ZIRB 3WMGA 4WAUA 4AI6A 1ZMXA 4JVSB 4OI2A 1AN0A 5L3QB 4EJSC 1BIFA 2GCNA 2P6UA 4MKHA 4Q9KA 3AVPA 4QL3A 5FL7D 2XXAB 2V9PA 5DGXA 1UPTA 1JR3E 3B1YA 3LLMA 3KFVA 1ZNYA 2RGGA 3W3ZB 1EESA 1KI6A 1J8YF 5GJBA 2OILA 2VHUA 2GCOB 2YWGA 1NP6A 1H8ED 1CJUC 3KXIA 4A6PA 3LNCA 1M8PA 1EFRD 4KCGA 2D3WA 2WWFA 2WJJA 1CJMA 4LYJA 1XPOA 1W2HA 2WZQA 1I2DA 3AKYA 1G8FA 4Q48A 1P61B 5E7IA 4B2PA 1PV4A 2X19A 1FP7A 4MKGA 5B30A 5DYGA 1P60A 3LW7A 2NOAA 1T6NA 1XDBA 1P9WA 5J47A 2VHQA 1EG7A 2KB0A 1W48A 1T3SA 1TQ4A 1NBMD 3LV8A 1GNPA 4DT1B 2ORWA 3P20A 4G5QA 4DB4A 1HT2E 4M9XA 2F9LA 2OCPA 1R5BA 1OV4A 3U7HB 4MRNA 2J3EA 4YMSA 2ZRDA 4CEIB 3A1WA 5FR2A 1E9SA 2AN9A 4OHYA 2IT1A 3GEHA 4EPTA 4KHZA 4KU4A 2ONKA 1Z63A 1LVGA 1XFAA 2AWNA 5AUOB 2TMKA 5JSZA 3PUZA 4KYUA 1RZ3A 2CLSA 4B6FA 4V0KA 3QENA 1KK1A 2ZVQX 1FL9A 4IDQA 4YXWA 4M1SA 4DWJA 1Q12A 3E70C 5CYOA 2JIZA 5KU1A 3LDAA 3M6AA 4TSFA 4IDHA 1M74A 1AGRA 1EWRA 4N1AA 1Z6XA 1ESNA 1QRAA 1ODFA 2XOKD 2DPXA 4UNSA 1Q1ZA 2RGCA 3JVUA 3ZD7A 1XPRA 4MQBA 1J70A 3OIVA 4V0LA 3B5JA 3RABA 1PJRA 1OH5A 2PCLA 1E1RA 2Z43A 4EPWA 5JHHB 2ZE5A 4B3DA 4MDEA 4ZV4A 1U9IC 4C0KA 1IN7A 3V00A 3RS3A 1ZU5A 4JVNA 4N0EA 3MG9A 4A8JA 2J0QA 3GJ4A 2QENA 2W2XA 2ZYTX 3A58B 3RWMB 1GIAA 1WCV1 1CBUA 4TL7A 2J7KA 1W2GA 2GNOA 1Z06A 4LX0A 3WBKA 2QMUA 2A30A 3I5YA 4M8NE 1ZVQA 3PEUA 3EPJA 2ZE7A 4TLDA 3VKGA 4MKFA 1PUIA 2ZRHA 2ZJZA 3VMFA 3AVQA 4HLDA 1OH6A 2NMVA 4O3MA 3WNCA 1G6HA 1H8HD 1M7BA 2ZUCA 3U3RA 3Q5EA 4QHTA 5FOUA 2GJ8A 1FOEB 2NZJA 2W6JD 4TZ0A 1Q44A 2ODEA 1NKTA 2XZLA 4NYIQ 3GEIA 5TB5A 3VAAA 1ZBDA 3W6OA 4FMDB 3K70D 4LCBA 4BFVA 2WMOB 2D7CA 4IEEA 5CK5A 3VTKA 5C4GB 3GPLA 3C15C 1L8QA 1TQ2A 3RRZA 3T1TA 1ZNZA 4BFUA 4FW9A 5L3VA 2Z5FA 4C30A 5DN6D 3OEED 5SZJA 2CL0X 4GMDA 1NMYA 2FZ4A 4DEXA 1JAHA 3LO5A 4M1KA 1ZD1A 4XIGS 1TQDA 4PAOA 4DSNA 5J4VA 2FWRA 1OT3A 1NRJB 4BGDA 3RC8A 2W0MA 3C41J 2BM0A 2Q3FA 2RHMA 3GD7A 2EFEB 2YOGA 1A4RA 2BBSA 1R5NA 1G5TA 4TYNA 4MDFA 4KVAA 4J0QA 1S9HA 4ESVA 2YKGA 5JWOA 1V5WA 5FI0B 2WWGA 4RJLA 1G8PA 2WV9A 2ZRPA 4L4UA 4P33A 3ZIAA 1TQ6A 3REFA 3SFZA 2C03A 4C0LA 2ZRKA 1NKSA 2IBMA 1KSGA 5EP2A 3WBJA 1NVVQ 2ECKA 1FUKA 2H7VA 2EFCB 1XXHB 1XWIA 3I3SR 4D0NA 5FFMA 2PCJA 3FB4A 3GLIA 1XMIA 2X8AA 2ZANA 1ZC4A 4Q4AA 3W8NA 1FNNA 4RZXA 3Q7PA 1XTQA 1KY2A 4Q66C 2WJGA 1G41A 1I4LD 1ZRHA 5K8IA 1OE0A 1KOFA 3IIMA 4GI7A 5L3SB 4BEJA 2ERXA 2AK3A 3BAFA 4XWAA 2XTNA 4GBMA 4HAYA 3O8BA 2QE7A 1QHNA 5CYPA 3I61A 1FTNA 2D06A 3BWDD 3T12A 1GL9B 1II9A 4HLCA 4EQ6A 1CP2A 1ZJ6A 4M4SA 2G83A 2JJ1A 1ZW6A 3R7WA 1D8TA 5AJWA 2IYSA 1EX6A 4ZKDA 5FOXA 1XCPA 4TL8A 1G3UA 3M0EA 4CDGA 2HXSA 2VA8A 4FMCF 5EE3A 4B32A 1D5CA 1OHHA 5H70A 3KKNA 4XD7A 2SHKA 4Q9JA 2NO1A 3CH5A 4KSCA 3CH4B 1UDXA 2ZI9A 4KFRA 2YNMA 3K0CA 1DPFA 3O47A 4L5BA 1DAHA 4C7OA 1G7TA 4Z1MD 2FSHA 1TEVA 1AKEA 2G1KA 3A1SA 1BMFD 4QJ5A 1NBME 4CYMA 2GZAA 3TK1A 4KV9A 4H1UA 2EYQA 1HURA 4JJZA 3UMFA 3K0FB 1Q20A 1E9DA 1VYTA 2GTPA 1IONA 4YDSA 3GJ0A 4RCZA 1IJEA 2FFAA 1UBGA 4NYJQ 1OXTA 1S3GA 2J0SA 2VP5A 1I4TD 3AF1A 1J8MF 2H16A 1DAGA 2QM7A 4LRWA 4PO1A 3LBNA 2RGNC 2GESA 2PMKA 1W4BA 2I1VB 2QORA 2RGDA 3RNLA 4IVPA 2QQEA 2ZXUA 3AGQA 4FD2A 4BRUA 3RAPR 1Z5ZA 3KQHA 3T1QA 2FEMA 3FMFA 3MAAC 1E2HA 1YU9A 5KPJA 4BASA 4LV6A 1JB1A 1IQPA 1RRCA 4PHFA 1Z6YA 1NI3A 2AXPA 1U8YA 5CIWA 1R2QA 4DCNA 5KNDA 3PEWA 5C4MA 3BXZA 4GT1A 2WSMA 3DEFA 1VG8A 5JBQA 4NYMR 1UEJA 4QOSA 2A9KA 3SHWA 2CXXA 5CJ2A 2XSZD 2OSBA 2P5TB 2FMXA 2ZROA 1XF9A 1T8TA 2BKUA 2JDIA 1M2OB 3T61A 2C9YA 1IY1A 521PA 2LKDA 2GAAA 2VP9A 4Q7MB 4DUGD 1QHGA 1OFHA 1U0HC 4KJZA 4DLRA 4CGZA 2FPMA 4QBGB 3MWYW 5FPYA 1S96A 4CEHA 1NN1A 3CX7A 5BWMA 4QGFA 2GEVA 3BJIC 3B9PA 4V0OA 1TAGA 1T3HA 1Q21A 3RRMA 4F91B 5HKKD 2WIBA 2GZDA 1EFUA 4XH9B 5CB6A 2OCBA 3TAHA 3VX3A 5FL3A 1UM8A 1RC8A 3IUYA 5UKDA 1VHLA 1ZUHA 3AKEA 2GVDC 2KI5A 3ZJYA 3DOFA 3I8SA 4YMVA 3Q72A 5JFGA 5JHGB 1QZXA 4LWZA 4L9WA 2XOKA 1IBRA 2IUSA 4ZKEA 1TF7A 4CEJA 4KO8A 4A0RA 4JKYA 1F3OA 1EK0A 4JBXA 4LHVA 2DYKA 1E4VA 2IA5A 2CLCX 1G6OA 2YC4C 3TJZA 1UKEA 1KJWA 4NONA 3W8RA 1Q3HA 3TMKA 3FKQA 3ASYA 2Q9BA 3K9NA 1N6HA 1W4RA 1ZD9A 2BJVA 1OLOA 2WTUA 1N25A 1SQ5A 5JECA 4QRHA 4A4DA 4PZYA 5FBQB 1CR1A 1IXRC 3CR8A 5FOWA 3TR0A 4C0SA 4XSHA 3UIEA 2DB3A 1EWQA 4II7A 1XZQA 3KKOA 3LBIA 4QNMA 1VPLA 2DFKB 1UBEA 3B6EA 3CWQA 4EFLA 3L43A 4GOKA 4TQ9A 4Z8XA 3BK7A 1H8HA 4RD4A 5JRJA 5JRZA 4W9MC 2W6JA 2WJHA 3TRFA 5JCZA 1D9XA 1P5ZB 1G291 5GVRA 2XTMA 3NHBA 2W58A 1LS6A 3AGPA 5FOSA 2Z0MA 2IS4A 2ZJ2A 1XEFA 3DZDA 4ARZB 4A15A 3ADBA 1DARA 3ASZA 1L2TA 2Q9CA 2ORVA 1DS6A 1UDWA 2DHRA 2JLXA 2O5VA 4RD1A 4TL9A 3BFKA 5DN6A 3Q8XB 3P4YA 2ZEJA 3OEEA 4KI0A 3OHMA 3RYTC 4DIEA 4TMXA 4EJSA 4GMXA 4A1FA 1Z6GA 3KKMA 4D80A 1F2UB 4K46A 4Q4HB 4Y0VA 3PV0A 2HT6A 2F43A 2V1XA 621PA 2YV5A 4IOMA 1W36B 3AUXA 2J5XA 1NL3A 3CZPA 2QBYB 4H9GA 4IJMA 1E4YA 3VKHA 4OI0A 2J87A 4BFWA 1LFDB 4GZLA 4E03A 4B73A 4DVGA 4OI4A 5CJPA 3D7MA 5KOYA 1QHHA 2OE2A 2FX3A 2F55A 5FPTA 4JLBA 2IS2A 2WOOA 1S1MA 2QM8A 1WMSA 2ZSEA 4PC3A 3U44B 1L4YA 3B2EA 4OKSA 4H1VA 4YONB 4HUQA 3WHLA 2D62A 2QSZA 4A6XA 2CVHA 4Q5IA 2FU5C 3LX5A 4LOAA 2P6RA 2DBYA 2ZR7A 5KDDA 4M9SA 4TYWA 1Z6AA 4DLXA 5C1BA 4ON9A 4IW3B 2IYUA 3CNNA 3U5ZB 1E2NA 1US8B 1WRBA 1E2IA 2A7QA 5E7JA 1XP8A 3T1VA 4QBHA 2ZS9A 3PUWA 4AK9A 3LH5A 2C95A 4ZDKA 4GPTA 3KQKA 1BOFA 2REBA 1YZKA 1U90A 2Q9AA 1GKIA 5EZ5A 3ZS8A 2PH1A 4RSGA 1FMJA 4PHGA 4Q1EA 1JXMA 3A1UA 2ZJ8A 5DLQC 1OIXA 3PJRA 4EFNA 1IN8A 1G21E 3FHOA 1NIPA 1CJTC 4FN5A 2P67A 2ZJBA 4TTQA 5G41A 4XVUA 5BYJA 1U99A 4JL8A 5J4YA 3TH5A 3M4YA 2WHXA 1AIPA 1FNMA 1QVAA 3QY0A 4POAA 2OAQ1 4BFXA 3Q5DA 4JBWA 2ZJYA 4JKIA 3SI7A 1MRNA 5JCPA 3CX8A 3X1XA 3QXSA 4QFMA 2IYVA 2QPOA 2QMHA 3CNOA 3CONA 3WY9A 5FTNA 1IXSB 1XEXB 4JS0A 3MRSA 3HYTA 3SHFA 3RLFA 3AQ4A 3U60B 2VP2A 2IWRA 1M7HA 2WSSA 1HE8B 4KFSA 2YZ2A 4LYAA 5AJYA 1E2EA 1Q1QA 2CL7X 4LJ9A 3ZD6A 1KO8A 1GRQA 2ZAMA 1CTQA 3NDPA 2BOVA 5GJCA 2G1JA 2WJYA 4Z1MA 1RVDA 1ZIPA 1BMFA 3C5CA 1W4CA 4JLOA 1U9IA 4KLNA 2PX0A 5CIQA 1E98A 3G5UA 4XWKA 3Q85A 4V0ME 5D3MB 2YOHA 3IEUA 4OK5A 4U00A 1U81A 3A4NA 2FOLA 3EARA 3KZ1E 4MGYR 4CIDA 1BS1A 1G3IA 1CEEA 1W0KD 4ZCMA 2O8EB 1XZPA 3DHWC 3WMFA 1MV5A 4HAWA 1G18A 2ORIA 5G53C 5JI3E 1F2TB 1Z22A 3NTUA 2ZE6A 4FMDF 4TN1A 1F6BA 4E22A 1AS3A 1MRSA 4YMWA 1R5OA 2G77B 4L8GA 3W34A 1XPUA 2O8DA 5LB2A 2PEZA 4R98A 4GRAA 3HDTA 3KUCA 4BZXA 4LY6A 4BFYA 2ZSFA 1E9FA 1ZAKA 4FWIB 1OKKD 1R8QA 2XSZA 1N6KA 1QHXA 1ZCAA 1VCNA 1SVIA 3FMOB 3HU2A 4LJ4A 2GZHA 2H57A 2O52A 3IBYA 1OH7A 2HYDA 2EWVA 4JYBA 4QC2A 4DUGA 2IL1A 3MGCA 1A7JA 1E0KA 3E1SA 2QTHA 1P2SA 2ZU6A 4ILEA 3X1DA 3IIJA 3O8DA 4IXMA 3RHFA 1T5IA 3X1ZA 4D6PA 1YZNA 3AV0B 1MOZA 2VHJA 4RVCA 4Q1FA 2N42A 1R10A 2V55B 5HKKA 2QAGC 3MLEA 4I4LA 5HCNA 4GDFA 4R9UC 4XVQA 4JLAA 1W44A 5JS8A 1E9CA 2QA5A 1HUQA 4C9BA 2ZI4A 1J2JA 2IF2A 2F6RA 2RGEA 2Z4RA 3QG1A 4GSYA 5HTKA 4AKEA 4D4MA 4PSVA 3HU1A 421PA 4BZPA 4DLYA 3Q7QA 1FUUA 1SHKA 4IDOA 4WZAE 1MO4A 3QXJA 3P4XA 3I4LA 2ZRBA 3LVQE 1Y63A 1E6CA 2ZQ5A 3OEHD 4B3FX 2QRZA 5ANRB 4LHXA 4Q1AA 1G7RA 5TARA 1HQYE 3NC1C 1XEWX 5EXTA 5FR1A 1XCMA 2QE7D 3L0IB 4RD3A 3EPLA 2RCNA 4ZO4A 4QXAA 3OIWA 3CLVA 2AL7A 1LV7A 2QT1A 2W0SA 4DLTA 3BH0A 4RFVA 4HB3A 1CRPA 2HJVA 1P2VA 3ZS9A 2J0VA 4LHYA 4HEJA 2JEOA 3L82B 2DCUA 4OHWA 5JLJA 2EFDB 2IUTA 5JMTA 1ZM2A 1MABA 3FMPB 3R20A 4XD7D 4UJ3A 3D6TB 3GJ7A 2WICA 3EPHA 4ZCLA 4KSBA 3I1FA 5CDFA 2KSQA 2C2HA 4JLNA 1R0YA 2FSIA 1H65A 3FGNA 3W3AA 4URWR 3PUYA 4HI0E 1IN4A 3LAWA 4AG6A 4HAVA 1KKLA 3WP1B 2OHFA 5CB8A 1XX6A 4ZI3A 4TLAA 1YQTA 4Q02A 4DSUA 4ZDJA 4OQLA 3VX4A 1B23P 5H8WA 4PC6A 1R0ZA 2QQ0A 3OFND 3AF2A 3UG7A 1WXQA 1VCIA 4A8JB 3U6BA 3T5DA 5JJLA 2Q3HA 2J9RA 2D74A 1E2MA 5CLQA 3KL4A 2AKAB 1CJKC 4MYCA 4P0TA 4QJ4A 3LQRA 3ZVLA 2X2FA 4MITA 3RRNA 4A0FA 1YZLA 5KSZA 1W0JD 3SBDA 3EX7C 5JJKA 1JQJC 2EQBA 1K6MA 1NN5A 3T06B 1X8JA 3FKSA 1T4GA 4IXNA 4URZR 4TYPA 3UG6A 3NH9A 4DJTA 2N46A 4U7DA 2ZYVX 5FBLB 4URXR 2RGNA 1Q3TA 5AUPB 3T34A 3L8ZA 3BB1A 1RRFA 4MUAA 2V7QD 1GOTA 3TGPA 1IN5A 3TIFA 3K09C 3JZMA 1TMKA 2VHCA 3KJIA 4IVRA 5K8UA 3B78A 3ZZTA 1OPXA 4B2IA 3SNHA 2JDID 1OFTA 4PPGA 2R2AA 1XD2A 1BO6A 4OHVA 1N6RA 2QSYA 4NCNA 4IRUB 3W6NA 2PZFA 1F5NA 1NLFA 3H4MA 221PA 3HWSA 2I4IA 5LB4A 1E0AA 1X3SA 4XVRA 2JATA 5KNCA 3K0AA 4D4KA 5KSPA 4ACAA 4B76A 1WQ1R 5TMPA 1WB9A 3E2IA 821PA 1XB2A 3PITA 1KI9A 1Z8FA 5FUVA 3PIRA 2ZRFA 4KBGA 1GL7A 2WWYA 4DLSA 2KBFA 4WW0A 1YR6A 1AA9A 1Q1BA 1LNZA 3CPJB 4F38A 4CW7A 4C2UA 5G3ZA 2H8KA 2NIPA 1U8ZA 3SQWA 4HB2A 1YRAA 3LD9A 1G4UR 3OE7D 2OLKA 4AURA 1W4AA 2C04A 1YZQA 3AVVA 1CRQA 1SXJC 1N6IA 4Q18A 2VP0A 1XD9A 5F9FA 1CXZA 1KI4A 2ODBA 3NBYC 4TLEA 1JJ7A 3VU9A 1Z6TA 4LBVA 1TU3A 3NIBA 2WVJA 4OQXA 4CVNA 3RVBA 4JVLA 1TL7C 4PSKA 1BKDR 1QDEA 5DHFA 3VR5A 3SQXA 3THYA 3IHLA 2JLZA 1VTKA 5E4FA 4F4JA 3GLIB 1Z47A 2CLDX 1X1SA 1Q22A 1KAOA 3QOFA 4Q4AB 3ZZUA 4TMKA 4UXJA 2O0KA 4KBFA 3F0TA 2NZ8A 3CRVA 4P32A 1ZNXA 1L7VC 5FI1B 2BWJA 4O0MA 3IIKA 1JEDA 4W5JA 3BD9A 2FV8A 2AX4A 4IDPA 4PO8A 5LD2C 2FJUA 5E95A 2ANCA 3QSYA 3NBFA 1NG1A 3KJHA 1GDDA 2Q0HA 1XEWY 1J90A 3GCGA 4RFSA 4BLSA 2HDNB 4OBEA 2A2ZA 2D2EA 5JZVA 4EQ6B 3ECCA 4RD2A 3WYAA 3CRW1 1OXVA 3C16C 3B1WA 1LF5A 1HA3A 3P32A 1Q57A 3R7WB 4V03A 4B3GA 1FX0A 1W0KA 3ZVMA 4OQFA 2CNWD 5DSZA 2IUUA 3CM0A 2OG2A 2BIFA 2E1RA 2G0NA 2J59A 3SJBA 4BE7B 2BVNA 2IYYA 2QN6A 5CLLA 4UJ5A 4W7SA 3DZ8A 3SC3A 3V4RA 1A1VA 3DMNA 4TLBA 3QKSA 3ADDA 4ITRC 3AF0A 4OJQA 2W00A 3GLIE 2HEIA 4C7OB 1ZUIA 4TYYA 5LPNA 5EP4A 4B48A 4F7WA 4KVGA 5LBIA 3HP1A 4FMBB 1OKKA 4NBSA 4MGIR 2C99A 4NTZA 3MWLA 1W1WA 2JGNA 2JLRA 2VQSA 3IQWA 5EUMA 4A9AA 3NHAA 1C9KA 2ZSAA 3EWSA 5TDHA 4D26A 4DCVA 4TZ6A 5EXSA 4TYQA 2ZI5A 4JMPA 4DXAA 3I32A 2A5JA 4BLOA 4HAZA 2IF0A 1MR3F 1GKYA 4IEIA 5H68A 5L3RA 3ZQJA 3QJYA 3EWAA 4WXRA 3SJCA 2JA1A 3VR3A 2FF7A 1OXUA 4M1OA 4OL0A 2C96A 4IDNA 3U4QA 3GJ5A 3LY5A 4FIDA 1Z0DA 4JYCA 3B1ZA 2UZIR 3U3MA 3TNFA 5BXQC 1IXZA 4EUNA 2YVUA 1W7AA 2FGKA 3A36A 2QMOA 3SE0A 2AD5A 3ADKA 1MO5A 2ANBA 3QVVA 2G9NA 2O0JA 4BLTA 4UNPA 3CZQA 1PLKA 3EXAA 4NHOA 3G82C 3BGWA 1KHTA 4DDTA 2F1HA 3U3KA 3UKDA 1N6LA 3OEHA 4D0GA 3K9LA 1G7CA 3ADCA 2WAYA 1W46A 4RKEA 4DDVA 2B6HA 4EPVA 5JEEA 2VF8A 4MYTA 4Q9LA 4CEHB 3UK6A 4UKDA 1MKYA 1N5LA 2W2VA 4P4SB 2GXSA 3V9PA 3MMPA 3UPUA 4MRPA 1GITA 1D6JA 4TMTA 2BEJA 4BEBA 5F9HA 3AVXA 2X2EA 2YWEA 1WDTA 2IHBA 2GBLA 3N2EA 4AKIA 3C5HA 1G5PA 4MRSA 3O8CA 2CJWA 1YZTA 2OZEA 2FH5B 5B57C 1UEIA 4C2TA 1E3MA 1SKQA 1SXJD 2E87A 2WSSD 2YWFA 4ASUD 1RRPA 4GP6A 4CZ2A 3GMTA 4YLGA 3QXHA 1E2FA 2W2TA 3ZGXA 4CEJB 3LBHA 1E1QA 2WPDD 3TSOA 1VG9B 2QP4A 3LVRE 4B3BA 1P62B 2NO6A 3OIYA 3CIOA 4JT2A 3KJEA 4DZZA 3OFNA 4BFSA 5F2EA 1GRNA 2V6IA 4TMVA 1ETUA 2NO9A 4HLUC 4US1R 3PENA 2V54A 4A0HA 1N5KA 1VMAA 2XEXA 5FUYA 3FFBA 1W0JA 3B7GA 2A5GA 2QEQA 3MWJA 2XB4A 2QMEA 4D2IA 5DE3A 4YC7A 3MSXA 2QG6A 3QKTA 4FCVA 1PLLA 2CCJA 1ZINA 2OUKA 5A0FA 3KJGA 1GNRA 2ZR0A 4LHZA 4TT3A 1NIJA 1VHTA 2WJVA 2ZETA 2V7QA 1KSFX 4M1WA 4V02A 3WYFA 2QP9X 1N6NA 3K70B 3TVDA 2WIAA 1MT0A 2QRNA 2WKRA 3K8YA 4DB2A 2VL7A 3BIFA 3QPUA 4N3NA 1KK3A 1OB2A 3WP0A 3U61B 4Q4JA 3B1VA 1AQUA 2GK7A 3PQCA 1YE8A 4LC1A 1G5RA 3WNDA 3RC3A 3DMDA 4IFEA 3A6PC 3ZVNA 3C7KA 3BB3A 1GP2A 3ICQB 4EKDA 1KK0A 4B2LA 1CKEA 1CULC 5FOTA 2ONJA 5DYIA 4EJSB 2GF0A 3C14C 4P4SA 3UANA 1OJLA 2ZPTX 1FFHA 1A2KC 2F43B 2YHSA 3KX2A 3W90A 1I2MA 3QPVA 1LF0A 3SZRA 1TTTA 2KJQA 2UVQA 1KI8A 2CHGA 4Q1CA 2HLDD 4EPXA 2B8WA 2XITA 4XWOA 1P3JA 4MGZR 3OE7A 1QHHB 4IKEA 4KXFB 4DCSA 1OYWA 4NP6A 2WJIA 3JZAA 2VSXA 3CRMA 3TW4A 2HUPA 3W5IA 2QAGA 3HR8A 4NMMA 2O8CA 5AUQA 1JECA 2ODWA 4Q4LA 4HUQB 3CBQA 4FI3C 4S35A 5SZHB 5BN5A 4IOJA 1G7SA 2O8BA 1K5DA 1E0JA 5IF9A 3LA6A 1X8LA 1XTSA 2GETA 2FG5A 1QBKC 2QY9A 1CJVC 4B71A 3GEEA 4PQRA 4C0QC 2JLWA 2WKPA 4YMTA 1L4UA 1G3QA 4NU0A 2ZJAA 2CE2X 2OXCA 2HCBA 4UNQA 5BYKA 3NWJA 5GVSA 5B64A 4I1OA 1W47A 2ASEA 3L0PA 5DI3A 4A0GA 2VEDA 4JLKA 1D9ZA 4LPKA 3I62A 4HAXA 1E9EA 2PLFA 2WWHA 3MFYA 1S2MA 4WIAA 1II8A 1ZM3A 2MSDB 1N2CE 4HATA 3V4FA 4IOKA 2RAPA 4A8JC 1KJZA 2VF7A 4XTCS 2NG1A 4B3CA 4PX9A 2HYIC 3FHTA 1DAKA 2RB4A 1KJYA 3AKDA 2AD1A 1DAFA 1T9HA 3NC0C 4B44A 1ELOA 2ZVPX 1KMHA 4ABYA 3ZDQA 1NLZA 2HXYA 5G3YA 1ESMA 4Y0AA 2BV3A 2HT1A 5EP3A 2DWPA 4U02A 4XOIA 2PBRA 2CE7A 2GKSA 1EFTA 3THXA 1XTRA 4LJ5A 2AHOA 5E7MA 3J81k 2CNWA 3AVTA 1S0UA 3RS4A 1XTKA 3LRPA 4WOPA 3NVAA 1G4AE 1P2TA 1OF1A 4HB0A 1JBKA 4CT4B 2PJZA 4GNKA 1TUEA 2BCGY 4PHTA 2IHYA 4D0LB 2R6DA 3I72A 4FWTA 3LX8A 1E2DA 2R62A 2QL6A 4LYHA 1GG2A 4U5XA 3TSWA 1ZD8A 2RGBA 2WMNB 4HAUA 3LQQA 4KYIB 1VG1A 4RD6A 3THOA 2ZAOA 3GJXC 4NCKA 2XGJA 2C8VA 1UF9A 2ATXA 2P65A 3DM5A 3EC1A 1D2MA 3FKSD 2LWIA 3IILA 3TKLA 5HPYB 2B92A 2VLIA 3CKLA 3EW9A 3EA0A 1E94E 4YQFA 1LW7A 5M04A 1CR4A 2P2LA 3DKVA 3U3JA 3A4LA 3ZZ0A 3ONWA 2V1UA 1G3MA 2PEYA 1T0JB 5AJXA 3AM1A 4QJ3A 1M6NA 4JJKA 4LBWA 4YDHB 2BC9A 1T8UA 2EWWA 1BYUA 1T3LA 2KWIA 1ONBA 4NCHA 5B58C 4QG7A 2QNRA 3RRYA 1OFUX 4RY2A 3U7GA 2DFLA 2JAQA 3A1VA 2O8DB 2OT3B 1FP6A 1Z2CA 2OFOA 4CT5A 3QKRA 4TWZA 2FN4A 2BJWA 1VYVA 5SZKB 4MUBA 2IS1A 4A2PA 4PZZA 2OEPA 1YVDA 3BC1A 4JLDA 3MCAA 2IEYA 2DY1A 4DDWA 1OB5A 1KO1A 2IYTA 4WXPA 4NYMQ 1G1MA 4MH0R 2VH5R 3GJ3A 2BM1A 2IXFA 2CEAA 5IRCD 2ZIAA 3DKPA 1SVKA 1VKJA 3N5CA 3TUIC 4UNNA 4Q7LA 4AWXA 5KDOA 1JR3D 2XJ4A 4NE2A 1SVWA 3BFXA 1WBBA 3B60A 5GADl 5GJWC 1RFLA 3OF5A 1N5IA 4LUCA 2FPLA 3NEYA 2XNSA 1TEXA 1OSNA 2GXQA 1XU4A 4XTRA 2O8FA 3CNLA 2YWHA 5KHOC 2F9MA 2BEKA 4QNRA 2CDNA 4X8OA 3EZ6A 1SXJA 2XZPA 3GFPA 1NVXQ 2V8OA 1GILA 2H17A 3R9WA 1B0UA 4ASUA 4LBYA 1U8AA 2FNAA 4M53A 3ZVRA 3GLFA 3GJ8A 3WHKA 3AVOA 2KE5A 3I73A 1XCGB 3IO5A 4URUR 1VIYA 4FMCB 4FINA 3TQFA 3KUDA 2WPDA 5AR1A 1E69A 2CCKA 4LV8B 1ZM9A 3QPWA 1M1YE 1QVRA 2GHIA 3GLHA 2J46A 1EFHA 2UZ3A 3QF4A 2XAUA 1J7KA 2ZITA 2G88A 4C0JA 1P2UA 2QAJA 1T0HB 2OESA 4KLZA 3DM9B 4DRZA 2R65A 1MABB 5FTKA 1RE0A 4DLWA 4G5SA 1XTJA 3BORA 1FTSA 2GWHA 1YHNA 3LFUA 2XX3A 1MO3A 1P6XA 2RGAA 2BDTA 3CPHA 3QEJA 4BFZA 3HPRA 5FH9A 3GLGA 3WMEA 4LJYA 4HDOB 1RYFA 3ZLJA 1A82A 1LTQA 2R6GA 2EW1A 5J4LA 1V43A 3ICEA 1G9XA 4AG5A 4X8HA 4BZQA 3P1JA 2BBTA 3QQ5A 4JVMA 4PQYA 3K0EA 3R9IA 1DVRA 1W5TA 1RYHA 2AFIE 4G5OA 4NCIA 5JI2E 2G6BA 4XSGA 2J7PD 1U0LA 3EZ2A 2FDCA 1HT1E 4KITB 2BCJQ 3D3QA 3PG5A 5K8LA 1XBTA 3HR7A 4NL4H 3T1OA 2RH5A 2YOFA 1NY6A 3AKCA 3PCRB 4HB4A 3B82A 5KO2A 4WVFA 4G1UC 1OIVA 3Q3JB 2VBCA 2ZREA 4R7ZA 5CITA 4LK2A 1VYUA 3GP8A 4L15A 2VO1A 4LJ6A 4BRWA 1TF5A 4Q9HA 1YR9A 3SN6A 4WZ6A 2V6JA 4K81B 1NF3A 2IXGA 4IVQA 1KDPA 5G40A 1FQJA 5KNBA 1UKVY 1KI3A 2JJ8A 2CVFA 3B8HA 2HLDA 2P5SA 4RZ3A 4HSEA 2RHDA 2OCYC 2QT0A 1Z0KA 4DKXA 3CF0A 1IN6A 1WA5A 3K9HA 3KTAA 1K5GA 5CDFE 5C18A 4M22A 3KQLA 2ZRAA 2ZYWX 4WBSA 2QU8A 4Q00A 4D81A 1XD2B 2HV8A 1X6VA 1G19A 2Q3MA 3UWOA 4AKHA 2BMEA 1JJVA 4M1MA 1R0XA 1KZ7B 2C78A 3K0AB 4BWYA 3F8TA 2ZI7A 2EVWX 1JEEA 4LI0A 1OXSC 1VIAA 4US2R 3EIHA 2GEUA 1IOZA 2AFHE 4B35A 3P26A 1AS2A 3AF3A 5HE8A 1P9RA 2I1QA 4Z51A 4NPHA 1DEKA 3CR7A 4AYTA 3FWYA 1XMSA 1HQCA 2WOJA 3W9YA 4P4UA 2XZOA 2GILA 3SFVA 4PPQA 4LSGA 1PLJA 3SR0A 4US0R 3KXKA 5EUQB 3E5HA
chains in the Genus database with same CATH superfamily
4N0DA 2AH5A 4E6PA 3E3OA 3LO8A 1TPZA 1CR2A 2ZWPA 1TLLA 2HCRA 1PJAA 4OP2A 2W42A 1F60A 4RHEA 3UBMA 4FJ0A 1JFLA 3NP7A 3KL2A 5HEKA 3GZNB 2JI6A 3NEJA 2EJBA 1DX6A 2E4ZA 1E2QA 4PC2A 2IELA 4BNUA 2Q2WA 1GEGA 1VSBA 2CMKA 1X7WB 4DR7B 1V8OA 1WEKA 5EIAA 4QUEA 5MGBA 4ARVA 3DCYA 3WGHA 5TLSA 4KH1A 3K5IA 1ZCBA 1OZFA 3QTLA 5DXJA 4WCFB 1SVLA 2ICAA 4ZMBA 4RDIA 1C9JA 3QUSA 4R9SA 4GLLA 4J0IA 4RJIA 4MS3A 1UMDA 2REXB 3BMCA 3RUAA 2YWBA 2WJ3A 3NAMA 2JJMA 1SWVA 3NDJA 3R3VA 3PXXA 2CFSA 4G0PA 4B31A 2VRWA 1DAEA 4G0VA 1HDYA 3KLBA 4UTOA 1G59A 1ML4A 4ACBA 5I4KA 1HT0A 2N3ZA 4WZZA 3HCAA 2IHJA 2ZM5A 3HFSA 2AC7A 1BTOA 3AUKA 3C6BA 4FCWA 5DNDA 2PMEA 3AEQB 1IOVA 5AK0A 3W05A 1KTVA 2MSEB 3CLHA 3D7LA 2WBLC 3M81A 3G9XA 5CT8A 5DX8A 2JLQA 4ZCSA 1X7XB 1U94A 2V6MA 3ND7A 3WQQA 1DKMA 1Y3CE 2DHDA 1FK8A 5IYZF 5EE0A 4IV8A 2FEPA 4MUJA 2DJ5A 7ADHA 5F35A 4XQ9A 5LL6P 3DFFA 3JWGA 1ZH2A 4BP9A 4INJA 4HQOA 5FBKA 1NVVR 5K3SA 1DJLA 2D2FA 4C0WA 4BNDA 1ONOA 3AZQA 4NBTA 4M0DA 5CM2Z 1S3SA 5CNIA 5B1HA 1UXJA 1K6IA 3QKSB 4TXJA 4WLNA 2CEKA 2GWRA 4OU4A 4Z4EA 1J9ZA 1SKYB 2J6HA 4M1TA 4ZCPA 3SJZA 4CBVA 2H5IA 4D9NA 4OJTA 3OUTA 1CY2A 4AJJA 1EVLA 1JVSA 4ATNA 1V45E 4LRQA 1VRCA 2IWHA 3K8QA 5C5DA 1MXFA 3I53A 3IPXA 1RIFA 1X15A 1Z0FA 2GPTA 4R05A 2AHRA 2B8JA 2BE9A 3VSDA 5A4AA 5IKPA 3LG2A 1NPYA 3GRKA 4QOIA 4HGRA 5IKMA 3U80A 3D6MA 5AM3A 4RXTA 3V1LA 3K8OE 3ZWDA 1JDVA 1KKMA 2GAJA 4FYHA 3HXQA 1TYCA 4E1BA 3NKVA 4HRYA 3O6VA 4X66B 3N05A 2O05A 4C4ZA 5LZ9A 2H1LA 4TRRA 1KIAA 4FEEA 3VJRA 3TLJA 4KWEA 3QIAA 5CEEA 2YRWA 2O2YA 3MIIA 2GLTA 3RGGA 3H5LA 4L9SA 4CCYA 2Q28A 3P9KA 6PFKA 3BB4A 3EZFA 4MRVA 3RV3A 1BWPA 4EFMA 3NBZC 5H9WA 5FLXA 3MQ4A 1UINA 5KREA 3FNGA 5CM8B 2GJKA 3BHIA 1U7UA 4QASA 3ELYA 1L8AA 3QU5A 4Q3NA 4TV9A 4X92A 2CKMA 3MJTA 2NTYC 4LHSA 5EG5A 1M34E 2IC5A 2FWBA 3KXPA 2ZCJA 3IE1A 4P2BA 3M2TA 2FGJA 4G25A 1YASA 4YYEA 4UHHA 1J0EA 2VF4X 4MV6A 1KK2A 3PX3A 1Z68A 4EGJA 4GMHA 1LQ2A 2YH2A 4FCTA 3QBVA 3REQA 1OFIA 4EB6B 4UHKA 4KQCA 5LJLA 3DF7A 5ERGB 4DIDA 3I1YA 2NUPA 2C9CA 2UZ1A 1CETA 5CVVA 3S7TA 1QAMA 1L7OA 1TVMA 2O0HA 2X7JA 1U0SY 4U1RA 1BCSA 2IP1A 4MAAA 2IX9A 4NYJR 1W19A 4ZPXA 5L3QA 3M5PA 4YDRA 1I6KA 1MUUA 2F3TA 1VHDA 3PGXA 4TVSA 5C2JB 1U4SA 2JCSA 1HNNA 1VB3A 3ZGVA 3D4IA 4L16A 3QH4A 1BW9A 1W0CA 1W36C 2AEJA 3Q88A 4G8BA 2M6SA 4KRFA 5AW4A 3MJ4A 2Z57A 1QHSA 4ER5A 1QS0B 1Y6QA 4J0DA 2IZ0A 1QDUA 1XZBA 2OV8A 2BMDA 3ETCA 2W2LA 3KBBA 4QYSA 3RAJA 5A6SA 1JDZA 8LDHA 2Y9MB 1P1BA 1JKXA 1VL1A 1ZXXA 5B53A 3BSYA 3R5JA 2AYYA 1SQ0A 2QSJA 3OT4A 4UBLA 1UPUA 2Z95A 1A97A 1NDUA 3JQGA 4BNZA 4FXPA 1DJOA 1KH2A 1CUVA 2HBRA 4PZDA 2VDJA 5ECDA 4RQAA 4JASB 4XPIB 2P1ZA 4EAAA 4UXIA 4U2FA 5EWMB 2LE0A 3WK7A 3L8MA 1AKYA 2I2BA 5KPDA 4LXUA 1P0MA 3VSBA 1I01A 1PWXA 3UA4A 1P4JA 2RI0A 1XDGA 1EUZA 3PSAA 2BRUC 1HFWA 3EH2A 4L08A 4FR0A 2XDQA 2GGSA 1XTUA 4HH0A 5JAMA 3DT8A 4GEGA 2ERCA 1RDFA 4B6SA 1P74A 3FDIA 4D8TA 4OHZA 3EQ6A 1YZFA 4FR5A 1U5BA 3CB2A 2NGRA 1EVKA 4TKMA 1AS0A 4WZBB 4BQRA 4BO1A 4GVXA 5IULC 3BPSA 2G4LA 1INLA 2YXBA 4P4NA 1AHNA 1SBZA 4BO9A 2DERA 4YWJA 4W9NC 4BPRA 2C20A 2QVYX 2EJWA 1KI1A 1U3VA 1L5FA 1QONA 4N7MA 4K26A 2WA2A 4M3NA 2R6ZA 5IT4A 1P2DA 1ZC3A 2EW2A 3N59A 3A9WA 5AHXA 2LVBA 1YKSA 1OLXB 2Y1LA 3PDUA 3GARA 4P8RA 3KVRA 1XHLA 3NU1A 4OGKA 3CF6R 1N5DA 3NTOA 4BP8A 1TMGE 4BLRA 4F1WA 2W83A 4WLFA 3MMNA 5CFLA 1V6CA 1N57A 1U98A 3QEMA 5E3HA 1T5LA 5IHPA 3V1NA 5A2QA 1JWAB 4W5RA 2P40A 2WKQA 3D3WB 3F6PA 4A2WA 1VL8A 4O4LF 1KC1A 4EENA 4PCVA 4RULA 1TW2A 4EW2A 4IFIA 1NF8A 3LY7A 1VL0A 2XVYA 3DPSA 3OH8A 2AE2A 1Q6ZA 2RKOA 1THGA 2WYIA 3BRSA 3OIUA 3F5QA 3HB7A 1DBWA 4XGKA 2LR0A 5EQJB 1RADA 3S2GA 4BWVA 1YCGA 2C98A 3UM9A 3EFHA 4L07A 1I9CA 1VIVA 4PHHA 5IABA 3NIFB 1ZWKA 5DM0A 3R6LA 4JP1A 4WN9A 2V58A 2FFBA 3BD8A 3V8MA 3I5XA 2QRLA 2L42A 2WJPA 2XGMA 3DL0A 4KMSA 2EG9A 4BN5A 4OQMA 1LZKA 1WP9A 3OAAD 5EUCA 3SC2A 4YJ3F 3L6BA 1ST3A 5J2TA 2XBMA 1IH8A 1C8BA 1R4AA 1QMPA 4L4YA 5F1KA 1N6OA 1O08A 2R84A 5JMPA 1V9SA 3DKIA 3QFCA 5KOJA 2O8BB 1Y9DA 2FP3A 3BH7A 4FEYA 3QEOA 5ICFA 2VR1A 1TUBB 4MW7A 3ASUA 1ZY2A 3DXYA 2FOIA 3A2MA 3FKJA 2GD1O 3QNUA 4FS3A 1JDTA 4GIBA 2NXEA 1KAGA 3JYOA 4WI1A 5D7NA 1JJFA 5ICSA 2JJ2D 2AYXA 5J4HA 3JD0A 1IDOA 1TC1A 4G0NA 5K6AA 4E46A 2RHCA 1GDHA 2VSOA 2GH1A 3A3OA 3IBGA 1J1IA 2Q4TA 4BVGA 4CTKA 4FDVA 2RHWA 5A04A 3A6GA 2O54A 4GR9A 5B3JC 3LP8A 3VR6A 3X2EA 3L6CA 1LBEA 1USGA 3KXLA 1OYOA 3PTAA 2D00A 5HIAA 5IUNC 3GYGA 5FBRB 4BUZA 3NR2A 1H0SA 4QGHA 1ZSYA 1HE1C 4DYHA 2IH5A 2ADOA 4H60A 4P36A 3EC2A 1RBMA 3IVMA 1C3JA 2XUGA 3ABZA 1TNDA 2JL1A 3GWGA 4LJSA 1DAMA 4DBLC 1ZQ1A 1MVNA 4XEUA 1JHUA 4XDYA 3ZY5A 3LQ4A 4IGIA 2XNDA 5FL7A 1Z2AA 1MJNA 3V1YA 3WXMA 1CEYA 3PXBA 4RIEA 4P3YA 1M6YA 4G3XA 2CK3D 1M33A 4LZLA 4OB7A 5IK2D 1GPH1 1GA6A 4H35A 2HPVA 2XJ9A 3R3YA 2OCXA 3NX4A 1E9BA 3PFBA 1H8EA 4GZ3A 4MV9A 4OQZA 3VR4D 4F2GA 2BZGA 4JZKA 1SBYA 3ZDFA 3N7UA 4GICA 3ZH2A 2Z6AA 4CRWB 1MMFB 2CDBA 1AKTA 1FRFS 4PAMA 1EFRA 4XA8A 3H2KA 3UGTA 3WLRA 2H65A 1QYIA 3GA7A 3TVYA 1UFQA 9ATCA 2P77A 1N5JA 5DEIA 121PA 1ND5A 3BERA 5BSRA 5DX1A 5C46F 4NKRA 3GFOA 3KWLA 3LX4A 2BR4A 4M2LA 2JHFA 2PZJA 3AVWA 4RVOA 1A7AA 1SM4A 1IZ7A 1LPSA 3MUOA 4HWTA 4TMZA 4LFBB 2FEWB 4LY3A 4RYDA 13PKA 2DPGA 3ZCSA 2ZUEA 4XYBA 4U8HA 4BMCA 3UUWA 1TADA 3MD9A 1P75A 4FHDA 1UBSB 1GUBA 1GZSA 2FSFA 1C3LA 3EPKA 4HDQB 2IYZA 1KIFA 3BOSA 4MKXA 2PZEA 2YC2C 3EXHB 4JQOA 1P3Y1 4NCXA 3V8RA 3TAUA 2IOFK 4YY3B 1SD5A 1T2FA 4Q24A 3PEVA 4YAFA 4NCJA 2H8GA 1U2RA 1XJCA 4R31A 2QB5A 4UVEA 3ZW7A 1QH9A 3AW9A 3ESYA 3P2IA 4A27A 2J9XB 4GQAA 2G4VA 4DNXA 1NWHA 3SOPA 4QXMA 3OM1A 2XUKA 2FFQA 3RTGA 3LLUA 1XMQB 1AK2A 2BM8A 2HJWA 2F3RA 3QKRB 3ETLA 4EB3A 2D8AA 2P35A 2VPXA 3VYWA 4JN6B 3VYTB 5ISMA 1GFZA 4M0EA 2E9SA 2VP6A 2ODNA 3AY6A 3JCZA 4JU8A 3UYLA 5JDCC 4RZQA 3R75A 2VIIA 2GS9A 3FFTA 3EIEA 3FVTA 4B43A 4K1LA 4YAKA 2E4XA 5HKOA 2EXXA 1FP1D 3QE9Y 3W79A 4O4LB 2D1RA 2QYSA 4R5MA 4JV5B 3OOEA 2OBXA 2CBXA 3WKCA 2NVWA 3RBZA 5C8YB 5DYTA 3E3AA 4B3SB 5IJ9B 5AVXA 4BTEA 3M4XA 1I2CA 2QQGA 3MCUA 3Q3VA 4O4JB 5JS7A 2B1GA 2F7SA 1FVOA 3EAQA 3W06A 4JLVA 4FBLA 4HXEB 4BX0A 3ZWAA 4EYEA 3CCBA 4G4SO 3B5IA 3HL4A 3ILHA 3KQMA 3RVOA 5KQMA 1KDRA 2L0XA 3QG5A 3BKXA 1Z0AA 1XNGA 2VTEA 3R7NA 1UBTS 4TXLA 5CB0A 1ABEA 1NPTO 4EG3A 1ISRA 2CBZA 1NE2A 3ESZA 3FLMA 4MNTA 2BT4A 4H4CA 4ARSA 2H1VA 4KPFC 3STYA 5GINE 2H85A 3ZW8A 3EIOA 2INGX 3RFUA 3NJRA 4FOSA 4GE3A 1F4VA 3MTQA 5L8VA 3RT1A 2GJ9A 3C3AA 5K9ZA 3PWKA 4XR9A 3SKXA 1OA0A 5GV8A 5AVZA 5EJ5A 4HHEA 1SOAA 1OWNA 2IUFA 4CL2A 3NVKI 1ZSVA 1KDOA 2EP5A 2V3VA 2GAOA 1P5FA 3EN0A 4OB8A 4QBIA 4RCVA 5FADA 4CJXA 1IY2A 3SF8A 1GKUB 4BV9A 1YNSA 2GERA 3ZBTA 1B0AA 2CWWA 5EI5A 3O4VA 3T4UA 2ERYA 1T2UA 1P7CA 2OECA 2R44A 4JC0A 3QF4B 3SQOA 2CNLA 4A2QA 2B8TA 5KU7A 1GTVA 1HO3A 3CKKA 1F17A 4I5IA 1E3EA 5GMOA 3GFGA 4FHCA 1QH8A 1C5KA 2C9BA 5TX7A 3WLFA 1GGVA 3W2EA 1JTFA 5ESRA 3DXFA 3WGKA 3VJMA 4MSUA 2WIKA 2B1RA 2HV9A 4KVZA 1TT5B 3GLGB 1XQ1A 5H3LA 2ZRGA 1Y9ZA 1RKXA 5KX5B 1FLVA 4FYIA 4AWAA 1P31A 3C6XA 4OKNA 2B3TA 3WISA 1I1NA 2ON6A 1H5UA 1V41E 3O31A 3FFAA 3U7EB 4UEQA 1ESEA 4H77A 5AP9A 3UMRA 4S2UA 3ODPA 3AEZA 2C5LA 5IFLA 4JUCA 1KZ9A 1OWOA 3F4BA 1TX4B 1YH3A 4UUBA 5FPQA 1Q0QA 3BE8A 4CM4A 3QUQA 2QG4A 5TGTA 3FCAA 1Y5MA 5KJCA 4Z4QA 4NK5A 3HKDA 4MW0A 4LW8A 1PQYA 1SCKA 4M1YA 2A1TR 4JK3A 4XFJA 1D2HA 4PLFA 3DAHA 1IE3A 3NHWA 3NAGA 5F2OA 4O4IF 4PQGA 4DA6A 4N48A 4CKXA 5I01A 4GPZA 4B47A 5K3EA 2IHKA 2J3IA 3D4PA 3BILA 1JALA 1WF3A 3KPYA 1UPXA 3USES 2DHCA 3CN9A 2XD4A 3MQFA 4JJIA 1TF2A 1XLUA 5GM2A 3TTUA 1I7SB 4GYYA 2FSGA 1XD8A 3DBRA 4U8GA 4ZO9A 4D42A 4Z4HA 4B4UA 1NW3A 4CMAA 3Q6NA 2OQRA 4F1JA 2BH9A 2CF5A 3Q5GA 1P91A 3D1VA 4O8CA 4PO3X 2VDQB 3WVNA 5JIBA 5K8TA 2XCSB 3GYBA 1D8AA 1JZTA 2BUCA 2ZSDA 3KTAB 4O25A 4PC7A 2NO4A 2IVZA 1XWFA 3E84A 3QE0A 4D4JA 3ZJ5A 4AP9A 5MN5A 2GASA 1DV2A 1Y0BA 3N0WA 4R71A 3GUZA 1SULA 3F90A 2J6CA 2IZOA 3F6EX 4IP0A 3QJ5A 1CF4A 1Q3KA 1OUMA 4JJGA 4MV4A 3E3MA 1P1IA 4AMZA 2XCQA 4MUIA 2MYNA 3AB3A 3PNLA 4Q03A 4R01A 4UQOA 3ULKA 4ZMRA 1I4DD 4C3ZA 5K6TA 3MAJA 4MPJA 2NQTA 1YJXA 4E5SA 2P4EA 3HXLA 5JWRA 5EGSA 4YLYA 1OWLA 1GFIA 2X8JB 1PFYA 1ZA1A 3CXRA 3H5IA 1UBRS 4IZOA 1Z9BA 5A3RA 2PR7A 5DH9A 4GECA 1ADGA 2HWUA 3HHEA 4HBZA 4PC1A 3EYWA 5L6LB 2ZU0C 3GJQA 4JIGA 4BPBA 3F3YA 1R8SA 5BW8A 3E9RA 1QLWA 1DHTA 4TN5A 3DMFA 3ZYCA 1H4QA 3LGSA 3RYIA 4RVSA 3UMSA 4Q7EA 3MINA 3M1AA 1H93A 2BLNA 1Q95A 2P2ZA 2QG9A 4FBGA 2H6EA 5HQTA 2GM9A 4C0BA 1WDLA 4YP5A 5IDVA 4BLPA 1O3YA 1CF2O 2AYZA 3OZCA 3H5VA 3N3AC 4IOLA 4Y2QA 3HO1A 2J45A 4GKBA 2OHHA 3I9V6 1W2WB 1PR3A 2QTVB 3PWTA 1AM4D 4ZCQA 4TUYF 2GFHA 5BMVF 3WA6A 1KZ1A 2XIJA 1GUAA 5HJEA 3BWYA 2B21A 5FX2A 2QBYA 2FSVC 2E2WA 4QGSA 3KQNA 2CUZA 1PR1A 4BECA 1BROA 3FTFA 1EBFA 4ESOA 4G6ZA 1OU4A 4BLQA 3RC2A 5TIIA 3FUWA 4LKOA 4M0LA 2R60A 4NABA 4RK6A 3RTBA 2F67A 1M1NA 5DM4A 4KEAA 4MAFA 5FHRA 5FNVF 4DJ5X 3KQUA 3GW8A 3HJHA 4PYIA 5IARA 2XWJI 4NZYA 4KQ2A 5FBHA 4HDCA 4MJ7A 1UXIA 5EJIA 3RM3A 1CYEA 4KC0A 1HLGA 3F5MA 1L4GA 4J91A 4KXMA 2PT9A 2IYOA 1QK5A 4N3GA 4Q9NA 4QU5A 3W8FA 2C9MA 5T8KA 1NYLA 3QHPA 5ETJA 5CURA 1ZIOA 3OLQA 2BRUA 2EKPA 4FLMA 4WXMA 3JQ7A 1I13A 2CUTA 4CQMA 5I47A 1Z7GA 1WQ3A 1C9EA 4J1QA 4W5HA 2JH9A 2O1EA 3H4IA 4D3SA 4C4YA 2ZI6A 1GCIA 3LIPA 2FA9A 1JIKA 3TL3A 3WQHA 3LBFA 1KI6B 2OP0A 1PR2A 3U4DA 1EE9A 2H9YA 4I9FA 1K06A 1EXMA 5HTOA 4DFDA 3E23A 1X9HA 4W9NA 1NXXA 5ABPA 3E9DA 3FWPA 2NU8B 2ONZA 2WF8A 3DQQA 4DQLA 2FPRA 4RHFA 1KEVA 3ZIAD 1OI3A 2FZLA 4E13A 5KYWB 4H6WA 1KFCB 1MW8X 1AKVA 5CFMA 3OEWA 1ULUA 4D8XA 3O8RA 4MVJP 2JLYA 1KI2A 1TU0A 4UEOA 3S5UA 3EAGA 2BBWA 1SGWA 2HCJB 1K89A 5A1TA 2XPCA 3EF0A 2Y8EA 4G5RA 4G67A 4I99A 4GWKA 4PFKA 3KZCA 3M6XA 4KN8A 3OQ1A 2WB4A 1P8AA 3G7NA 1X1BA 4ES6A 4PTLA 2G6TA 1AB6A 1E61A 1J00A 4WPGA 1QQTA 2EC5A 4F8EA 2QVGA 2HX1A 1GHTA 1H2WA 4J0HA 4WFKA 3TNJA 3MZ0A 5HQ3A 2VZ8A 3LQKA 3I05A 3NQ41 3GJRA 4RPIA 4KMRA 3S2FA 3JYLA 1ZUNB 3N1UA 3O2NA 3F2VA 4GI3A 4BNHA 2XCTB 1W5SA 3LXRA 2B7LA 5AK6A 4NDNE 4N3BA 1GARA 1R9JA 3NOQA 3NP9A 3O1IC 1KY3A 2UZ4A 1EGAA 3OC0A 2I03A 4DIOA 4LZZA 2DQZA 2O7QA 1TKCA 1VBMA 1WMFA 3MWDA 2O3SA 1MC4A 2JK1A 1HRDA 3AILA 4RA6A 1T2NA 3U5TA 3BRWD 2C2MA 3H13A 5P8WA 3U4CA 3GUUA 5AJUA 3SU8A 1DXOA 4YO7A 4YWHA 1Z29A 1DBSA 3FNFA 1R0LA 4JSYA 2KLHA 1N5RA 2X6QA 2ZS8A 3OCVA 2YNMD 2O3JA 2Q07A 1OX5A 1EI9A 4BP3A 2W6IA 3P7MA 3UMMA 1O2DA 2DR2A 1D1QA 3ZNPA 3SLKA 1ARZA 1TZ2A 4QXRA 3RF7A 4HAIA 2R4TA 4JH0A 3TKAA 1AKRA 1FA9A 1AN0A 3FVRA 3GLVA 2GCNA 1CUYA 3OZGA 5B3JA 3L4SO 2QMYA 3MW8A 4Q3EA 2WHPA 1GZ7A 2HSWA 1RWNA 3TBHA 3B1YA 1QV7A 2PKEA 2A3NA 2AZDA 3KOUA 1EESA 5T7BA 1I3NA 5GJBA 1KF0A 4A26A 1FFXA 2YJ5A 3MUNA 1SC3A 2W93A 4KR3A 1BJKA 4MGHA 1PT5A 3R44A 2O2XA 3EXHC 1JQ5A 3LWBA 1M0WA 4CQLA 3ABOB 1D1SA 3R3UA 4EHBA 4XFKA 2GEBA 2C3PA 3UAXA 2G67A 5CT6A 5M34A 2HEGA 1CJMA 2IPNA 2PS3A 1Z18A 4QOHA 2WZQA 1I2DA 3M7IA 5DCLA 4Q48A 5E7IA 4C3VA 2NVBA 4B2PA 1EP1B 4BMDA 1PV4A 1TVKB 4UEJA 2YWCA 1CCWA 2UYYA 3UZUA 3IT3A 2M6RA 3T0IA 2NOAA 2QDXA 2RSLA 1T6NA 5D1HA 1P9WA 1EYZA 3C5EA 5CRIA 4R68A 1T3SA 1L9KA 1TQ4A 3EQ7A 4EG1A 4YV0A 1KEWA 3DWGA 3HMQA 3ABSB 3KSUA 1NUSA 4Q82A 4Q37A 4DB4A 4RZIA 3FBGA 1RMYA 1E3JA 2OCPA 2OPBA 1R5BA 1OV4A 4FGSA 5I7VA 4JWTA 1JKFA 3CS3A 4OF4A 3TZQA 3U7HB 1U2EA 4RTKA 4J3NA 5K0TA 2J3EA 5F52A 4RVGA 4DR1B 5HK8A 3OMWA 3HBNA 4CEIB 3KPUA 2AN9A 2JFXA 3MYRA 4L72A 2GLUA 2L82A 3UAYA 5C5CA 1JUDA 2PUGA 4R0MA 4DGSA 3E15A 2IGBA 3L7LA 4GSKA 1Z63A 1X1QA 2YZMA 3L7MA 2E5WA 3RKSA 2G5PA 1GL3A 3NASA 3AFGA 3LUFA 4OJMX 5AUOB 3TSYA 3H8WA 1NJ6A 4JI6B 2PU5A 1EQAA 3RVDA 4X54A 1MX3A 3SM9A 1ZN2A 3PR3A 2ZVQX 3SXUB 5CXSA 1HX7A 4OP1A 5CPBA 2AMVA 4XIFA 5K2MA 4L57A 3VR5H 3WIOA 3DVSX 1EWVA 1Y8QB 1YV9A 2N75A 2VDVE 1RJFA 2JGKA 3OJLA 4LDAA 4TSFA 2C59A 3F2IA 3RIMA 1AU9A 1H94A 1XWWA 4MQEA 3U9TA 1AXGA 2CFOA 3ESXA 5ICEA 1Z6XA 4UUNA 3DW3X 4FDMA 1GAWA 2RARA 2YFQA 4GM0A 2CV2A 2PV0A 2VLBA 3ACBA 3NWPA 1L1EA 3HCCA 3CUSA 3R7FA 2NV6A 4J75A 2RIRA 3B3GA 3VI3B 1XPRA 5EQFA 1RJWA 4MQBA 1J70A 2V7XA 3IAXA 3N76A 1WCWA 2EEPA 3B5JA 4GOOD 1GZ5A 3V1MA 3PRJA 4IUBS 4NG5A 4EPWA 4ZV4A 4QPPA 3P5BA 1VL5A 3VNUA 3MERA 3GJ4A 4EF6A 2VJDA 3O82A 5JO0A 1WLYA 1GGFA 5EYPB 5HS6A 3HMKA 2QMZA 2UZ0A 4KE7A 4NV3A 3DUWA 4TL7A 3KSBC 1REQA 2J7KA 1W2GA 4CXMA 1Z06A 5T6MA 3WBKA 4A5SA 4CFSA 1ZRMA 3C3YA 2A30A 2AJCA 1O1YA 2IFTA 2PWZA 4AY4A 1PYOA 2GTHA 1WG8A 1ZVQA 2COKA 4UMVA 9LDTA 4KQMA 3TRKA 4O6VA 5EIHA 4B83A 4MEAA 5JU6A 1Y8RA 2R8PA 4PCLA 3VMFA 2C1EA 4F4FA 1SG0A 3AVQA 5CVUA 3M6LA 2NMVA 4FFNA 3V7UA 2QAIA 4O3MA 4CN9A 1IHYA 3EVAA 3ZDRA 1DRWA 2VPWA 4DEVA 1AQIA 1O95C 1FOEB 2NZJA 3N0RA 1Y8AA 3IBFA 4J29A 5A3SA 3NHRA 5CYGA 4TZ0A 1NKTA 3GJYA 3RU7A 3ROKA 2VZ0A 3SJUA 1L5ZA 1NXWA 3T1YB 4PCUA 3WLNA 2CNDA 3W5DA 1U7DA 1FE8A 3ASVA 3LT2A 5KOHA 3K70D 3CO0S 1NOKA 1PT9A 2WMOB 5CK5A 2KHZA 4RIHA 5FFNA 1R3DA 2Q5HA 5LDGA 3GV0A 4L85A 1P8JA 1H1DA 4N18A 4TV8B 5CMLA 1SEPA 3SVZA 3VPGA 4BO8A 1L8QA 1TQ2A 5DTQA 3D0QA 4ZYTA 5I9NA 2H1HA 4YEDA 4BFUA 4F04A 2HY7A 5DP2A 1YQGA 2Z5FA 2PX8A 2MR5A 4OHOA 3VV3A 2BFBA 2AGVA 1YJQA 2MYUA 2XE7A 3OEED 4P38A 2FZ4A 1GEEA 1PNQA 1Z6PA 2P41A 3R77A 4M1KA 4ND4A 1TQDA 2OZKA 3BBLA 4I0WB 1PFWA 1KRHA 4PAOA 2I6GA 4X93A 2HHHB 1NRJB 1HE2A 4TMYA 2H11A 5KEIA 3RC8A 4AQYB 2D1TA 2BM0A 2IZ6A 4QQ8A 1SB9A 2EFEB 2YOGA 1UPFA 2R7MA 3FWHA 2FF5A 3VTZA 1A4RA 1H4VB 1VJ1A 4NZMA 5JS2A 2PH3A 2W6CX 4MDFA 2Y4OA 4O4IA 4I50A 3FZGA 4WDRA 1U3FA 4KVAA 4OEHA 5JPDA 3RVRA 5KX5F 3DNFA 1CDDA 1QCZA 4MEJA 1Z33A 4H16A 4HNAA 1BS2A 1S89A 2YKGA 1V5WA 3CN7A 4LN1A 4G89A 8ABPA 2ZRPA 4H7KA 3IR5A 3PIIA 3JR3A 1NKSA 2N47A 5EP2A 5MFPA 3QVJA 2H7VA 4YRDA 1R6AA 2I9PA 1BKSB 4KGVA 3PXEA 4RHYA 4BCDA 2PBLA 2QJWA 4D0NA 3B9BA 1BGVA 1XMIA 1H0HA 2X8AA 4FUQA 2Q41A 3Q6MA 4OO3A 3EDYA 3LLVA 1BCRA 3H75A 4ZAVA 2H1WA 1RBQA 3MSCA 2PUTA 1K0UA 3OX3A 1KY2A 3L9XA 3NNNA 2WJGA 3E7PA 4Q66C 4ZQEA 1KYVA 1G41A 1I4LD 1RM5A 1M54A 2Q1UA 3L46A 3OCCA 3QX7A 1EUYA 4EELA 3IIMA 5L3SB 4PTZA 4RJ2A 2H5LA 1W35A 1YJ8A 3PSHA 3UXYA 5FT9A 2FN9A 1ISFA 4BGVA 4HAYA 5MHTA 5TGZA 2G9RA 5CYPA 5AI0A 1K7SN 1XVUA 4OQPA 3I61A 2D06A 1RHJA 3BWDD 1GL9B 2D1YA 2FZWA 2MJLA 3GCXA 1CP2A 4NDAA 3HB0A 1ZJ6A 4PZCA 2G83A 1X1TA 1LJ8A 3GUCA 4RPHA 2PNFA 4BP1A 2AS0A 3VV2A 5CB4A 1ZW6A 1D8TA 5AJWA 2I7DA 1PP4A 4G0UA 1G3UA 3RREA 5TGDA 4PIPA 1H1LB 3C6YA 4CDGA 4I3FA 4IUYA 3PHLA 1W6RA 1ZJZA 1JR2A 4ARBA 1EAYA 3ML1A 4WTOA 3TJRA 2HRQA 3HKEA 4XD7A 4JUDX 3QEAZ 2V0NA 4TUYA 5BMVA 2NO1A 5KYUA 1YCDA 3AEKB 2NSHA 2VJAA 3CH5A 2ZI9A 1LW6E 3K16A 3K4PA 4KZKA 2VRCA 3TCKA 2OC9A 1B0PA 1DPFA 2GZ1A 3AM3A 3O47A 4L5BA 4AZ0B 4N76A 1G7TA 1L7RA 1SQSA 2WVGA 2A9PA 5DZSA 3DEIA 1JSZA 5F4ZA 1RLUA 1BMFD 1FSSA 1ZH0A 4MMYB 4QJ5A 2E6UX 1BU8A 1JKIA 4MOWA 3TK1A 4PFQA 3TW0A 1HLPA 1Q20A 5FNVA 2EF0A 1BVHA 4ZZ3A 1LTHR 2LW7A 1E6MA 3GJ0A 5JCJA 1COZA 1UBGA 3AB8A 1NW6A 4L5IA 4LTMA 4Y9TA 4D46A 1E3IA 2VP5A 2YXPX 1I4TD 1NNSA 1BD3A 3EXFB 4Y2JA 1DAGA 2QM7A 5DW0A 2AOWA 1K92A 4PO1A 1ZAYA 5JYEA 2J4FA 5H80A 5C37A 2P68A 3ELDA 2IOQA 3MS7A 5B7GA 3PJFA 2QORA 2I1VB 2RK6A 4J07A 5CBPA 3KHUA 2IYPA 3RNLA 2HU7A 2QQEA 5E0KB 4OQ4A 3DUFB 4G37A 5I9MA 3TO5A 5LYYA 1N2HA 3G0CA 1E2HA 3F6RA 1YU9A 3L8DA 2OZPA 2E6KA 3R5SA 1PHRA 1YE3A 2QX4A 2WTMA 3FWZA 2FSVA 4PHFA 4QJBA 3IDZA 1OILA 3AJ8A 1LA2A 5AKZA 5K8JB 2FLWA 1C41A 3NZEA 3Q40A 2BI4A 3OQIB 4K87A 2H2WA 3A25A 2VI5A 4AO7A 5EKTA 4A23A 5KNDA 2MHCA 2BGTA 2A84A 1GTZA 2RHRA 3M33A 4CM8A 4OX9Y 2A9KA 4FDLA 3SHWA 2B9EA 3E1GA 4ME6A 4ND6A 2OSBA 3IQFA 2CNKA 2FMXA 4FFLA 1T8TA 3QWIA 2C9YA 1IY1A 1OAOA 3IPLA 2R1VB 1N9GB 4JQYA 3A14A 4NY1A 2VP9A 3GDWA 3H2BA 4Q7MB 3PF9A 4WE3A 4DUGD 4L2IA 1JU3A 4WKPA 3SX4A 4NSNA 4D43A 5C5IA 2H00A 1DC3A 1FQOA 2FHPA 4KG7A 3MWYW 3MWEA 5FPYA 1AURA 2M6KA 5JH7F 1NN1A 5BWMA 4EFKA 3IQHX 2CMHA 2QLMA 2GPBA 4IKOA 1ZKDA 3RF6A 1N9ZA 1Q21A 3UMBA 4BB6A 1JIIA 1DPGA 4MKRA 5HKKD 3AK4A 4L4XA 1IAVA 4LRSB 5SV2A 2FK8A 4FLFA 1MG5A 1PSWA 2C61A 1CVIA 2GZDA 3FPKA 4UAJA 4UEWA 4XH9B 3HCBA 1IHOA 5CB6A 3INRA 2YJ6A 4ZQCB 3A11A 4YTEA 2P75A 3HZRA 4I6GA 2PPVA 2X9NA 4H7IA 1WCIB 1ZUHA 3OA2A 1WHTA 3AKEA 4DMKA 3TSZA 1TK2A 3M49A 4K28A 5EJAA 1R37A 2AR0A 3AC0A 5E8RA 5ALUA 3H9BA 1GYPA 2XOKA 4L9WA 5JNSA 4KUGA 1IBRA 2BMWA 2IUSA 4ZKEA 2BONA 1R6XA 3LC0A 1PTKA 2FQYA 4KO8A 1QPZA 3OFKA 2VJQA 4MZXA 3U40A 4JKYA 4LHVA 3RYFB 2DYKA 1E4VA 4UHDA 2CLCX 3QPCA 3U1VA 1L8XA 2I7VA 1J0AA 3ORRA 3IXLA 4PLYA 2QQFA 3TJZA 4BFLA 1Q3HA 3QVGA 4HEA6 4J6FA 1E5VA 3M1LA 4C5BA 1ZD9A 2BJVA 4RKYA 3M3DA 1WUJS 2WTUA 3R41A 1IFXA 3PQ6A 3KWJA 4PZYA 5EMLA 2RB5A 3C5WP 4DWWA 2I4NA 4U4AA 4W82A 3Q9UA 3QVLA 5I9SA 1QQ5A 2H51A 1IG0A 2Y1OA 4II7A 2YVQA 5B1EA 10MHA 2FZKA 3HHPA 1VPLA 3B6EA 3P9XA 4LHEA 3VO2A 2BGIA 1F06A 4Y1GA 1E7QA 2FG7C 3L43A 4TQ9A 2EKQA 3M89A 4Z8XA 4NESA 1CUUA 1H8HA 2C9DA 1KQGA 1PQUA 1PV2A 1OTXA 4G41A 3T0GA 3EVEA 1ZR4A 4HNUA 5DYNA 3IULA 4YS6A 3TRFA 3UJDA 3VC1A 1TVEA 3PU6A 2PRZA 1UK6A 2R48A 3LLSA 5JCZA 2C00A 3N3BC 5GVRA 1V3UA 2Q0SA 3NHBA 1LS6A 2VC2B 3QPDA 4PZAA 4AJPA 2DBQA 2Z0MA 4WKCA 1TW3A 2XR1A 3DZDA 4U2DA 1OI7A 3LYAA 4PZEA 4ARZB 1YBVA 3UK1A 3I1IA 3R2JA 4FBMA 4XB2A 3ZVKA 1SWWA 3HY3A 1X94A 4X20A 1DIBA 3SF0A 4DZRA 5FUMA 3M5CA 4F3YA 5JYDA 2JLXA 3ZJTA 3NKFA 4RD1A 4QXQA 3L1HA 3P96A 3Q8XB 3QOWA 2EP7A 1MPXA 4KI0A 4BIMA 5GIPE 4CLOB 2PR2A 1XRMA 4KWTA 4Y6RA 5DK4A 3LPAA 1VMEA 1ZJYA 6NULA 1XOIA 4RLQA 1W1UA 1Z6GA 3NCHA 3CYFA 4D80A 1FYWA 4K46A 4U2EA 5EHQA 4F9GA 2F43A 4QUIA 4RPKA 1GU7A 3PRKE 5JZ9A 2ZB3A 5IJWA 5JW6A 4EMSA 1NL3A 4V3CA 5ADWA 2PJUA 3VKHA 4AN4A 2J87A 4TZKA 3WG9A 4GZLA 4PM4A 1X38A 5CJPA 1A72A 3HCPA 4E12A 2LDBA 3VH4A 2SECE 4KNYA 2VK8A 2F55A 3ROEA 2W2PA 1XRRA 2WT9A 1GQQA 1Z45A 1R0CA 4BLVA 4UZSA 5K8CA 4Q4DA 5AHWA 3B6KA 4CL3A 3UCFA 4R2KA 3E61A 4E5PA 4BRSA 4MV5A 1EJ2A 1VGQA 2DWUA 3CUTA 1LXCA 4A6XA 4C88A 4Q5IA 1CK4A 2XRYA 1R4ZA 4H1HA 3A6LA 1N3YA 1QJ4A 1U0RA 4KIGA 5KNCD 4W8GA 1Z6AA 4DLXA 4LDQA 4ON9A 4IW3B 1AG9A 3ONFA 2LD4A 1AMUA 1E2NA 2A7QA 1UXOA 3RGWS 5BNZA 4C2BA 5KYXB 5T4FA 4ED9A 1EK5A 1WUYA 1PF7E 1Y7HA 1OLUB 1DTWB 3KQKA 3F78A 3L6EA 2VUUA 3ZLBA 1V7QA 3ZS8A 1T3GA 4CMCA 4B3JA 1PQPA 2BHLA 1USVA 3GDFA 4QPCA 4DV5B 1BN6A 2WQ6A 2G72A 1A4IA 4RY9A 2WIJA 3LBAA 5LP6B