4MQDA

Crystal structure of comj, inhibitor of the dna degrading activity of nuca, from bacillus subtilis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
133
structure length
133
Chain Sequence
AMIKSWKPQELSISYHQFTVFQKDSTPPVMDWTDEAIEKGYAAADGAISFEAQRNTKAFILFRLNSSETVNSYEKKVTVPFHVTENGIHIESIMSKRLSFDLPKGDYQLTCWTVPAEMSDLHADTYIIDAVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-entry nuclease inhibitor
publication title Crystal structure of ComJ, inhibitor of the DNA degrading activity of NucA, from Bacillus subtilis
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase inhibitor
total genus 25
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11033 ComJ Competence protein J (ComJ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.30 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 4mqdA00
4MQDA
chains in the Genus database with same CATH superfamily
4ILIA 4R5IA 4R5KA 4EZUA 4WV5A 1BPRA 4MQDA 1Q5LA 3QNJA 4JN4A 1DG4A 4EZWA 7HSCA 3C7NA 3DPQA 3N8EA 4EZZA 4EZPA 1CKRA 4ILHB 4EZSA 1DKXA 2V7YA 4JNEA 3DPPA 4JNFA 4HY9A 4I43A 5TKYA 1U00A 3DQGA 4F00A 4WV7A 3H0XA 4EZQA 5E84A 2KHOA 3SBTB 1YUWA 2BPRA 4EZTA 1DKZA 4B9QA 2QXLA 4R5GA 4R5LA 4JWIA 3D2EA 4JWEA 4R5JA 2OP6A 1DKYA 4ILGA 4JWDA 4EZNA 4JWCA 4EZVA 3ZEFA 4EZYA 4EZOA 3C7NB 3DPOA 4PO2A 3DOBA 4F01A 4FL9A 4EZRA 4E81A 3D2FA 4EZXA 3SBSA 4HYBA
chains in the Genus database with same CATH topology
4ILIA 4R5IA 4R5KA 4EZUA 4WV5A 1BPRA 4MQDA 1Q5LA 3QNJA 4JN4A 1DG4A 4EZWA 7HSCA 3C7NA 3DPQA 3N8EA 4EZZA 4EZPA 1CKRA 4ILHB 4EZSA 1DKXA 2V7YA 4JNEA 3DPPA 4JNFA 4HY9A 4I43A 5TKYA 1U00A 3DQGA 4F00A 4WV7A 3H0XA 4EZQA 5E84A 2KHOA 3SBTB 1YUWA 2BPRA 4EZTA 1DKZA 4B9QA 2QXLA 4R5GA 4R5LA 4JWIA 3D2EA 4JWEA 4R5JA 2OP6A 1DKYA 4ILGA 4JWDA 4EZNA 4JWCA 4EZVA 3ZEFA 4EZYA 4EZOA 3C7NB 3DPOA 4PO2A 3DOBA 4F01A 4FL9A 4EZRA 4E81A 3D2FA 4EZXA 3SBSA 4HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQD A; 
#chains in the Genus database with same CATH topology
 4ILI A;  4R5I A;  4R5K A;  4EZU A;  4WV5 A;  1BPR A;  4MQD A;  1Q5L A;  3QNJ A;  4JN4 A;  1DG4 A;  4EZW A;  7HSC A;  3C7N A;  3DPQ A;  3N8E A;  4EZZ A;  4EZP A;  1CKR A;  4ILH B;  4EZS A;  1DKX A;  2V7Y A;  4JNE A;  3DPP A;  4JNF A;  4HY9 A;  4I43 A;  5TKY A;  1U00 A;  3DQG A;  4F00 A;  4WV7 A;  3H0X A;  4EZQ A;  5E84 A;  2KHO A;  3SBT B;  1YUW A;  2BPR A;  4EZT A;  1DKZ A;  4B9Q A;  2QXL A;  4R5G A;  4R5L A;  4JWI A;  3D2E A;  4JWE A;  4R5J A;  2OP6 A;  1DKY A;  4ILG A;  4JWD A;  4EZN A;  4JWC A;  4EZV A;  3ZEF A;  4EZY A;  4EZO A;  3C7N B;  3DPO A;  4PO2 A;  3DOB A;  4F01 A;  4FL9 A;  4EZR A;  4E81 A;  3D2F A;  4EZX A;  3SBS A;  4HYB A; 
#chains in the Genus database with same CATH homology
 4ILI A;  4R5I A;  4R5K A;  4EZU A;  4WV5 A;  1BPR A;  4MQD A;  1Q5L A;  3QNJ A;  4JN4 A;  1DG4 A;  4EZW A;  7HSC A;  3C7N A;  3DPQ A;  3N8E A;  4EZZ A;  4EZP A;  1CKR A;  4ILH B;  4EZS A;  1DKX A;  2V7Y A;  4JNE A;  3DPP A;  4JNF A;  4HY9 A;  4I43 A;  5TKY A;  1U00 A;  3DQG A;  4F00 A;  4WV7 A;  3H0X A;  4EZQ A;  5E84 A;  2KHO A;  3SBT B;  1YUW A;  2BPR A;  4EZT A;  1DKZ A;  4B9Q A;  2QXL A;  4R5G A;  4R5L A;  4JWI A;  3D2E A;  4JWE A;  4R5J A;  2OP6 A;  1DKY A;  4ILG A;  4JWD A;  4EZN A;  4JWC A;  4EZV A;  3ZEF A;  4EZY A;  4EZO A;  3C7N B;  3DPO A;  4PO2 A;  3DOB A;  4F01 A;  4FL9 A;  4EZR A;  4E81 A;  3D2F A;  4EZX A;  3SBS A;  4HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...