4MQEB

Crystal structure of the extracellular domain of human gaba(b) receptor in the apo form
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
415
structure length
403
Chain Sequence
SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 139
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqeB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqeB01
3E3MA 3N8IA 3CG0A 3HEBA 3T6KA 2LIVA 3KYJB 1BDJA 1YMUA 5EWJB 3KHTA 3G1WA 1P6QA 2RJOA 4MR8A 1MIHA 2IPNA 3FFWA 2QW1A 2FQXA 3O2JA 1EHCA 4RK0A 3H5VA 2E4VA 3L6UA 2MYUA 1BDIA 3ILYA 3N0WA 5TQ0B 3A3KA 1M2EA 3KTOA 1U2QA 1U0SY 1TLFA 1RXEA 2R4QA 5KWSA 4LDZA 3I09A 3JVDA 4JASB 1AB6A 5FWXA 4IMJB 3UKJA 4MR7A 2CHFA 4MS1A 3HSYA 1Z2EA 2FEPA 1FFSA 5FBKA 1ZH4A 5C5CA 1YK1A 3I45A 1JF8A 3EQ2A 4G86A 3P9YA 2WWVD 3TX6A 1T34A 4RDCA 3BBLA 3LUGA 2J48A 2OQRA 5EWLB 1C0EA 3L49A 3MQ4A 2R48A 4MS4A 2A9PA 4HYEA 2FN8A 4NQRA 3OLVA 4OLAA 2FN9A 1FFWA 4QICA 1BAPA 2FMHA 4LDAA 2V0NA 4ETMA 4YRZA 3HO1A 4RXUA 3QLUA 3O21A 3HK2A 2QZJA 4KRFA 3RVKA 2OENG 3HDGA 5CNKA 2GI4A 1XHFA 4RK6A 1NXWA 2LUOA 3F6CA 3MIZA 3QELB 4ZMSA 4RU1A 3HVRA 2JBAB 1JX6A 3I42A 1MVOA 3RVOA 1QMPA 4OATA 1NXXA 2JVIA 1BA2A 1I3CA 4MR9B 4W5OA 3QX9A 5EWJA 2NZVG 1D1QA 3JS5A 4W5RA 3RQIA 4Z4EA 4G0PA 3O75A 5DLEA 1KGSA 4N03A 4OTZA 5DKFA 1NXSA 4MPTA 4EYKA 1DJMA 1VRVA 1HEYA 2IPMA 2L2QA 4FB4A 4RXTA 1Z16A 2HQRA 5TQ2B 2MYPA 3T38A 4N41A 1TVMA 4D6XA 2FSPA 4RY8A 3H5OA 1P6UA 3DLBA 5JS1A 5KC9A 3QX8A 3IP9A 1DG9A 4YWHA 3CTPA 3KLOA 3KJXA 6CHYA 4XXHA 3HUUA 3LKVA 4WWHA 3A0UA 3BRQA 3F6PA 3CLKA 5IUKC 2A9OA 2HQBA 3N0XA 3HXMA 2JVKA 3NNSA 3ROFA 2E4UA 2PE5A 1JHZA 1UDRA 5HKOA 1ZH2A 2ZAYA 3R0JA 4DQDA 1YMVA 2RDMA 2I6FA 1LJLA 1Z26A 4FE7A 3HM9A 2PUGA 3NHMA 2ZWMA 4MR8B 3EJWA 3OQOA 1E2BA 5EWLA 2AYZA 4KVFA 4KMRA 4YGXB 2IOYA 1U8TA 4QYMA 2QU7A 4Z9BA 4OLBA 3B2NA 1A0OA 3H5IA 4Q6BA 1PNTA 3LUFA 3CKMA 4WXMA 4YV7A 2ID9A 3UUGA 2IPLA 2FQYA 3M6MD 4KPYA 3HDVA 2PJUA 1DRJA 2HJ9A 1NTRA 2QSJA 1JFSA 1A2OA 4MR7B 3RVRA 3FDFA 1SRRA 2L18A 4MS1B 2ID7A 3HV2A 3LUCA 4YO7A 1JH9A 1W9HA 3RVLA 4Q6WA 3VNAA 1JL3A 1YTUA 1PHRA 3OM0A 1LBHA 1SXGA 4MR9A 4XFKA 2IYNA 4MS4B 1WETA 1JFTA 4H60A 3BREA 5KQMA 2XDYA 4OBBA 5TPWA 1NXPA 5IC5A 2MSWA 1JDNA 3RVJA 3OQNA 5FBHA 1JBEA 5TQ2A 1VKRA 1JFVA 2NUBA 5BQ3A 4KQCA 1USGA 4EVSA 2JRLA 1QQAA 4NCBA 1KRWA 1CYEA 4O5AA 3RVQA 1YIOA 3N75A 4RY9A 3HS3A 2A9RA 3JVIA 1YVUA 3UK0A 4ETNA 3KYIB 3BILA 3KS9A 2L17A 2PUAA 4Z4IA 4WZZA 3FGZA 1BVHA 5IEBA 1DBWA 1W25A 1LK0A 3Q15C 4IF4A 3I5AA 4RZSA 5IUNC 1Z17A 3RH0A 3A10A 1TJYA 3H5WA 3KKEA 2PUCA 3RVMA 4RKRA 3NBMA 1RXIA 3EULA 4KK4A 5F64A 2FEKA 1DBPA 2B1JA 3RVNA 2PAFA 4JP1A 4LX8A 2PUFA 4ZJPA 3QLVC 1R8JA 3OMWA 7ABPA 1K66A 3M9XA 1F4VA 4MS3B 2QXYA 3IPAA 2MSKA 4N0QA 2NT3A 4LE2A 3QLTA 4MQFB 3O1JC 5E3JA 3SM9A 4PICA 5ABPA 5JNSA 3DLHA 1Y1LA 1YK0A 4ETIA 3JY6A 5D2CA 3DBIA 3H1EA 4N0PA 3QEKA 4KQ9A 1SXHA 4YCSA 3K4HA 5TPZA 3IPCA 1ZITA 3TO5A 1QPZA 4RK4A 2PUDA 3SG0A 5KQPA 4W5TA 2WMYA 1SXIA 3IDOA 1EFAA 1DCMA 1E6KA 3KG2A 3OLWA 1GUDA 4CBVA 2HSGA 2WJWA 3HUTA 1L5YA 1DBQA 4KZKA 4Y9TA 1USKA 3FFTA 4LE1A 1PUXA 4Z0NA 3T95A 1MB3A 5GQSA 3D02A 3NNDA 4JOQA 4RK7A 3H5TA 2QR3A 2B4AA 4HNQA 4RXMA 1NXVA 5CNMA 1NXOA 5CNJA 5HQJA 3SNKA 4IRXA 1ZVVA 4G0OA 2QVGA 5IX8A 3MMNA 2E4WA 5TPWB 2PUBA 2FLKA 5BRJA 2IPAB 4M88A 4KFCA 3GL9A 2IKSA 2JVJA 2JCGA 4G0MA 4H3HB 4JB0A 4G0QA 1URPA 3D8UA 3GBVA 1OXKB 1ISRA 4RKQA 1U2PA 1EWVA 1GCAA 2E4YA 3N0RA 4MS3A 5KQLA 1AB5A 2WB4A 3JPWA 2RJNA 3A0RB 3CZ5A 3LKBA 1GUBA 4MQFA 4YS6A 3OQMA 4EGSA 4KNYA 2NT4A 3H75A 4LZLA 5IEJA 2PL1A 3K9CA 4G97A 1QP0A 4RS3A 4RWEA 1M5UA 2MYTA 1RZRA 2PMCA 1ZN2A 2F8TA 1E6MA 1ZHHA 1ZGGA 3OLZA 5TQJA 5JS2A 4KV7A 3OO1A 4HNRA 1P2FA 3CG4A 4ML3A 2VUIB 3O2SB 2N9UA 3LUJA 4G0YA 2VYCA 5HM6A 1P8AA 4MGEA 2FMFA 5EWMA 4E7OA 3LUHA 3C3MA 1JYEA 1DP4A 3ILHA 3KLNA 3CHYA 2FEWB 4RV5A 1ABFA 2GBPA 4TMYA 4E7PA 3MF4A 4QPJC 3URMA 2H0AA 4Z9AA 1QO0A 2LPMA 4FE4A 1D5WA 2R25B 1CEYA 3SY8A 4D74A 1YS7A 2M1ZA 5TPZD 2GKGA 5BR1A 2DRIA 3CNBA 5B3JC 4LE0A 4MRMB 1VPWA 2VK2A 3H6GA 4OG2A 1K68A 2FQWA 1C4WA 2H3HA 3H5LA 1Z18A 3RVPA 4D6YA 5IBQA 1APBA 2TMYA 5BRAA 1NY5A 3IP6A 4UHKA 3VNBA 2MYNA 4N76A 1KRXA 4XAQA 2YHBA 3LTEA 4WXEA 2RGYA 3SAJA 4F12A 2BGGA 3FMVA 2AYXA 6ABPA 3LUAA 1KMIY 3C97A 4RSMA 4PYRA 4DN6A 1RNLA 3F7NA 1FSPA 1PEAA 1JYFA 3DZDA 4LRQA 3ROTA 5JNUA 3QEMB 4MLCA 1ZY2A 2O20A 1D2AA 3BRSA 3HCWA 1ISSA 2WY2D 3S99A 3EODA 5KC8A 4B09A 3TB6A 2HQOA 3H1FA 4YLEA 4XARA 5CHYA 4PEVA 2HPHA 4G0ZA 5IULC 3O1IC 5JNRA 1RPJA 3O1HB 3RVSA 3G85A 1Z2DA 2QVCA 4YR7A 3LUDA 5JNWA 4MLDA 4DADA 1DRKA 3OLYA 4EVRA 1ZESA 3CRNA 4JA2A 3TMYA 4MQEB 3OM1A 9ABPA 3EQZA 5GOTA 4Z4FA 3O74A 1DZ3A 1EWKA 4RK1A 4JB2A 4Z4CA 1RZRD 4O1IA 1GCGA 4MRMA 5CNIA 1B00A 3IP7A 1DC7A 5PNTA 1FFGA 1VLZA 1H9CA 4RY0A 3HZHA 1ZAYA 5JNTA 1Z25A 3DGFC 1D4ZA 4PZ0A 3TD9A 5FWYA 2JB9A 1SD5A 2FTKE 2MSLA 1L5ZA 3KSMA 3MM4A 4RK5A 5EWMB 8ABPA 4S04A 1QQBA 4L4UA 4XASA 4W5NA 4WUTA 4F06A 4EUKA 1DCFA 1OXBB 5IUJC 1QNLA 5ED4A 2JK1A 1M2FA 2VUHB 2IDMA 2L19A 3H1GA 3C3WA 3LFTA 3W9SA 2FW0A 2PUEA 1QO0D 3Q7RA 4ZYLA 4EVQA 1XHEA 4G0XA 4XLTA 3E61A 1Z13A 4P1ZA 3QEMA 4GPAA 4YP9A 4MYRA 4F8JA 3DGEC 5DTEA 3KCNA 1LBIA 4Z4GA 3Q9SA 1ABEA 3GT7A 4H3KB 2E4XA 4GNRA 1QKKA 3NHZA 1M5TA 2FXIA 3EGCA 2X7XA 4IILA 4Z4HA 5TE9A 1D1PA 3O2QB 3OLXA 3GRCA 3N6VA 1S8NA 4P98A 4Q7EA 3HJFA 2FMKA 1ZGZA 1LJUA 2NZUG 2YHAA 3LOPA 1JDPA 3CS3A 5HSGA 4IGAA 2QV0A 1CHNA 3LMKA 2LBPA 4JAVC 5TQ0A 4W5QA 2R47A 4L85A 2GX6A 4MQEA 3QLUC 1JWLA 1PNRA 4ZPJA 5B3JA 3EAFA 2WJAA 2FMIA 1USIA 2CHEA 2PLNA 3N53A 2CD7A 5DGCA 3EDCA 1E6LA 3GYBA 1BDHA 2PL9A 3C6QA 3GV0A 2P4UA 3MA0A 3Q41A 3Q7TA 4ZMRA 2CWDA 3CZCA 3T8YA 2LP4Y 1TMYA 3GBPA 4NCAA 1EWTA 1FQWA 1TM2A 2KYRA 4F11A 1A04A 1Z12A 4EYGA 4UHJA 1QP7A 3SQNA 3LUKA 4O1HA 4EY3A 2P9HA 3M9WA 5I4CA 1DCKA 5KQGA 3JTEA 1GLGA 4Z99A 3F73A 3NNNA 4MAAA 2A9QA 2W42A 1JLKA 4KREA 1DC8A 4TLLB 3CFYA 2F8SA 4F3TA 1U04A 5FWXB 1QP4A 3QELA 4PE5B 5FWYB 3OO0A 4NICA 3IP5A 1EAYA 2JBAA 3JPYA 3QLVA 2FKAA 4N47A 4TLMB 4S05A 2FVYA 3MYYA 1J56A 1NATA 1MAVA 3OMXA 4IMIB 2PKXA 3C3KA 3QK7A 4NV3A 2GWRA 1IIBA 5DCLA 1YS6A 1XWWA 3GA5A 2Q5CA 3CU5A 1PEYA 5C5EA 2E4ZA 4TN5A 4WT7A 5T3YA 4EYOA 2FLWA 4KK3A 3GWGA 5KI6A 1NXTA 1F51E 3Q7SA 1MB0A 5JNVA 4EYQA 1ZDMA 3H6HA 2WRZA 4HNSA 5T7BA 2M98A 1Z15A 3FFXA 4QYWA
chains in the Genus database with same CATH superfamily
3T5MA 4OV6B 1K5PA 3OU7A 1Z5OA 3T6KA 2VJMA 5CB4B 1RBQA 3TL6A 1SZPA 1SIOA 3JX9A 1B6GA 3EFBA 3DOJA 5KJCA 2FWAA 2GILA 2JHPA 3HRIA 3H5VA 4JR1A 1NPYA 5KVQA 3S2GA 4Z7QB 2I9KA 3P9RA 4JDUA 4JODA 5LQNA 1B2LA 1FFYA 4GHWA 1Y3CE 5EA2A 2XRZA 4HRXA 1X80B 1H22A 1TEXA 1Z0AA 5TR9A 2G88A 1VLHA 3NWPA 3QBEA 3W5AA 3CRQA 2WPDA 3VR3A 2P68A 2B5VA 2XDQB 4NS4A 3JQRA 3AI1A 2I3DA 2AEFA 2HU2A 3WWPA 4EUSA 2DPLA 2CEKA 1M10A 3I6YA 3QKTA 1DCTA 5HZMA 1MGOA 4M46A 1T3TA 4TXNA 1NVMB 2JI6A 4G4IA 2D13A 1E7YA 2ZIAA 3M1YA 1AHIA 4XYEA 1JA1A 1GUFA 1P75A 3K30A 3MW8A 1NGSA 1C0EA 4MQ6A 1TLLA 2ZUDA 5LMUB 2I5PO 4L08A 1CRWG 1AHPA 2PMFA 4FR5A 3CKYA 4N9QA 1K8YB 3SFTA 3DL7A 3DHEA 3OZRA 2D2XA 4KMOA 4XRRA 5KYWA 3OFJA 2QZJA 5HEKA 1KE2A 4Y8VA 2VAMA 2XVYA 2D7JA 4X5OA 3HBJA 4CUKA 5KCMA 1E2GA 3SZRA 1YCHA 3TFWA 3K96A 4Y6QA 2QRNA 1NMXA 4DS3A 1SHJA 4DFDA 3CC8A 3ACBA 4ARIA 5D00A 4RU1A 1F7UA 1TW3A 1GPNA 3BZWA 3KT6A 3QE4A 1JX6A 5TY0A 2ZIWB 3ME5A 3W79A 2FRVA 4OLHA 3IMKA 3OT5A 5IFKA 3LQYA 5I01A 4W5OA 2DTDA 1NI4A 2V7BA 2HBQA 4HZIA 4S3MA 1XMQB 4FFOA 5EWJA 2J7KA 2OV2A 5ADHA 4BTEA 2P3SA 3ADOA 4RFVA 3ZKWB 2NNLD 3DZFA 4TROA 4ZO9A 2XJ9A 4B6JA 5DKFA 1XCPA 1Y98A 1TU4A 4X71A 4HWKA 2NU9B 4TYMA 5D3KA 4Z0HO 5FJIA 1RYYA 4FKBA 3ZJVA 2JPDA 1L8LA 4N41A 2ZBPA 1VBNA 1Y7HA 2AOXA 2JI9A 4OL0A 4C9BA 5JS1A 4LK3A 5GZ6A 1UWKA 1ZGBA 1N57A 5JBIA 1GZ3A 1KKUA 1CUIA 1GAQA 2JLYA 3OQJA 3WGJA 4MGYR 3RLFA 3CLKA 1Q57A 4G3XA 3WOVA 3I6ZA 1OGIA 3UOAB 5FLXA 1JH8A 4F5YA 1JHZA 3O0DA 4U7PB 3RFFA 2PUHA 5IG2A 1KJ9A 4EG0A 1W36C 3K4QA 1EZ1A 2FW9A 2PU7A 2C0QA 1LJLA 2GBCA 2I6FA 2YNMA 1U8UA 3GXOA 4PPFA 1CZNA 4BVLA 4F3NA 4LOJA 4YQYA 4LF5B 1RAHA 2GFHA 3IHTA 1CRLA 2QSZA 5BUSA 4O8CA 2EXXA 3BORA 1Q20A 3CF4G 1Z0IA 5DM70 4ZOCA 3JRWA 2VBGA 2X2OA 2VJYA 3AG6A 2HIAA 3LP5A 5GJCA 2FSGA 4X1OA 2NUPA 4EHDA 3MHPA 3QVUA 2IYXA 1Z7GA 2C4HA 2B83A 1Z4JA 3FDFA 2JLXA 4KG7A 4K9SA 4IIDA 4MS1B 5JR3A 3TNFA 1NI3A 5JSQA 3TEJA 3H16A 3LUCA 2C1EA 1XU4A 2W98A 5FR1A 4WZ6A 3R3JA 4JXKA 1E9VA 2ZTMA 3S40A 1E1DA 3TLBA 1QZXA 4MR9A 1A7JA 1ZX1A 2I66A 3EQ8A 3JU3A 1ZNQO 1F5NA 3P9ZA 3M6WA 1G5HA 3P9XA 3PXDA 3RTAA 2O2SA 1BMFA 1A7AA 1X7HA 4OD0A 4D5EA 5BR8B 3BBPA 1C3LA 1ZI8A 5TPWA 4AZ0A 3NOQA 4R51A 1P1KA 2BFCA 1X15A 1FW6A 1DQZA 2PZKA 1C3VA 3F2VA 4GAEA 1L1RA 2F62A 3IBSA 3AETA 3TZCA 5BQ3A 2OHJA 1USGA 3KYCB 2HA0A 2JRLA 4Y2HA 1YKFA 1YA4A 1PWHA 4WVFA 5A0FA 2XD9A 2XQGA 4JYMA 2OHVA 3KL2A 3Q8WA 1OFUA 3MJFA 4FK8A 4GPBA 4KXVA 3ZH9B 1RQRA 1IZ7A 4NEHB 1QPGA 1ZCBA 3NEJA 5ITZB 3UATA 2GBFA 3ZDDA 1BS9A 2IYPA 2L17A 3E8MA 4FONA 2FCAA 1ZRNA 3MYRA 2YVQA 3R3XA 1C7ZA 4Q21A 5G0TA 5AVSA 6REQB 4NARA 4CM7A 4AUEA 1J0AA 1OSNA 3FB1A 4NCHA 4UBJA 3GLUA 1QZ3A 2VA9A 1TQ6A 3O73A 1SXJA 3IBYA 2VWHA 3K9HA 1C7RA 4EY6A 3PNSA 4N0MA 5KTSA 4P4UA 2VTEA 3UWMA 1TTTA 1EQUA 3HO8A 1X38A 4C0XA 5ICMA 4IPTA 3WX0A 4TZTA 3VA7A 4E22A 1AO3A 1G6KA 4JP1A 4YCBA 4AROA 1P3Y1 1W2WB 4P3KA 3PUXA 4PQFA 4CQMA 4CM6A 3ASVA 3QTLA 1K88A 1IULA 2JFWA 4O5OA 1XMVA 2XMZA 3K35A 5CLHA 5DB4A 3UXMA 1E2MA 1R6TA 1N8TA 2WF8A 4C29A 2NVOA 2XYGA 3BL5A 2OEPA 2Y66A 2NT3A 3RCBA 4P2GA 4DR5B 1WUJS 1EFRA 1Z2NX 1T6NA 2WKRA 1T3GA 4MUJA 2PNJA 3W1VA 3TDKA 3CH5A 1YACA 3IBGA 1PJ8A 2IYAA 2MU1A 3HJTA 3IPCA 3EEYA 4PC1A 4Y6OA 4BVKA 3HHPA 2AEMA 3BGWA 3CVXA 4H27A 3KSDO 4GX1A 2AZXA 1ZJYA 4LNHA 4YRRA 1AU9A 4UQOA 3VRHA 1DCMA 1UK6A 4LZZA 1U28A 2RAVA 3L6OO 3EVFA 5EJ5A 3L04A 1EWQA 1E1CB 3QX7A 1AE1A 4B8YA 3NTLA 1MG5A 5E4JA 3R9KA 4KLCA 1OBVA 1G8GA 4J76A 1C1DA 5E0OA 2BN4A 4DR4B 3GZJA 2VHEA 4KBGA 4MIOA 3H5TA 1GYPA 3ZHQA 2J30A 3QVVA 2B2XA 4WASA 1GNRA 3BOSA 3R3YA 4Z3KA 3GJ5A 2QGZA 3CPEA 2EIXA 4PPGA 1KI6A 1NQVA 1NBME 1QV9A 5CFLA 5IX8A 4EDFA 2SCUA 2ASVA 3Q1LA 3AF6A 3FBGA 3IAUA 3KRTA 3T5DA 2VSOA 2NAPA 2QYTA 4MB6A 1VRWA 3LHKA 4HXYA 4F91B 3GL9A 1RVDA 4BO3A 1MJHA 3ZNOA 5H3HA 3BHJA 5EIHA 4GZ5A 3W8EA 2ATXA 3UAWA 2PWPA 4M7OA 4ZCQA 1VPLA 3DLIA 4RTKA 4PGGA 1GM5A 2G9RA 4BNTA 3TXAA 3ZVKA 1AOXA 1E4YA 4UTVA 1VDMA 1WSWA 2QZZA 2ZRBA 3QIAA 1O5OA 1PGQA 2BT4A 1JEYB 4ZGWA 1BQ4A 2EERA 3OQMA 4QAQA 1HQKA 1CC1S 3A14A 2PUVA 4FJ0A 1JIKA 4M38A 4M1QA 2C5AA 3CR8A 4FXPA 5CG2A 4FMPA 3L6DA 1ZCJA 3DBHB 4KCGA 4YECA 3WGIA 3VC3A 2X13A 4M36A 4YEDA 5EAIA 3U4HA 2NPIA 1JQBA 2K7ZA 3CX8A 3T3OA 3OO1A 3OUZA 4PYLA 4RVFA 1P2FA 3R8XA 1W48A 2N9UA 4WK2B 3AR5A 1TIPA 1VP3A 3LPDA 3IESA 4C4OA 1G20B 1IN8A 1T43A 3DFIA 1H8HA 3B6KA 3ROPA 4G25A 4YT2A 2HOQA 3EY9A 1YR8A 4H1UA 1PDWA 4Q4CA 5BN4A 4LF8B 1ULAA 1CB0A 1C50A 3BTVA 2DUUA 2IOHA 3HMQA 4UAVA 3GPLA 3EPJA 4FLFA 4BQOA 1Y4AE 2XLCA 1PGNA 2WIFA 2Z9BA 1E60A 4QHYA 2Y93A 4L8YA 1WBBA 1I8TA 1Y0BA 2VNJA 1RJGA 4KAFA 4ZOAA 4D26A 2YFHA 4GWGA 1HT0A 3CH7A 1RVV1 5CT9A 5DX1A 3A1TA 4HLUC 4WCVA 1UBNA 1BWRA 2D5IA 1ZM3A 2PJZA 3FVWA 3KYDB 3PDUA 3FETA 4BBPA 1GT6A 3OCVA 1ONNA 3NT2A 5EJAA 1NWHA 5LIPA 1AZTA 1V6AA 5AJYA 5ALTA 3PQEA 4JC8A 2MYNA 3KP1A 4ZA2A 4TMFA 3IUJA 3GBSA 3TRIA 4FFRA 2ORVA 5HDQA 1IEQA 4C14A 4LF9B 2JG3A 4EGCB 3IAHA 2I3AA 4NMHA 2A14A 5KHLB 3C16C 1KMIY 1U0NA 4OP2A 2PRIA 3TRHA 2AR0A 4NOJA 4NIMA 1EM8B 3R6GA 3IFSA 4PYRA 4GPD1 3F7NA 2ZUBA 2EX4A 1ZQ1A 3O4VA 5C1DA 4XR4A 1U99A 1UZUA 1O77A 4MLCA 4XSHA 3PCRB 3SYMA 1BCSA 2ZSHA 3Q3CA 2PZJA 4PGFA 1KSGA 4YAKA 1JRLA 1AKTA 2W6ID 4YJKA 2X76A 3RM3A 4LOHA 2YIMA 4P0QB 3TB6A 1JMYA 3H9EO 4AKTA 4EM6A 3W5VA 5BWOA 3LF1A 1EK1A 4QGAA 2XT6A 3IALA 4N6GA 3DMTA 1U2TA 3REGA 1PT7A 1O97D 5JNRA 4QQKA 1N6RA 2FNAA 1PGJA 2ZSFA 4G07A 4RD2A 3Q72A 4HAUA 4WLFA 2OVBA 4YR7A 1OROA 1TA9A 3VR2D 5BOSB 3FR7A 4I4TF 3FNBA 4EVRA 1ADYA 4TGLA 1X7WB 2D7CA 1J2JA 3OP1A 4GZ6A 4LJ7A 3IR6A 4N9WA 2QEQA 4PV7A 3QJGA 1UJ5A 4ASUA 4D0RA 5JTTA 2AC7A 4TRMA 1VJ0A 3IAEA 5H80A 1JHDA 2YZNA 4POOA 5JPDA 3LTNC 4FFMA 4NMMA 3O8RA 3GO4A 1I4DD 1N8SA 2BCGY 3MTAA 5GAJA 5IDVA 3CLTC 1FXWF 1K7XB 3LV8A 3PICA 3WAGA 5B1SA 1CD5A 3QUQA 2GJKA 5J4HA 1KZHA 1DTSA 1VECA 1P4HA 1YGPA 3I34X 1Q1EA 1V6SA 4CU5A 4RTLA 4XX0B 4I7EA 1MB9A 4EUKA 1XCMA 1O9GA 4G5HA 5ED4A 1V7PC 1QNLA 1AS0A 4PAQA 4D4MA 4KH0A 4D45A 4F5DA 1M2FA 1TJ5A 4L78A 1VG8A 5F1KA 4C2BA 1QVAA 3OTOB 5A9SA 1SY7A 4WH0A 2QTWB 2ZJ7A 3RKSA 4ZYLA 1FS6A 2XWBF 1Q74A 4I6GA 2VCYA 4TWZA 3QEMA 1PV2A 4GPAA 1MGPA 1S0UA 5DIFA 2GA8A 4Q4AB 4FLEA 4P36A 4TMWA 3GN2A 4JUIA 1KK3A 5BSWA 3S2YA 4BNDB 4WVLA 2AFHA 4M9CA 1DKPA 1OLSB 1U90A 1DEHA 2PPVA 3ZLTA 2YYSA 4J7CA 1JB9A 3IQDB 3L4BC 4B6PA 4WOKA 3AGPA 2O3QA 5AI0A 4FR0A 3DKPA 4IILA 2HSEA 2P6PA 4UUPA 1RPZA 2C97A 2X1HA 4XA8A 3MEQA 5HTKA 5HA5A 2P77A 5BSFA 1G8HA 2CT8A 3DOEA 1VG9B 3WMEA 1LWNA 5C7IO 3RSCA 3PQ2A 2DR2A 4CEHB 1G60A 3P9PA 1QHHA 2A1TS 1M2HA 1N78A 4PFKA 4JP3A 3CB4A 3UK6A 2MINB 5B3KA 1BJRE 1AKRA 1GZ7A 2PMDA 3BB4A 3DEYX 3G7NA 3QXXA 1M0WA 4FYVA 4L3VA 2VL7A 3U7QA 2XMDA 1FTSA 5DGCA 4JI0B 2FV8A 4C4RA 1ZA2A 3GV0A 5KQLA 2LCIA 1QQAA 2GMWA 3P0RA 3T1NA 1JA0A 4YAUA 3TRFA 3NRJA 3OOEA 3L8YA 3FJOA 3OD5A 4YJGA 4N54A 3TZEA 1G9XA 5EJFA 2HADA 1EWTA 1TM2A 5AKKA 2CLFB 2IE0A 4MWBA 2OBBA 1A04A 4D80A 1LDGA 4O1HA 3HCEA 3A9VA 2K2WA 2BKLA 1TUBA 2QR5A 2JI8A 3MT7A 2EZUA 2NX2A 3C3XA 4U00A 2H4FA 3FOBA 1M73E 1WY5A 4JUAA 1GU0A 3DEHA 3F73A 1EQ2A 1PJRA 4GEKA 4JENA 2ZBRA 3BWBA 2XNCA 3FNHA 3PIDA 2G8LA 1WULS 2J33A 3RK4A 4MV5A 3B38A 3NCHA 2JFBA 2C5EA 3BFXA 1A72A 4I8IA 2QTLA 4Q48A 1FQKA 4E4RA 1EAYA 1XR3A 1LKZA 2FKAA 4J0CA 5ESXA 4DYVA 4S05A 1CRZA 1QCYA 5AKYA 3K0CC 2VH1A 4WOPA 4DTIA 3STTA 1MAVA 4LHSA 5LZ2A 2AA3A 1NW7A 3PUKA 4CMJA 5WRFA 1H4SA 4LQLA 1KOGA 5JH7B 3GLHE 4C3ZA 4FMDB 4ODIA 2XNKA 5DCLA 1D4AA 4JLSA 4KE7A 4PZYA 3ZJYA 3CRVA 5C7YA 4ZOQI 1QS0A 4FYWA 2Q4EA 2GN2A 2OGTA 3UCEA 4P35A 1FRZA 2DTXA 3ST7A 3FJ1A 1KI2A 2IXDA 4BNXA 2CLHB 1ZUHA 2GASA 4NPCA 3VBEA 3GWGA 1VBFA 1Y9ZA 1Y1KE 4DMCA 4CM8A 5EIXA 3LCRA 4Y2GA 2ZYTX 1RC0A 2F1KA 3QMWA 4R84A 5L7YA 4OU5A 4HNSA 1YI0A 3L0PA 4JGIA 3FJYA 2IGTA 2XE8A 2LE0A 4KDFA 4EZIA 4QYTA 4BVAA 2Z8XA 5KZMB 1RKUA 4E21A 1PVDA 3DUWA 4IQ0A 3OJLA 5THXA 4X20A 2ZZNA 1CR6A 4J7UA 2OQ2A 2PX4A 3OT1B 4YAJA 1MP0A 4RK0A 3DNPA 5ICCA 5LL6P 5EJMA 4YGYA 3PDCA 4KXQA 5F73A 4OJQA 3G6KA 1VMKA 3WJ1A 1GARA 2AFRA 2HF2A 1P7ZA 4X7MA 1XTKA 4ZYXA 4IG9A 3ZCRA 4CM9D 1Z6PA 5KIAA 3MBKA 4K86A 5EHGA 3FWPA 4KR2A 5EJ7A 3FOZA 4I9HA 1IXSB 1NVAA 1Z5PA 4YH1A 3T3DA 4ETWA 3A06A 3W5UA 1NSYA 3VSDA 4DCJA 1V26A 3PFBA 4P81A 5CA1F 4G86A 4PO9A 4GMHA 4EEXA 3EZLA 2O8DA 1T8WA 4NU6A 4KTTE 3G82C 4YRFA 2RB5A 1TA4A 4NCNA 4R2IA 4CKBB 4HEA6 1K92A 4P4NA 5KYYA 4DZTA 3CT4A 3PJFA 1EE2A 3QOWA 4BV2A 2X0KA 3L02A 3C70A 1BAPA 3EG9A 3EW7A 1ZKDA 4AQ7A 3IO5A 2XMRA 4HYTA 3SC4A 3UK1A 2OENG 2P7IA 3O82A 2XRYA 2OFPA 4Z51A 2XXAB 4KXLA 3BD9A 3F98A 2WUVA 1JPVA 2K6GA 2R00C 2F3QA 3TZ6A 1R8QA 1LRKA 3P2MA 2C07A 2KLBA 3F67A 2JBAB 3JQ7A 4V0LA 4DQXA 5JSHA 2D3TA 3C8DA 1ZUIA 4ZEWA 1U4OA 3SS8A 2RBEA 2JVIA 3O8LA 1QG0A 1FY2A 5JMOA 3MBIA 2Y1EA 1SQ5A 4CGZA 1NM5C 1UMCB 3CEHA 4OI4A 1V9CA 3KR1A 1N6PA 4G56A 4TV9B 4N12A 4PRLA 4MGIR 3U1BA 3N2KB 4FB4A 2P6RA 2GCNA 3V9AA 1Z16A 5FHRA 4XYGA 1PO7A 4QVIA 2GN0A 4DM7A 5COQA 1UAYA 1CR4A 1D2EA 1IHYA 5K0EA 2WTMA 3TOVA 5DNYB 2TMGA 4JJGA 4W9RA 3EGWA 1FP4B 4JJ8A 1J9GA 4X61A 4XXHA 4YXWA 2ID8A 1ARZA 1ISMA 2QF7A 4Z0PA 2ZSJA 3UHAA 1EUDB 1ETHA 2DQ4A 4HRAA 4YJHA 3ZHXA 4DCGA 4Q24A 3ZJUA 2VT2A 1MD9A 1OTYA 2QW8A 1RMTA 3JWPA 4GOOD 1PTKA 3VI3B 4K87A 4UTNA 3JWGA 1V8PA 3I04M 2UZAA 1YMVA 5FIUA 1P1RA 4XFJA 4PLTA 2ZWMA 4YCJA 4BNNA 121PA 1Z33A 2FAXA 3NHRA 1Q0TA 1DL5A 1LI5A 3DF7A 3HKEB 3R5KA 2P0AA 2JKVA 2GZ3A 2ZRGA 4YGXB 4Y9UA 2A8YA 2CGEA 3U80A 2Q1UA 2I2DA 2JNWA 2QUJA 3ZD9A 4LMBA 4M0DA 1X39A 1J24A 3UUGA 4MIKA 3M6MD 2XOKA 3JZAA 4QECA 1BNCA 3TFQA 1GNSA 1PSDA 1ZRMA 2QXUA 2VRNA 2QSJA 2ZUUA 3QTBA 4I66A 4IEIA 5T64A 1UAGA 3ZIAD 2FP4A 1U9JA 4CMHA 4DIUA 3EFOA 4FIDA 3W6PA 4YDSA 3AP2A 2QNRA 3ABQB 5F35A 1NAHA 1JL3A 3GUYA 3T4XA 3VNAA 3WGGA 1T4CA 2R6R1 3IOBA 5JCOC 4A0QA 3QKIA 2P9GA 1ZD1A 3C6ZA 4KUEA 1QJ4A 2FN4A 2O3RA 3JYNA 4MZDA 2IYLD 4E6PA 4H60A 2FX2A 4AKHA 4QUBA 2ZYIA 3BREA 4UASA 1V1RB 4UBNA 3WYNA 4EKNB 5KQMA 2WJGA 2WZBA 5KUTA 3OQNA 4FGUA 1Y8QA 2DBVO 3DWGA 1KOJA 1XAGA 4X95A 4AZ3A 2R1TB 3R9IA 4KW7A 3TLXA 1DQSA 1NR5A 1K7EB 4KO4S 3WRXC 4RHFA 4KQCA 4EVSA 3O8OB 2A5JA 2LVBA 3OZCA 4XUCA 5IJ0B 5JSFA 3T3PB 3I37X 3IE1A 2D1QA 3G88A 4K40A 3IJEB 4OQPA 5EMKA 3SEFA 4D0LB 4F0JA 5EKDA 5AVYA 5U1PA 4RY9A 4C2UA 1NJFA 3U5TA 3UK0A 1NQOA 2CL7X 2KLHA 4L76A 4QGGA 2LW7A 3FGZA 2OB1A 3H2GA 1L5RA 1W5TA 4XRGA 2FPGB 1C30A 3OLQA 1GZUA 3FR8A 1HE3A 3TSOA 1I4WA 1QRSA 1H1TA 3RRXA 3RT1A 1T26A 2RMKA 3EEOA 2V6BA 4E5DA 5AUPB 1T1IA 4EW1A 1DUIA 2ONYA 1BQ3A 1U7PA 1VHWA 1VHLA 3IMGA 2YHSA 3TUJC 2CNKA 4B9AA 4HGRA 1SNYA 4BE9A 3RVMA 4CM3A 3CPHA 4IG4A 1NDHA 1BYIA 2Q1WA 4KN9S 1BZYA 2VLIA 5JSUA 4LNUA 4LQ4A 4UPDA 2RGNC 1P4AA 3K32A 3RSHA 4HGZA 3TIFA 2V1XA 1SC9A 1PJAA 4MS3B 4RPLA 4EKEA 1RM3A 2I7DA 2WSBA 2C2OA 5LQDA 1NQTA 3HU3A 2HRQA 2PZFA 3AR3A 3ZGVA 2FSHA 3PKJA 4E13A 5I3CA 5TJ9A 3TSYA 1OMOA 3U9TA 1UC8A 1T8RA 3PI7A 1IJEA 4X7RA 5KYVA 1YDHA 1Z07A 3C8ZA 4Q7QA 5DYNA 1MTOA 1C41A 1R3UA 4JR0A 4R9NA 5JZ9A 4W5TA 1NQAO 1CEEA 5KPJA 3ZLJA 1HV8A 1UXIA 1JAIA 1PUIA 2OLKA 4NMXB 1UODA 1KEKA 2AFIE 1II8B 3MTBA 1IHUA 2AZTA 3A31A 4Q66C 3WLHA 4B33A 3U7FB 1Q14A 1DI0A 2VJQA 3KQQA 1C4OA 4JFRA 2ILVA 3FFTA 4M8LA 3FPBA 4UBLA 1Q1QA 4G1FA 5GQSA 3STUA 3VTZA 3KM0A 3DL2A 3EDMA 4JOQA 3VUFA 2UU9B 2FP3A 2YR0A 5DTJA 1II0A 2IKQA 3D3QA 2CNBA 3TIIA 1OFTA 2DTEA 2TS1A 3RT9A 2BGMA 2JANA 3DFMA 4TTTS 5FFFA 7MHTA 2E1PA 2HO4A 1FX1A 2ZYSA 3QVWA 3TLCA 5FI3A 1W4RA 4UNNA 3OM9A 3CRZA 1YNOA 1YF3A 1Q21A 3NIBA 2O2IA 1V11B 4Y9RA 1I5RA 1E3QA 2IKSA 2YJ3A 1I2BA 5KTMA 3QFHA 4LYJA 3THYB 2WMOB 4LBYA 3DZBA 4X9XA 3RUCA 4B31A 2A9VA 4U3JA 4BCDA 1KEEB 4RKQA 5EP4A 3QZUA 1AQIA 3PEWA 1Z5UA 1MO2A 1RWWA 3PLRA 5D3ZA 4B85A 5THQA 5ECWA 5C0OE 1G3UA 2A88A 4L5JA 2V7TA 2YX1A 2FPRA 3SHFA 1XTBA 1OH6A 2Q7DA 3GJ4A 4MQFA 5HCNA 2KBEA 3NHPA 1D0IA 2W6PA 4XWAA 2FA9A 1F1BA 2R7KA 4BMPB 1MRZA 2K5UA 4B2YA 5GIOE 4BKPA 4FOSA 4LOKA 2ZETA 4B3HA 1PFUA 8LDHA 5CT4A 2W6CX 1ATIA 4RGQA 2Z83A 4URYR 3EXHA 2ZTUA 1U0TA 4GBMA 4MVXA 4WLNA 1DJNA 2QN2A 1N6NA 3BE4A 1BE6A 3N87A 4UXHA 1JXAA 1DKOA 3O2SB 4Y6GB 3MCUA 5EKSA 1KZGB 2BOVA 2YY7A 3JAWB 5KSWB 3I8SA 4LDRA 2XUAA 2YWHA 2FZEA 3SIRA 4MA0A 2GK7A 1P33A 4D3FA 1W6RA 4KC0A 1OH7A 3DV0B 3FSGA 1YS2X 3MOGA 5AXDA 1JYEA 1V25A 1TQHA 1HTTA 1R15A 2WE8A 4C5AA 3V8EA 2XUPA 3CHYA 4UZEA 3K1ZA 5EKXA 5FWNA 1CY4A 4F3YA 3SXPA 1W88B 2R62A 1CJMA 3HDHA 3NC1C 4K8RB 2YASA 3TR5A 5BVGB 3ORHA 1P2DA 1AMUA 1SK9A 1TPYA 1E9SA 3UJBA 2X42A 1OBHA 1CUBA 3K71B 1CF9A 4QPNA 3KZNA 1HZZA 2JGNA 2RGXA 4TWRA 5DI3B 2HJGA 5BMVF 4MRMB 5BR1A 2Q7OE 3CX4A 1NX6A 2WF9A 3RVPA 2PJRA 1R00A 4KPUB 4HGOA 5H3LA 4AQDA 1NY5A 3S1LA 1GCIA 4R2MA 4ENRA 4G0UA 1NPTO 3K8QA 3DDCA 1OHHD 3KT3A 5I7OA 1H42A 1OC4A 1IWBB 1MO4A 1GRNA 1QQ5A 4XAQA 1D0SA 1BOFA 2QUIA 3W2GA 4YRNA 1Y89A 3PNBA 5IBCA 2C59A 1WXHA 1XFDA 3QUSA 5DF1A 1HE1C 1W87A 4L4RA 5A1TA 1CQZA 3CUTA 3MZ0A 3OIWA 1M7GA 5A5VA 4F93B 3GNQA 2Q1SA 4UATA 4E5YA 4PIPA 3CLUC 3PA8A 4E11A 2PL5A 1E6EA 3D5EA 4BPBA 3R9XA 2I1WA 3DMGA 3UK7A 4PN7A 1KO4A 3P19A 1I24A 3MN1A 4KDRA 4XWTA 1GGEA 1I3OA 4Z5XA 3UFBA 3O5AA 3ZVMA 4C7OA 1CUSA 4DG8A 4M8KA 4I36A 4MH0R 4X92A 1DJOA 1M1YE 5BNFA 2PV7A 1GEEA 3GLVA 3AY6A 4Q82A 3WRYC 2YICA 3Q6NA 1IHDA 5D6NA 3S44A 4MV6A 1TYBE 1VJTA 2ACVA 3AERB 1YZHA 4PWYA 3PL1A 1PR3A 2QUAA 2HPHA 1J21A 2Z3VA 3CCCA 1XZ8A 1MOQA 3G1TA 2DXIA 4JYPA 3RVSA 1EK0A 2G09A 5E8JA 2OYRA 2YDXA 4B7ZA 4UHFA 4HDMB 2DR0A 2FDRA 4MLDA 1M33A 1E2EA 3CUWA 3ONEA 3W5SA 2W6QA 1XAJA 2ODTX 3WBKA 4E1BA 2LD4A 1D6MA 1YC2A 2A9FA 1P81A 4HI0E 5SY4A 5EESA 2HWXA 3B52X 3T9CA 2O05A 1SB8A 2FFJA 3UAYA 1VLZA 3KVYA 1FMFA 2EDCA 4CMEA 2XUIA 4AJ1A 3GAMA 2FPKA 2WW8A 1A82A 1AGRA 1K97A 1P0CA 1IZ8A 3AEKB 4UOZA 5FWYA 3MM4A 1G8PA 2Q5IA 2W2KB 3DS8A 1Q84A 4L4UA 4G1EB 4XASA 4W5NA 5JZVA 4QFDA 4QELA 1ZZGA 2VNIA 4JXJA 3NHJA 1HL7A 1TKBA 2O2ZA 4K6KA 3H1GA 2GPWA 4WE3A 1QORA 4HO1X 1RKBA 3U7IA 2WP0A 4IDGA 3EXAA 3CE9A 3EIOA 5MDHA 4ZQCB 5J23A 2QL7A 1KKMA 2WABA 3VSEA 4BNLA 3EF3A 4OEHA 4ZMBA 3V00A 4JYAB 2NXEA 1P60A 1YR6A 4F8JA 2NU7A 3LWDA 5HF8A 1RWKA 2D8MA 5LBIA 4LJ5A 3HXQA 1WU7A 4GWLA 3TTWA 3H19A 3GP5A 3D0OA 3WNZA 3W4JA 2R11A 3EUWA 4BFVA 3HVHA 3R0XA 3RG8A 1HMPA 3JWHA 3M4JA 2A2ZA 5EHNA 4BQSA 4KKVA 2Q1XA 4JKIA 1QH9A 1GQOA 3OLXA 4HXGA 3D7NA 3VPXA 3KBOA 4TMTA 5LOVB 4OKSA 1LJUA 2IUUA 3SCZA 2PIAA 1RM4A 1Z8NA 3CS3A 1UDCA 1EE9A 3JQBC 1P31A 3KUXA 2DHQA 3GIWA 3AFHA 4KQFA 1TRKA 3UJ8A 1QQ6A 4J1TC 4ZIRA 4MOWA 4IP0A 4ZREA 4AYXA 4J6EA 5B3JA 3PPYA 3QNUA 2NTEA 5CJ2A 4DC9A 1A9RA 1BE1A 1BS1A 2M6RA 4H7EA 4QBFA 3PEYA 4P5EA 2CD7A 4Q02A 4J4TA 4ER3A 3LLVA 3G8DA 1RLTA 4PNPA 2HRCA 2WUFA 4EFMA 3I39X 3GGGA 4IJQA 4F56A 1DKUA 2H06A 1CVLA 1WPRA 4M0KA 4UHEA 3Q4GA 2C95A 2IZ1A 3VUEA 2PVCA 3W8NA 3AR6A 5BYJA 5ALMA 1XDDA 1CIVA 3PNPA 2EWMA 5JG7A 2YCBA 2I2XB 4DA9A 1RXUA 3O3MB 2VYQA 5G4LA 4EPRA 2XYPA 3LW8A 3OTGA 3DOIA 2V74B 4ZEXA 1D2GA 5JVDB 2WF6A 4HWPA 4WOJA 1RWNA 2HMWA 3PNYA 3EASA 4ED9A 4JEHA 1KQNA 3NTOA 1LLDA 1MUUA 2VHJA 2NU8A 2ZAIA 4MAAA 4EJSA 3GUHA 2WJVA 4RTJA 2G9VA 4YAEA 3SR4A 4AP5A 4CLHA 5LSAA 4OAPA 3D2BA 4OXIA 2HCTA 2OAEA 5FWXB 1KU6A 1IEXA 1L1FA 4BS9A 1MJGA 5CT8A 5HRCA 3CO0S 3R6DA 4FBMA 4GMKA 3VOBA 3MMSA 5C8ZA 5K0BA 3PC2A 4B46A 4B4WA 1Y48E 1LV7A 2V9CA 1KFKB 3EZXA 3HFJA 3AR8A 3DTYA 4FOLA 1I36A 4M1EA 4O8ZA 4RQUA 4QSMA 4D44A 4YXFA 4ZI2A 1PZNA 4QX6A 2Z4RA 4J2OA 3E9RA 1EXMA 2H1WA 3O8QB 3PDIA 1Y34E 4MDHA 2QD3A 2Y2VA 1ZINA 2IUFA 2G5CA 4CL0A 3LFHA 1INLA 3C3EA 4BO0A 3UXHA 4KQHA 2Q3EA 1TZ2A 4WT7A 2XQJA 4NBTA 1C3EA 1JV2B 4PTYA 5T3YA 4B4OA 3R09A 2P5UA 4I4NA 5FO1A 3GEDA 2AYYA 1XRMA 2P2DA 1M1ZA 2H17A 2J08A 2QIOA 4PNZA 2ENWA 3K1AA 5DLYA 1ZR2A 1DC5A 1JVBA 3CNLA 4NYIQ 4Q37A 3P1JA 3BZUA 1S8FA 1OAOA 2G5PA 3SF0A 1T5DX 1E8NA 1ONOA 1E1NA 1AGXA 3B3QA 2OCXA 3DB1A 2CFIA 1OZGA 3FPGA 3GFVA 3K0FA 2QW1A 3L84A 2ZJ5A 4JCOA 5EKTA 2YS7A 4DMRA 1XQYA 4JITA 1CPYA 3UJAA 1U7TA 2BFBB 1R10A 2VZ0A 4QBKA 5FNVF 1NQUA 1PFWA 1FRQA 1T1GA 2DJIA 2TMKA 5KYXB 2HEIA 3CLRC 1I4TD 1U2QA 2WZDA 4BNYA 3R3SA 1PFVA 1XTQA 3FVRA 8ADHA 5L3VA 2R4QA 1M1YA 1UPXA 3EJ6A 4TTIA 2XZTA 2A57A 5A02A 3IEUA 1KKLA 4FEGA 5TS3A 3VHXB 3N8GA 3PRJA 5FUQA 3PV0A 5EGSA 5K3CA 1RMYA 5GIPE 1QIMA 3OUTA 2D2VA 5EE0A 4ZC8A 5FBKA 4JI4B 3NASA 1JDSA 2HW8A 1RJWA 3QF4A 3AVYA 3NW9A 1RRGA 1YZ3A 1XCJA 4MO2A 1ZK0A 4EGAA 4HH1A 1NFFA 1Y7IA 1YI8A 4I55B 8AT1A 1KQPA 3MTEA 3QSYA 2SKCA 5CGZA 1ZCFA 3AFOA 4DMMA 5GZ1A 2GHQA 2FMHA 1SBIA 2ZXFA 4BC1A 4ETMA 1NUUA 2D00A 3ZVLA 1FP1D 1LJ8A 3CW2A 3UT6A 3SE7A 3PWTA 1DUSA 1V8BA 3N2GB 3RR2A 3UMCA 3LBNA 1G17A 1TAHA 4XGRA 4C0LA 2YY6A 3M0EA 2P2YA 2VT6A 5JQGB 2Q2OA 4WKCA 4MQUA 5LFAA 3AWIA 4Y2SA 3HVRA 1BKSB 1T8PA 3S1AA 2PH3A 4HS4A 4MUEA 4FGZA 2ZCJA 4GPEA 1R5NA 1Z7EA 2ODPA 3JQFA 1DIBA 1B93A 5KNCH 3OH8A 1VG1A 2WTUA 1BA2A 1MIOA 3KALA 2PIDA 4EGQA 1NLYA 3RQIA 1BH2A 1ZUD1 3ANXA 3O75A 1B8NA 1SQ6A 3TDMA 1CQXA 4JJ4A 3T61A 4TQUS 4UREA 4CM4B 2CZQA 1HEYA 4IIJA 1XPJA 1KAGA 1TZKA 2WJZB 3PT9A 2OCDA 1QIKA 2HQRA 2OCPA 1KAOA 2ZJ6A 5FA6A 2DWPA 2I2WA 1T5HX 1TO1E 5C5IA 4PLHA 5HW0A 2CJPA 3CTPA 5HQTA 3MQ2A 2Y71A 3JZMA 4IDEA 5FXMA 1NJ6A 4RQTA 1JIVA 1L7PA 5IT9A 1E5DA 4EX7A 3GOHA 1EXWA 3O8NA 4MUHA 3UAOA 3EW9A 3WZ2A 1CYDA 1QUEA 2C1XA 3TLAA 5HKBA 2NP6A 4GT1A 4MIYA 1GAEO 1TW2A 4MW4A 3T41A 4FE7A 4R1QA 2OZVA 4K1LA 4OA8A 2PGJA 1H5UA 1G8SA 4B6GA 3PX2A 2AYZA 3C6YA 1FFEA 2ZIZA 3H2YA 3L6BA 5ILGA 4Z1MA 3UB2A 3UBMA 3OFND 1IIRA 5HHTA 3UCXA 2FWRA 3BMNB 4Z9BA 4K81B 2FB9A 4MHSA 1JHYA 3TLYA 1CF2O 1VCOA 3ITNA 5KNDD 2BH9A 4YIKA 3BEOA 3RF7A 2AMYA 4KFSA 3V8NA 3RS2A 5KNCA 1R66A 3IPLA 2IXFA 1IM2A 3HV2A 2C98A 2GN1A 4KI7A 1KI1A 2XKJE 4N39A 1W9HA 1I3LA 1UFOA 1S2NA 3DPIA 1E1MA 3X43A 4Q6WA 1ISFA 1ZLYA 1J22A 1ADCA 1PHRA 4Y2QA 5EIOA 3ET5A 4HAVA 3AZQA 4LTMA 3H2ZA 1CLEA 2QQGA 2Q3DA 4IQGA 2RD2A 4ZCTA 3A9SA 2BFWA 4OQEA 4C43A 1Q7TA 1QBGA 4PSKA 3S7TA 5LQUA 2O8EB 3MTIA 4CCWA 1C0PA 1QFSA 4Q9AA 3ROZA 1V1MA 3M6VA 2YXPX 4DQUA 5EXTA 1CFJA 5JPCA 5D5PA 1PEKE 2ETXA 3V8QA 1DOZA 2PUTA 4KVZA 3HU5A 3V2IA 4EG3A 3HNOA 4O5AA 1CUXA 3I8XA 4LGMA 1TYCA 3G2QA 2O2HA 3GFOA 4LRUA 4V2IA 3PYMA 5JISA 4F9FA 1SC6A 4QUKA 3LLCA 1SCUB 1Q3HA 3RRYA 1T8TA 4Z4QA 2O4CA 1CJSA 1MJNA 2YIDA 1SBCA 2AKYA 3BK2A 1M2JA 3QFTA 3BB1A 3PIIA 3RH0A 4HS9A 2PSEA 4HXFB 4B9EA 5BQFA 5HKAA 1A9TA 2G0TA 4I2NA 4GRDA 4AKEA 5IYZA 2AFIB 4PQRA 5HWSA 1NVVR 3HYLA 5DOZA 1GG8A 4DADA 1CXZA 1ISGA 4IQ8A 3IPRA 3HDTA 4PXYA 3RVNA 4DR1B 2WKSA 4LX8A 5J4YA 4TXJA 2BR4A 1FVFA 3H9CA 1GXSA 1TJPB 2C9BA 3OX2A 4WCDA 2VTBA 4DR2B 4NMWA 1MT3A 1P2UA 4JJ7A 4J3NA 3GGDA 4UM9D 4GGMX 3T9BA 2CHQA 3WGZA 1L4LA 1ZD8A 3DZCA 2SNIE 3ESYA 1BW9A 1Y1LA 4RMIA 2YV5A 1FDVA 5FBRB 4AJKA 5HNKA 3AB8A 2BFAA 1T0JB 1KOFA 1ZITA 4KYUA 3IIJA 4ECEA 1VOTA 4CLOA 1C0IA 2X1LA 4FEEA 2G0NA 1GL6A 3KB8A 4LJ9A 3A6PC 4KN6A 1MCZA 1N3IA 1Z8FA 3O4HA 4XTRA 5F51A 3ZK8A 1SQGA 4C4YA 1ACLA 3UT5A 4PU0A 2ZR0A 2DLDA 3KKMA 2V7GA 1G8KA 1EFAA 1A9PA 3V8PA 4BO7A 3D8NA 3H65A 1JR3D 1XRRA 2W0MA 4DUZB 3AL2A 2R65A 2OZKA 5LYJF 4NTZA 3JQCA 1P0QA 1SUCA 3V1UA 1BFKA 1WMEA 4H7KA 4GOJA 1USKA 3IPXA 4MRNA 4RUKA 5ECDA 4D9GA 1A5ZA 1T6YA 3D0KA 1CHDA 2L0XA 1ISHA 2BUAA 3AR2A 4OF4A 1HDCA 2B92A 5KVAA 3PRKE 2QR3A 4UUMA 4E2XA 2ZUFA 1SCIA 1ZVVA 4KSYA 3E8SA 2AOUB 3WJ7A 1GTJ1 2AOTA 2O52A 4RIIA 1I3KA 3ZHTA 3J81A 1UBKS 1SVIA 3Q5DA 1ZK2A 2CLCX 4R5MA 3C3CA 2PZGA 1SUFA 1HTBA 2BMDA 3IURA 1KJJA 1LBQA 4BNGA 4O2AA 1U65A 3K09C 3HZOA 3QHAA 3OAAA 4DYHA 4KAXA 1X13A 1HZJA 4Y7CA 5I4KA 5I9LA 1OXKB 3RS9A 4JS0A 4TXHA 1RTTA 2Q99A 1L4EA 4EB6A 5DH9A 2YWRA 3LLSA 1NV9A 3N7AA 5HIKA 2N3ZA 3ZD6A 3TXYA 1JDBB 5E6UB 3U48A 1SKMA 1SBYA 4TMXA 3PEEA 1JR6A 3AF4A 4ER6A 5CLJA 1S2DA 4PAOA 1JYSA 2BUBA 4JMPA 3SIXA 1WZ2A 1Q1BA 3K9CA 1QP0A 2G5GX 2ZVPX 3H2SA 5LZ8A 3QKRA 2M6KA 1DADA 1IPEA 2IXEA 1K9SA 1LFAA 1OUMA 1D8TA 1XD2B 4G8JA 2TRSB 5BWCA 1HURA 1TKRA 2ZJ1A 1RWBA 3B5EA 1HEIA 1DWOA 2MR6A 3WLOA 4MVJG 2I6QA 3SNHA 2G40A 2IW1A 1YONA 2XCSB 1M76A 3DXZA 3T5PA 4D3SA 2CYAA 4QJIA 5HM6A 3VJKA 1BIFA 1ZH0A 5ISMA 2ZZMA 3E4DA 2TYSB 1QM5A 2QPTA 3M89A 1TGYA 4LW8A 4KO2S 2BC9A 1VLLA 3QBVA 1OT5A 1W7AA 1LX7A 1RWOA 1WDMA 2G83A 1A71A 4Q9NA 1NVDA 1IQUA 4FIZA 3OA0A 2B2NA 1BCRB 1P2GA 5EQFA 4A6XA 4HEJA 4BFWA 3NATA 3LA6A 3ELUA 4QUIA 2BGUA 4TKMA 1NURA 3KHKA 3SY8A 2JFXA 1UWCA 4Q00A 4QGHA 2HK6A 2MWMA 3NHKA 3ZWXA 4BP1A 3HU2A 2OY0A 4EL0A 2B61A 5CDTA 1RWXA 1ICIA 4Q7KA 5EGNA 2H3HA 2X4GA 1Z18A 3M5CA 1CERA 1V1JA 4J1QA 3EN0A 4DLUA 1LX6A 1YGYA 2M2IA 4XJVA 3ANMA 4E94A 5BRAA 1ZSYA 1QGED 2OORA 5IT0A 4F4HA 4ENSA 1CX9B 2QY9A 5HMMA 3AVUA 1GHTA 4HD8A 4BKOA 3B82A 3GPBA 1UKCA 1NBHA 5A3VA 1A7KA 3FZQA 3U3OA 5B6JA 1DHTA 3KKKA 5CPBA 1T9ZA 2AG0A 3W04A 1MAAA 1PN3A 2QTVA 2B7CA 4HC4A 1KSHA 4O02B 3O2NA 1VYUA 4JHLA 1RYZA 1VJ5A 5C4IA 4BX0A 2XH8A 1HE4A 3MS4A 5ESRA 2PKEA 1UC9A 2H85A 3AP1A 1ZY2A 1RKVA 4MW5A 3ROKA 1RQPA 1SUPA 1XHLA 2Q7XA 3AESA 4RACA 4KWTA 5KTTA 2VTDA 4AIRA 1IBLB 3D6AA 1G7SA 2WLSA 2ZRJA 3MJTA 3L7YA 3EGDA 1SHZA 3IIKA 4MQ4A 2D6FA 1E5LA 2WZCA 4QQFA 3PGJA 1TU3A 1Q0RA 3QBTA 2JFYA 3SBDA 3MNFA 3W2EA 4DDTA 3DPSA 5J3JA 3T15A 4RANA 1YRWA 4RH1A 1D2CA 5B12A 1VPVA 1Z0DA 4B2LA 4N3CA 4HAOA 3ZZ0A 3V4FA 5IHPA 3ZR4B 3ZWOA 4G63A 1JQ3A 1NYLA 4C7XA 2RB4A 4FPXA 4IVPA 4HGPA 4JA2A 2DLNA 2J9ZB 3KZVA 1P7WA 3KWMA 5KDOA 4CG3A 2RGCA 2ZJ0A 1N2GA 2PMEA 4NDZA 2WYVA 4JB2A 5FAXA 5B3AA 4A91A 2PX3A 5JI3E 1C8BA 3CIOA 1OZFA 3S29A 3NYWA 4KMSA 4OI1A 2WNHA 3RBZA 2RGGA 1N7HA 4LSMA 3OE5A 1WNFA 2O2GA 4LRSB 5JNTA 2IS4A 1F5SA 4R6WA 4A8JA 1QCZA 2R68A 2ZWIA 4UU7A 5K45A 3UMYA 2VEOA 5CT6A 4DLYA 4Q3CA 3SDBA 2B98A 2HI0A 3FMPB 4WUTA 2Q6LA 5BR4A 4NXNB 3M6UA 5K3EA 2FSVC 1W85A 5IUJC 4BMXA 3VU0A 4OQDA 4C0WA 2I2BA 5H16A 3UKOA 1EUQA 1NE7A 2CVQA 3C4JA 4JU9A 5FR2A 5C35A 4M1WA 1J8YF 2QN7A 1X0VA 4C4TA 4FQ7A 5KWEA 5KYKA 1QO0D 5GOZA 5E3HA 3ZYZA 5HJEA 3G8YA 3FOWA 3MCVA 3NALA 5K4AA 2N46A 4UDXX 3QKSB 4YCNA 3C3AA 4QNMA 2ZIXB 3DGEC 3IUSA 4LMAA 1C4XA 5ALXA 1ANKA 1GLVA 1H2EA 5J40A 4BEJA 3D2AA 4H3KB 1NVWQ 4QUAA 4F2GA 2GZSA 4LHVA 3NYQA 5LN1A 4AP9A 2FXIA 1UBSB 1EFLA 3DAOA 2OXRA 4TSKA 2X7XA 5E6SB 4DUGA 3C7DB 3KFVA 5KU7A 1XA3A 3F5QA 5A7HA 3O2QB 4DLZA 1JGTA 2I80A 2X2EA 2DULA 2FMKA 3B36A 3H1AA 3PHIA 3S6JA 2FW1A 2YHAA 5HZHA 2XY4A 1UXGA 4KIFA 5I9SA 7REQA 3K7EA 1KDPA 3LY5A 2PAAA 2HWUA 2H63A 1J42A 4B75A 4Q3KA 1B74A 2IEZA 3HXKA 1QE5A 2AXEA 3IR7A 4HZUA 3C15C 3QLUC 1EP1B 4AZTA 5EZYA 1XZIA 2WJAA 4EMUA 1QGUB 4BZZA 5HUHA 3Q7PA 4WTOA 2FMIA 3SC6A 1X9HA 1H1LB 2V3WA 3ZBUA 2E5LB 2HRZA 3EDCA 1ILEA 2GM4A 2PV0A 3RUIA 4C30A 3EZ2A 2ZTLA 3ICPA 3X1WA 3DLAA 3NBYC 2I3GA 5CHEA 3SQLA 3PENA 4GSLA 4EMSA 5CFZA 3G89A 4UU8A 2PD6A 3PP8A 5FOVA 4U1RA 5I7RA 5IZCA 3A2NA 1P2TA 3K92A 4EITA 3GQBB 1KR2A 3KE9A 4TTSA 5NULA 1KNQA 4KSCA 4DQ0A 2JIRA 4D8YA 1RJ9A 1G5TA 1O5IA 4MQLA 3VAZA 4DPKA 3KXPA 3CEPB 1UWVA 4L57A 4RIGA 1OVGA 4FLMA 5K8CA 3DEFA 2NVUB 2ARKA 4Z1OA 4YMTA 1XF1A 1OH8A 2Q28A 3WLQA 3C6BA 4UNRA 1E2IA 2QDKA 3I5UA 3PD0A 5CIYA 4ZAGA 3FHCB 2Z9DA 4MHTA 1N2EA 1E1YA 1CIJA 1TDJA 1GTVA 3QELA 3I2HA 3OO0A 3TYXA 5JY1A 3UANA 3LC0A 2BZSA 1DJLA 4JQSA 4RHXA 1W30A 4J0IA 1QHFA 2DGDA 2H2AA 2CXUA 3BAFA 3KQMA 4MW7A 1Z2PX 4S0ZA 1QLHA 4GI3A 1ND6A 1I5EA 1CY6A 1T0BA 1KPGA 1NPDA 2BHRA 5T3UA 4YAGA 4BLWA 4RC9A 3VHLB 2WIAA 1P5HA 2VJNA 3LYLA 5IDWA 1NULA 3QK7A 2NP7A 1XAIA 3E5HA 3KXDA 1NY6A 4OK6A 5EIEA 4ESEA 2HNAA 1AC5A 5F4BA 2J5BA 3LHIA 2E4ZA 3QY0A 1L9KA 2QY6A 4MRVA 3BE8A 1WEHA 5DASA 1CIPA 1IE3A 1OX4A 4UFOA 2QQEA 4B80A 4IV8A 4F4IA 4B45A 5FTLA 4YBRA 1NJSA 1PR9A 5KJFA 3CEAA 4TSFD 5EEHA 1JDJA 4WDRA 5MN6A 3H4MA 2G28A 5ICEA 2C2HA 1FUIA 2XNDD 2H54A 3STVA 1I6LA 4PSAA 4GZMA 5DT9A 3T9FA 3HEBA 4CQLB 1HUQA 3WGUA 1RM5A 3L06A 4NPHA 2NYAA 3PR3A 1P6QA 2VFAA 5JTUA 4BFYA 2W93A 3IQFA 1FQOA 4YPOA 4QYXA 5IRCD 1T15A 3JRNA 4IKPA 4TVBA 2WWRA 4BO5A 4BO9A 2PH5A 4HUQA 4GZ3A 5DNAA 3RV3A 1TO2E 1QHNA 4AF7A 2LIPA 4UJ3A 1U0SY 3N6RA 4L2IB 3ZCTA 1C0LA 5BW8A 4KV9A 5L3SA 3TKLA 1KH2A 1O0SA 5LPNA 3U4QA 3TD6A 1D6SA 1E3WA 4ZCSA 1R6AA 2GH1A 3U7HB 2X9LA 4HDNB 3TMKA 3DAPA 1E1LA 4O6VA 1PL0A 4C6TB 3D6FA 1L8XA 3U61B 4X1KA 1UK8A 5I4BA 3T0FA 1YJQA 1V8DA 3H9UA 5ADVA 3P9QA 4NQZA 4QOHA 4O0MA 4RF5A 4RTPA 2EV9A 4B2IA 4EWLA 3L49A 1U8FO 3T7CA 5BYKA 3HN6A 2BDTA 5DK4A 1PFKA 1BU8A 4LDAA 1F3LA 4E6EA 5JEDA 3HK2A 1KDRA 2B36A 2XADA 3V8VA 1NMZA 5JV5A 1UOEA 2A1UB 1NXWA 2DYKA 3ID6C 2YKGA 4WQMA 1XL1A 5E1BA 2BUCA 2AMVA 3T7AA 4ZMSA 1MQAA 3GDGA 3OEHD 5K0LA 5B4UA 3UPTA 3QE9Y 4HGNA 2XT0A 2O59A 4KRGA 3PVCA 5F9FA 5KNBH 3WKEA 3KB2A 1B26A 4AJEA 2BFDB 4WXPA 2EJVA 5BWLA 3QX9A 1KORA 1WZEA 3AWDA 4OI2A 4HSGA 1Z5GA 3FYTA 3M4YA 3EMBA 1HFEL 1O94A 3H3FA 3ORYA 4OHBA 1H93A 4MGHA 4W5RA 1D3AA 3R6TA 4OJKA 3BCSA 4ZVKA 5J63A 1ES9A 3E6AA 1S3GA 2E6KA 3STHA 3VR6A 4OIMA 3EHEA 4IDBA 2IHNA 3KJQA 4B3SB 4G4SO 1L5OA 3N2LA 4C4XA 2FSPA 3A05A 1VCIA 2BZGA 3EARA 1GUYA 3IP9A 3PYLA 4EJ6A 1D7OA 3KLOA 1JU9A 4Q05A 4QU0A 1C29B 1JMVA 1T2DA 3ZGYA 1OT3A 1T2VA 4ISBA 4MAFA 1E32A 4NYMQ 1R0KA 2PEZA 1XQ1A 3BXOA 1BG6A 1X8JA 2X5KO 3IRVA 4UC0A 4YRAA 2XQKA 4RO0A 3HXMA 4JLDA 1MJGM 2E6UX 2HCRA 2I2CA 3AOEC 5B37A 2ODNA 5C5DA 2D4HA 1VSBA 1PK7A 3EGEA 1XYGA 3LQKA 3R0JA 3MINA 5C3MA 2OZLB 5JRDS 1PT9A 3RWOA 4QDOA 1QF7A 4XVQA 5D7BA 1L2TA 2F43B 3OOSA 1P1CA 1H94A 1SUBA 5AVVA 1LF0A 5EMLA 4CMIA 5DP1A 2JI4A 1F8YA 1LI7A 3KPJA 3EC1A 1CCWA 2X0EA 1AK1A 2NZ2A 2JFVA 3UVEA 1QVRA 3HDVA 3RODA 1Y9EA 3MS2A 3HJGA 1NTRA 2WPDD 3VR3D 1O97C 2Z3ZA 5K3AA 5KNBA 3WL4A 2WFLA 4JI5B 3KHUA 5GZ3A 5CLLA 5KNLA 3S81A 1RQ7A 2C1ZA 4MINA 4I1VA 1NF2A 1P3DA 5AXCA 5LKRA 2OBLA 4PYNA 4FSDA 1B6TA 4MWZA 4QQNA 4HBGA 2VYFA 5CX1A 5JS8A 3FOFC 2NXWA 1Z38A 3SKVA 2C00A 4GP7A 3WKBA 5B6IA 1CF4A 3RARA 4RPKA 3KDSE 3BJRA 4HLNA 3OOWA 1SR8A 4GECA 2XDYA 5FPHA 4EKIA 2QRQA 1D2HA 2WSMA 3A8TA 3D0RA 4HEHA 3I53A 4JVMA 1VA5A 1T6XA 4J49A 3K5HA 3V4LA 1C9KA 1OLOA 3LE8A 3RIMA 2ZYHA 5CA1B 2I78A 2QD4A 4NCBA 3ZE8A 1H4TA 2QM0A 2XUKA 3I2YX 3P5BA 5BOVA 4CN8A 3L4KA 3RU9A 1YIOA 1E69A 4IHJF 4C7MA 5A6SA 5A05A 4Z2AA 1P80A 1U1GA 3NHUA 3WL3A 4UU1A 1R8YA 1U2SA 4ZT6A 3HEMA 1ZGHA 4EB0A 3LAWA 5L45A 2HV8A 3OZAA 4LMRA 2VZLA 2LCQA 3S5UA 1NI4B 3P0HA 4URZR 5B1DA 3SYRA 3GUZA 3GMIA 3HY4A 3KEGA 3WLTA 4KQ6A 3UBTA 3U39A 5CXQA 3B1XA 2GEFA 3R74A 3RKUA 2AJ8A 2ISQA 2YRWA 3RREA 1UADA 2QTFA 3NIFB 4RLFA 4XVRA 1ZVQA 5CVTA 1ODFA 4QGBA 1RCTE 1RPNA 4LKRA 3TVTA 3IEKA 4MYDA 2FUKA 1GTL1 1UINA 2BIFA 3FTCA 4Q1AA 1X1QA 2QM7A 1JEQB 4FNGA 3RSOA 4D98A 4ID9A 1PBNA 3KUCA 2VH5R 2OO3A 4DWJA 1SBQA 1L5HA 4LDPA 3DP9A 2NYRA 3VR0A 3X2EA 2IZ0A 1IONA 1KA9H 3A37A 3DFKA 4O0LA 4WSOA 3QLTA 1EB9A 1G3QA 3E7XA 3ZQ4A 2XZLA 4YI3A 3I62A 1FDWA 2COEA 2I33A 3AH8A 2YNMD 2CXTA 5LA6A 4D92A 3T52A 3U3ZA 3FTDA 4IUCS 2ZBVA 1JXQA 3L2OB 4RK4A 1U7HA 2R6JA 3PC8C 2Z3WA 1TTPB 5KQPA 3I9V6 1XDBA 1CEQA 1G6OA 2J9FA 1G3RA 4P32A 3T7RA 4B5LA 4DDMA 3NH6A 1B7GO 1KFJB 3VYTB 3E18A 2G9ZA 2WVGA 3A9TA 3HVIA 3TQRA 2NUPB 1KI4A 3DEIA 1X94A 1L7VC 5FD8A 1A8UA 5IASA 4BDSA 2GGSA 4N5LA 5JDCA 2YQ4A 3CZ4A 3IJRA 3BHIA 2SKDA 4WUVA 2Q46A 2EJTA 2I71A 1KJ8A 1Q1GA 2YJGA 2Z2JA 3NKLA 3I64A 4OXNA 1IATA 1RQXA 1Y1QA 3OX1A 4NONA 4TRJA 5FP0A 5IAKA 3VJLA 3PVSA 1VPTA 1VKOA 4TWJA 2XUHA 4MHOA 4YACA 3SNKA 1GNQA 2Z09A 3GRVA 4G0OA 4HJRA 4CF6A 4DG9A 3OM8A 1U3DA 2E4WA 1M6EX 5TPWB 1BMFD 3HVKA 4LJRA 2CFOA 5CXSA 3DR3A 2BFCB 4MB0A 2R1VA 3IUPA 4C01A 4KFCA 2EX0A 3ADBA 1NSFA 3QU2A 3U44A 2JCGA 4ITUA 1CR0A 2GZRA 1WZCA 2JEYA 1GCUA 2YVAA 4ZOBA 4G0QA 4BGEA 4BU1A 1WMDA 3AEQB 2VC2B 3GJQA 4YREA 4JUFA 2B34A 3QVXA 1EWVA 4OP1A 3GRFA 4Q93A 1TAQA 1B16A 3C5CA 3VZRA 4O4IA 5CG1A 3I0NA 1P18A 2GUGA 3REQA 3HR4A 5IWAB 4Y1RA 2I65A 4WK0B 4JC4A 2Z8ZA 3PHCA 5C7OO 1G6HA 1U3WA 4CCSA 2ZW9A 4KOEC 1Z2OX 5M2QA 4G1MB 4IFEA 1F9AA 4ZHQF 5JZMA 4MWEA 4RS3A 1EE1A 2O2CA 4YT5A 1B0ZA 2YXBA 3BGSA 4KACA 4NL4H 1SXJD 4FUTA 3KUDA 4ZANA 2Z5GA 3PHHA 4F2PA 5BYAA 1G2IA 1TVKB 3I05A 2P0YA 3FROA 5JS2A 5KJEA 1NN5A 4HNRA 3UJ7A 1QFXA 4TT8A 5BNTA 1S8OA 1TK3A 3VSCA 3K31A 4E09A 1NKVA 3DZIA 2Z4TA 4AX4A 2F9LA 3JW8A 4CQMD 4OQXA 3COJA 2WJHA 1YJ5A 4PZCA 4E7OA 3GJTA 3MG9A 2ZOSA 2R3SA 3Q2KA 4FDTA 4BLVA 1VCNA 4EX6A 1KZ7B 1V4BA 3PDJA 4UJ5A 3L0IB 3OZFA 4H1HA 1JFFA 3C3PA 4HYQA 5DJ5A 1B0AA 1NFRA 1YBFA 1B3BA 3HJNA 5DZSA 1EFRD 3OWHA 4QOFA 4EKGA 3DCJA 4PZLA 4Y9SA 2IS2A 1X1CA 3A7DA 1Z6QA 4FFLA 5BV2P 3S68A 5SZHB 3HSKA 2PHZA 1A69A 3V1YA 1E2PA 2P5SA 3GI1A 4M8IA 2Q5LA 1H85A 1HE5A 1XVAA 4FN4A 1Z5ZA 4ZO4A 3BSWA 5B1IA 2Q2NA 5JIBA 5G40A 4B2PA 1Q0SA 2GCIA 2R6ZA 1C1DB 2NO7A 1V3VA 3HGMA 2QRJA 2NW6A 2GR9A 3MJDA 2GD0A 3ZS9A 5AVWA 5ILQA 3FBTA 3BWCA 2BTQA 1SRQA 3GFGA 3OJCA 1ML4A 3GB9A 1XRLA 2KE5A 4CL3A 2PUJA 1KI6B 4DN6A 1II9A 1CRQA 1P2SA 1VL2A 3G2PA 1AV7A 1JYFA 3ACDA 1HDEA 1MB2A 2FJPA 2R2AA 4EGJA 2O20A 1ECJA 4BX9A 3LL7A 3S99A 5B1EA 1E9CA 3PRHA 2W58A 3DXXA 4D9JA 3RV4A 4INPA 1JSXA 1YHYA 4QUEA 1U8XX 3THXB 2GBIA 4DLWA 3ER9A 1X1DA 4AD8A 1VSTA 5FOXA 3QUTA 3OZTA 4MYTA 4ZQGA 1IUPA 3F3MA 4Q0MA 4BVFA 3DDHA 1AK9A 2I6UA 4NNOA 1JQJC 3HVJA 3P0JA 5B4TA 2PBLA 3IP8A 2ZSAA 2QVCA 3KQOA 1KH1A 1FE8A 1Q7EA 3G8AA 4GSKA 4HAYA 1ZD3A 1DRKA 1AS3A 2VDMB 3PU6A 4C2AA 1ZESA 1TZMA 1ZM7A 4EPWA 1N0WA 3HJUA 2H5EA 4ITVA 1QG2A 1R7RA 3HV0A 1RI4A 3IUEA 3O74A 4QTUB 3WHPA 4JK3A 4HDOB 4MVWA 2UVPB 1V5GA 2CXXA 1FFXA 4GFDA 4UEOA 3WJAA 2I1VB 2NO6A 2WM2A 1GSIA 1MHTA 2BSAA 1VSVA 1W5FA 2ZLBA 4C6RA 1HF3A 4K6HA 1A95A 1EJBA 1VHQA 1SOVA 2IXTA 1K9VF 4PC7A 4Q19A 4E3ZA 3N5CA 3RRJA 4C6HA 1JZSA 2FTKE 1H8HD 2V0CA 2VUTA 3B89A 4D0GA 2DPXA 3KSBC 4U7TB 5BN4B 1Q7RA 2VAXA 1VJCA 3B8HA 1N7IA 3W9UA 4LC9A 3LD9A 4D81A 3V4ZA 3FNGA 4KXWA 1GDTA 1B2RA 1FA9A 1ZG3A 3QVKA 5LYYA 2HGSA 5K2OA 2NV2B 2EKPA 3FGNA 3MWEA 1DAHA 3LQ4A 4ZRDA 3W9SA 4X8HA 4IIGA 1SG9A 2ZT5A 1GT91 1NW3A 3CCBA 4P1ZA 3ROMA 2H7YA 4LSZA 1A9YA 4IOMA 4LHWA 2QTCA 4I6EA 5YASA 3ON5A 3V33A 2F1OA 3W34A 1NKTA 3EIQA 3LO5A 4MCIA 1K2VN 1PR1A 4M0MA 1OAKA 4O2BA 3B1VA 2BR5A 2WU3A 1ADFA 4FD2A 2AUMA 2BSQA 1HLDA 1SCDA 4HPWA 3F6BX 1F2TB 4X91A 4ATNA 2GXQA 2R6CA 2W11A 2CN1A 3QE2A 5EYPB 3SX0A 4FGJA 4PIMA 2A94A 2IEYA 1NC3A 5F21A 5BMVB 1H23A 4YP1A 3U16A 1NUAA 1DMSA 1SVSA 3RHSA 4QHSA 3MUEA 4Q7EA 2G6BA 4BN5A 4IINA 4NBRA 2NQ2C 1RDFA 4BX8A 6AT1A 2VJKA 3RRMA 1VMEA 4G9GA 2J0UB 2R47A 5MFPA 4MQEA 1PNRA 2PRKA 1EWRA 4HOYA 1CUFA 2HX1A 3C3BA 2HJRA 1F60A 1TIBA 4NFSA 1D6NA 1OYVA 1IMOA 3NH9A 3DKRA 5BN3A 1E6LA 2OLEA 4FYXA 3ZWAA 4NZOA 1GGVA 4AS2A 1J7KA 4BWVA 3QV1A 4E14A 4XIFA 4DR6B 3PXUA 4HV4A 3CZCA 1P5JA 2KW5A 3F7MA 5BWNA 1E96A 2PYDA 1A98A 3GBPA 5F5NA 3AKDA 3SDSA 4AU1A 5A9RA 2OCKA 4X45A 5T4HA 2UYGA 4OM8A 2Y0EA 5HIAA 5IHXA 5FOUA 4XDGA 1YVEI 3SQNA 4MKZA 4TLEA 2FZVA 4U6SA 3AHEA 3T4PA 4HLCA 3WYFA 4YVFA 5F1PA 1HO3A 1U8EA 2HA7A 2P1DA 2RHJA 3TQFA 4PIVA 5T8KC 4BU0A 5JC8A 4ASUD 1QHYA 4N0DA 2LCFA 4BRUA 4EMBA 1QP8A 1GPBA 1QGOA 2I1QA 3ZHYA 3DHWC 3Q8LA 3KPWA 1LC3A 4QWWA 2BM8A 5E95A 1AZLA 5FPPA 3TQSA 1E0AA 3CW9A 2OKCA 2CLSA 3R3UA 2C84A 3TNLA 1NIPA 2E55A 1T36A 4MGZR 5EZSA 3VOAA 2B2CA 4KLZA 2Q6TA 3FYDA 1DX6A 2Z56A 4NK4A 3RBVA 1KARA 2W48A 4MUMA 1OC2A 4MDFA 2B3TA 2AZ4A 4J91A 2ZRHA 3HCCA 4MRPA 3JASA 1C81A 2C78A 3AUTA 5AJXA 4JI6B 5BSUA 1UM9A 2Y92A 5A9SB 1JI3A 3DCNA 2APJA 3A6EA 5E4TA 5CJJA 4H9GA 2A33A 5AMXA 2JIOA 1E0DA 4LZJA 5EEGA 4ND3A 1J5PA 4BUCA 2G08A 2FMUA 4EYOA 4QT4A 1L5VA 2GCOA 3AHGA 3JARA 4OHVA 3WSVA 2X0JA 4GYWA 1NXTA 2YJZA 4CW7A 2AFHB 4RD0A 2V6IA 1XMIA 1SCNE 4PC6A 1M6WA 4RYLA 1Y3BE 5ADWA 1ZDMA 2JH8A 1NLMA 4YNBA 4XWWA 2M98A 2E49A 4D02A 1AMNA 3AF5A 4OO3A 4JNCA 3Q0IA 5DBFA 4EMTA 2RKWA 3FDZA 3KHTA 2BFEA 3G1WA 5CVUA 3ES9A 4KBYA 3RYHA 2A67A 2F3UA 3KJHA 3VPBA 4QPCA 1QHHB 4FYMA 5AQ1A 4D9IA 5BQOA 2FEMA 2Q07A 2WHRA 1X7XB 5AJUA 5TEWA 1NBMD 2P9QA 2WYOA 2W2OA 4AJNA 3NM4A 1ZN9A 2E21A 2ZT6A 4IVRA 3T9DA 3WXBA 2VPZA 3U7QB 2QRPA 5DHAA 5K0JA 4Y98A 3GJXC 1EGQA 2OCGA 4JASB 1HE2A 2VAWA 1AB6A 3P9NA 3RJMA 3A4MA 3FWNA 1OX5A 3OJFA 2CHFA 2AXNA 4YFVA 1Q1ZA 1DAFA 1UBHS 3WQBA 2B30A 1QDUA 4L16A 1DPGA 3DQPA 1YMQA 1PYOA 3U26A 2WU8A 3L7DA 4BP9A 5MFZA 5JYCA 3A1NA 5C51B 1IQ0A 3KC2A 2VT7A 3Q3JB 3KQLA 1Z0JA 1QDEA 3UGTA 1Z4IA 3IVRA 3OU6A 3FCYA 2YS6A 5EWLB 3EGXA 2GESA 1QR6A 2V03A 4QODA 1H4QA 3L46A 1TUBB 5DNEA 1SN7A 4ZOEA 5KX5F 4M87A 3HNPA 2Y8EA 1LDNA 1FYWA 4X60A 4IXTA 2FCRA 3DT8A 3HO1A 1U8YA 4RXUA 3TQHA 1OYOA 4WBXC 5BV8A 3LDHA 2BKAA 3UYKA 1GTZA 5CBPA 2AX3A 3EMDA 2HYIC 3IAM6 3HXPA 5HGXA 3ZU5A 4V1CI 2IH5A 2LDBA 4FFNA 3N76A 3HKCA 4XDZA 2HB6A 3I42A 1ZRSA 4ZYTA 3IVAA 4LRWA 3SHQA 2D8AA 2GNAA 1GUZA 2B1RA 2W90A 2ZJ2A 3L07A 3U5ZB 2OM6A 5FKJA 1BFDA 1OU4A 2I1LA 3I8OA 4J0QA 4G24A 4EHBA 3ESXA 3L7NA 4EW3A 5EQTA 4MQBA 4G0PA 4YQZA 1FFAA 1CV2A 3NKVA 4N03A 5BSKA 4AO7A 3UJHA 1N7GA 4D56A 1QS0B 2Q8NA 5TQ2B 1UAAA 1LS1A 2VJOA 4UBOA 1B4DA 4IF6A 3OJOA 1XX6A 4HLUA 3I23A 3P7MA 3D7RA 4N5IX 2DFDA 4C0HA 4CM8B 2ERXA 1ZBDA 1IDN1 1YUNA 1Y81A 1YJ8A 3R5SA 1QRRA 1YXMA 4TKVB 1Y3IA 4XUEA 1EINA 4JMLA 4OIFA 1SQSA 5HPYB 3KU4A 3PPVA 1MX3A 5H02A 2ZAYA 4AY6A 4ZO8A 4DQDA 2RDMA 4ZRMA 3FBWA 1LPNA 3UHFA 5KOYA 2IYOA 4F86A 4DA8A 5K0TA 4L27A 4PPYA 3ODGA 5GV8A 3M4XA 3X1KA 1T5BA 3GD5A 4QYMA 2A5GA 4V0MA 1OFUX 1WXWA 4JHXA 3B2NA 1ODTC 1CE8A 2QTGA 4F5WA 4D25A 4JLVA 2XYRA 4UD2A 1K5HA 2ID9A 2MOKA 2PN1A 3FMFA 5G4KB 3U6BA 4RZHA 4P4SA 4CI9A 2XGOA 4V0NA 4C87A 2VA8A 5JZSA 2GS9A 3AYXB 5D51S 1NOJA 1TYDE 5IVIA 3TZLA 4LY0A 3JQPA 3BICA 6YASA 2C42A 4OGKA 2QX8A 4PG5A 4Q4DA 1YA6A 1M75A 3T3MB 1TGVA 5FNVB 1CB7A 3G0CA 1E7SA 1ESMA 3T1VA 4BEBA 1YTUA 1VYVA 3DF9A 1TM5E 2O3SA 2IYZA 3NUQA 4B3BA 1FTNA 1XQWA 4H4EA 2C7GA 2XA9A 3HM2A 2QPOA 4P8RA 4UNQA 5H68A 3UEOA 2HXYA 3FVTA 1GSAA 3R8CA 3HUFA 4TQGA 1MLDA 5HFAA 1LV8A 4DCCA 1VKRA 1OKKA 4OHFA 4FMCF 3QXHA 1WV0A 4G1VA 1V96A 2RFLA 1FBTA 1HH4A 1ZK4A 1NW9B 4WZAA 4I99A 4WN9B 2PZMA 1OWLA 2X7HA 3FRJA 5I9BA 1X3LA 2WHPA 4RWZA 4ETNA 1U4NA 4MGKR 1Z75A 2PGIA 1HQDA 3PGA1 4X6LA 2YZ7A 3NTXA 3RABA 1A2QA 3NEYA 5FORA 2GF2A 3PCXA 1O6ZA 2Z6UA 5IUNC 1L5LA 4P92A 5LC1A 4KYTA 1NUTA 1STOA 1XQVA 3MAAC 4P9NA 4PFSA 1K08A 3MILA 1NW4A 1LH0A 1XZQA 2B94A 5J2UF 4QARA 1P3JA 4NFYA 4KN8A 3SEZA 3QE3A 4MAMA 2HHHB 1S96A 2FEKA 3ZEIA 5LA6F 1U0LA 1OWNA 1AQYA 1NA5A 2NZJA 3DDOA 3GGSA 3ICCA 4ES6A 1AJEA 5DIZA 3OOJA 4I4CA 2HPVA 4CT0A 1THGA 1M2WA 4PZPA 4YXWD 1CY8A 3B3AA 3R41A 1IN4A 3FMIA 5A4FS 3CVYA 4G4JA 1Y6FA 2N42A 3EEFA 1D1SA 3SDZA 3WZMA 1QDLB 2QRVA 2HTEA 5CTJA 2CBXA 4CT4B 4LDNA 2VJCA 4DDHA 1IM8A 1LK5A 1QYCA 3QEKA 4BLRA 2ZQ5A 1AQ6A 4IX9A 2BR3A 5BYBA 1KGDA 1RXCA 5CVJA 2RHRA 5CP8A 4C04A 5C81A 1V9LA 3H9BA 1V7QA 3IXMA 3V34A 5AVJA 3EIFA 4EATA 5DYIA 5B57C 3IKMB 4HNAB 2ZUVA 2C92A 2WJWA 5MGBA 3K9LA 2EJCA 1L5YA 2XOKD 3KDPA 4G4SP 1XVIA 4JGGA 3WI7A 5BN5A 2YYZA 1S2LA 2QAGC 2FP4B 1EA7A 3UQYS 5AIAA 5IN5A 2CZCA 1Y3AA 3AUSA 1XLTC 4D5GA 1T4CB 4PG6A 1GPLA 3G0DA 1K1EA 2P78A 5CNMA 1NXOA 4YRJA 1RSZA 3MWDB 1MAUA 2P9BA 2L42A 3D2CA 1YU6A 4PQGA 2B8NA 2YN2A 3BQNB 3PFNA 4IUYA 4YROA 3WDKA 3X2FA 4PX9A 2JLWA 4ER0A 4H0CA 1W44A 1F06A 4O4JF 1Y8QB 2GM9A 3X2SA 4ALIA 3KKLA 3W8RA 1JKXA 4AZ3B 5CB4F 5JW6A 3IELA 4HX5A 1Q7CA 3LT2A 4OGWA 3DTTA 1WBDA 1JDTA 5KWIA