4MQEB

Crystal structure of the extracellular domain of human gaba(b) receptor in the apo form
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
415
structure length
403
Chain Sequence
b'SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 139
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqeB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mqeB01
4PE5B 2CHFA 3JPWA 4G0PA 5IUJC 1JFTA 1NATA 3SM9A 3KYJB 5CNKA 3RVKA 1LBHA 1YMVA 3F6CA 1Z26A 1CHNA 3HM9A 2PL1A 1M5UA 3D8UA 3IPCA 4RU1A 2HPHA 2FN8A 4P1ZA 4YS6A 2PUCA 3HK2A 3MYYA 3QEMB 4RY0A 3FMVA 3OQNA 4QYWA 1BDJA 3EQZA 3ILYA 3L6UA 4DN6A 5JNWA 1NXSA 3DLHA 1MB0A 4YV7A 1NXVA 3O2QB 2O20A 5CNIA 2FXIA 3C3KA 3H5VA 3MM4A 3JY6A 4IMJB 2RJNA 1W25A 3M6MD 4LDZA 3W9SA 1CEYA 5BQ3A 4XXHA 2OQRA 3LKBA 3C97A 4MQFA 2Q5CA 4KZKA 1JHZA 1E6LA 1QQAA 3OLZA 4GPAA 4L4UA 4ETMA 3LMKA 1E6MA 5CHYA 2IPAB 2GKGA 3LUAA 3LUJA 3IPAA 1M5TA 3JPYA 4TN5A 4EVQA 1NXXA 3G85A 3NHMA 4MQFB 2I6FA 3O1JC 3OM1A 2JCGA 3MQ4A 4EYGA 2E4ZA 3GRCA 5D2CA 3CG4A 3N0WA 4WUTA 3TO5A 1ISRA 1USGA 2AYZA 2W42A 4KRFA 4WXMA 1T34A 2CD7A 4D6YA 1NXPA 1D1PA 4RSMA 1P8AA 2J48A 3KHTA 4RXUA 4OLBA 3SNKA 3DGFC 2PE5A 1ZGGA 3GBPA 3LTEA 1PEAA 4JP1A 3E61A 3URMA 3VNBA 3KKEA 1DC7A 2ZAYA 3K9CA 1S8NA 4RK0A 3HDVA 2DRIA 2R25B 3DBIA 1GUDA 2PMCA 2HQOA 5EWLA 2L19A 3QELB 2PLNA 2F8TA 3MIZA 1KGSA 2LUOA 3N0XA 2FQXA 3FFTA 1VLZA 3SAJA 3A10A 4HNSA 3MF4A 3N53A 3EGCA 3KJXA 5KC9A 1TJYA 3LFTA 2FLWA 3F6PA 3GL9A 4M88A 3HDGA 4MR7A 5EWLB 1WETA 4N03A 4Z9BA 3TX6A 4W5RA 3SY8A 4KMRA 2L18A 3FGZA 3RH0A 4ZPJA 3JS5A 4IF4A 4WXEA 4UHJA 5TQ2A 2IPNA 3O2SB 1YIOA 3EDCA 3MA0A 2WJWA 4N0PA 3OLXA 4Z4IA 3IP5A 2GWRA 1C4WA 4MR7B 3HVRA 1ZH4A 4L85A 2PUDA 4YP9A 3UK0A 2LP4Y 1IIBA 2HSGA 2H0AA 4PICA 5TQ2B 3QLVA 4RXMA 4EYQA 5KQLA 3OLYA 4QICA 2JK1A 5EWJA 4E7PA 4MS4A 2PUFA 4FE7A 1DBQA 4MQEA 2JBAA 4Q6BA 1P6UA 3OO1A 2LIVA 1I3CA 4HYEA 2P4UA 1M2FA 5TPZA 3T8YA 2NZVG 4KNYA 4IRXA 3CNBA 3FDFA 4YR7A 4G0MA 3JVIA 2V0NA 3FFXA 1U04A 3QLUA 2P9HA 4RKQA 1EFAA 2JVKA 2JVIA 3GT7A 3RVLA 1JYEA 1JWLA 4Z9AA 2PJUA 5EWJB 4EVSA 5JNUA 5DGCA 5E3JA 4LZLA 2KYRA 2JBAB 1ZESA 2M1ZA 3OMWA 4MQEB 3O1IC 3TD9A 4YGXB 1EWTA 1HEYA 1Z13A 3NNDA 1ZDMA 1Z25A 5TE9A 4KV7A 4QYMA 4G97A 1EWVA 4Y9TA 4NV3A 3I45A 1LBIA 2VUHB 3Q9SA 1RZRA 3QX8A 1VRVA 1PNTA 4CBVA 4UHKA 4G86A 5B3JC 3ILHA 1RNLA 4MGEA 3EODA 3OLVA 3SQNA 4RS3A 2NUBA 2YHBA 4XLTA 1DCMA 4Z99A 4ETIA 2N9UA 2JB9A 2PAFA 3O21A 4G0YA 2ID7A 3CZCA 3EJWA 1QPZA 1QNLA 4RKRA 3F73A 2QSJA 2E4WA 3FFWA 5IEJA 3LUHA 1BA2A 4RK7A 2PUBA 3JTEA 2HQRA 5JNTA 1YTUA 1Z16A 3RVPA 4PEVA 3HO1A 4YO7A 1ZY2A 4W5OA 3NNSA 4MR9A 4KQCA 1XWWA 1D4ZA 3BREA 3EQ2A 3H1FA 3H5WA 3H5LA 3HUTA 3KS9A 3R0JA 4Q7EA 1L5YA 1Y1LA 2L2QA 3RVQA 5T3YA 3DGEC 4LE0A 2GBPA 4RDCA 5TPWA 3T38A 5JNVA 2NT3A 4RV5A 3UKJA 1MVOA 2JVJA 4Q6WA 1KRXA 2HQBA 4KK4A 4Z4FA 5I4CA 1MB3A 3CG0A 1VKRA 4MR9B 3EAFA 3KLNA 5TQ0A 3GA5A 4P98A 2NZUG 2M98A 3C3WA 4G0QA 3CZ5A 1SD5A 1A0OA 4RY9A 3LOPA 2B1JA 2FEWB 2WMYA 1JH9A 4W5NA 2IPMA 5TPWB 1DCKA 4EGSA 5FWXA 5ABPA 1GCAA 4YWHA 4YCSA 1NY5A 3H6HA 3Q41A 4G0ZA 2AYXA 2VUIB 1YMUA 2FW0A 2MSWA 4ZMSA 3QELA 5TQ0B 3GWGA 3M9XA 2HJ9A 4MLDA 5IEBA 5C5EA 3HJFA 1USKA 4KQ9A 2E4XA 1FFWA 5IX8A 4XARA 7ABPA 5IUKC 5FWXB 1JYFA 4GNRA 5HKOA 4EYKA 1W9HA 3UUGA 3G1WA 1DBWA 3HSYA 4F06A 4N41A 1K66A 4EYOA 3O75A 3O74A 1TVMA 4MYRA 5FWYA 3RVSA 1Z17A 3NHZA 2MYUA 3HCWA 2IOYA 1PHRA 4B09A 4Z4GA 2CHEA 4EUKA 2QU7A 1F4VA 4PZ0A 1KMIY 1YS6A 4LE1A 8ABPA 3RVRA 4OBBA 4F12A 4S05A 1DJMA 3O1HB 4DADA 1SXGA 3CHYA 4D74A 1QQBA 5FWYB 5KQPA 1A04A 4Z4CA 2QV0A 2MSLA 1U8TA 1PUXA 3KCNA 4OATA 4YLEA 3RVJA 3E3MA 4RWEA 4YRZA 1DZ3A 1DC8A 1JBEA 3JVDA 3Q15C 1LK0A 1YVUA 1B00A 1OXKB 1QP0A 5TPZD 1QP7A 1F51E 4MPTA 5JS2A 3C6QA 3HEBA 2X7XA 3MMNA 4ZYLA 4LRQA 4RK6A 1M2EA 4S04A 4F8JA 3OM0A 3HXMA 1E2BA 1Z12A 3TMYA 4KVFA 2XDYA 2FTKE 2IYNA 1L5ZA 3CRNA 3Q7RA 1TM2A 2MSKA 4WT7A 3DZDA 4FE4A 4W5TA 1JX6A 2QZJA 3QEKA 6ABPA 4MR8A 2WWVD 3IP9A 4IMIB 2FKAA 4JAVC 4JB2A 2IPLA 5GQSA 5DKFA 1OXBB 1BAPA 2ZWMA 5DTEA 9ABPA 1RZRD 1YK1A 2FQYA 2VYCA 4EY3A 1XHEA 4LX8A 4MRMA 3QLVC 2QXYA 3H6GA 3KTOA 3RVNA 1TMYA 2FEPA 4OLAA 3CLKA 1AB5A 4NICA 2PL9A 3TB6A 5BR1A 4MR8B 2L17A 1ABEA 1LJLA 1U2QA 4G0XA 3RVMA 3DLBA 4O5AA 4ZMRA 1J56A 5CNMA 2RJOA 4XFKA 1MIHA 2YHAA 2FLKA 3QLUC 2F8SA 1Z18A 4MRMB 2IDMA 2LPMA 3H5TA 2FEKA 3ROFA 4OTZA 4XASA 1DG9A 3I09A 5KQGA 1QO0A 1NTRA 2ID9A 3A0UA 5KWSA 4G0OA 1VPWA 4NCBA 3BILA 3N0RA 3GYBA 4H3HB 4IILA 2A9QA 1NXWA 1JFSA 4KFCA 1PEYA 3GV0A 1U2PA 4RXTA 4RY8A 4TMYA 2GI4A 1CYEA 3Q7TA 2IKSA 4KK3A 4F3TA 1BDHA 3KYIB 3A0RB 1D5WA 5FBHA 1FFSA 1A2OA 4MAAA 5TQJA 1JL3A 1D1QA 2PKXA 1H9CA 2BGGA 3CFYA 4KPYA 1ZH2A 4ZJPA 2FMKA 3H75A 1ZHHA 3QX9A 4EVRA 2MYNA 3OQMA 2R48A 1EAYA 3N6VA 1ZVVA 1YS7A 4H60A 2OENG 1ISSA 4N76A 1QKKA 1DBPA 4MLCA 2VK2A 4N47A 4DQDA 3RVOA 1URPA 3QLTA 4H3KB 5JNSA 4Z4EA 5IUNC 3VNAA 1RXIA 2E4VA 3T6KA 3F7NA 5PNTA 3BRSA 1JDNA 5IC5A 4F11A 3C3MA 2WB4A 3IP7A 1Z2EA 3M9WA 1GCGA 3HZHA 2TMYA 4E7OA 3LUFA 4JB0A 5KI6A 1KRWA 2E4YA 3OO0A 5DLEA 3BBLA 3H1GA 4MS3A 3CKMA 5EWMA 3LUKA 2FN9A 1QMPA 4TLLB 1FQWA 2R47A 2GX6A 4TLMB 3OLWA 2MYPA 4PYRA 1K68A 1Z15A 4MS1A 2FMHA 3D02A 3CU5A 3LUGA 3HS3A 3QK7A 1EHCA 2RGYA 3A3KA 3HUUA 3KG2A 3RQIA 4N0QA 1RPJA 4MS3B 5EWMB 3OQOA 1U0SY 4O1HA 5BRJA 4XAQA 3Q7SA 1MAVA 4LE2A 1GUBA 4NQRA 1QP4A 1P2FA 3NBMA 1ZN2A 4IGAA 1FFGA 1NXTA 2WJAA 2A9RA 3B2NA 2JRLA 4HNRA 1C0EA 1TLFA 4MS1B 5T7BA 4ETNA 1USIA 1DCFA 3N75A 4JOQA 5KC8A 4LDAA 4KREA 1D2AA 4QPJC 3I42A 1NXOA 3LUCA 1XHFA 1JF8A 1YK0A 2FQWA 3CTPA 1DP4A 2RDMA 5GOTA 4W5QA 2QVGA 2CWDA 1RXEA 5FBKA 1DRJA 2WY2D 1JDPA 4RZSA 4FB4A 3L49A 5C5CA 3K4HA 4RK4A 3ROTA 4O1IA 2PUAA 1JFVA 2H3HA 3HV2A 3KSMA 5JS1A 1BVHA 1ZGZA 2E4UA 1GLGA 2FVYA 1ZAYA 3H5IA 3O2JA 1P6QA 2FMIA 4NCAA 2R4QA 4HNQA 1R8JA 3LKVA 5BRAA 6CHYA 1Z2DA 3P9YA 5HM6A 2PUGA 1ZITA 4Z0NA 3CS3A 3SG0A 3H5OA 1AB6A 2MYTA 2B4AA 3S99A 4ML3A 3GBVA 5JNRA 4D6XA 4Z4HA 5ED4A 3NNNA 2QVCA 1QO0D 4OG2A 4WZZA 5HSGA 3T95A 5IULC 1LJUA 3IP6A 2LBPA 1UDRA 4JA2A 1DRKA 2FSPA 4JASB 1SRRA 3H1EA 1SXHA 3LUDA 4RK1A 5KQMA 5IBQA 5B3JA 1ABFA 4RK5A 1APBA 2QR3A 3N8IA 4MS4B 1PNRA 1E6KA 5HQJA 2FMFA 3IDOA 1SXIA 5CNJA 3I5AA 5F64A 2WRZA 3KLOA 4WWHA 2NT4A 3EULA 2A9OA 3OMXA 5DCLA 3BRQA 1JLKA 1BDIA 2PUEA 3QEMA 1EWKA 1FSPA 2QW1A 2A9PA
chains in the Genus database with same CATH superfamily
1CUCA 1C5KA 1EINA 1UADA 4HDAA 2HADA 3W1WA 1CUJA 2XMBA 4KZPA 3B82A 1DBSA 1QHNA 1TVEA 4HVLA 1BDMA 3KOYA 2YWGA 1OE0A 4RCZA 3X1JA 1U8EA 4C4AA 5C8YA 4P1ZA 1Q19A 5ENDA 4LBZA 5T4EA 3Q3CA 3FMVA 4C6SA 1U2SA 2VNSA 1A7AA 1IBSA 4QYWA 2J4DA 5JNWA 3DLHA 3LDUA 3DMPA 1LXCA 1E2JA 3OA2A 3CRVA 3H5VA 1U3FA 3NC4A 2PV7A 4JJAA 4FFSA 3E4CA 3BGOS 3WRYC 3JAWB 3L5OA 4L73A 4KKXB 2Q5CA 2K87A 4G4JA 4XVRA 5AO9A 2WTNA 1IRXA 2DG2A 3ICVA 4ZN6A 2WYHA 3AK4A 4IH1A 4L4UA 3BCSA 1KEKA 2ZE8A 4JVMA 1YRAA 5LD2B 4Y2PA 1MEJA 1AS0A 3HXQA 3ONVA 3AY0A 1M0TA 3AUFA 4BNZA 4R2KA 1XK6A 1QFSA 1MLDA 1PZNA 2X9NA 3EUEA 4G56A 4TM7A 3WBBA 1AZLA 1CJKC 1IIRA 3G2OA 5JXHA 2QE7A 5HBGA 3CXRA 3VZSA 1POWA 3GEEA 4WQMA 4WUTA 3ZHTA 4BCBA 1IN6A 3TO5A 1ZO8A 3F6YA 3WB9A 2BCGY 2Q2OA 3D6MA 2JLWA 1GFZA 1J24A 5BQOA 1M1UA 4A03A 4Z3OA 1IVYA 1QFYA 2D62A 4B2LA 4FDAA 4LVUA 4ETWA 1PR2A 4F6CA 1HDOA 4HWGA 1FUYB 2GZHA 1PS8A 2CMHA 3L7IA 1GQ2A 1KMQA 1CUSA 3LL4A 3OFNA 4ZHQB 3AKZA 2SECE 1Y6FA 4XEUA 4L1KA 3K32A 3W77A 5L7WA 4H59A 4JU9A 2AJTA 1ZL0A 3C4QA 4P3PA 3RFCA 5BWBA 3HXKA 2JLCA 2VNIA 4V0NA 3KQLA 2O8CA 4NI5A 3VTZA 2IZZA 3CZMA 3I6IA 1VMAA 2IXFA 2QX7A 4B82A 4BFTA 1Z6PA 4MKRA 2A1TR 3PEWA 2IPXA 2GCEA 3IIIA 4TMVA 1FX0A 3LPMA 4FD3A 5BQPA 2BF7A 4YA6A 2BGRA 4HGOA 4D4KA 4B6PA 4R1PA 3SAJA 4AZ0B 4DLAA 1EVEA 2G4VA 2CLSA 5JQWA 5ALZA 5JXWA 4P2GA 3ENZA 4YY3B 3ZU6A 1K86A 3AI2A 1TJYA 3HKDA 4V0RA 4BO7A 4Q34A 5H0IA 3WGKA 3ZK7A 4IFBA 3KDSE 1I24A 1EFRA 4KMRA 2HCFA 3PC6A 4LPKA 2GD0A 4LQDA 4G65A 2VBCA 3L84A 4S1PA 4LZOA 4ZPJA 5KQSA 3AEXA 3UK1A 2X5KO 2ZJ0A 5LQSA 4J1TA 4WY5A 2OHVA 3KTDA 3OZXA 4B71A 1Z0IA 2CXNA 1Z8FA 1WB4A 2CMFA 4M8LA 2I80A 3ZZUA 2X8WA 4EHJA 3EUAA 1C9DB 1KJ8A 2OZVA 1FFYA 1HF3A 2IBMA 3QV1A 3C48A 4OH7A 2II6A 5IZCC 2PFSA 5HYVA 1GT6A 1H4VB 2OCXA 3Q3GE 2XGGA 3MJ4A 4L4XA 1PX0A 1KZGB 2CMDA 3D8RA 4OI1A 5AQ1A 4R8RA 4G5GA 1QJCA 2YUTA 3FRIA 3OO1A 1ZRMA 3VVMA 4H1UA 1IM2A 4Z1MD 5IU6A 3H2IA 5JALA 2OOKA 4DSTA 4RLHA 1WF6A 3HBNA 3IQGX 3FDFA 4EK9A 1DAGA 4UHFA 1DFHA 4CG3A 4ZPXA 1IMJA 5CA0A 3RVDA 4YASA 2C1XA 1I10A 3GN2A 2IH2A 4KYVA 2YJ6A 2ZZKA 3JAMA 1S4MA 3RRZA 2ZM6B 3P2OA 3PJRA 5JY6A 4ZCLA 2GN4A 1Y7LA 4RJ2A 1YRWA 5IC4A 2GHIA 4N3NA 5HKKA 1U0BB 2QAGC 5JLJA 2G88A 3CNOA 4DR6B 5IJAA 4J0HA 1LBIA 1XEXB 3NTRA 1KQOA 4G85A 4IH9A 1EPUA 3SBOA 3TJMA 5HZHA 2W2XA 4HXFB 2VYVA 1K6EA 1VJ0A 2A0XA 1ZM9A 3F74A 1QIEA 2ZWIA 4GIBA 3S1LA 2P75A 2H1CA 1IUKA 1DCMA 3P97A 3WA6A 2M9MA 5H16A 4PLTA 3VKHA 2IEGA 3DUFA 2O4UX 1FMTA 3AFIA 4Z7OB 3AHFA 5FXMA 1ADGA 4D6PA 2W22A 3BFVA 3EIFA 2WE8A 4BLSA 3N39C 3WNBA 4YUWA 5LMNB 1AOXA 2Q6OA 1V7ZA 4RK7A 2H16A 3JQGA 4QAQA 1Q0SA 3WIEA 4UPEA 2C7BA 5BQ5A 4XPIA 4D4GA 1JV2B 4N5IX 2PJRA 1JXMA 3H1TA 4GEGA 5C8XA 1TEXA 2FKNA 2QE7D 5FOUA 1HR0B 4IWYA 4RTKA 3BREA 4Q00A 2CV0A 4JI4B 4FKMA 2PH1A 3D3EA 3PQDA 5J1TB 3FYCA 2ACVA 4JD5A 5L4NA 2ET6A 3A2LA 4CKZA 3VUFA 2GBPA 1QC5A 4F4FA 2QE6A 1R4NA 2JVJA 2GVDC 1XLUA 1BWSA 4ENRA 5JPCA 3E9NA 5DHTA 1H42A 3IDAA 4AUKA 1O97C 2Q1YA 1FFBA 2ZUDA 1HFWA 4EGFA 1GRVA 4YPVA 3OFND 3IBFA 1KKUA 1L7RA 3ORRA 4IRMA 4W5HA 3STUA 3WIBA 4CIWA 5HRCA 1QKIA 1I3LA 2EBWA 3DTVA 1LS6A 2BYTA 4BNIA 1RAHA 4II7A 3T1OA 1XZQA 2H4JA 1MH9A 1N2GA 1FBTA 1QIMA 4IQGA 2C99A 4ZTUB 1I7NA 3EHDA 5TQ0B 4K0KB 1IHPA 3M9XA 5JYCA 4FGKA 1DX9A 1CJSA 3VGJA 3BCUA 3QI2A 4F6LA 3ZD6A 3NAGA 4FDUA 1GNTA 4IUYA 3I76A 1CQWA 5HKOA 1AGRA 3BL8A 1RI5A 4WOCA 2OFPA 1XZFA 3DWIA 4FEYA 3EVGA 2A5GA 1K66A 4ZALA 5FLEX 5G0WA 3LPLA 3NBYC 3OIUA 1NNEA 2BGJA 2XNCA 3B7WA 3PRYA 3R41A 1EFRD 1UJ5A 1XKXA 1IPHA 4P86A 4P58A 2K6GA 1R0BA 2C2GA 3NW9A 4AZSA 4OXKA 5J2UF 2Z6UA 3D2AA 1QAQA 3K2EA 4ZAWA 4AJHA 4Z4GA 3MTGA 2GRJA 4B6EA 3G8BA 3NXKA 2X3FA 1QJ4A 2VHWA 3B2QA 3BXHA 2HWUA 3VI4B 2QOEA 1RABA 1X1BA 3Q2OA 4JR1A 3PPVA 4JDPA 1TUIA 3EPJA 2OLKA 3H0KA 4UU8A 5FI5A 4AK9A 5KYKA 1Z2OX 4JT2A 1F8XA 3ROGA 1RJDA 2AN3A 1UBKS 3N8GA 4KV9A 5C1IA 5IH3A 3B5IA 4J75A 2O1XA 4EJ6A 5LCXA 3JR3A 1DC8A 2WMNB 3JRNA 4D9FA 2G7ZA 5F12A 4F2DA 4HDOB 4JUIA 2QM8A 3GGCA 4Q24A 1KDYA 3AOGA 5CUQA 3JQBC 4WLVA 2GBFA 1KDOA 1QHEA 3DL7A 3QV2A 4RMNA 3RTBA 2QXTA 1WUKS 4HN4B 4BB0A 3UG7A 1VLJA 4DARA 2C9CA 9GPBA 1AX9A 1M2JA 2P4SA 4JBXA 5J5CA 4DGSA 3PU6A 1P6XA 1K3FA 2GPWA 1IPFA 4H4DA 5CTAA 1TJPB 5FA5A 3SJZA 3DR5A 2X13A 4E5PA 3IP9A 1FB5A 2ODWA 2QD3A 3PEVA 3TOXA 1MXFA 3FZQA 3O3NB 3ZZTA 5HKKD 2W8BA 2HA0A 4XIJA 2QIOA 2GUGA 4E4RA 4QG3A 3L6DA 1RJEA 3LBHA 2VYVD 1D9XA 4TZTA 3E2MA 1UZUA 1CLUA 1TMYA 1ULZA 1VKOA 1WRBA 1J00A 2H1FA 3HFRA 3BJEA 4MUKA 4MWZA 1PJBA 3FRHA 1FS4A 4FC6A 1KFEB 2CLFB 1TJ4A 1AXGA 1ABEA 2QRGA 4YLYA 1U2QA 5JAIA 6REQA 1AQ6A 1SY7A 5DGHA 5CT8A 3GNLA 2RJOA 2R86A 3LK6A 3SOZA 1MIHA 1T6BY 2WP0A 1IMOA 2Q5EA 3OJFA 3JW8A 1PZMA 2XYGA 3D54D 1DUIA 2BFCA 3T5BA 3UQZA 4WIAA 5TT0A 3CKLA 3QWAA 4JZKA 1KK1A 1SIBE 4XWWA 1YR7A 4XASA 4LGMA 4EELA 1O97D 1BJKA 3UAVA 2EJBA 1V1JA 4DHWA 1C1DA 5I9SA 1FUIA 2ZWAA 1WV1A 3PWZA 4QLAA 4KO1S 3X2SA 1NXWA 1QVRA 4QOHA 4PS1A 4WXRA 2VSXA 3LX6A 3U9LA 1J0BA 2HC9A 3ZE9A 3E5HA 3IXLA 2PBZA 3IAEA 1BH2A 2OV6A 2K2QB 3A6HA 4PCAA 1X39A 1GN8A 2QX4A 3LGXA 5IRCD 2ZOSA 4LZWA 2V6JA 3ICOA 3SEFA 4JS0A 3ZQUA 5I9NA 4G1VA 5CB6A 3RI3A 3KR0A 3M6VA 1GYRA 5B3KA 1I32A 1AF7A 2I87A 4K6CA 4LOAA 3WJ7A 3ESQA 3DTVD 1ADCA 2R11A 2ZTUA 3G8AA 2OD9A 2Q2WA 2BFEB 4M8SA 1ZHHA 1UPCA 4FFVA 1N4AA 1VIDA 4IR7A 3OQMA 1UDAA 1V2GA 4TSFA 1ANKA 3TIIA 2BC9A 1YUNA 2WOOA 4FMCF 4N9QA 5KYWA 2XHEA 1SHUX 2NXCA 5FPPA 4ZTBA 1X80B 2Z1NA 1MENA 3SHTA 1DEKA 3PQ4A 3JAKB 1JKXA 4R1LA 1XXHA 2NUAB 5CA1B 1BQ3A 4AO7A 5J59A 3U44B 3HZHA 3S27A 1KEPA 3MCUA 4NXNB 4FXOA 2ACKA 2EX4A 4JB0A 3ZI0A 3OO0A 3IBYA 3VVCA 1EDEA 4R2LA 2CSXA 3ZTYA 3BBLA 5EXXA 3UHPA 1N3BA 3CRW1 4WNCA 1GA6A 3OLWA 4EG0A 1Y1QA 4W5JA 4MKIA 4AKTA 3RF7A 3WIDA 4ITUA 2QNBA 4JBNA 5KNDA 1Z0DA 1G7CA 4DDWA 3GFQA 4ARAA 3VSAA 1AGPA 1QE5A 1I2AA 2RGYA 2WKSA 3JYHA 3P9QA 3K70D 3GIWA 4XE5A 2IYFA 3WWCA 3S44A 1LDYA 2L82A 1OVGA 3N3AC 4KWHA 5CMLA 5HIJA 4NE9A 3R3WA 3D64A 5A04A 1M2VA 3P0RA 1XZDA 4XJSA 3FPLA 4MWEA 4XB1A 2XT0A 1QB8A 3U3JA 1LDBA 1RYYA 3ZDXB 4HVAA 3D8HA 4MEBA 4W5NA 2N42A 4FJ2A 2O2GA 1F9AA 1SVSA 3CUWA 4X84A 3ZBPA 3ANMA 4BKQA 3IMEA 3VSEA 5J4KA 5BV7A 1NXOA 1J0XO 3O8BA 3GLQA 4M0MA 4B43A 4L51A 4YJ2F 5A3JA 1Z83A 3G79A 3M3DA 4DA6A 5J63A 1C1HA 1DRJA 1XTIA 3AB3A 1YHZA 1ZZEA 3MAGA 2QVZX 1IFXA 2DECA 1JFVA 4HYQA 4R6WA 4YQZA 3P0JA 3SVZA 1G18A 3UFXA 1JSLA 2VTEA 3CX4A 4XD2A 1O94A 5TC4A 3W2EA 3B60A 4L2IB 1IBCA 2FMXA 4DAEA 3H5IA 3RNOA 3QZUA 5IJZA 4ZK6A 4J2OA 1WXDA 5K8JB 1R8JA 2D54A 3LKVA 2P35A 1M33A 5BRAA 1ES9A 2W0MA 3V1UA 2Z6VA 3GJ8A 5HM6A 2PUGA 5JSUA 1K0UA 2O05A 2BRUA 5COQA 5HMMA 1OAAA 4B2PA 1OH7A 1RRCA 3GLFE 2WM8A 3TD2A 4RTOA 4ZU3A 2UYGA 4R0MA 2W2MA 1CQZA 3A3YA 5I7SA 2KM1A 3A9WA 4OHXA 4ZI7A 1L5QA 1WPQA 1C3JA 1OWLA 1UOOA 4GMDA 5EE9A 1DIHA 5T67A 3REQB 2YH2A 3RASA 5LU9A 3TQIA 5ALLA 2YL2A 1NFQA 4Q3AA 5DHRA 2NAPA 3UCEA 5CRIA 5CVCA 3PE4A 3DYBA 5DNAA 3AVPA 3SP1A 1XD9A 3ZY6A 3MMSA 3ETDA 4PC2A 1TYZA 3DFMA 1PNRA 2BGUA 5BN5B 3IDOA 4HDRA 1TYAE 2NVUA 1IAQA 3K09A 1SEVA 2Z30A 1YB6A 3AHIA 3MELA 1JLKA 3V9AA 2YV1A 3PVZA 1P2VA 3HRIA 4KU4A 2ABWA 2D5CA 1BXRA 1D8TA 1QG0A 2CHFA 2QW8A 3K1TA 1DQNA 3KD2A 2WC1A 4MUAA 3RPEA 3ANXA 3IR6A 4TSFD 5HBRA 6YASA 3ZWMA 3U4MA 1XZPA 2J3JA 2OYSA 1DDGA 4M0FA 4OHFA 3NHWA 2EYUA 2D3WA 5CM8B 2QN7A 4ZRNA 5IVHA 3HG7A 4YRLA 3Q10A 3ABQB 4JC8A 3RBXA 1W85A 4DN6A 1JLLA 2W93A 3HQ4O 1S9DA 2I2BA 1AT1A 1FU7A 1DO8A 4YQEA 5LOVB 3W8DA 3JQCA 4XYGA 3M6MD 5E4JA 4OGWA 3UT5A 1IBKB 2D1TA 3FHJA 2IP4A 4ZAYA 2DQ4A 2OCAA 3IOCA 3KKMA 1XNQB 1HNXB 1DGQA 1YC2A 3MVEA 2QI9F 5L95A 1II0A 1GCIA 3M1YA 3OLZA 4WLNA 2ZSKA 2WWIA 4ZCRA 5AVWA 1KK2A 1B41A 1MJFA 1YCDA 3IQZA 1H94A 2O0JA 4MEAA 1QIHA 1Q15A 1G8HA 1U81A 3D6HA 4YAFA 3P9KA 3ETHA 4KXFB 4MX8A 3N3BC 2FPSA 3EA5A 1AM4D 5JG7A 2PPVA 1A9XA 4FYHA 2YMLA 2ERYA 2ETXA 1RM4A 4QEZA 3BHMA 3IT3A 2RHTA 3QWFA 3BMCB 3F9CA 3FCEA 1ISRA 1P1CA 3CONA 4JQOA 4KI7A 5AI9A 2W42A 1GU0A 3A04A 1W5BA 2JHGA 3FE2A 4OJQA 2O2XA 4V0MA 4UW9A 1GZDA 3F8TA 5TEWA 4BO2A 1JAYA 1K4YA 4LJKA 1NSTA 5D3MA 3NZEA 3DOOA 3OX1A 4JXJA 4MEJA 5EVJA 3VHQA 1K75A 1PEAA 4KN6A 5HM8A 4ID9A 3PUWA 1XT6A 1FRVA 3R44A 1X7HA 3BMNA 1ZK1A 2D74A 1MJNA 4LXIA 2PJDA 3CVWA 1R50A 5JASA 3C4VA 4WNAB 5COAA 4Y2YA 2DRIA 1HG0A 3IOEA 1O94D 3CX7A 4DRZA 4KN8A 3L82B 2HQOA 4X24A 3IQEA 4KSBA 4U7FA 2GSWA 2IYYA 3U3MA 3NTUA 3PEUA 1L6RA 1LBTA 1ZL2A 2I6SA 4YMSA 3KZNA 3E0XA 4ZOCA 1FSSA 2YZMA 1UWKA 1XLTC 4J94A 4GP9A 1I5EA 3EZNA 2XYVA 3MF4A 4KSCA 5HKLA 2IX3A 2Q50A 2PD6A 1J7KA 3EGCA 3GRRA 2NPFA 5AVJA 3PHJA 3LFTA 1F2VA 3WWEA 4P3OA 1M6VA 2EZ9A 4PONA 4ZAZA 3MWDA 4RA9A 4GI7A 3BYZA 3UAZA 1T2NA 1PJ3A 4I9FA 2QTBA 3RYTC 4PSKA 5I7UA 2ZXFA 3JQFA 1T5BA 2Y71A 2UZIR 4HFMA 5HF8A 3IP5A 3I6MA 3UG6A 1C4WA 1LNZA 5CB4A 3L8CA 1ZUNA 2OZLA 3LQQA 5IM4F 2ZYTX 1TJNA 1PQUA 2G5PA 4UCXA 2B1IA 3B1KA 4X1IB 5AHRA 5EPUA 3IUNA 2YV2A 3E5MA 4AO8A 3U4IA 4MS4A 2I7XA 3RROA 3KOZA 1IK6A 3OZ7A 1DBQA 1V8BA 3B3FA 3C7KA 1T24A 1JEEA 2JW5A 2W2NA 2IYLD 3KUKA 4H35A 4GWGA 4HYEA 4M1WA 4MUXA 2UVDA 2HIAA 4JROA 4UXIA 4X0EA 1DUSA 4QDTA 4DNPA 1OGJA 2PKCA 2ADOA 4YR7A 1CE8A 1RU3A 4B79A 1UM9B 3Q8XB 1UOPA 1JVNA 1NJ8A 5FFMA 4AIIA 3E23A 4UNPA 1EBUA 3SQMA 1RYBA 5DGCA 2Y1OA 5BN4A 2R1TA 2Z83A 4LZLA 1FP4B 1ZESA 2JBAB 3OMWA 2J3HA 3QE4A 4GRAA 3DFZA 5A03A 1ZCAA 2QUHA 3HKEA 3MSCA 4MP6A 4PAWA 3PGLA 3AJEA 3A37A 4KRXA 4A6XA 3K0SA 2NSLA 3HJCA 1Y3IA 4I1IA 1RPAA 3RADC 1EWVA 2GM5A 2BY4A 3W2FA 3UJCA 3WGTA 2YJ5A 3V3KA 2OV1A 2ODQA 3W5CA 4CBVA 1AXRA 1PT9A 4UE3S 3NEJA 5K9ZA 2PD4A 4CV3A 3UBTA 3ZWAA 3I6ZA 3OY7A 4X92A 4G8BA 1JA1A 2GESA 2BM1A 2QUAA 4JC0A 1PU2A 2ZT8A 4CETA 2PUTA 5DLQC 4YP6A 4EHAA 2UXBB 3Q5EA 2ZXEA 1T6YA 4I6JA 3TQRA 5CFMA 1CR6A 2R6GA 4A8TA 5EMHA 1UFRA 1W0KA 4X44A 1G3MA 3VYWA 2QSUA 3ZWCA 5CG1A 4FDVA 4JJGA 4OBEA 2Z3VA 4F5WA 1SU4A 2CVOA 4NHEA 2ZRAA 4EJSB 4L0QA 3JTEA 3LDGA 2QX9A 3NBKA 2VI5A 2IF0A 1IN7A 4O4HF 1F38A 1KAMA 1ECLA 4JP3A 2EKZA 3GLGA 4PVDA 1QCZA 5B1DA 4DNOA 1Q7RA 1IOZA 1MIOA 1I2MA 4N5MA 2FMUA 2R4TA 1H0KA 2J67A 3IMKA 4C7JA 4G8JA 4LGYA 2DF8A 3L8EA 5EERA 3SI7A 4EKDA 2GOYA 3TCXB 3T7KA 4MVWA 1LV8A 2XUFA 4EGCB 1NW9B 4LJ8A 1Z56C 4YAOA 5JNVA 1AMUA 4MO2A 1E62A 2EP8A 4YUZA 1HLGA 4I1VA 2I03A 1B4DA 5AXCA 3E15A 2YBEA 2R6ZA 3I23A 3ZBQA 3P9SA 4FYJA 4HAWA 4JLOA 4JDUA 4PX5A 4LJYA 5EKUA 5F35A 2HRDA 5LP6C 1JHOA 3I9OA 2C98A 4IINA 5ECYA 3IAM1 2EARA 4Q3DA 2BT4A 1HV8A 1A8IA 3L7BA 4ZT3A 3EF0A 1A0OA 1C9MA 2QY6A 1I33A 4MP8A 1V3QE 4RY9A 2YOHA 3ZHUA 2IPMA 1W94A 1Y0BA 2CL5A 1LQ2A 4G24A 3T7RA 1EP9A 1E9CA 3UK7A 4LRSB 1NY5A 4MV1A 4TMFA 1VIAA 3WB0A 2AYXA 2YY7A 1XMJA 4L76A 4Q37A 4WCVA 5IAAA 5GJBA 2JLAA 5KINB 1OPRA 5LWQA 1RWXA 1G9SA 4I4TF 1GSIA 1PFWA 5M3BA 4KR9A 3SYTA 5AM3A 1OLSB 4QUHA 1KQFA 5LA6F 1JEQA 1IEQA 3SFTA 4L9WA 3JWJA 5THXA 2R1ZA 3I0MA 5KTRA 2Q6VA 5FWXB 3OE7A 1J0AA 2Q45A 4AJPA 5C3UA 1J8FA 4B6JA 1BFDA 5JSHA 4UHHA 2XVYA 4PSAA 3B3QA 2YXEA 5CFRA 2DWQA 2ZIVB 1RPZA 2RD2A 1GADO 1E98A 1N3YA 1ZOOA 3CR8A 3B13B 4KIUA 1LTHR 1X7ZB 2JJQA 3U4QA 1TEVA 2VZEA 1AY0A 2ZI4A 3BE8A 4DG5A 2FH5B 3I2YX 4FOLA 2QU7A 4B4VA 3HNPA 4Q48A 4US1R 2IS4A 3TR5A 1LZKA 2B1RA 4P80A 1YL5A 2YS7A 1KZ7B 4TT8A 2J7PA 4DNXA 2XTNA 4RTRA 4WVLA 3IJRA 1NE2A 4JBLA 4LWZA 2HU8A 2B37A 2R1UA 3G82C 1SG9A 4PPQA 3CUEF 1QS0A 2QF7A 4JOBA 3R3JA 4AUEA 4YRZA 3F6EX 1Y3FE 5FPSA 3UB4A 3SJAA 5IC6A 4GM4A 3DMTA 1WEHA 2FMTA 1LLCA 2H06A 3DOEA 5CXSA 3EXIA 3V34A 3RC9A 4MPTA 2H54A 3A8TA 3IKJA 1TCAA 2HF2A 3HEBA 3OT4A 4I5IA 4UUBA 5JS2A 2B5OA 4URVR 1USVA 3ECCA 1FS5A 1ZISA 1EX6A 1L7OA 1I3OA 1TIBA 1O5TA 1E0JA 2ZS9A 4GOMD 1ZD8A 2JCSA 3GI1A 1QMGA 4TMWA 4ASUA 2I54A 2H1HA 2ZKIA 3AKCA 4MVJA 3D3QA 1QVAA 2VH5R 3WK7A 1G291 1NDHA 4B47A 1JFFB 3ESZA 3TZKA 4DCMA 3DLPX 3N2EA 4PGGA 2PSHA 1Z0FA 3VPSA 3VUEA 2XJ4A 1PJRA 1CXZA 4YJFB 5DZSA 3WHPA 3TIVA 4UQLA 5MGBA 3IIKA 5LU8A 1SXJB 4BZWA 3F3MA 2FQYA 5I45A 1N2BA 3AKDA 2IBTA 3EGXA 5G0UA 3R5SA 3BAZA 5IT5A 3JQ9A 4KJZA 3TUZC 3DT9A 2IYTA 4KR6A 4HNHA 1AHNA 3V9PA 2Q3LA 5JZBA 1EFLA 3COSA 4XGRA 2P5TB 4JFAA 4QOFA 5D87A 3ND5A 1R8XA 3Q3EA 1CUBA 1CHDA 1U6JA 3NUZA 1W0KD 4CG2A 5K3SA 3HWRA 4JVOA 1UDXA 3L6CA 1YCHA 4Z6KA 4B44A 5HWSA 1SBCA 3P20A 3PUJA 2V7GA 4FQ8A 4YUXA 1RD4A 2FPKA 4OTZA 4R4JA 4WACA 5KQGA 1LA2A 1FP2A 3KKOA 3A0UA 3JV7A 3V2UA 1OX6A 1ZJ6A 3HMKA 1ECFA 4QGSA 2Q3CA 2BGTA 1KQNA 5BMVA 1KZ9A 1YB4A 2RAFA 3L02A 3PT9A 5E1MA 3RIXA 4LF5B 2CLMB 2NQ2C 4J3JA 4WW0A 5J2UB 2H9YA 3GV0A 1HMYA 3O31A 3TSOA 3NWJA 3O3MB 5CM9C 3HKBA 4AG6A 4L3WA 4FYXA 4L5AA 2AL7A 5KYXB 1KSJA 1JQ5A 3IAS1 4B6FA 4BEBA 4DWOA 1Y33E 2W43A 3DOCA 5BMOA 1DC5A 3I2GA 4JKOA 3FUVA 6NULA 3CZAA 3B9RA 4MJLA 4MZXA 3IA2A 3VR0A 1WZEA 3V5NA 3ILSA 4HDMA 2GQ0A 3FB4A 3UXHA 2HU5A 3PQCA 4F56A 1ZR2A 2ADMA 3AQIA 5EKXA 3BXGA 1IUPA 3S1AB 3HWX1 1T35A 2CBZA 2AFVA 1GOTA 3CLTD 2CXUA 1CZKA 1TVKA 3ZPXA 3CNEA 4U6SA 1G5QA 3ZXSA 1Q3TA 3F0TA 1E9RA 3KWLA 3CIFA 1QQ6A 1MQAA 4N76A 2EQAA 3TTTA 2VRCA 1UQTA 2L69A 1AQYA 3QOFA 1CRZA 5ENVA 4EJ0A 1RR6A 1YACA 3I0ZA 4UM9B 2XA9A 5EE0A 3FXAA 4V0OA 3VO1A 1CJUC 1RJ9A 1AKEA 4DNQA 1F1JA 2H00A 4ND5A 1AKQA 3T3PB 1PJ8A 2ZVPX 3L7LA 1XRMA 5JMOA 4URXR 5KWEA 4N6GA 3SOPA 4DLTA 5EWMA 4TTQA 4M8NE 3D3NA 4JJIA 2OFWA 3OEED 4UE6A 3UAXA 2WINI 3AXTA 3F96A 4JEMA 2ZAOA 4NMXB 5ITVA 1SWWA 2ZJ2A 4IV0A 1CJTC 1M2NA 3KYBA 1E79A 2WD9A 3U7EB 3WP0A 1L1EA 4XWOA 2OO7A 2XT9A 1GPLA 1I01A 5IJWA 1BHO1 2XADA 4A2PA 2P6NA 1RKUA 2C00A 1MFZA 2J7PD 2QNIA 1CVRA 2DAPA 2QN3A 3U31A 1THMA 2YQZA 3DHYA 1GVNB 4B2IA 4CMAA 3PQEA 4EJMA 5IPFA 3B70A 5JUWA 1QCDA 3UMSA 3G5AA 2WT8A 4NQRA 1QP4A 3HR4A 1QG4A 4L6IA 4ISBA 4E1BA 1CJMA 1IDN1 3AESA 1V4VA 1CS4C 1J20A 5DM60 5EJ9A 3TXAA 5LLDA 2X19A 3NDIA 5JFGA 2LIPA 3BGIA 3EG9A 4O4IF 4QXMA 5ARBA 4JJ8A 1I94B 3FOZA 2IYZA 3CNQS 4YAKA 4ASUD 5BQXA 3K8YA 4OKNA 5I51A 1KU6A 1QYVA 1RKXA 4MVJD 5FKJA 2Z5GA 2DBYA 4K40A 3R9IA 2COKA 3M9LA 2KJQA 5CIQA 3R8XA 1E61A 2Q46A 3KV1A 3IDSA 2W6CX 3W2TA 5JECA 1NIJA 2Z0MA 5GONB 1UMBB 4E30A 1TIPA 1XPRA 2CL7X 4QREA 2GETA 3HCFA 4H08A 4YJ3A 3ZGYA 1A4UA 3A6GA 3V2GA 1KY5A 1JHAA 1ECPA 3G02A 4D43A 4PC1A 1XELA 3ESBA 4OAQA 4FMCB 5CT6A 2WPDA 2HWKA 3LW8A 5JTUA 4XRGA 3EMVA 4TL9A 3S99A 1FTGA 2IODA 3G8YA 4BYMA 2XGOA 4ZOEA 1GKYA 3MWJA 4DIUA 2C7PA 3WNDA 1E3TA 1OI3A 1VLHA 1ORVA 5EXSA 2KX7A 3JZDA 4H6XA 1R15A 3FCXA 4FGLA 1XVTA 4Q4AB 2GEUA 5JANA 3R9KA 1RHMA 2VNHA 3E9MA 4MVJG 3O9VA 3ROKA 4F7DA 1GU7A 5EKSA 4DPMA 5IDQA 5D51S 3FPBA 1B73A 1LPMA 1BX0A 3BF7A 3IIEA 2DWUA 4N6NA 2IEAA 3PK0A 2D06A 2I0FA 2NO7A 5AR1A 5DBIA 3UHJA 4KTTE 1A7UA 1QHSA 5EKTA 4MVJE 4D25A 3F46A 1JU9A 5DT9A 5DNVA 4A8JB 4LDNA 3VU9B 1RI3A 1SKAA 1KH3A 2AR0A 2E9SA 1COZA 2FZ5A 2REQB 3G2IA 1T6NA 1O4WA 3I34X 5I7WA 3IQXA 4AZ3B 1TQ6A 5KKNB 2MHCA 3CPJB 4YAWA 1EWKA 2VWQA 2CJPA 2QW1A 5FJJA 1LK5A 4TROA 1XLVA 3PA8A 4YI5A 4DUPA 4TVKA 3D6AA 4INAA 4BAUA 3W4IA 4UBKA 2R79A 4Z49A 1FMLA 4AJIA 1YMVA 2H5EA 3E9CA 2VRCD 5AICA 5LZ7A 4AIRA 5GGYA 2GF9A 2W37A 1CR1A 2G70A 2PL1A 3DFUA 3JAWA 4YJ2B 3W2IA 3SQLA 3VTFA 5LP1A 3A6FA 1DUVG 2DFLA 3EG5A 4R1TA 5AXBA 4KBFA 4CGZA 2I6QA 2Z57A 4I9UA 3OE5A 4QXRA 1H66A 3PGKA 1H0RA 1WHSB 1P0QA 2QL7A 3MN1A 5KDOA 2EXXA 1TC2A 1O87A 2J4CA 3OX4A 4EO9A 2FXIA 3JZMA 3JD4A 1C7EA 3NT4A 1LGYA 4OKIA 4Q1AA 2ZRCA 4GMXA 4GLBA 4X6UA 2XA2A 1K0FA 4NCJA 2F1OA 3NANA 3QGMA 3BAFA 4TL6A 3RE1A 3ZVRA 4YJ2A 2WLSA 1A8PA 3RSFA 1E79D 1DAEA 3U3OA 4C4TA 4KHPB 3H16A 4U7TB 1H2ZA 2YDXA 5G41A 4RULA 1F0PA 4X6XA 3BD9A 3ZI4A 3ICCA 3LUJA 1WXXA 1D0IA 1KPHA 4EQ6B 3K53A 2FN3A 3BTVA 4B40A 3ANSA 1DQSA 3VTKA 3WWPA 3UANA 4Y2VA 3NH9A 2Z5VA 5K0NA 4ZHQA 2XPCA 4UTOA 4HG2A 1YGYA 3DQZA 3CUKA 4U7DA 4CLDA 2Y0EA 2BSXA 4HWPA 2ZI5A 1D4OA 4MQMA 3NIDB 3CBQA 3VO8A 1FRZA 3M49A 4N5HX 4J0JA 4MQ6A 2PU7A 4AXXA 2V3VA 3G5LA 4F9EA 3V6MA 5BUZA 2V7EA 2HDOA 3NKVA 3IULA 1G60A 1JZSA 5C35A 1OYWA 2KE5A 3VNBA 4JH0A 3B1ZA 4B3CA 2IDKA 4OH1A 4AZ0A 5J5AA 1OTHA 3D1VA 1YNSA 2JGLA 3H2KA 1CIJA 1SRQA 1TGYA 4WK0B 2AMYA 2UVQA 4BJ6A 1TZKA 1H6BA 1XYYA 1MN6A 4BIIA 3AJ9A 1P75A 2EFYA 3PA6A 1XRJA 1TYBE 2RK6A 3H6KA 2LUOA 1PWXA 1IXYA 2I7TA 3VAZA 3PD0A 1CY0A 4QDUA 3FGPA 1PW7A 5BP7A 3ELWA 3WA7A 4PX3A 2QJFA 3HXOA 3EOBI 1K27A 4MDEA 2CMKA 4UDYX 3UFBA 4XYLA 3HXPA 1M1NB 4FYKA 2WPDD 2FZ4A 4M9XA 5HFJA 1JJIA 1GGMA 1HTBA 2X6QA 1GKKA 1KYVA 1V3TA 2FLWA 5A4KA 4CCAA 2AOVA 5HRAA 1C8BA 5KO2A 4YJGB 3UTDA 4D9EA 4YCMA 1M73E 4HPWA 3VTAA 2FGJA 4I08A 1Z5UA 5AHOA 1VRCA 1MNAA 1RE1A 1P0PA 4PO9A 4EY4A 3WGQA 3LK7A 3MA0A 3OESA 4CUKA 1QLHA 1S2MA 2Y77A 3DVQX 1FYWA 1V3UA 5KBYA 4BNWA 3TM5A 2H18A 9MHTA 3KTFA 4KQ6A 4YRGA 4DAOA 4L85A 4TYWA 4Q21A 2AFIE 4QO7A 4P4TA 4JQYA 4NDAA 1T8YA 1ZM2A 5K6AA 5CFZA 2VXYA 4FYYA 4IY1A 2UYHA 3WMWA 1X77A 4M7OA 5EL0A 4TKZA 3RYCB 1P6UA 2J32A 1YB2A 5TPZA 1FDSA 3D5QA 4K81B 4AG3A 1QH0A 4CODB 1SKYE 4RD3A 2GDZA 2XECA 2V0NA 3AONB 2R00C 3DDHA 3OCCA 4TS4A 5CJ2A 3SS7X 2HBZA 2G77B 3AI1A 3P19A 2RC6A 3M2TA 5DASA 1XEXA 2GWHA 1RACA 3DL0A 4TV9F 1FDRA 1K6MA 2FPWA 3W5UA 2IGTA 1VGVA 3I4LA 1U1EA 1TMKA 4X8LA 3D2CA 4FZ5A 3U4GA 1LSJA 5AVQA 4DUYB 1ZDMA 3T5DA 2X9LA 1ITZA 3AUSA 5CLQA 5EMKA 1RJFA 3QBTA 3QFSA 4M9UA 5D5HA 4WCFB 3TOCA 4GM1A 1QF9A 1TM4E 4XUDA 2WZBA 2A5DA 4Z9XA 4F86A 5LZ4A 3PJEA 4AY2A 2G80A 2VP2A 3QX8A 3DB2A 2CBGA 5HUHA 3KQUA 3RU9A 2QTGA 3J81A 1XHLA 5GADl 1J06A 1O6ZA 4K3UA 3AU9A 4N4AA 1J7JA 1Z88A 4ZKDA 2DPXA 2AOXA 5EIAA 5ICCA 2VDPB 1OX5A 2HM7A 4HNTA 1XEFA 3HE3A 3M6AA 1EBFA 2WJIA 2O54A 1G16A 2XB9A 1XDWA 3QF7A 4YRQA 2QSJA 5AW4A 1I0IA 1MEEA 1R4MB 3UJ3X 4BN0A 2EF1A 3EPPA 5JCOC 3J80A 4TVBA 1SCJA 4A9AA 1A5TA 1AKYA 2XNJA 3QVOA 4TRJA 4BMSA 3RFXA 2C5EA 2YHIA 2XGMA 3FPSA 4K6MA 1A9ZA 1C7QA 4ARVA 2WAOA 4PEVA 5CLIA 2PZMA 4RJIA 4XVUA 4Y1FA 1U0OC 4XQGA 5TARA 3AJRA 5JZSA 5JHGB 1NVTA 5ECWA 4CI0B 2GBCA 3EPRA 1P73A 2CYBA 3MJEA 2FUNB 1G20E 3RVQA 2L2QA 3E7PA 2JLVA 4MICA 1YR3A 4ITRC 4WBXC 3OH8A 4OL9A 1MOSA 3UKJA 5GIPE 5FT9A 4GBGA 1XZNA 3X1YA 2C5SA 4FM9A 3GH1A 3ZOZA 1G5PA 3OM9A 4AT1A 4R9RA 5TXGA 1VE9A 4NU6A 1OJLA 4I19A 4DLBA 1MOZA 3EMKA 2IYXA 3Q0EA 4L9RA 5TQ0A 4HEHA 3T5CA 3AVVA 3O90A 3TDMA 2I4MA 1E8NA 3CZ5A 5ER6A 5CFPA 2VJMB 4F1KA 3G89A 2DX7A 3O38A 1MABB 2GHTA 1FDVA 4BJ3A 1ST3A 4GPIB 3BWEA 4LJ5A 5DGIA 4YWHA 3HC7A 4O2RA 3T7AA 1SC9A 1RRKA 3H6HA 1SIOA 4LVOA 3T0GA 5HZGA 1CRWG 5K8IA 1UBEA 3DDUA 3TNDA 4Q4LA 1ZW6A 4OJYA 1ESZA 2CK3D 1SVUA 5FOWA 4P2BA 5KYGA 5AK6A 2OP1A 1G2QA 4ALIA 4B3BA 1P81A 5KAMA 4TL8A 3LF1A 4YHBA 5P8WA 4CMIB 4M2LA 2AZDA 3KSZO 4PFJA 1DBWA 2NTEA 3DG9A 4EHFA 2JLXA 3MGGA 1HRKA 4OA5A 5KSPA 1H1TA 3BH7A 3O74A 1E0KA 3VPAA 3KB6A 4LYJA 1GL6A 3BK2A 1PQPA 1TYDE 3F71A 4Q9NA 4NNOA 3QY0A 3T5MA 4Y2JA 4C3UA 4ZT2A 4WCDA 1T0UA 2PEYA 3VMMA 2G4LA 2E55A 1VP9A 2PT5A 2CB9A 4NJEB 4A4DA 1MO2A 1VCNA 3I6BA 2CHEA 1OIWA 3NEAA 4ER6A 5B58C 1I0LA 1LPOA 4QDOA 2HXYA 4ZYWA 4S05A 1EVKA 1YR2A 2WBLC 3TYXA 2WMOB 4B9AA 1P5ZB 2A78A 4BV9A 2BMJA 4MGHA 2E4AA 1RXYA 1NC1A 4D74A 1HQKA 2EZTA 2JGRA 2X6TA 2DSNA 5H68A 1M9NA 3RVJA 4BVLA 3GAFA 4HX9A 2WJHA 1XL0A 1E8MA 4FPXA 4GT1A 1CR2A 4O4HB 1XQVA 4UM5A 1KZ6A 2GBLA 3V7NA 3C14C 3KSRA 5BWOA 1DARA 3C74A 4DSNA 5TPZD 1M34B 1QYXA 4XWTA 3RHFA 4QT4A 2BHNA 4DDHA 5EXDA 4B76A 2ECPA 4GICA 2QPOA 2XDQB 1NPYA 3INYA 2DJIA 3ND8A 4UM8B 2AQIA 2O5EA 4CXMA 1OROA 5CCEA 3E81A 4KNVA 1BEEA 2I4RA 2GFHA 5JZ9A 3PI7A 1GQFA 3DE6X 3TL2A 3NYRA 2EWWA 2IYSA 1QX4A 4RETA 3MQ2A 2AKEA 4QVIA 4OFXA 4L7QA 5HIIA 2ETVA 1TC1A 5DP1A 2QZJA 1ZXXA 3GGSA 3QEKA 2I65A 1XP8A 3OKCA 4ZQIA 4AW9A 1RTTA 5FO1A 1K4MA 1A72A 1M1YB 1W9MA 4KQEA 4H7JA 4PGHA 1XTRA 4JBWA 3M6LA 3WHLA 4OSOA 1JJFA 2C4VA 4NJMB 4OQZA 1QE3A 3MWKA 5T4FA 3QWIA 3LQ2A 4MIOA 1AB5A 3B9BA 4B3IA 2IW1A 4NICA 2WIAA 5TQVA 1DTSA 2AUTA 1XJ0A 2WQZA 3I1FA 2F3QA 3PCXA 3PCTA 1U9IC 4H7IA 3AR2A 5KX5F 2IWRA 1HZZC 4I4TB 4J7UA 4YV1A 3SSAA 4Q02A 2QP4A 3KJIA 4NSNA 2FAXA 5LA6B 1ABBA 4DKXA 3QFTA 4HRVA 4KQKA 2G40A 2A5JA 2ZI9A 3VU0A 2QMEA 1FU8A 4EG7A 3KPJA 8GPBA 3V7YA 3SZGA 1EA5A 1EK2A 4G0OA 3C0KA 1BQ4A 3BIJA 3G1UA 4LK2A 4P38A 4ZEOA 4XTCS 1SVLA 5SY6A 1N6IA 2YYYA 3LQ1A 3ASYA 4TYMA 1YU9A 2WT4A 5DRYA 1CYEA 1X1AA 4AY6A 3PNVA 4Y2XA 3EDYA 3RO7A 3SR3A 3EXAA 5REQB 1X1DA 3R3SA 2BFEA 4LZNA 3TNLA 2QU8A 3G0DA 3VBEA 4LFAB 3LDAA 3Q3HA 4P82A 4QXQA 5E7IA 5JO9A 4BZQA 2GN1A 2LCFA 3KOOA 3S2UA 3CW8X 3ED1A 5TQJA 3W6UA 4QNMA 5HOQA 1SUDA 1CUWA 1GNPA 5DHUA 3G7UA 1UBLS 1TZ2A 3K0KA 5DI9A 2E87A 4LXXA 2JANA 1X80A 2QM3A 3B1XA 1P72A 1G8YA 2QTWB 1T3TA 2Z4RA 3JAKA 2G0AA 3KQMA 4HLDA 4OMFG 1T4BA 1Y8QB 3M4ZA 4BMDA 5CA1A 2GEBA 3PNKA 4RTLA 3RC1A 4CMKA 3KTAB 4BU0A 3IT1A 2A0UA 2F8LA 1GZ4A 3U44A 4B6OA 5C32A 1UDWA 3NETA 4GC9A 3UXEA 2H8GA 1YVRA 1QONA 3BS4A 1Y1KE 2REXB 1XDSA 1ZICA 2PSFA 2V9CA 3BRWA 3I4FA 1DEAA 4H3KB 3VFDA 1BRMA 1YIDA 2IXGA 1RXIA 4Q7KA 3F7NA 1SCIA 3LYUA 1YR1A 4CDRA 5A5FA 5C34B 4KVZA 2AG1A 1VHDA 1WUTA 2A59A 4LK3A 1KH2A 4X9XA 2G9RA 2VYNA 2XBUA 1I9GA 4GWKA 3LUFA 1DO2A 4QU9A 1QGDA 1VG9B 1RP7A 3IVMA 3I5YA 1JEOA 2AG5A 3NYWA 5GMOA 4AY3A 4OP3A 3IT0A 3PNMA 3SYLA 5A4MS 3ADKA 4YMUA 4KNWA 5TDHA 621PA 1UK7A 2AD1A 1E9DA 1JIXA 2NNWB 4RFSA 4TLMB 4ZYUA 3DCYA 3ZBUA 2CE2X 1Z2AA 1QH8B 4NYJQ 3LC7O 1Z5WA 2NUPB 2XTJA 2YJGA 2OOSA 3I9MA 3INGA 3UV6A 1MRZA 4YIKA 3UWKA 3SJCA 2ZKLA 3F1LA 4E88A 1FNSA 4MPPA 4PQFA 4BX9A 1VM6A 3S8MA 1WPGA 2PMWB 4JUFA 2Q7DA 4V39A 4JKYA 2H1LA 2D1RA 1PJQA 3IXQA 4U9HS 4GXNA 2GEVA 1U8UA 4TX1A 2O8FA 1TCBA 3HRKA 1AURA 1YRQA 4HNRA 4HUTA 3KOWA 4XQEA 1OI7A 5AQEA 3BRCA 3EFEA 2JAHA 3G2LA 1AKMA 1U1IA 4OUDB 3ND6A 1ULHA 1USIA 4BQPA 4CL3A 5K0JA 3FDZB 4KREA 4L2IA 5IAKA 5T8KC 2CY0A 4K6HA 5JPDA 3VYSB 5L6MB 5A0VA 1I2ZA 1FRFS 3E5RA 3L7AA 2VEOA 4C4PA 5T6BA 1U3UA 1OZHA 3IC5A 4RO0A 4H6VA 2E1RA 2PUAA 2QL6A 4F3YA 3DMYA 2ZJ8A 5A4FS 2BJHA 4DVGA 4A8PA 1AKRA 4XB6B 3ESCA 4G81A 3KP1A 4JJ4A 3HEMA 4W9NA 1Y7TA 1E89A 1EBBA 2N1MA 1M2KA 1GL3A 4X91A 5FA8A 5A9RA 3A9SA 1NWCA 2VJYA 4JYBA 2VQ3A 3IV6A 4J1TC 3GDWA 4RBNA 1B7GO 3SC2B 4GVPA 3Q6NA 2WAXA 2ACEA 3LXMA 4X1OA 3ZKAA 5JEDA 1EM8B 1DC4A 1MQ8B 1OXUA 2HK8A 2AMLA 2QYTA 4XGQA 3CX3A 2ISQA 3OJLA 5ALPA 5E2AA 1Z73A 3S4YA 4OY3A 3IEMA 5DNDA 5BSGA 2HRRA 1UMDB 1RQXA 1EDZA 1REQB 3CX6A 4R2IA 4CM9A 4RZ3A 3O8OB 1FFXB 1CYDA 3ZGVA 3ORQA 3ROZA 3HN7A 4DTCA 5FBWB 1R12A 1R74A 4CMGA 4YCAA 2I6XA 3N8DA 1C9YA 2XNDA 4MUMA 1CTQA 2XQGA 2WIJA 3ISTA 5BN5A 2FSHA 3B1FA 3NCHA 5HW0A 3ZHRA 1KI1A 1L7MA 2OECA 2F90A 2FLVA 3LUDA 4NONA 4RK1A 3ZXIA 1H69A 1ZH8A 4V24A 2DERA 3I9NA 1PT6A 2ONYA 5EMMA 1TW2A 2CLOB 3KKNA 4I4CA 4S1WA 4RX1A 5ED0A 2IS6A 2FSIA 4BN5A 1ORHA 3JYLA 4RK5A 2CF5A 2O2SA 2X1HA 3AYXB 1EZZA 2ODBA 2ZBRA 3GFGA 4UBOA 2ZTVA 2FMFA 4DMGA 3FTFA 2WRZA 4CF5A 3BD7A 1WW3A 2H1RA 2NU7B 2OILA 3G3EA 5KUTA 4DY6A 3TECE 2PFGA 1P33A 3DE0X 2BM0A 1B6GA 1RBQA 1BGWA 1AUXA 1ZD3A 3VYRB 2RGUA 1T1JA 4NU8X 5T41A 3DQPA 3KYJB 2ZIAA 4O4IB 5CNKA 4EHBA 2J31A 3H4TA 4YV0A 4WLOA 1FMCA 1PR1A 4FD2A 5EA2A 3D8UA 3TINA 3BRWD 2VQFB 1NW4A 2Z2YA 2P41A 3KE8A 1Y5NA 2UKDA 3PSAA 5E4YA 3UMVA 1BOOA 1L4GA 4RY0A 4WDRA 1EFTA 3ULKA 4CMEA 2HZ7A 2JGEA 5AKZA 1XZCA 4RD2A 2C7GA 4MINA 2CEAA 4TVOA 2GKSA 3DV9A 4ENUA 4KUEA 4HGYA 1VHQA 1CW2B 1WA5A 2I8LA 2R68A 2VP6A 3MS7A 3Q4GA 4XXHA 1PGOA 2X23A 4KZKA 1Z47A 2F9LA 1H6CA 4DLUA 3W7AA 1II9A 5SY4A 3FWNA 4ETMA 3BMCA 4LYHA 1W2GA 4EFKA 4ED9A 5CHYA 4B4UA 5L8VA 8AT1A 2EF0A 4P3NA 3F9IA 3FPJA 1A69A 2W2KB 2V9PA 4HD8A 1UAAA 1F8GA 4H1TA 3TKLA 2WAAA 3G2NA 3LCUA 5HUJA 1BVUA 1NP3A 1QHHB 4R1UA 3ZY5A 3O1JC 1XQXA 4R83A 4UAJA 4K1LA 2P9CA 3NMUF 1C0IA 3RR2A 2CXRA 1M2OB 1VIYA 2B25A 1R0KA 2O2DA 3H05A 2AYZA 2Q1TA 4WXYB 2JGIA 1U0TA 1BGXT 3R6LA 2W8ZA 4PX2A 3Q2IA 4WNAA 3COWA 3OMLA 1VP3A 2HSDA 1PQWA 1S2IA 1VTKA 1DHRA 3L4BC 1RBZA 5F2OA 4ZEMA 3U1VA 1O9GA 5I8WA 4TMZA 1Z34A 4I9GA 5KKAA 2Q5LA 2YN2A 2HI0A 5ECDA 4DMFA 4EMTA 2PWYA 3Q8KA 3VPGA 4RZIA 1W5TA 5K03A 1IDOA 1DC7A 1E59A 2NIPA 3RUDA 3RJ5A 4UC0A 3SXPA 1S1CA 1JQDA 2OWEA 1XQWA 1J8DA 4H9GA 5BSVA 2FFBA 4CYMA 4F45A 2QT0A 1WO8A 4UFOA 3KEGA 3BXEA 4RADA 1VHWA 3HVHA 5E2IA 3JZIA 4WMLA 5JMPA 1JHQA 4G4SO 2W11A 5HRUA 4C9BA 4P4SB 1VJ5A 1LRJA 1ULUA 3NKLA 4AMBA 1A50B 1H4TA 3U7GA 3A2NA 3MMPA 3WQHA 1V48A 1SQSA 3IELA 3FWKA 1AS2A 3GRYA 2VHXA 4OOFA 2GCIA 4HDQB 3TIGA 2ZYHA 5EIFA 4NLLA 3CWZA 3ENQA 3K6RA 4OA8A 1OUMA 1XCBA 3FJ1A 3ABSB 4GX2A 4RL6A 3IHTA 4JI8B 4EFDA 2P5UA 5IS2A 4CM9D 5KU1A 5A6SB 2V8OA 1NYRA 3C85A 3EEFA 3N7UA 4BP8A 2B8WA 5AHXA 4LTDA 4TTRA 4RQBA 4X1IA 5A06A 4C6HA 1QRSA 3U7FB 1KAGA 2R7NA 2XNDD 2VTBB 4NFHA 4OHUA 3H0CA 4EF5A 4UHCA 1CDZA 1CIVA 1NKTA 1S6YA 2BJVA 2BL4A 2Y9PB 3PC8C 4IF6A 1IY1A 5BOSB 1Z4NA 1HNWB 1UM9A 1W4ZA 2LP4Y 4BQFA 2PX4A 3P0FA 3UT0A 4DDTA 5HE9A 3GZNB 3ZVLA 5KQLA 1E6WA 3IOYA 2VDOB 2ZRNA 1SC6A 1T2AA 5EJ4A 2XCTB 1FP4A 1K7SN 2JBAA 3OKPA 4FJ0A 2F3TA 4D57A 2JI6A 2OSBA 2Q41A 3L0ZA 3LHSA 4U7JA 2R3SA 5T57A 3LY7A 1EE9A 2GAFA 2J33A 1MV5A 1T5HX 3MJTA 3KIPA 2OY0A 2HNBA 1IONA 2WYOA 2C4MA 3HNRA 4QU0A 5F5NA 1DIOB 1X1CA 3AI7A 4Q82A 3JQ8B 3KZCA 5I4BA 3SC3A 1VLLA 3ONNA 1F0KA 1PRYA 4Z9AA 2ZJOA 4EVSA 5BVGB 1Z6XA 1K7FB 1L8AA 3G8DA 4U2CA 2H7VA 3E2IA 1R4AA 4C05A 1OYYA 1MD9A 1G6HA 4WLEA 4UXJA 3UJAA 2WIGA 2VATA 3TOSA 2C3UA 2BF4A 2Y99A 1WXQA 5KYTA 4U2FA 2ENWA 3NRJA 3VR4H 2JGNA 3AVTA 5GV7A 1VPEA 4D02A 3ICEA 2HV8A 5JY1A 4YV2A 3I92A 4WKOA 1Q2UA 1T25A 1KVQA 4W4TA 2GYVA 2JGDB 1Y8AA 1HT3A 4BFXA 2PSSA 2PAFA 5JHHB 2QD1A 4HQKA 5FPQA 2GZRA 2DFDA 2BISA 3EJWA 1EB8A 1U7UA 1JEJA 5IBRA 1BVYF 2CUNA 4Q9LA 1P1IA 2FDRA 5IEJA 1YE8A 2C3OA 4O5OA 4R7TA 1RE0A 4C14A 2PUBA 2FF5A 3KNZA 4UDXX 3NHKA 3LY5A 4CQNA 1DIGA 4Q3KA 4HEJA 4BLOA 2O4CA 3S7ZA 2Y6UA 1B6SA 1NKSA 2OMKA 4ZA2A 1K5DA 2BOVA 7REQA 3IALA 1MB2A 1U4SA 4FINA 3GLKA 4DJTA 3UYLA 1STOA 3HFJA 1E6CA 2QLBA 1DADA 2HRCA 1RIIA 2Z8XA 4F92B 3IJPA 4E5SA 4EA6A 1V9CA 1ZNZA 3B5JA 4HN9A 4B3JA 1PTKA 1WVGA 4Q6WA 3UAGA 3BOSA 3WLQA 5B55A 1OTXA 1Q1NA 2QP9X 2GHRA 4M1OA 4WBSA 2DTXA 1MB3A 4LGVA 4BNDB 2QLLA 4O2AF 3WLKX 5KNCH 2NAFA 2OZKA 3J81k 1GG8A 3I01A 3WRVA 1ECGA 2NZUG 3P5BA 3C3WA 3AFOA 4FLEA 1OLSA 1KO8A 2EWVA 2NM0A 1Q1GA 1XC7A 4JJZA 4N8EA 1PFVA 5HIMA 5FWXA 4DMCA 2F67A 4OQFA 3UHFA 5BR4A 5ALIA 4FMBB 1FS6A 2VUIB 4JITA 2W83A 3JVUA 4IL5A 3TLKA 2XEDA 1WE2A 3LG2A 4AQDA 3MB5A 3IVGA 3O7WA 3NIBA 4MLDA 2QLNA 4LC1A 2FG7C 4C08A 1NVWQ 3RU3A 1WPXA 3ZIUA 1UXJA 4TV9B 1X7ZA 1DOHA 1HDIA 1DPFA 4LYYA 1I30A 4DDUA 4IKOA 5FWDA 1JUDA 3R0IA 4AJ4A 4BLVA 5IX8A 1NN5A 1PX2A 1HL3A 2VPWA 1RQNA 3X2EA 2P91A 4ENQA 2NSYA 4UTVA 3O8QB 4ZGGA 4TVSA 2P3QA 3KFLA 5J5VA 4GOND 4L8LA 4EH1A 1KYQA 2VUTA 4UNNA 3LVQE 3KXLA 1Q20A 2PGXA 1BKYA 3AUKA 1UXOA 3LXXA 4QSHA 5DBGA 1NUUA 3QX3A 1FSGA 2I7DA 2POQX 4OI0A 3OWXA 2IOFK 2XMQA 2ZQ5A 4KWIA 3MFYA 4QVKA 2ZB3A 5DK4A 1SUBA 3R75A 3U26A 2Q0QA 2Y1WA 3HCBA 4LY9A 2C5FA 4NATA 5FEUA 2FW9A 3WNQA 3MILA 1NMZA 3DBHB 4XCXA 4G0UA 1AV6A 5ICFA 2C8LA 1O8CA 3LP8A 5DXJA 4BJHB 3C6BA 3T4EA 1RJGA 3OG9A 2DBRA 2OFOA 2NU9B 3AHDA 4UBLA 4M89A 3FYUB 4RYDA 1UXIA 3CLRD 4TMTA 1TT5B 3M5PA 1OXKB 4UHEA 5B64A 1JFFA 1PCXA 2AVNA 5K0EA 2WJ4A 4UUAA 4S04A 5IKMA 1M2EA 4N65A 4YBRA 3ITKA 4J16C 2FJPA 4YJFA 4O8CA 1SXJA 4AI6A 4QZVA 3NCTA 2IZ5A 1OZ0A 1YTLA 3L7DA 2P0EA 2X9GA 1P1HA 4OQ4A 3Q1LA 2KI5A 4QWMA 1IN5A 3Q5GA 4MJXA 4J07A 5IBPA 1DKRA 5BYJA 4NMHA 1QK4A 4WA8A 3A9RA 5DGDA 4GD3Q 2G9NA 1PSWA 2YY6A 3MHTA 1RLJA 3CF2A 2R5FA 3C3YA 1TU3A 1VPVA 3BKXA 1XHEA 1BE1A 3DPUA 4JLDA 4EY3A 5IW8A 1Y4ZA 3SBDA 3TTXA 4TTJA 1NLZA 2JH3A 1SBZA 2IHKA 2FR0A 4K8RB 2AMVA 2RBEA 2X3UA 3CN7A 3OEHA 5DBOA 3L4SO 3WQBA 3M5WA 1GRNA 3AH8A 4OJKA 1KVRA 2E49A 1G9TA 1J42A 3B1VA 3QLUC 4Y6PA 3T1VA 3A1SA 2XY4A 1RYHA 4TUYF 1NV9A 4I5GA 3WLHA 2CXTA 3IUBA 3ROQA 3PUVA 4YACA 1S96A 2GUWA 3BD6A 1U2DA 1YQEA 4M7WA 2C5GA 3L9WA 5KYXA 3HFSA 5AK0A 1NZDA 1XPJA 1E2EA 4LYFA 3FMFA 1F2TB 2ZB7A 3EH1A 5JPIA 5KWSA 4MLZA 3GVHA 3D8SA 1N2CE 2CV2A 2QVXX 1QBGA 2X2EA 3K3PA 4OHRA 4JI5B 2XW6A 1UBRS 2HU2A 4GOOD 3BGDA 5K3OA 2BLNA 1PEYA 4TWIA 1JDZA 4L4RA 3GLHB 1T8RA 3ZCPA 3D2BA 3S1AA 2Z98A 1CFJA 4CPDA 5KHOC 1J8YF 2P4EA 2QVBA 2WTAA 3HL4A 2RHLA 4Q39A 4ECEA 1ETUA 4J3NA 1XYVA 2BHRA 3G17A 4UVHA 4LBVA 5FBHA 4C3OB 5HIAA 1FJXA 1A2OA 2IP2A 5EMNA 3V8VA 4BMYA 1TKCA 5ALXA 2VSYA 1RCUA 5ENZA 5DTMA 1YHNA 2A92A 4LY3A 4E21A 2F7SA 1M2WA 3DDWA 1ZMTA 1Q2XA 2AT1A 4IMPA 2HJSA 5HNKA 4UJ3A 3BWBA 4CIYA 3VH1A 5HUQA 3WDMA 4ZJPA 4B4WA 1LX7A 1NLMA 1MGOA 2VXCA 3A9CA 3QX9A 2QRQA 1ZUWA 3OBIA 2WAMA 1V7QA 2QLFA 4TTTS 2EKPA 2FPIB 1ZYUA 4N3BA 4TYNA 4G41A 3RVBA 1M54A 1ZCFA 2GZ3A 4QBTA 1FDTA 1CETA 1XQ6A 4R6XA 4E3ZA 5K0ZA 4K6GA 3MUEA 3OICA 2X4GA 2TMYA 3U4CA 2O6HA 2JEOA 2ONCA 4QRDA 3D8BA 4HLUA 4EG4A 1XK7A 2HJWA 2W2OA 2ZVJA 3QE3A 5C37A 5HTOA 2FX5A 2PH5A 3LUKA 4MRVA 2FN9A 2EJWA 2PVCA 2QTFA 16PKA 1MZVA 4L5JA 1UAGA 1JDBB 3S2IA 5JRZA 2C0CA 5JFTA 1QVVA 4PXYA 3O91A 4A5OA 2Z4SA 3AUAA 4GE0A 2J1LA 1WIWA 3W79A 5H4GA 3VYTB 3KSAC 2AFRA 1KEUA 1UJ6A 4KQXA 1LVUA 1XIVA 5KX5B 1G0OA 3HS3A 4I50F 3A3KA 3KG2A 1QB7A 2RCYA 3BXFA 4BUJA 4YWJA 4N7BA 1SBNE 1KOFA 4BNMA 1EP2B 1G4HA 2D5AA 4CLOB 3HGQA 5C8DA 1BWQA 3EIWA 2XITA 3HUDA 2NZWA 4D8WA 2ZBDA 3IE1A 1FJGB 1RYEA 3N86A 4RDXA 4AD8A 3MJHA 2ZJYA 2A9RA 3GPBA 3TCNA 1SCNE 4RORA 5BSMA 4IUDS 2AK2A 2C1ZA 4K88A 2I6UA 4PQYA 3T7DA 4IIDA 1OLUB 4LDAA 1ONSA 4MKXA 2OHHA 4UDNA 4UZSA 4AP5A 1CUZA 2C9YA 2XKKA 1CUIA 1SXJD 1UMBA 4I46A 1XHFA 4YNBA 4YUYA 2G3YA 1RI1A 4A36A 1M75A 3G5TA 3TJRA 4BE7B 1UZAA 4UARA 1SA0B 3ZY4A 1T6ZA 3H0EA 3E9EA 3ROTA 1B76A 4YRSA 1PN3A 4B6RA 4HFNA 5JS1A 1QHXA 2C7RA 1E4VA 2A1TS 3ELYA 4KH1A 1BJRE 2FRDC 3OZCA 4RPGA 4EW3A 3H4VA 1P6QA 1JKJB 3DWFA 3BF8A 4ZQGA 1ZIXA 3V7WA 1QGZA 3EISA 3WWZA 4HNQA 2G6TA 1DQRA 1YZHA 4YQYA 3OVMA 5L3QB 1Z4QA 5KSOA 2JJ8A 2B82A 1E1NA 3PPYA 5MN6A 1KS2A 2KSQA 2H2DA 2FW7A 5BSTA 3C16C 4K86A 3TPZA 1FFDA 2ECKA 1R9JA 1ZI6A 4Z0NA 3ANNA 3AKYA 3OEHD 1X74A 4DBZA 4ZO7A 4AWBA 2Y1LA 5C2JB 4Q4AA 3CS3A 1ZCZA 2CDRA 2YX1A 3DOIA 3N0TA 3O73A 4ZVQA 3UC5A 3WIOA 3GCXA 4EMBA 5HTKA 1JQ3A 1JQKA 3CUYA 4TYQA 4S1TA 2K5UA 3GBVA 3TGWA 2QMYA 1KK0A 4R2HA 3T9DA 4EJSA 5CDGA 3V00A 1WG8A 3HO6A 2RMKA 3PQ5A 3QU4A 1V6CA 3CJRA 3TTVA 2GK6A 3NBFA 4FEEA 3UA4A 1NPDA 3ZK9A 2IYOA 3AUJB 1LRLA 3L40A 4WINA 4A8JA 1DXHA 2XD4A 3VU8A 4TSKA 1ISFA 5DNWA 3VPFA 4JASB 2D7DA 3NOQA 4PLWA 5BWLA 2REQA 3NBUA 3ORYA 4YEDA 3VC1A 2SICE 4AZ3A 3K7EA 4MQ4A 2O23A 2WKQA 2ZWOA 2DFNA 3EIEA 3HWWA 4H7EA 2ZSJA 5L3RA 3ZK8A 5FTNA 2Q3HA 1SU6A 1YA8A 2ZFUA 4BVFA 3AR6A 1XRQA 1RPNA 3BB1A 2F3PA 1IJBA 2ZU0C 4QG7A 2QVYX 4CEIB 5LB4A 1KKLA 1DZIA 2NLOA 3MT0A 3B38A 3PFWO 1Q57A 1JG6A 1Z82A 2CLEB 2RI6A 2VEDA 1A8SA 2WIBA 3PDHA 3PQFA 1SUSA 4UM9D 2CVFA 4X3PA 4CT4B 4TV8F 3H9CA 4PZLA 5AM0A 3VSDA 1WHSA 3I2KA 4FCTA 4YONB 2ZJAA 2QR2A 2HW8A 5DU2A 2VPXA 5TVGA 3FD8A 1LBHA 4GVXA 1K98A 1ESNA 3IB6A 5FFFA 3QMVA 5BSKA 2PZBA 3HM9A 3KKQA 1ZEJA 5JJIA 3HK2A 2WV7A 3M4NA 5M5BA 2W70A 2X42A 1X7WA 1E3LA 1SCUB 3E9YA 2AOUB 3VR6A 1YFKA 3PPIA 4YAUA 1U2TA 2XF8A 3VBCA 4ND8B 4NBWA 1DMRA 3WGYA 4I4IA 4V0SA 3Q98A 3LX8A 4IMJB 1B16A 4IDFA 1VMIA 2VBGA 4L22A 4EQ6A 3LKBA 5IAJA 5BWNA 5DBFA 3TLMA 1G42A 3ZV7A 3GFSA 1OH8A 1P18A 3O4VA 5DW0A 4D8VA 2QAIA 1Q1BA 1HX7A 3SHFA 4D0SA 1QWSA 1AV7A 2ZR0A 4C5CA 1DAPA 3OURA 4NL4H 3P2YA 1C0PA 1O95A 2GTIA 3QVLA 3DVLA 4QTUB 4NBKA 1X6VA 4NFLA 4TN5A 4EVQA 4PTLA 2C9DA 2B8JA 2DGDA 3FPEA 5EJGA 2AG6A 3FI9A 3IHKA 1G6OA 3OM1A 1T5SA 3JQ6A 3NHYA 2JA1A 3LLCA 3D7RA 1A96A 3JWEA 3M89A 3ENVA 3EA0A 4GYJA 2QQFA 5EGSA 3UXYA 1KMMA 4UCQA 1N36B 3BPSA 2BIFA 1J8QA 3B1YA 3K0FB 4XWYA 1O2DA 5KNBD 5KTOA 1EUDB 1N7IA 3EE6A 4OM8A 1TX4B 4FCVA 3B6JA 3KHTA 5CJJA 4PLYA 3WGJA 2JCXA 3K0CA 5ELXA 5EVCA 2QN6A 1EQUA 1G5RA 2RI0A 4QJ5A 4DT1B 3T7EA 1DIRA 2WJ3A 3AF5A 3OQPA 2HJRA 1ST2A 5KOJB 3AM3A 3B12A 3MJDA 3KKEA 4S24A 2BMAA 1UF9A 3SIXA 4C7BA 1W4RA 4CQMD 2C7OA 1Q1ZA 4B8ZA 1L4UA 3QI7A 1YCFA 5B30A 2WM2A 1KO4A 1N9GB 2HWWA 3K2BA 1ZNWA 4KAXA 2DH5A 1M1NA 4B4DA 5E38A 2NO4A 3EVZA 4FMDF 1O5IA 2IHZA 4DCSA 1KC3A 2QTLA 4FGWA 3K35A 4NEQA 1LTQA 4YJGA 3U09A 5CHEA 3T35A 3HBAA 2NW6A 3I5UA 1Y6GA 4LF8B 3GFOA 5JSKA 3TRDA 4IFTA 3ZQ6A 2O2YA 3F7MA 2P62A 3GNSA 2JZNA 1R5BA 2C83A 3S2YA 2FEOA 3JXEA 3N53A 5F7XA 4EITA 2IZ6A 2VOEA 2VA9A 4W8OA 5A7FA 1P1FA 3G13A 4CVNA 3DXFA 1MAHA 1F60A 3LECA 2BKEA 4OMDA 1EIZA 3QFCA 5CDTA 3ICPA 1FBNA 3EC7A 1TPZA 1FVHA 4ER7A 4WXEA 3DMTC 4UHJA 4ONEA 2KMLA 3EW9A 2R6DA 1SD1A 4LCBA 2O8VA 4N0MA 2NYRA 3TNJA 2GTPA 3U17A 1M8JA 2X58A 3PICA 4H4EA 4ZVMA 5IJ0B 4I1YA 3D3KA 3GLRA 5TGTA 3CX8A 2XE4A 5EJIA 2BTQB 5CDFA 3AW8A 2D4AA 4GRIA 3PSHA 1FLVA 13PKA 5FA6A 2OHIA 2NO6A 2ZIWB 3UH0A 3P9RA 5JD4A 5SY9A 1L7NA 2WVAA 3GJ5A 1IY8A 1E4YA 4GPTA 3RSQA 5LLTA 3FIJA 5J1SB 4FE7A 3ZWPA 4MWSA 1N4DA 3PGJA 1D9ZA 3IUSA 3TLBA 1M2FA 4KRGA 1MG0A 3RS8A 1T1RA 4X20B 4BKOA 1T1IA 4X90A 1EVLA 1NFFA 2YWCA 1Y82A 1GZHB 2W6QA 2IITA 4D8YA 4G0MA 2QEQA 2PCLA 2VDKB 1LLUA 4WCFA 4ZOAA 4OO3A 1VSUA 3L0YA 3Q6MA 1R5JA 1O6CA 2VH1A 1DQPA 4NZPA 2AFHB 3CH4B 4PSDA 4WE3A 2HIMA 3OETA 3ORHA 1EQ2A 5C81A 1PDVA 2JEYA 4EOGA 1KJWA 4JR0A 4WADA 3AIIA 4RH1A 2ONZA 5ERXA 4BZZA 3N2ZB 1QOZA 3AG5A 4B4OA 4D46A 5JAZA 1Y48E 3VR6D 2FPGB 4G23A 1I36A 2FETA 4NV3A 4Y9TA 1E3JA 3FUWA 5IDYA 3QEAZ 2JATA 1HE8B 4KFRA 3NQ41 4G86A 1K9VF 4WFIA 1R4MA 2IXDA 1H3NA 1DNPA 4WY2A 1GZSA 4MJ3A 3KU1A 5JWRA 2V0GA 2M2IA 5AM1A 1NVFA 4N3GA 3JQPA 4Z99A 5B58T 2PWAA 2GZDA 4QIHA 4KBYA 4OOEA 2QT1A 1UWLA 1ONNA 3FROA 2WG2A 1DWOA 1QNLA 4HAXA 1QPZA 2DFVA 1IHYA 1PF7E 2OT3B 1O95D 2H7CA 3TZBA 1XI2A 5CW2A 5D7BA 4KOAA 4ES6A 2C9ZA 1YTUA 1P9LA 4ZP1A 3RVPA 5ICMA 1W73A 4BQNA 2ZB2A 4YCBA 2P67A 4CEHA 2A9FA 2PZGA 5IM4A 4N5DA 4KQCA 1D4ZA 2A88A 1JBQA 4JOSA 3UHAA 1HDXA 2F1IA 1TA0A 1Y1LA 3HI6A 3MWFA 2VJMA 4ALLA 3WZLA 3TRKA 2ECQA 4AQ7A 1MABA 2ZPAA 3DE2X 4RV5A 1IUOA 1P17A 4BWGA 1XALA 2DHQA 4IXWA 4O25A 5HQ3B 4Z4FA 1EHIA 4CT0A 4G8CA 4N5LA 1Y5RA 3GLSA 1XTBA 2P9JA 2DQSA 4LSGA 5FTKA 3RBAA 1R0WA 1PV2A 1YS1X 3R3XA 4G0QA 3TLJA 4BTLA 3IBSA 4GOXA 2DH6A 2ZSIA 1AUPA 4FR2A 2PA3A 3DTTA 3OPYI 5TPWB 5U1PA 4BP3A 1N34B 2GK7A 4GI1A 4CMIA 5ABPA 4E07A 5CB0A 1K8RA 3D6FA 3QWBA 2GF2A 1ZOSA 3WB2A 4DLLA 3QELA 3ZNNA 3SR4A 3WGZA 4R1QA 2R4UA 4HEA6 5BV8A 5FOXA 5CFLA 1ICIA 2HJ9A 1M2GA 2WFMA 2YTZA 3N7AA 3V48A 5JW6A 4G1EB 4IEIA 2QGNA 4CLXA 2W2LA 5HF5A 4LY0A 4UAUA 1V9SA 2E4XA 3G59A 4NJEA 4DW8A 4E5VA 1N6HA 1QDEA 1H65A 1E3MA 1JIJA 2BBOA 3O03A 3Q87B 5IUKC 3UMJA 4EPVA 4WN9B 3R1IA 1KIAA 1WTCA 3NPMA 5AESA 4LXHA 5BPFA 5HP4A 2FY8A 4WGGA 2KLHA 3PNBA 3ZHZA 2QR5A 3HCPA 4C7XA 2QMOA 2HMWA 2OO5A 2YZ2A 3D5TA 3F8WA 4I1SA 4AJ1A 2WU4A 3GOHA 3RAFC 1R7RA 3F3KA 3MK31 5F1PA 4J9VA 1J5XA 4O4HA 4S2UA 1VJ1A 1T43A 2RGWA 2ZBQA 1M34A 5GJWC 4FOOA 3CLHA 2Y76A 3WMRA 4B2YA 3U56A 3AILA 2HUNA 2TYSB 3O1HB 2WSLA 4X41A 2JGAA 3F47A 2XDQA 2JFGA 1A04A 2Z1DA 2JAUA 2DE0X 3EIXA 1PUXA 4KXNA 3KJFA 3BXZA 3MGBA 4N18A 1OXVA 2EZ8A 1CC1S 1JBEA 4RPLA 3RV4A 1B00A 1Q77A 1NVVR 5BRNA 3ILXA 2FPPB 2RONA 3DZJA 3O4HA 4MYTA 3LYAA 1NF8A 1Q92A 1YR9A 3IUPA 4KE9A 2XHZA 4GSKA 3WKBA 4QASA 2ST1A 5A1TA 2O14A 1OWNA 1K92A 1LLQA 1M1YA 1P2GA 2QPTA 3CTMA 3I6QA 4H7DA 1Y1RA 3OPVA 2FTKE 3G2MA 3DCJA 3RRFA 2ODNA 1K9SA 4NJMA 1HORA 1A9TA 4U4AA 4W8GA 4BPBA 1E7YA