4MR7B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist cgp54626
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
415
structure length
403
Chain Sequence
SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 142
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B01
4N0QA 4LDZA 4NICA 3EQZA 5F64A 3SY8A 1VPWA 3BREA 2AYZA 3GA5A 3KS9A 3RVPA 2ZWMA 3N0WA 3H75A 2RDMA 1NY5A 4TLMB 3HDVA 5EWMA 3KYJB 4JOQA 5TPZA 1BA2A 3SNKA 2E4WA 3IPCA 3UUGA 4XFKA 3LMKA 4NQRA 1R8JA 2JBAA 5EWLA 3O1IC 5TQ2A 1QPZA 2IPAB 4JB2A 2NT4A 2ZAYA 3H5WA 4LZLA 4IRXA 2HJ9A 1C0EA 4G0XA 4MRMB 4MR7A 1RNLA 4S04A 4N76A 1D4ZA 1DC7A 1ZH4A 4G0YA 4RK4A 4D6XA 1SXHA 2JRLA 4RKRA 4F8JA 4RZSA 2R48A 5EWJB 5IBQA 2HQRA 3OO1A 4WWHA 4XLTA 2NZUG 5BRAA 3LTEA 1J56A 2A9QA 4PYRA 2QR3A 4KK3A 4Y9TA 4LE0A 4LE2A 3NHZA 5EWMB 1QNLA 4PZ0A 1YTUA 3JVDA 1RXIA 2A9OA 3SQNA 5EWLB 2CHFA 2JBAB 4PEVA 1PNRA 1GCAA 2FN9A 1NXXA 2GBPA 5TQ2B 3IDOA 2CD7A 1NXVA 4XARA 3QLTA 2PL1A 2Q5CA 4GPAA 1ABEA 2MYTA 2P4UA 2HPHA 1IIBA 9ABPA 4N03A 3TB6A 4Z4GA 1JL3A 3N0RA 4FE7A 1D1PA 1JBEA 2LUOA 4Z4FA 4RK5A 2W42A 3IP7A 3GL9A 3OLXA 2RGYA 4RK6A 2FSPA 5JNVA 3H6HA 2FW0A 3QX8A 1CHNA 2IKSA 4G0PA 4G0OA 2FMIA 3CTPA 1Z13A 4MR8A 2MSWA 3RQIA 1FFGA 2ID7A 5JNWA 5KI6A 3Q7TA 3E61A 8ABPA 3D8UA 3QX9A 3C3MA 2GKGA 3C3WA 3C3KA 4RY0A 3Q15C 2MSLA 5HKOA 1M5TA 3KSMA 4RK1A 3OMXA 4RV5A 3FFWA 4YGXB 5C5CA 4W5OA 1JDNA 3FDFA 1GUDA 2QW1A 2N9UA 2HQOA 2E4XA 3O2SB 3O1HB 4OATA 4DN6A 2PUCA 4MLCA 3EODA 2PLNA 4F11A 1ZESA 2QXYA 4YO7A 3NNDA 4W5TA 4E7PA 2FEKA 4MPTA 1LJUA 3ROFA 2PUBA 1EHCA 3OM0A 3EGCA 3GYBA 2FQYA 2X7XA 3QEKA 5CNIA 1ABFA 1YMUA 1TVMA 3RVKA 4YRZA 1MB0A 1OXBB 3A0UA 3JPWA 3LKBA 4M88A 5GQSA 1DCKA 1YS7A 3CNBA 7ABPA 5C5EA 1FFSA 1FQWA 4EVSA 1M2EA 1UDRA 1P6QA 1PEAA 4GNRA 3EDCA 4F3TA 5KQMA 1P6UA 1Z16A 2A9PA 1QQAA 4P1ZA 1QKKA 2QSJA 3JTEA 2JCGA 3KHTA 3MQ4A 3OQNA 1SD5A 1PEYA 1SXGA 5HM6A 3Q7SA 1Z2EA 5T3YA 4MRMA 4MS3B 3OLWA 4MR9B 1FSPA 4G0QA 4YCSA 3JPYA 1RZRA 3GBVA 5KQLA 4G0MA 4MAAA 1H9CA 2F8SA 1USKA 1JH9A 1JDPA 5KWSA 1NXSA 2FN8A 3SG0A 4RXUA 3L49A 5ABPA 4MGEA 5IUJC 2FXIA 3FGZA 3JY6A 1EWTA 4UHKA 4Z4CA 4W5NA 3MIZA 4RK0A 3DZDA 4RKQA 3OQOA 1GLGA 1NXOA 4L85A 1TLFA 3OMWA 3HO1A 1HEYA 4HNSA 5HQJA 4MLDA 3IPAA 5IULC 4WZZA 3RVOA 3M9XA 2M1ZA 1YS6A 4KV7A 4TMYA 4EYQA 1S8NA 1QP7A 1NXWA 1KMIY 4RWEA 4RXTA 5CHYA 1M5UA 3LUKA 2FMFA 2WY2D 3F73A 3NNSA 3O75A 4MS4B 1KRWA 5FWXA 4LX8A 2L2QA 2HSGA 2WWVD 4Q6WA 4JP1A 1DG9A 1JLKA 3LUGA 2VUHB 1ZVVA 4Z9BA 3CG0A 1L5YA 3CG4A 3CZ5A 4HYEA 4Z4EA 5E3JA 1QMPA 3F6PA 1K68A 2XDYA 4H3HB 1JFTA 1Z15A 1Z12A 2MYNA 4RY9A 2MYPA 1LJLA 1XHEA 2WJAA 3IP9A 4JA2A 4QYMA 5CNKA 4EUKA 2WB4A 3EAFA 3QEMA 1QO0A 4G0ZA 1U2QA 5FWYB 5FBKA 3H5OA 4NCBA 4KPYA 5KC9A 2BGGA 5IEBA 3F7NA 1SRRA 5TE9A 5PNTA 3I45A 2JB9A 3LUDA 5HSGA 4PE5B 2PUFA 2PUDA 4F12A 2IDMA 3O2JA 3CZCA 4KQ9A 2B1JA 2R25B 3QLVA 3VNBA 3LUHA 1XHFA 3RVLA 2PUAA 2PKXA 3LUCA 5FWXB 3DGFC 4O1HA 1MIHA 3EULA 3HK2A 4EY3A 5JNUA 4LRQA 2WRZA 1BVHA 3OLZA 4RXMA 3QLVC 5IC5A 1DRKA 4IMIB 5KC8A 3MF4A 3W9SA 4MYRA 1TMYA 1DZ3A 4Z9AA 3G85A 1KGSA 3KYIB 4RSMA 2H0AA 3T95A 2VK2A 2WMYA 4OLAA 3O2QB 3RVQA 2R4QA 4HNRA 2FLKA 1BDHA 2FQWA 1P8AA 1LBHA 4MQEA 5IEJA 4OLBA 1AB6A 3QLUA 3O21A 4KVFA 4KNYA 3QEMB 4RDCA 5CNJA 4NV3A 1Z2DA 4YS6A 2IPLA 1JYEA 1FFWA 1K66A 3LKVA 2AYXA 4E7OA 4TN5A 1W25A 3MA0A 4YP9A 2GI4A 1GUBA 4RU1A 4ZMRA 1QP4A 1DBQA 3HXMA 3TD9A 5IX8A 4ZYLA 4QPJC 3M9WA 3T8YA 3LUJA 3I42A 4MS3A 5DGCA 4MR9A 4EYOA 3OLVA 3DLBA 1NTRA 2OENG 5TPWA 4OBBA 2LPMA 2HQBA 3RH0A 4F06A 1EFAA 3KLOA 4Z99A 4IGAA 3F6CA 5JNTA 4QICA 4P98A 1JFSA 1SXIA 2GWRA 3EJWA 2QV0A 3FMVA 4FE4A 1PHRA 4OTZA 2RJOA 3RVNA 1E6MA 3B2NA 6CHYA 1BAPA 1ZHHA 3O74A 2MYUA 4MQEB 2E4ZA 3KCNA 3LOPA 3EQ2A 3KG2A 4QYWA 4KQCA 3A0RB 3TO5A 1Z18A 4RY8A 4B09A 3TX6A 2IYNA 3SAJA 2V0NA 3N53A 1CYEA 4EVQA 2PJUA 1Y1LA 3NHMA 4S05A 1F51E 4HNQA 2RJNA 4MS4A 1QP0A 4DADA 1VRVA 4RS3A 3OM1A 1W9HA 4LDAA 3Q7RA 4XASA 1DC8A 4XXHA 5TPWB 3NNNA 2L19A 2WJWA 3H5IA 1B00A 3JVIA 1DCMA 2E4VA 2I6FA 3CLKA 4G86A 5I4CA 3N0XA 1U0SY 4NCAA 4UHJA 5JS1A 1ISRA 1A2OA 3C6QA 1A04A 1EWVA 1GCGA 5DTEA 3DLHA 3A3KA 1RXEA 3MMNA 1AB5A 3KTOA 6ABPA 5DCLA 5FWYA 4MQFA 4EGSA 1YK0A 4N0PA 4YWHA 4EYKA 5KQPA 1L5ZA 1NXPA 3HVRA 1U8TA 1PUXA 1USGA 2QVGA 5JNSA 3H5VA 3IP5A 2LIVA 4N47A 4YLEA 3RVSA 3LFTA 5BRJA 4KFCA 3BRQA 4EYGA 4WT7A 4YV7A 3UK0A 3H1GA 5TQ0A 2DRIA 1EAYA 2FEPA 2L18A 4KRFA 3RVMA 3H5TA 1NATA 3HCWA 4LE1A 4Z4IA 1U04A 2J48A 4H3KB 3KKEA 1BDIA 3OO0A 1DCFA 4MS1B 1LK0A 3I5AA 1DBPA 2B4AA 3Q41A 4KREA 1ZN2A 2MSKA 4RK7A 5ED4A 1ZY2A 4IMJB 3CU5A 3ILHA 4MQFB 5DKFA 3GV0A 3HS3A 1ISSA 4ZPJA 1Z26A 2NT3A 3URMA 4JAVC 4D74A 4O5AA 5KQGA 2A9RA 1YK1A 2PE5A 1JFVA 3CHYA 2VUIB 1TJYA 1ZH2A 1DRJA 3T6KA 3OQMA 3HM9A 3D02A 1QQBA 2QVCA 4O1IA 1P2FA 1Z17A 2JK1A 2PUGA 2L17A 4Z4HA 1I3CA 1MAVA 3N75A 1TM2A 5TQ0B 4ETMA 3IP6A 5D2CA 3DGEC 1DBWA 5IUKC 1U2PA 1ZGGA 2JVJA 4L4UA 1DJMA 2CWDA 3OLYA 4OG2A 1D1QA 1PNTA 1OXKB 4WXEA 4ETIA 1E6KA 1USIA 3HZHA 3LUFA 3Q9SA 1JX6A 1RPJA 5DLEA 4W5RA 2YHAA 3BRSA 1YIOA 2IPNA 3K4HA 5IUNC 2PUEA 1ZAYA 4ETNA 2ID9A 3O1JC 2TMYA 4W5QA 4DQDA 2LBPA 3C97A 3CS3A 3LUAA 5JNRA 3HEBA 3N8IA 3RVRA 1BDJA 3L6UA 4MR7B 4Q7EA 5B3JA 2VYCA 1VKRA 1D5WA 1C4WA 2PL9A 2R47A 3QLUC 2FQXA 3HJFA 4H60A 3CFYA 1XWWA 3BILA 3K9CA 2QZJA 3GT7A 1CEYA 2LP4Y 4KK4A 4ML3A 4KZKA 5B3JC 1D2AA 2E4YA 5TQJA 1MVOA 1VLZA 1JHZA 2QU7A 3GWGA 3FFTA 2FMHA 2O20A 1F4VA 3GRCA 4WUTA 3QELA 3UKJA 1ZDMA 3H1EA 3KLNA 3N6VA 1WETA 1RZRD 3SM9A 2M98A 2FMKA 3HUUA 3QK7A 2FTKE 2FEWB 4IILA 3HUTA 3MM4A 1NXTA 2CHEA 3M6MD 1E6LA 4KMRA 4YR7A 2E4UA 2F8TA 3T38A 5JS2A 2FKAA 3VNAA 1YMVA 2FLWA 4Z0NA 4FB4A 3TMYA 4WXMA 3FFXA 3I09A 3H6GA 4XAQA 3JS5A 3NBMA 4TLLB 1LBIA 3G1WA 5T7BA 1JF8A 2H3HA 3R0JA 1M2FA 5TPZD 1T34A 4D6YA 3A10A 2P9HA 4N41A 4G97A 2JVKA 2IPMA 3ILYA 3HV2A 3MYYA 4IF4A 5BR1A 2PMCA 4MR8B 3DBIA 3GBPA 3HDGA 3QELB 1JYFA 1KRXA 3HSYA 4MS1A 1ZGZA 3P9YA 4JB0A 2YHBA 4JASB 1A0OA 1EWKA 3H1FA 4Q6BA 3S99A 3BBLA 1JWLA 2FVYA 2PAFA 4EVRA 1DP4A 3CKMA 5CNMA 2NUBA 5FBHA 1MB3A 4ZJPA 2GX6A 1APBA 1YVUA 3H5LA 3E3MA 1URPA 2OQRA 3KJXA 3ROTA 4CBVA 1QO0D 1ZITA 3RVJA 2KYRA 3CRNA 5GOTA 4ZMSA 2JVIA 1E2BA 2NZVG 4PICA 5EWJA 5BQ3A 2IOYA 1Z25A
chains in the Genus database with same CATH superfamily
1VL5A 2NVUA 4AG5A 4E13A 3NYRA 5AT1A 2QLTA 1Q12A 4U7JA 1RRPA 4XGNA 2O2ZA 4MQMA 3FTPA 4EG4A 1AF4A 1G5QA 5AKGA 1BA2A 2WD8A 3DEYX 4ZV9A 1R9NA 4CI9A 2Q5FA 5CH5A 4FT2A 3ZVNA 2ZAOA 3DPSA 4RM3A 1Y3HA 4HAOA 1YZFA 4JBNA 3AO0B 5K8UA 5TMBA 2D00A 1N5RA 4S1NA 1J5EB 4PRKA 4PZ9A 1V3UA 4IRXA 2HJ9A 1G6Q1 1C0EA 1ZN8A 1RYNA 3WO1A 3K9QO 3WRYC 3HNRA 1PYDA 3IFSA 3SC6A 4MI3A 1DLJA 1IUKA 3EGXB 5LWQA 4E5NA 1Y82A 1GPKA 2J4CA 1FDWA 2YXBA 1DJLA 2XZTA 4M7WA 3WGYA 4GUDA 1MU0A 2OAGA 4I1IA 4XB1A 2J3MA 5C46F 2P90A 4GYKA 2PANA 3SYKA 3U7JA 3LBFA 1IPEA 4QGBA 3COYA 3L4SO 5G02A 4EIWA 1KWGA 3JD4A 5C32A 3SF0A 1Z5UA 3T0GA 1JPUA 3U4QA 3AQIA 2Z9BA 2C3OA 2P69A 3NC1C 3PIDA 1OFVA 4KQXA 4NARA 5EWMB 2QA5A 5A4IS 1AQNA 4N48A 2PGNA 5TC4A 5EWLB 2JBAB 4PEVA 1SUSA 4LC0A 4A0HA 2D0IA 4TT3D 4B6PA 4FBMA 4YQYA 4EEKA 1QH1A 3EVGA 2PL1A 5CH3A 4E2ZA 1XTUA 3NKLA 1Y3BE 3EGDB 4HAXA 1QOPB 4KUHA 3OESA 1HDOA 1GU7A 3ITNA 4R9NA 1V11B 3U3KA 1ZU4A 1LSJA 3N0RA 2BTQB 1Q84A 1USVA 3P2MA 5D8DA 2GSWA 4BJ5A 1PJ2A 4MHSA 4N5IX 3LF1A 2XVAA 3ZOKA 1R0KA 1CZLA 1WULS 3F0TA 1R5BA 4TMXA 3UAYA 3T41A 3GXBA 3INRA 3MMPA 1P5HA 3HUDA 1U6JA 5C1BA 3GROA 4QDKA 1JUDA 4U2FA 3PLNA 4HO1X 1F06A 3AQ4A 3KVRA 2VO1A 4V0RA 3GLFA 3CTPA 4KNWA 2H9AA 4O2AB 1TA0A 2QRQA 4O2BF 1LH0A 4P7BA 5CT9A 4DDKA 4ZYUA 3GPLA 1O0CA 2GO1A 1VLMA 4GGMX 4Q00A 5JY1A 4J16C 1W1WA 5EXSA 4NJEA 1WLYA 1V1RB 1CZUA 4RY0A 1EG7A 1P4JA 3JQ9C 3HXLA 3NDIA 5BSUA 1ZUIA 3AP3A 3G5LA 3NT5A 2D0OB 2WYVA 5C5CA 7ADHA 3QX3A 3CTMA 1FJGB 2GEDA 4LZOA 5FR1A 3MT9A 4DJJA 3ENQA 2V7WA 3SQWA 3O2SB 1WW2A 1SKBA 3DTYA 3N2KB 4IDPA 5FTJA 1XCPA 2IX3A 2G9NA 4W9NA 2Y1DA 3ANXA 1UZMA 5HE8A 2KHZA 3QBJA 1N6OA 1ZESA 2J3IA 1T9GR 1Z38A 3JWIA 1Z07A 4WFJA 2VRBA 5AFSA 3OC6A 3K7EA 1TYAE 2Z0MA 4A0FA 3GRYA 1J2JA 1EINA 4NAUA 5IDQA 1M2JA 1ULTA 1CR2A 4OGFA 1JDVA 1V45E 1KYQA 4KLRA 3WG9A 4M88A 4O0LA 4Q12A 3ONEA 1H69A 5C5EA 1QV9A 2GF0A 2X6QA 3FOBA 3IBGA 5CYOA 2C4MA 2QUHA 1UOEA 3FKSD 3D8RA 1IUNA 4TS4A 1OYVA 1L5MA 2BBOA 2H59A 4TZ0A 2AMVA 5LFAA 4NXNB 1ZIDA 1PG2A 2HXGA 5DH9A 1Q22A 4I2VA 1XN1A 3SQLA 1PZNA 2VPYA 2ZSEA 4QXOA 3LP5A 3QKSB 1OBOA 3IC5A 3OLWA 1P80A 2I9KA 1TT7A 5T8KA 4BMZA 1FSPA 2ZB4A 2IVFA 1C4KA 3WLQA 2IOQA 3HHPA 4EG0A 4KX3A 2F62A 1USKA 2FCAA 3GPCA 4YRJA 5M2QA 1E79A 1JH9A 2FN8A 5CB4A 4V2IA 2FMTA 4YP0A 3VU3A 2VJLA 3AG6A 1C1HA 4RZXA 1X9GA 5THKA 1PQPA 3ZCVA 2PMFA 2Q2NA 2V5AA 1HH4A 4XJSA 1ZIOA 3ZQ6A 1KS2A 3HYRA 2BHSA 3WHLA 2H9YA 2OZLA 4MDHA 1QOQB 4B17A 2VDPB 4MVJP 5KTTA 1T3TA 5CX1A 5AI8A 2R0QC 1PT9A 1K8ZB 1W85B 4X6YA 4ZO6A 2W2VA 3NVDA 4BKQA 5FPYA 1GNPA 3GCZA 4C05A 6GPBA 2ZM5A 4X84A 1F2UA 2JAPA 3O8OA 3ZGZA 1Q0PA 4JUIA 4K2AA 3RUAA 2ZS8A 4A26A 3RK4A 2ZTHA 1IONA 3TIFA 2BFEB 3V8PA 1K9VF 4XDYA 1GG9A 2V4ZA 4AKHA 2FMFA 1GZ7A 2ZYVX 3PHIA 3NTRA 4D9JA 3VKHA 3I8SA 1J22A 4YUXA 1RI4A 2GZ2A 5K0ZA 1MLDA 1UZNA 3RI3A 3K8ZA 3MGAA 3P9QA 2XCOA 3DMTA 3HDJA 2GBCA 3PUHA 1OBFO 3KUDA 3WYCA 3QXCA 4GNKA 3BGIA 4A9AA 1E8NA 4LGCA 3EDRA 3PXEA 1VL0A 3I2FA 4G63A 4RAQA 5DHQA 2F1RA 2JD0A 1J1UA 3RSLA 3BTVA 2HMVA 2C3MA 4ISCA 1PSDA 4YRRA 2VP0A 4A73A 4D9CA 1CUHA 1H8HD 1BS1A 2H4XA 2YN2A 3FMOB 1UBMS 3LP6A 1E1MA 1PFWA 3GRKA 4P4NA 1GR0A 1IDOA 5EIHA 3X3HA 2QTNA 2O8CB 1UFOA 1CQPA 3GX1A 4MVJG 4G0ZA 4W9RA 2ZYIA 4D3DA 4AM8A 2YCLA 5AI9A 1MXHA 5CVTA 1P45A 2QMQA 3CF2A 1L4EA 2FPKA 3WWOA 3KJQA 5IBRA 4TWIA 5EP4A 2PWPA 1LJ8A 4CU5A 1ZNXA 4IVNA 4AN4A 2UUBB 1Z6XA 2EBWA 1OFUX 2RK3A 3LUCA 2PHZA 3HY6A 5DMHA 2PK3A 3UOAB 3QG1A 4EY3A 4FCWA 2H1WA 1WXHA 1R9GA 1B15A 2FYTA 3KQTA 4LRQA 3QXSA 4PO8A 4PNPA 4RXMA 5I9TA 2NGRA 1I3OA 3B6MA 4J9VA 2XKKA 4RIFA 2WWTA 2AZMA 3ONDA 1FDIA 5FPTA 3ZJTA 4TMTA 1ENYA 1V48A 1P0PA 4MW5A 4L9AA 3HY4A 5AM3A 1J1ZA 4M9CA 3S2YA 1Q77A 1FXWF 1M2NA 2QHXA 3QLUA 1KETA 3RBAA 2C04A 1TM4E 1XO1A 3A6ZA 3EFOA 4LDJA 5IAGA 3TQRA 2K2QB 3VTKA 4IEFB 2IW1A 1R4NA 3MC1A 2AYXA 3ZOZA 3PTAA 4A0RA 5I8ZA 2PY6A 1P91A 4ZVUA 4CHGA 4Q3AA 1PL8A 5IX8A 2C1EA 4KXNA 4MS3A 3ZJYA 3MBIA 2LPMA 4KR9A 1AS0A 4GOND 3SF8B 3JARB 2XCRB 2TYSB 2Q1SA 3IE1A 4KQJA 3F6CA 4DG9A 3P0JA 2CNWD 3C3AA 5J2TF 3EPJA 3R7WA 4OSOA 4FSHA 5EE5B 2WSMA 2OY0A 1AQYA 3FMVA 3HB0A 3MTQA 1XELA 2BMDA 1NDQA 4OTZA 2BBWA 4TWZA 1VHJA 2R1TA 3DL2A 4YI3A 1II8B 1Y4DE 1CZRA 2AEJA 1EE1A 5TEVA 3ZCPA 3ETGA 3VR2D 3CEAA 5LMCA 4ZVMA 1Z0KA 1XCBA 3GDOA 1HDIA 2E4ZA 2IYLD 4PHTA 3C39A 3OD1A 4DLXA 4HH3C 5GGYA 1Z4QA 2QE6A 3GT4A 3TO5A 1YNSA 1LU9A 2WTNA 3M33A 2J3DA 3I3OA 2YWBA 1I0ZA 1LDGA 3OI7A 2R4TA 2BKLA 3GN2A 1OY1A 4DNOA 3ZK7A 3RASA 2QN1A 3A28A 3UB2A 4MLPA 1PDVA 1GG8A 1S7GA 2BIFA 2ISCA 1LZLA 2ZDQA 1Z88A 3C3PA 2G7MC 2HX1A 3NATA 1IVSA 4X61A 1NBAA 1HZZA 4F1JA 4PZDA 1IBSA 2PWZA 2GXSA 3GLFE 3K53A 2V3CC 3DNMA 1I6MA 5K0NA 2IP4A 4J91A 4DCSA 3ZLTA 4B4DA 1QHYA 3N07A 3SGLA 5EXXA 5FWAA 2I1WA 4B4OA 4F9GA 5C8YA 4BU1A 4QXPA 2HREA 3C6QA 3FF4A 3Q7EA 4H9GA 2NO4A 4UMFA 1P2GA 4YBZA 5ALZA 2PV0A 1PKXA 1QRRA 2QQ5A 2MSCB 1JAXA 1Q19A 2CW5A 1YL6A 2PWAA 3AKCA 3L06A 3SE0A 2W37A 3FTQA 3ILXA 2XXAA 1AGRA 4QSHA 4LV8B 2OGUA 1W87A 4G89A 5L7WA 3E9CA 3TG8A 3OIVA 1WSWA 4LC9A 2IIQA 1YFZA 1YK0A 1ZOLA 1DT3A 4ER6A 4F91B 3V7YA 2HWUA 2A67A 3DCJA 2V4MA 4KX5A 4DCVA 3LHKA 3VR6D 4R5HA 2I7TA 2MR6A 1HF3A 4N47A 1YZNA 5KO2A 5CA0F 1EX7A 3L46A 4RZHA 4BDSA 1JLHA 3IKLA 1FIUA 3DDHA 5FFNA 2YNMA 1EHIA 5LQSA 5LP6B 4WVLA 3DTVB 2QRJA 2X14A 3NH9A 2NM0A 4UDYX 3T34A 3DPIA 4Q1AA 3EW7A 4MW2A 3ZV4A 3FZGA 3OUZA 2FPGA 5BMVA 1TUGA 2P2SA 1AUPA 4F1WA 2WNHA 4AWBA 1CIJA 2JPDA 4LQCA 2XV1A 4FDUA 2RGUA 4QBHA 4UZSA 2GFQA 5AHXA 5J63A 4ARSA 4E2XA 1KSFX 3E5MA 2OCDA 4HHEA 4G4GA 4HEQA 3U7EB 2K2WA 5CAEA 1M1XB 3DKKA 1RAFA 4CNBA 5G0UA 3M4YA 1MX3A 2Y27A 1BXRA 2IWHA 2FG6C 3CU5A 3NUGA 1E92A 2CHVA 1G3MA 3VYWA 1H2ZA 2QGZA 1H2XA 3CHYA 1C9JA 3H9BA 1JKFA 4MB6A 2ZITA 5ALWA 3W34A 1J7KA 3KTAB 1A9PA 3N5CA 2C9CA 3BCUA 2W4IA 3SHFA 3UJAA 3FF1A 4C6RA 4LHYA 1C7IA 1FFEA 3PGKA 3GQBB 1Z17A 5BY2A 1OBHA 3A1WA 2IK8A 4EELA 3HL4A 1EH5A 1FUUA 1GZVA 3TW8B 5BSKA 4LOJA 4M4SA 5AWFC 4Q3NA 3S55A 1WXDA 3WVNA 5BNWA 2V03A 1Z34A 3QFRA 3D8BA 4UCQA 1UWCA 2IUUA 5MN6A 4WCVA 4RHTA 4WXEA 4YJ3F 1E6KA 2H4ZA 4INJA 4CKEA 4ZHSA 4Y67A 3CKLA 3DBLB 1J4AA 2IPNA 2JA1A 3QW2A 4EAQA 2LVBA 4B9AA 1A8QA 2XB2A 2AE1A 4ZVRA 4NWIA 1I6LA 4F1KA 5JAUA 4WEQA 5EPUA 2PXXA 2PGJA 3LUAA 1ZJWA 1IXZA 2ORIA 3ICEA 4IKEA 4DVGA 1ADJA 3NV7A 2Q28A 3VH3A 5J59A 3B60A 2FW7A 2CL7X 2GEUA 4HUQB 1TCVA 3S81A 2P0EA 3F46A 2ZSDA 4X65B 3IEMA 1M74A 2E7ZA 4ZOLA 1AK1A 1YGYA 4J1TA 1LZKA 2FSVC 1B0ZA 3OECA 4IDOA 3ZZNA 4HVCA 3IOEA 1Y7LA 4C0AC 3S1SA 3OFJA 5BXQC 3OEED 3PQDA 4X00A 3N9IA 1COZA 3KEQA 2JK0A 5KYUA 1JHZA 3T7DA 2JJ2D 1Z74A 1ZGHA 2X2EA 3NHYA 4EI8A 1I01A 1ECBA 1I7QB 5FTWA 2QJFA 3UBMA 2DMRA 4BGUA 1D2GA 4ARAA 4EITA 1RZRD 3OMLA 3G2NA 1CFJA 4OA8A 4TMWA 4UTPA 3H9GA 3FOCA 4WESA 5AJTA 4B3MB 1LPSA 3PFHA 3OH8A 4KYUA 3CM0A 4OBXA 4X1IB 4R71A 3ZDCA 1F0YA 2J0UA 2P6UA 3C8DA 5K0EA 4DE5A 3CX3A 4PINA 1SXJB 4J6EA 3FOFC 1WXFA 2PS3A 4JSTA 4E5KA 5KYWB 3EOAI 1QGZA 1RWBA 1Y4ZA 1LPPA 3L0OA 4KNVA 1Z6TA 2VQ3A 1JIXA 1I5OA 2QQ0A 4FKZA 4J94A 4MUYA 4O25A 1N8TA 4WQMA 3ISJA 5AXBA 5REQA 4XWAA 1C4OA 5LB2A 2P0AA 4AYTA 1U0TA 3I9MA 1JDTA 2QQFA 4NCHA 4IHKA 4N9WA 2O3QA 4CMAA 3P5BA 3EPLA 1OW3B 2YJ4A 1PWEA 4K28A 3TEMA 2GYVA 2GTIA 2PMCA 4X6UA 1YBMA 4WLFA 3TSYA 5T4HA 5CVVA 4TS9A 1NJ8A 2OHXA 3GH1A 1DDGA 4HOYA 2Y0EA 4OXRA 2XD9A 4XQ9A 3BL6A 2VTEA 2C2MA 5LP6C 3VM6A 3L4JA 1XRRA 3THWA 5EIXA 4FUQA 5I4BA 5KOIA 2PT5A 2QTAA 1W4AA 3DQZA 3FWZA 3V4RA 2RAUA 3ASZA 1UEXC 3CLRD 2IQ5A 4KN8A 3VNRA 2VBGA 3S99A 2REBA 5EVCA 2PIDA 1N3IA 4M38A 1AG9A 2NUBA 1DIAA 1OIVA 4KI7A 2PBZA 2I2AA 1URPA 1O8CA 2NU7B 1E5TA 1V35A 4QQ8A 3CMCO 2IOFK 4C0SA 3HBFA 4I1YA 3B3GA 1D03A 4KAJA 3EHEA 4P2GA 3VPBA 4ALJA 3T35A 3GUUA 5BSRA 3RYHA 2W2LD 1B0UA 3O1LA 1F17A 4UDXX 3DONA 1WXIA 3IEKA 2VCEA 5K8LA 3N8DA 4NICA 1G3RA 3GA5A 4EKYA 2HA6A 1P0CA 2VTBB 3HDVA 2HA0A 3E9MA 4JOQA 2VF7A 1YE3A 3AVTA 3P19A 3ZU5A 4JOBA 1TK3A 4R83A 4YYEA 2QJOA 2OFWA 4FXOA 1ID1A 2VVTA 3UFXA 3AC0A 1Y8RB 4AG3A 2YZ2A 5DNCA 1M72A 1QFJA 4CT4B 5T41A 2P3QA 3DEZA 3ZI4A 4JXZA 1CWUA 3JYHA 3Q5DA 3ADKA 5BN4A 3H0CA 2A5FA 3JW8A 5EJFA 3F47A 4D9GA 1HBJA 2FP4B 4MWBA 4IIHA 3R4VA 1W59A 4G2NA 4EBBA 2O57A 4RV4A 2WTMA 2OT3B 1LX6A 2DUJA 2PQ6A 2IE0A 2XTMA 1W4RA 3AK4A 3VR5A 5BN3A 3COVA 2YDYA 3QKUA 3ACDA 3BF8A 4ALKA 3AVYA 1F2TB 3NM6B 3EOBI 1LSOA 3EG5A 2QPTA 4CKBA 1NSYA 1QHSA 1IN1A 4BQOA 5KJ6A 4PU0A 2C94A 4S1OA 3A7DA 3M2PA 1JIKA 2VYND 1EVJA 2CXNA 3NHZA 4IWXA 2FGKA 3OCCA 4ZQIA 5IKXA 4X8OA 1KEPA 1KO5A 4XGKA 1OLOA 5D86A 2YZ7A 3CVXA 3B5JA 4UCFA 1L4HA 4PNHA 3ROQA 3V7UA 1VBKA 1POWA 2R60A 3O7WA 2ZCJA 2GAJA 2IXDA 4C0WA 3HWRA 1W9MA 2WI8A 3AM5A 4QFDA 4C5CA 3PR1A 4ZFNA 7MHTA 3DP9A 5IVKA 4L5JA 2OQIA 5ED0A 1NQOA 2H29A 1DKPA 2J85A 3TB6A 1JRLA 4FE7A 2XGSA 2JFOA 4YUYA 1HTTA 1U7WA 3RRNA 1XG5A 3AJRA 1EFKA 1XIVA 4HC4A 3CCCA 1SXJC 1PWXA 4BVEA 5ERXA 2IWRA 3MRSA 3VHRA 3ZE9A 2YQ5A 1X74A 1U80A 5AHKA 2ZBEA 1RWXA 4G8BA 5TMEA 1SBIA 1PJ3A 1W2GA 2DAPA 2PRIA 4XD7D 3SWWA 5FLXA 2WIKA 5EOVA 1CUVA 2C07A 1MA0A 1FFGA 1FUEA 1GSOA 3KYDA 3VOTA 1ISHA 4IDFA 4C0BA 3KE9A 2AN4A 3TB4A 3KV1A 1CR0A 8ABPA 5LOVB 3D8UA 2ECOA 1YI0A 1FZQA 1TYDE 3FPHA 4ESEA 4YV1A 5HK9A 2YQ4A 5CDGA 1XOIA 4J3NA 1LBQA 2EVWX 4Y1GA 2ENUA 3R3WA 3WRVA 2AOXA 1G2QA 2J31A 5HCUA 1CW2B 2JDIA 2FDRA 4O4LA 4HZGA 5JAHA 4YJ2A 1IY2A 2QW1A 4XYGA 3Q7IA 3R6GA 2Y93A 3SSOA 3WK8A 1SBZA 1EEHA 1RHMA 3BOSA 1XNRB 1L3IA 5C37A 4OIMA 3MZ0A 3H3FA 5CGZA 3K8QA 1GT6A 5AVKA 5DCYA 1C3LA 3WB1A 3NNDA 1NL3A 3KXDA 3NVMB 4HTAA 2QJTA 2QBYB 4JI3B 3OM0A 4LYJA 1ST3A 3DM9B 3FVVA 2R2GA 3HXPA 5A5VA 3O0DA 2HU8A 2DPLA 2WAMA 3A0UA 1TCAA 3PKJA 4IIGA 4BNLA 5M5BA 4MKHA 3DEIA 4YCMA 4DIMA 7ABPA 4UQPA 4L9RA 3L7DA 2GTHA 1SC3A 3ITDA 3QX7A 1M2EA 2W70A 3Q5GA 4QAQA 3RTBA 3WNDA 3C3DA 3W7VA 2BGKA 2VJOA 3AUXA 1E5DA 3VU9A 2MIIA 3ICPA 3EIQA 3Q3HA 3V2IA 1P6UA 3FCAA 3ORHA 1GRVA 4OYRA 3W5CA 1JMYA 1RRVA 2BKUA 4DTCA 2VRWA 2G0AA 5HM6A 3D1VA 4OJMX 4EYSA 4YMTA 3TDKA 3SHWA 4G0QA 1E6UA 5CB8A 1USWA 1PZEA 5H82A 2JHPA 3RC3A 4MAAA 1KYTA 1RDFA 5FL3A 3TLYA 5EMMA 1JEYA 2Z6QA 2HW8A 3IIEA 3R4CA 2JA2A 1CB0A 3GO4A 2DBZA 2EL7A 3BC1A 1DXHA 2VFAA 3TRHA 2HWKA 3MGCA 4G9GA 5H59A 2QVZX 2B61A 5AJWA 2BZGA 2P5TB 1MX1A 3NRJA 5SV2A 2IV2X 2VHEA 4U7PB 3WS7A 3LTNC 1N3LA 1O4WA 3U0VA 2WWFA 1ZI9A 4FTWA 3I73A 2PMBA 3DBOB 1SGWA 2QB5A 2DHQA 3QZUA 3OTOB 4I50B 4YRLA 4QGSA 4DMGA 1P44A 1TCCA 1L5RA 3HYNA 4MWDA 1WD7A 4ROTA 4YJGB 3M9XA 1UP4A 1HETA 2AJ8A 4AICA 4BUCA 4C3ZA 4ILKA 2M1ZA 5AUPB 1YSCA 3K70D 2BOVA 1M8PA 4PX3A 5COQA 1ZD3A 1TA9A 5CHYA 1TGVA 3K9NA 3KAQA 1JFLA 1W581 2O8FB 1K8YB 3LECA 4RE6A 2GB4A 4GI7A 4ZTBA 4L2IA 1NUPA 5CT6A 5T4FA 3RRFA 1WUJS 4NJMA 4JXKA 4JUBA 4V0MA 1A8PA 2C8JA 3C3XA 4LV6A 4CKYA 3LD9A 5HUHA 3KVVA 3EA5A 3NEAA 2IYEA 3KBBA 2IEAA 4TTVA 4W6ZA 3OZAA 4M22A 4AKTA 2YWJA 1YOBA 5ALJA 3WIDA 3BFKA 1KE1A 2C31A 1Y1TA 3ACBA 5JYCA 5IYZF 4TKLA 2FR8C 1S3GA 1YRWA 1BMDA 1N2XA 2E1PA 2ZRGA 3CZRA 1Z45A 3FHLA 1QO0A 1ZPDA 3E48A 4R9SA 1H0RA 1JSCA 3KM0A 2FRXA 5HJ7A 1TPZA 1TJNA 4KPYA 2XUOA 5IAEA 5IEBA 3K0KA 4DCOA 4BKRA 4BVLA 2H2IA 2P77A 2YOHA 2PRSA 2JEZA 4TL9A 1JE1A 4OHMA 3O2JA 4XTCS 1U0OC 4D8VA 1I4OA 5JQWA 1J42A 5FAKA 1OAOA 1SCQA 1TYZA 3EN0A 4HPXB 1MTZA 4F7WA 1IM5A 1T4CA 1RWMA 2VIIA 5AW2A 3B1ZA 4NK5A 1WPGA 4ZO4A 4JQYA 4JZKA 4LHWA 1U9IC 4H1VA 1QO9A 4G5XA 3KSUA 4KSYA 5EJ9A 1KNQA 1DZ3A 1DO2A 3KQVA 3LX5A 4Q9IA 3BJRA 3VH4A 3HACA 2QQGA 4V0KA 4HGYA 3RVQA 5DYGA 4QFMA 1BTOA 1GIAA 2IYFA 4C5BA 1KI4A 1Z6QA 3AVVA 3U16A 4ZGWA 1TO2E 4NEGA 5CNJA 2C2KA 4F38A 3VUFA 3RD5A 4I3HA 3IDSA 1JYEA 2NSLA 4MKXA 4PR3A 4WNYA 1NYRA 2HY7A 1SWWA 2OVBA 4EAAA 1E62A 1FSZA 1AZWA 3OOSA 2A5DA 1XJWA 1NQAO 4B6QA 1QP4A 2CEKA 1QIKA 2K6GA 1NW6A 2W8BB 1N5MA 4IDGA 4QPJC 5GM1A 4O5OA 3T7IA 2QZ4A 3F49S 3U3JA 4JT4A 3I42A 4KLCA 2QK4A 4MNTA 4MV8A 1NTRA 3JAKB 2I78A 4UFOA 3LQRA 2Z83A 3VH2A 3C15C 3V4FA 1Z5OA 4ZVNA 4OKNA 2A94A 3FWKA 1X38A 5I9SA 2G1PA 3IAAA 4B44A 3K0AB 1JFSA 2CB0A 1D5CA 2G17A 3O4HA 1VSTA 4RF4A 3HB9A 3JAMA 1Q57A 1E5LA 3EDOA 4QASA 3WQQA 1XJCA 1I13A 2SBTA 2Z2KA 1BS2A 2H7VA 1SG9A 3D3WA 2G4LA 3NOVA 1PD0A 4ND3A 3ERCA 3ZDDA 3ZD7A 1OV4A 4BS9A 1WY7A 3HXKA 1WUTA 5JSUA 3JQ7A 1BIFA 4AY3A 1AZTA 2BFAA 2ZREA 1BXGB 2NYAA 3VX4A 3ADBA 3AF4A 4AJKA 1E3SA 1M76A 3A0RB 3LBHA 1Z18A 4HRXA 1XPOA 2VT2A 2G72A 2XODA 1PG0A 5K03A 5JH7F 3WBBA 4CTKA 2DXIA 2SNIE 3AJ8A 4DR1B 1LWOA 3P4UA 3VAZA 2GCIA 1A7KA 1IWOA 1E1NA 3DFUA 4NZNA 1VGRA 3TNFA 1T4GA 1I3KA 5HNKA 3G9ZA 4DYHA 3DE1X 3SHTA 3F5SA 1Z63A 3NAZA 4G1EB 3PFIA 2L19A 7GPBA 5DM60 3EYWA 4YMVA 1D09A 4U7GA 3EVCA 2UYQA 4UAUA 1FC0A 4GOJA 1GTL1 3IALA 4C04A 2J8ZA 1WF3A 3CLTD 1A1SA 3DBHB 3K5IA 4KN6A 3V2GA 5JAPA 1Y8ZA 3FB4A 1K4MA 4KE7A 4KIJA 1A04A 4KFSA 1TKCA 3EUFA 2X9QA 4IJKA 4OOEA 3UMCA 4JI2B 3FJYA 2OBFA 4LTNA 1HYQA 1CJVC 3KD2A 3OOEA 1Z36A 4MV4A 3WOVA 3GARA 1U1IA 4B45A 2IVZA 2ZYSA 1EUDA 1RJGA 3PQFA 5FOWA 3WL8A 1RKUA 5DEIA 4GZMA 4KLAA 4PS1A 2JFPA 3P52A 4HJRA 3EFEA 4MCHA 2ICAA 1D2EA 2YY7A 1MTOA 4IJ6A 1ATZA 1I10A 1UC8A 3D2LA 1D2NA 4PLHA 1GARA 1LW6E 3QUBA 4BZXA 3NASA 5EZYF 4A2CA 1N5OX 4DJEC 5EKSA 1X39A 3G2JA 3KHKA 4BMDA 4DANA 4EYGA 2XZLA 2BBTA 2IEYA 4XJXA 5I4IA 2IZ7A 4E1AA 2GA9A 1O5TA 1MMFB 3ABRB 1DI0A 1FP1D 2R68A 1U63A 2J3KA 4WZBA 1TAGA 3BGOS 4XVCA 1XMOB 1BHO1 3GCGA 1NZFA 3M5DA 2WFMA 3R77A 4JMLA 5IS2A 2BHNA 4LJ6A 5I8PA 2VYVA 2YRFA 3FRJA 1NLFA 1PSZA 1U04A 1KPHA 1UJ6A 2GGSA 2Q5QA 2WHRA 2WOJA 3E7PA 2Y1LA 5TXGA 3TCXB 4K1XA 3I5AA 4ZDJA 5CYPA 1WHSA 4EFLA 3Q41A 3AIIA 3W4IA 4D92A 4EMSA 4GI2A 5K2MA 2UZAA 2XVMA 4DCTA 4D74A 4BNUA 5CVDA 2CBXA 2XUHA 1JR4A 4KPEC 4P38A 3TECE 1J0EA 2BBSA 2VATA 2ZCUA 3CZPA 3THXA 3AM1A 5HIAA 4GSLA 1EUZA 1JDBC 2FE1A 4O1IA 2A30A 2XGJA 3O4FA 5JBNA 2XTZA 1XALA 3A6HA 3DEJA 3EBLA 4BL5A 4E3WA 4OFWA 2WJGA 3KE8A 3IT0A 4B3FX 5KQSA 1ZGGA 4NS4A 2ZQYA 5DX1A 3S8EA 2OL4A 4H7IA 3WGUA 1Z6AA 2C77A 4NMXB 5E4TA 2XCLA 4KTVE 2Z5VA 1N2SA 1OXKB 2P3SA 2Q4EA 2YWXA 1QFSA 4NDNE 2H4HA 4UBMA 4NG4A 2GWHA 3AG5A 1A71A 3KZCA 2HB6A 2IDJA 4LXIA 1U81A 1UK8A 3LU1A 5J47A 4CRWB 4R6WA 4GWKA 4EA8A 1LUAA 1RQPA 2WMOB 4Q18A 3V8BA 4LYHA 1BD4A 5GJCA 1FS6A 3RQSA 4RKWA 3EVTA 2J0SA 3RFUA 5AKZA 3JZMA 4Z86A 3BKXA 1P3DA 2X8LA 3T5DA 2PL9A 5LMUB 4DR7B 4TX1A 1JA9A 3VFDA 1DBIA 1NV8A 5HS4A 1WPQA 3FYUB 2Z08A 2E49A 4I6GA 4JR1A 4L8WB 4O4JA 2QZJA 2UUCB 1TTQB 3PHJA 4C4RA 1Q7EA 2HA4A 4ABTA 5BQOA 1DQNA 1R0YA 1PW5A 5IK2A 2GTPA 2X0IA 3OZEA 2WSBA 1RQXA 3LY5A 1E2FA 1CVLA 3CNNA 3IA7A 4N5HX 3MS4A 4A2PA 1P7VA 3A8TA 3TOCA 3Q3VA 2C42A 3E8MA 2QKYA 3N6VA 4WN9A 4J0FA 3TOZA 1XRNA 2V8OA 3U13A 2QGNA 1RWWA 4J7CA 1TXGA 4DLVA 1HFEL 1XQ6A 1R5OA 2BFDA 4FOLA 4MZDA 4UE3S 3TI9A 3V97A 5CW2A 1JNYA 3FPEA 2DWOA 4XLZA 1TA4A 4WDRA 4Q39A 3ROKA 2WAOA 4GLLA 1IXRC 3AH8A 5C81A 2PKQP 4X24A 2R7NA 3JWGA 4TKMA 1QFXA 3CZAA 3ZE7A 1BQEA 1RHKA 1U94A 5ECDA 3V46A 1P4AA 5KTNA 1NPDA 2XWJI 1JF8A 3CR8A 4KDCA 2ZJ2A 4ZOCA 3QLEA 4RGQA 1GFIA 3ZGNA 2QMHA 2ZIUB 3D81A 4FYYA 4Q15A 4IMPA 4LKRA 3ZGYA 1X0XA 3A10A 4RENA 4CMHA 4G1CA 3JYNA 1AK9A 3MWLA 4IXMA 3HU3A 3MWFA 1YE5A 4KYVA 4U3JB 3CE6A 1VOTA 3FZYA 1ULBA 2O19A 3QVVA 1E7YA 5DM1A 1E1RA 1PKEA 3E35A 1XD2B 1Q1NA 2CZCA 3O9ZA 4J2TA 4PZPA 4WZ6A 2FZ4A 4EDFA 3CVJA 5LXTA 1C1DB 2OR3A 4G5RA 2G0TA 1QH8B 2GR9A 4BQSA 2OUIA 2GCOB 3F3SA 4MS1A 4TVSA 4BGDA 4PCUA 2G5PA 1R3DA 3CXRA 1U7OA 4JQOA 5KTKA 2CZGA 4LXXA 1C7EA 2Q9AA 5WRFA 5A62A 1A0OA 2CKDA 2GCGA 4PW0A 4AS2A 5DK4A 5A2GA 1IXSB 2PU5A 4RDXA 4BY9E 3WMFA 1WCIA 3OY7A 3UATA 2QR2A 1EWRA 2JL1A 3FVWA 4FNGA 3SU8A 4ZJPA 1YVUA 2REQA 3BZUA 5JCJA 1RM3A 3AIOA 1OLXA 4IGFA 3ROTA 3NJ8A 3SYNA 5LM3A 2A4KA 4ARUA 1E2BA 2Q3HA 2AW5A 1BO6A 2FH5B 6NULA 1UAYA 1QCZA 5BQ3A 4CCYA 3BPSA 3ZDQA 1PLJA 1ZCJA 2C99A 5CVJA 3H5NA 3T3OA 1WABA 3A70A 5E6SB 1VZ2A 1A9ZA 4LYFA 1V1JA 5D3KA 2C1ZA 1Z5GA 2XKAA 5TY0A 3R0XA 5KKCA 4HGOA 2VNIA 4ENSA 4R84A 1KFJB 4TKVA 4EEZA 3EVDA 3EOZA 1YR8A 5LIRA 3A6PC 4G1VA 4M0UA 1CJUC 3FPKA 3WRYA 4EKEA 5FOVA 1ADCA 1B43A 5DK6A 2P0YA 3H18A 3OETA 4U2GA 1R00A 4ENWA 2G9QA 1JEDA 1YA8A 3ETLA 2CLHB 4UOQA 1ACLA 5D85A 1E3QA 2XBLA 4DJAA 2QAGB 3DDZX 4X8HA 5DBEX 1C0KA 3NW9A 4HDCA 5AKLA 5L95A 1S2OA 2FUEA 4GI3A 2CSXA 1ULAA 3D1JA 4URUR 3CN9A 4LWPA 5A3RA 2Q21A 1OT3A 1IJFA 2WTXA 4BQIA 1MDBA 2CFTA 2WHYA 4INPA 5CCEA 3NJ4A 2ZRJA 4F8JA 5C7YA 1OH8A 5SZHB 1NURA 4YFVA 1ZLXA 4TV9F 5B7NA 5BRAA 2NTYC 2I3ZA 2QR3A 4B7XA 5BVHB 3FYUC 2ZIAA 3BMOA 3BXZA 3PFCA 1FFYA 2WKPA 4I4TF 3AF3A 4U8GA 2LRHA 4XRRA 4JGGA 2CFSA 4X0EA 4LUCA 4C1NA 3O93A 3G7SA 4OI4A 4REMA 1JILA 4U7HA 4CMIB 1N9ZA 1N57A 3ZGOA 3EEIA 5FX2A 2NO7A 1GCAA 2YHIA 2DUWA 2UAGA 1YE8A 3BM5A 3MWEA 1GPUA 3ZHRA 3IERA 2V5UA 4RVGA 2X19A 5H3CA 2ZTMA 3GFGA 3P9IA 5DI3B 2MYTA 4JL8A 3FPJA 1IK4A 1YKGA 1E61A 3BXFA 3TQTA 3BZBA 2HLNA 4G4SP 4MIKA 3SJCA 1JL3A 3LIIA 2F17A 1JBEA 2VSQA 4CKCA 4XWKA 4KR3A 3LNTA 1SXPA 4JS0A 2VZEA 4WZBE 1EFTA 2PUWA 1ADYA 1R74A 2VPTA 3OJFA 1DEAA 1M8JA 2D54A 3AW9A 3GHHA 1XHLA 4HEJA 4R1OA 3UAVA 2R8OA 4NYIR 1K06A 1X80A 1PR9A 5DCWA 4J16A 4CUJA 1UK6A 1WDWB 1XMXA 1ZM4A 4XWGA 4UUOA 4RFSA 3WNCA 1CDZA 1FK8A 2D5BA 4N8DA 4BV9A 1JA0A 1H65A 2EIXA 2GBLC 4IR7A 2WJZB 4DBLE 1N8KA 2AQHA 2EJTA 1KARA 2AB0A 1NVWQ 3HB1A 3HKCA 2ZJ0A 3SR3A 4FFWA 2VPZA 1QZUA 3BHNA 3NTOA 4KRGA 1L7DA 4X54A 3GU3A 2J5QA 4CDGA 3VO9A 5ENDA 2R1VA 2VUUA 4A6PA 3UF0A 1M5TA 2B30A 2FW6A 1ZL2A 3IS3A 3RIGA 2GJ4A 4CLXA 2GH1A 4AMZA 1MEEA 3GVCA 2JFNA 3B3AA 1EFPA 2WD7B 2RBEA 4NULA 2X2FA 4ZARA 4DN6A 4KQ2A 4R05A 3HR4A 2GZAA 3TRIA 1UBTS 3N58A 4OHRA 5IBPA 3VZPA 2DG2A 4LRUA 4AUNA 4PAOA 2JIBA 4D8WA 5IFKA 2C7QA 3NVKI 4DB2A 2Q4DA 4TS1A 3WGLA 1YR3A 1J9GA 3EEBA 3KQLA 2ZI6A 2WIJA 1RFLA 5BVGB 2X4DA 3GJ7A 4I55B 4H7FA 4CV1A 4BXOA 1NR1A 4ME6A 1DCKA 3CPEA 5LQDA 3CISA 3K0HA 4TYPA 1TZBA 1WQ3A 4WHMA 3OX4A 5EPOA 4POAA 4QPNA 3EA4A 1PEAA 4BKUA 5CT8A 2RAVA 3JQCA 5P8WA 1J8YF 1ZMXA 1NC1A 4JP5A 3DW3X 5F33A 5CJ2A 4JC8A 1Z5NA 3A6EA 1P18A 1ZFNA 4FFPA 5IM5A 1OYWA 2HCTA 5EE9A 1Q5PA 3BXOA 1VBFA 4NKRA 4QHTA 1GP2A 4DLYA 2A1TR 3EGXA 4WOJA 4L5YA 4G0MA 1I7DA 4K9PA 1HT2E 4ZANA 3GF4A 4HQNA 3NXKA 2C4NA 1T1IA 1HMPA 1W5BA 1OFUA 1N1MA 2PZGA 3C7AA 4UCWA 1MB2A 4MGEA 4MVJI 4UUAA 1FVHA 3CLHA 2HIMA 3HVUA 3RJMA 1PIWA 3A9RA 1CRWG 2W43A 1U1DA 2JBHA 3EIEA 3GA0A 2C5HA 4L85A 2W71A 1UT6A 4MKFA 4MQUA 2V6JA 3DTNA 1HQDA 4IGKA 2OYSA 1CKEA 3ANSA 2E82A 5DX8A 1KYXA 4URFA 2E5LB 5HFNA 4TMYA 3ONNA 1FBTA 3DAHA 1EQAA 5HKBA 3T5PA 2OV3A 1S8NA 4NMHA 4F46A 3GP3A 2CLMB 1UAGA 2EQ5A 3DOEA 2DFVA 1N36B 3O75A 2E85A 2XDQB 3CZ4A 2WYUA 1XKLA 2QT1A 4UHHA 5BWMA 1PNVA 5B1IA 5KOHB 3KJEA 3G0GA 4JLUA 2LDBA 3IJRA 3OU6A 4LZPA 3UY4A 2G08A 1T91A 1FX0A 3I72A 4K3VA 1QYIA 4ZAGA 2EJVA 1HYBA 2QSYA 1RADA 1QRDA 1SBHA 1SQFA 3AHFA 4REQA 5TGZA 3KP1A 3R9XB 2P2ZA 4I1UA 4AJOA 5JJIA 1THGA 4O2AA 3C3YA 3F2IA 2OEPA 3E0QA 4BFXA 4KQHA 3QEMA 2ZRIA 1FFXB 1MOQA 3H2GA 4JC5A 4MJ7A 5FPPA 3U2QA 4V0SA 3VR5H 3SOZA 5FBKA 5IJ0A 3DTTA 4BQPA 1E77A 1V1RA 2J46A 3QKRA 2YVQA 3KB2A 2OBMA 2RGCA 1X7WB 4I6JA 1AQLA 1DKUA 1XLWA 2WG0A 3LUDA 4GPD1 3ZU4A 1SUIA 2GEFA 4LQDA 3BKWA 4QG7A 2X8BA 3G2HA 2PKYX 3K0SA 5AOVA 2WJPA 1BE1A 1W46A 1XN4A 3QTTA 4B80A 4QOFA 3Q8MA 2BMAA 2NZXA 2W00A 3EC7A 2PKXA 3G2OA 4DPKA 2AHOA 5A1JA 4QPCA 4YUWA 5IF3A 3MEQA 2XIJA 4OVKA 3E9EA 3FWNA 1XEFA 4X8MA 3W1VA 3AGQA 5L4LA 1N0VC 1UPFA 4I1VA 1ODCA 2XA2A 2NXWA 3H5AA 4RVSA 3BGVA 3K1ZA 4WCFB 2G1UA 3L40A 3L6CA 2HDOA 2I22A 4YV2A 2H6EA 2XB4A 1S2IA 3PQCA 2NPOA 2IY7A 1BGXT 1KSHA 1EUCB 1LRLA 4YAWA 1JV2B 2NG1A 4UHFA 2V9CA 2ZJBA 2IS6A 3V7NA 1T5LA 1GVHA 2ILVA 3TAUA 2O23A 1SK8A 4N54A 4RDCA 1H1LA 1KAGA 3E4DA 1ZAKA 2QPAA 2D7DA 3H3JA 3AOGA 3DZFA 2BDUA 4BMPB 2ZKIA 4HLUC 5LCXA 4L74A 4BO3A 1NVKA 1E99A 4YP9A 1UBSB 4PC6A 4TYWA 4URZR 1EK1A 1HOTA 3I76A 5LU8A 5CA1F 2WHEA 1G20A 1QWSA 3QKSA 1P2VA 2HMTA 1EK6A 2X1LA 3KQMA 4I7EA 4KH1A 1YS4A 2CXRA 1MPXA 1YVDA 1ZSVA 2A14A 2GN8A 4V3CA 5DM2A 5HK8A 4JJZA 4MEBA 4URYR 2HRRA 1QPBA 2X3FA 1SG6A 4X97A 3HKDA 1I36A 3K70B 3PD0A 3P0IA 3SYRA 3UCXA 3C1OA 1ECFA 1YCGA 3CSUA 4KYTA 3ROXA 4H1TA 4FE4A 5ALNA 4BO8A 3AI2A 4BO9A 1IC6A 5IM4F 2ST1A 2EWMA 3JV7A 1OFGA 1BVUA 1H3FA 3KYCA 3MS7A 4LJLA 5BW6B 2EZ9A 1RMQA 2PGOA 1H3EA 3NDBB 4FW9A 2I6GA 3QI2A 2HIGA 4I4CA 1J0BA 4QLOA 4UM5A 3TGWA 1MC4A 4I9UA 5IDYA 5I7HA 3ZWQA 2QTVB 3KJIA 1IY0A 4RPIA 4OREX 1EP9A 1MQ9A 5BYJA 1WUKS 2O2SA 4L72A 1KQ3A 3L6EA 1TF5A 4NBWA 4BPBA 1QANA 1FSGA 1Y1LA 1PO7A 2BFEA 3H1TA 1YJXA 2IXTA 3HWWA 2VTVA 4HDNB 4GPBA 4PHHA 5D00A 4Z9FA 3R6LA 2C57A 4FFSA 2ZM6B 4B6EA 3FTNA 1W9HA 1TW3A 1U8AA 1OH5A 1IY8A 4LFBB 2QP4A 1KP3A 1QIFA 3EIUA 2Z4SA 5KDLA 2BGLA 1KI7A 3RGGA 1X42A 4Y3UA 2I6FA 4PFJA 3RSZA 3K20A 1J2RA 3QMWA 3AEQB 3LYHA 5E2BA 2QM7A 5JS1A 1A2OA 1QRAA 2NTVA 2WIFA 2EFDB 3Q6NA 4IPTA 3DOIA 4DSUA 3AKZA 3JQ8B 3H8VA 3IE0A 2J5BA 3IIMA 5KVCA 4BX8A 1S9DA 1D6SA 4HI0E 3A6GA 3OA2A 2PTGA 1EHYA 3KTOA 3S2ZA 1WTCA 3B13B 3E18A 4WKOA 1GGFA 2ZIWB 3O8NA 3RTCA 4DILA 3EGWA 2XVZA 5JD3A 1E1CA 4EUNA 4YWHA 4EX7A 1YD7A 2BR5A 2FW1A 2PRKA 3CPSA 3HVRA 3RHTA 4CM5A 3QG5A 3LDHA 3FR8A 4TWJA 5DOVA 1HGXA 4BZQA 1AD2A 1AIPA 1IN4A 1B74A 1I5EA 4F04A 1RMYA 4RADA 2DHRA 4CMJA 4H7EA 4K8OA 3ROEA 4OXQA 1QTRA 3I5YA 3RT9A 4KFCA 2ETXA 3TAHA 3T3IA 1SQGA 4TQUS 2IHKA 2VDRB 1PX0A 4HG2A 1NKVA 3SS8A 2CUNA 3SYMA 1Y7IA 4RPLA 1CIPA 3H2JA 3FI0A 4BN4A 2XHZA 2IBMA 1U6KA 1NRIA 1T1SA 3ZS8A 3RIEA 4WIAA 5EN4A 1HT1E 1PUJA 3H9JA 3GFBA 1Z28A 3EAQA 1NBIA 1PGOA 2OHIA 1MO5A 3LUPA 4XPZA 4EZIA 1WWKA 2J3LA 3E3NA 3ORFA 4DLZA 4WCFC 4BEWA 3N0VA 4B85A 4LDNA 3HS3A 2FWIA 3VXKA 2YRWA 3HNPA 2PGXA 3OZGA 4JLVA 4ZC1A 3WGGA 4FFBB 4MAMA 3SI7A 3FKJA 1CUZA 3ZWNA 2XW6A 3G79A 3BWYA 2GJ8A 2O48X 1RABA 5ECYA 1YJ5A 4CF5A 4YAUA 1WY5A 1YJCA 1UM9B 3AERB 4MTLA 5F4BA 2NMVA 4FZJA 1XTSA 1I3CA 3AEYA 1EUYA 1GGJA 5JRZA 3Q8WA 3H9UA 3AL0C 3BJIC 1WW8A 3PRYA 3DLPX 5C3UA 4BNHA 4EB3A 3HPRA 3M6IA 3NGLA 3FTCA 1D1QA 1IM8A 3A58B 4EOGA 1D1TA 1BU8A 2V74B 2QP9X 1RBMA 1XGKA 3KZVA 5H80A 5IC6A 5HBGA 3F2VA 1JH8A 1YZUA 1WSAA 3N59A 3QVXA 1YIOA 3WRWA 4Z7JA 3K70C 1KQNA 1B42A 5DMXA 1LV7A 3C97A 3CS3A 4PBSA 1RWVA 4AJLA 2FSVA 1GADO 2ZIXB 5EXDA 4Q02A 2JHCA 5L6MB 4GYYA 5BW5A 5EP2A 3PEFA 1E2IA 5D7BA 4GOLD 2EYUA 3HR8A 3SZGA 5B37A 2R66A 1FP4A 4H17A 1E2GA 3O3OB 2IX9A 3KB6A 1T2CA 2O2EA 3L7KA 4Q34A 1IHOA 1V25A 3Q9UA 4KZKA 3KWJA 1C3OB 3DKPA 4DCJA 2QU7A 3CNLA 4HGNA 4NY1A 1CZNA 3RCBA 4BAZA 1ADGA 1F4VA 2H2DA 3EG9B 4WUTA 1T2VA 4JBIA 3PNVA 3A27A 1G8MA 1WETA 2R6R1 3G0BA 3LX4A 3M34A 1ZHOA 1GGHA 2JFGA 4UAJA 3JVUA 4MOWA 3QK7A 1CQWA 5EA2A 1PK7A 2AWNA 3CT6A 2ZIEA 3ZV5A 3ELUA 1RJWA 3K9BA 4M9SA 1Q92A 2JI7A 2F8TA 2P9FA 1KPGA 4ZGGA 1RE1A 1ZQ1A 1U3CA 2FLWA 2XCUA 4DLSA 3V5NA 3KKLA 4P7FA 4KRYA 3AY7A 1V16A 1T0PA 2RK6A 3G1WA 2FMUA 2H3HA 3QXXA 3SM3A 1EIWA 4G5HA 4Q21A 3EMVA 1TJ4A 3EBPA 5T4EA 2B37A 1VKJA 1GTSA 1TE2A 2RHLA 4RHEA 5LP6A 1L7RA 1GCUA 5ALSA 2VDVE 3KR2A 1RVV1 2Z8YM 4F21A 2H54A 2W98A 2Z57A 4IQ8A 3OUTA 2DH6A 1MQAA 4O4LF 2PBRA 4HMQA 2Q8PA 1EEXB 2PGLA 2Y4NA 3JYLA 1O87A 1QV6A 2ZB3A 1IRXA 1O89A 4PC2A 3R1IA 2NUPB 3TXAA 1NVVR 2IUTA 1VPTA 4MPPA 1Q7GA 3RAFC 2JBWA 2J32A 2OG2A 1QYRA 5CDYA 5ALIA 3KSAC 2BEWB 1X1BA 2ZBDA 3B3QA 1T6XA 4DA8A 3KEFA 1OGYA 3P20A 4B8WA 3STWA 1YFLA 3WLJA 1C81A 1RHQA 3FOAA 3W3AH 1G20E 1J0XO 2BP7B 4WOCA 3BBLA 2WICA 3LYUA 5K6AC 1LC0A 1XYGA 2GHTA 1C50A 4CV3A 2X7JA 4QYIA 2I5PO 1P1JA 4MTCA 1HNZB 3M83A 1TADA 1W47A 2M2IA 3L8EA 2VOEA 4YCDA 4DT1B 3IV6A 1E3EA 4NFSA 1Y34E 5A4MS 1NG1A 1OI4A 3KR0A 3KTAA 3PXGA 2RBGA 2Q0QA 1Q0QA 1CG6A 1MX9A 3NTVA 2ZRAA 3GQBA 4DARA 5A0VA 1R16A 3H6KA 3H8SA 3KQWA 2H17A 3FOZA 2WJHA 3D0QA 1EK0A 5JC1A 1N5IA 1ZMRA 3EQZA 4MA4A 4V02A 3EGIA 1T26A 4TTJA 1EDDA 1RMTA 1B8NA 1JLLB 3VOBA 5ER6A 4F2HA 2CV0A 2B8NA 4GM0A 1IZYA 2H11A 3LIPA 2BR3A 4X5OA 1GM5A 4LQLA 1V41E 4OP1A 4GF5A 1Z82A 3FE2A 2P2CA 5F23A 2ARKA 1AKWA 2DLNA 4LZLA 3VO2A 3LVFO 1JAYA 1DEKA 2DTXA 4UMDA 4HN9A 3QE0A 3WLRA 2YYZA 2R62A 1V5GA 3PDIA 3QSGA 1AMNA 2WYHA 1UC5B 2HEGA 5HQ3B 4ETWA 3TPFA 2C96A 1BYUA 1ZH4A 3IQXA 4BLTA 5JALA 2WNSA 2SHKA 1H2AS 3M6AA 4Q4HB 1TGYA 3CLTC 1HQKA 3F96A 2BGRA 1AF7A 4QOSA 4MGKR 4BRWA 1I32A 3G9UA 3JALB 4U1RA 4JXXA 3OTWA 3JWJA 1ENZA 1YO6A 2GRJA 3QHQA 1R88A 2BGMA 4IX1A 3FPSA 2VDOB 4KWIA 4XUCA 4KK3A 2DQZA 3FD8A 4PZEA 4K1LA 1R6TA 5ITSA 1CX9B 1OGJA 1U65A 3AVXA 4ZGBA 1JR2A 2X8JA 1G1AA 3EWSA 3HZZA 3P0RA 4ZOLB 3WGZA 1E89A 5BOSB 4JOCA 4ZHQB 4W99A 1RXIA 3LCRA 3SQNA 2OMKA 5EQTA 1PNRA 1VGVA 4BV2A 3KAJA 2B4YA 1H2EA 2I4MA 1F2DA 3LP8A 3QFFA 1QCYA 3U7QB 4EYEA 4JLAA 1LNSA 3V9PA 3QLTA 1PDOA 3WYEA 2W4MA 3GUVA 5JECA 1P9WA 1T5SA 4P58A 2WPDD 3R2JA 3V4VB 2A3RA 2CMFA 2PMWB 4OCZA 1MJ5A 1ZMOA 3A1CA 2H5EA 1ZIPA 1IWPB 1CZKA 4BLVA 4DS3A 5KYWA 1G16A 2FZLA 4INAA 4GLFA 4J0QA 5DHTA 3QVJA 2Q3DA 2WHXA 4YO8A 1QIMA 2P6NA 3EUWA 1WB6A 5SYMA 3VDQA 3G9XA 3IP7A 4UBIA 4MHTA 4QUAA 4Y2GA 1A2QA 4NYMR 1WMFA 2FUKA 5DE3A 3RF6A 2OFPA 3H6HA 5JSQA 2BH9A 3GLVA 2IKSA 1E5QA 1IQRA 4ZALA 2YWCA 4GXQA 5BSMA 2HXYA 4MCAA 1OU4A 3J80A 4IGEA 3NHKA 4UAGA 5GV8A 2PGAA 1BDMA 4AO7A 3N6XA 1IOVA 4M0EA 3G88A 5H3HA 4QU5A 5F51A 5HUJA 3Q15C 3PEYA 3C6MA 5HKOA 3KL4A 3RF7A 1JXAA 1EGHA 1RPNA 2X2OA 3FFWA 4KWHA 3VSCA 2HMYB 1NN1A 1QO7A 4U2KA 5FPHA 4D26A 3OWXA 8OHMA 1M2GA 1T3HA 3DZCA 2QTRA 3A11A 4FW8A 3SE7A 4D82A 2IUFA 3HGQA 3A37A 3HRHA 3TOSA 4EPWA 1NYLA 5G41A 8GPBA 1ZR4A 3V48A 1EJ2A 4PLGA 1OWPA 2PLNA 4RQUA 4LK2A 2G5GX 4E5PA 2A35A 1ZBQA 4XW2A 1OVMA 1HG0A 5L3SB 5ISMA 2O1EA 2QLFA 4KE9A 1ITZA 1C3JA 4JH0A 4NRDA 5AW8A 1Q3HA 1ZSYA 3L8CA 3OU7A 3R5TA 4DBVO 5C52B 1AKRA 2XSZD 1OXBB 1ZRHA 1GA1A 4MUIA 5AH0A 4LYYA 1N33B 1PGNA 3PQEA 5KCMA 4D0NA 3PYLA 2VTBA 1N1DA 3I8XA 2G25A 1TVEA 4UQOA 2ZJOA 1Q21A 5FRDA 2J5KA 3MSXA 4AZ0B 4CM9D 4CMGA 5E6RA 1JALA 3WLHA 2D5LA 2XJ4A 4OHZA 4C78A 1PZHA 2PKRA 3PUIA 4EECA 1Y8RA 3KOWA 2H1RA 2JCGA 3BGWA 3HI4A 3IUBA 1KORA 1PEYA 1PL6A 2BF7A 5BQXA 1RRGA 3JZDA 4H35A 1QVRA 3DKIA 1UXKA 3LO5A 4ZU6X 4MR9B 4ADSG 5IDXA 4LF6B 4RZQA 1M1NB 3DXZA 2AQKA 1RBYA 2FP4A 2C98A 2VPPA 3PL5A 5LMNB 2HIAA 1TEZA 2DQKA 1CIVA 1NXSA 3QV1A 4QPZA 3W8FA 5KQRA 2CJXA 1J39A 2GFIA 1MRSA 3KKOA 3KHUA 4HADA 4QM6A 1PQYA 1YGPA 2B5OA 3ESRA 2CMGA 2Q6KA 5HZKA 4QG3A 1QJ4A 4YMSA 2NW6A 4HWTA 3J7AC 3OFND 1UBFA 3ZLJA 5EJ5A 1SUCA 4G85A 4K9SA 4OY3A 1F6BA 2X9GA 2B9VA 3OMWA 2HMWA 4JQCA 4U63A 3CX7A 1P17A 4QOEA 1XLUA 4MLDA 4X41A 4ZVKA 5K4HA 4KOAA 2H51A 4MWGA 4YDRA 2AT1A 3VR3D 1C7QA 3M1IA 4P35A 1NN5A 1O77A 3D4NA 4DSNA 1CUDA 1M5UA 3S8YA 3QW4B 4LIPD 3GQVA 5DI9A 3GCDA 5I7AA 2NADA 1Z7BA 1CULC 4HBZA 1E3WA 3OJCA 1F14A 2FCRA 1M7BA 4IZHA 2RE8A 4AS3A 1P0IA 5FPSA 4ACBA 1XAJA 2FR8A 2WMNB 3BICA 3CG0A 4K9QA 1IB6A 1POXA 4NBVA 3S2GA 3LPDA 3T1VA 4Z4EA 3E8SA 1T2UA 5F2EA 4C6HA 2XUZA 3QPBA 3BH7A 3K5HA 2H7XA 3FROA 3MGGA 1TTTA 3PK0A 3BMNA 3EPRA 1W30A 3EW9A 1YMQA 2BMVA 4IKOA 3REQA 3JRXA 3RBZA 4BATA 4BMCA 4DGQA 2XUJA 2ZYTX 2ZYHA 4FS8A 1VJ1A 5K4GA 2BE9A 4KGVA 1TK2A 3QNUA 3MAGA 2HA2A 4RA9B 4DY6A 3ZY3A 5EXEA 3VTZA 1YHNA 3UJDA 1HTBA 2CFCA 2WV7A 3EWNA 3I9NA 1SUBA 3C45A 2AF4C 1S3SA 1VKNA 4GWGA 4W7SA 2MINB 3KJGA 3KNZA 4QREA 2NYRA 3PFGA 1NVTA 2AMYA 3LWDA 3JQFC 4QECA 5EJ6A 3ZY6A 4IIJF 3SX0A 2NPIA 1JJAA 1DX9A 3PFNA 4Q82A 2ZZKA 2JGIA 4O1HA 2Z95A 2CXPA 3BF7A 4WW0A 3AFOA 4L4XA 3TXXA 4LF8B 1CUWA 3OG9A 1LLDA 1AVTA 2HK7A 4B3JA 1SFRA 3DMFA 1K6IA 1RYYA 1T29A 2ZBGA 2ZR7A 4Z3DA 5BQ5A 1VDMA 3M0EA 4DXDA 4GMKA 4N40A 4X1YA 3DFFA 4FVTA 4Q3BA 1E3DA 2BEVB 3D2AA 2J9XB 3A1UA 3AB3A 1IHUA 4OLAA 5JISA 1QMGA 1T5BA 1NJ1A 1GRRA 1DWUA 2QTBA 5IEJA 2Y1CA 1KFKB 1GU1A 3B1WA 4LK3A 1DJNA 3OEYA 4N0EA 1RRCA 2X1HA 2EDAA 2POCA 4XOUA 4BNIA 2PX0A 2PPVA 2ZYAA 3Q2KA 4WBSA 5ALKA 4DSAA 4F6CA 4ZXFA 2XXJA 1E9FA 1MORA 1BEZA 5T67A 3TD9A 3W5AA 4QULA 3GBSA 1Q0LA 1VGQA 2JKZA 1M33A 1YQTA 3AMVA 5JW6A 2OENG 1FUYB 4RL4A 2R6JA 4C2AA 4D8YA 4KFRA 1PTJC 4IO1A 2HBQA 2JAOA 4KTTE 4Q9LA 3E82A 3I9LA 3HJUA 4P98A 3H2SA 5IDVA 1JDJA 4TT3A 3TOVA 3BVPA 2DBRA 4CG1A 2AXPA 4YRDA 3LSYA 1Z68A 4RANA 3GWZA 3K1AB 4R16A 4ZQBA 2BPOA 4L5BA 4LZNA 1VIVA 3I83A 4QEKA 5F1KA 1BAPA 5E7JA 1FXSA 3OICA 3Q2IA 3A31A 1DWOA 2REXB 4LBYA 4YMLA 5A71A 2PXCA 1T9CA 3KG2A 2O7QA 4I55F 3AFHA 1MAHA 1GRNA 3OTHA 4HRAA 2W9XA 1K8RA 4YJGA 4ZXPA 1WOYA 4MQLA 3VJMA 5M7EA 3L01A 3KKZA 3VGPA 4K9KA 4OJKA 3MTGA 3F78A 1SCNE 1ETHA 2JANA 3W79A 5HYVA 2CUTA 2B36A 5J3JA 3SNHA 2ERXA 3OT4A 1G59A 2O8FA 1ADFA 2OHGA 3THYA 1NWCA 5CVUA 4DUGD 2VA8A 1EPUA 1H66A 1DC8A 2OFXA 3KZMA 1KFBB 4H4CA 3U9SA 3D4IA 3W6PA 3WGQA 1GAXA 3H5IA 3O31A 1Y3CE 4GPEA 4CIXA 1W1UA 2R44A 3O73A 3CZQA 2OA0A 4JEMA 1KZ1A 5KNBD 1PFQA 4UHJA 1ETUA 2I66A 3I34X 4YONB 4F8YA 5KNDA 2HA5A 4W6QA 1GCGA 2FP3A 2R5FA 3LOUA 2C84A 1D4OA 4JC4A 1AKNA 1AB5A 1XZ8A 3WK9A 3E4CA 4DSTA 2XNDD 4FJ2A 1I7LA 3FNGA 1EVIA 1DJPA 1VHWA 2BGJA 2OGZA 1KMMA 1AT1A 3CV3A 2Q6LA 3BDVA 1H2WA 1FB5A 4QQNA 5EPEA 3SICE 1LCIA 2JFHA 3F7MA 4ABYA 2V55B 1U8TA 5E7IA 1J25A 3LW8A 4BFUA 1ZD1A 2Q5JA 3FG9A 3W06A 3A9TA 3G9TA 3U80A 2C20A 3ZWYA 1VZ3A 3B82A 1DMRA 4YXWD 3A9CA 5K8JB 5LQAA 3TJRA 4GD3Q 2XX3A 4LDQA 3B36A 1UC9A 1Y1SA 3DLIA 3HKEB 3GXOA 3VSAA 4BU0A 3GH3A 4BVJA 2A8YA 3FIUA 1II0A 1TKAA 4ZPXA 5FOSA 3CKKA 3OX1A 2J3HA 1PR6A 3PHLA 4R8VA 1Z73A 3FKSA 3G1UA 1L3CA 1IIRA 4M8IA 1Y8CA 4F3KA 1H6BA 3HCWA 2AD5A 2OLEA 4TXJA 3WQSB 5EHZA 1G5TA 3RLIA 2OD2A 2VQEB 3R8FA 1D4FA 2CFOA 3OPMA 4LJ9A 3C87A 1YL7A 3TPZA 1E7SA 1O94D 3H4TA 3OO0A 2HZBA 1F9AA 3D6UA 3E1GA 2Q5EA 4HMPA 1ZISA 1E0SA 3OHSX 4MW9A 3F6YA 4KOEC 1N6RA 2AX3A 4JT8A 3MCVA 5FUXA 2QZZA 3ILHA 1VIYA 1B14A 2X5OA 3DMDA 1WKBA 4ENUA 1BS9A 5IDWA 2Q4TA 1BCRB 2NSJA 2BI7A 3JQQA 4ND8B 2J08A 4MW6A 2J0VA 4FP9A 4F3YA 1Y1RA 1KERA 3DAPA 2P6MA 2PRJA 5DULA 1SMKA 4YRMA 3COPA 1Z39A 1Y89A 2FPXA 1IJBA 4BUZA 1K86A 4DL9A 4R1SA 2H5JA 4JEUA 3BWMA 2L17A 3FY4A 1I7PA 2EZUA 4BCBA 1AUOA 1EU1A 1KY3A 2GDJA 2WAYA 3IP6A 5D2CA 4DOMA 1C7ZA 4FNOA 3ROGA 5KDOA 2KQUA 5ESDA 2BHTA 1WCV1 2W2NA 5HX7A 1T6ZA 1VYVA 4UPDA 4W1QA 3RLFA 1J8MF 1X19A 3E22A 3V42A 1CUCA 2EW2A 3VC3A 3H99A 2PUEA 5F9MA 4OUKX 4NZYA 4LYDA 1AU9A 3AY0A 4S1WA 3RPEA 3HEBA 2D06A 1VC2A 4M46A 2VWQA 3LC1O 2PS9A 1AHPA 3TZEA 4Q7EA 3M6UA 3UMVA 1E3LA 2AKYA 3TK1A 2YTZA 3WJAA 1ODSA 3TBFA 4X3PA 4OHBA 1H8HA 2O8EA 4V39A 1SVKA 2CB9A 4GQAA 2PEZA 4B6JA 2VNSA 4DV5B 3HI6A 3FJOA 4V24A 5CEJA 3E7DA 3WP0A 4D0SA 4GUAA 4PLTA 3RODA 2NOAA 3UW3A 3VC7A 4ZD6A 2EXXA 2R1UA 5TQJA 3WGMA 3TQSA 1JA1A 4EK9A 5HJ2A 2HUPA 3ZS9A 4B83A 1I1OA 4BYGA 4HT3B 4H7PA 2RG1A 2NZ8A 2WW8A 1UT5A 4TKUA 3V4ZA 3QELA 4P7JA 4CMCA 1GGMA 5BR4A 1DPGA 1RYDA 4TKZA 3KOUA 3JATB 4RS4A 5EE1A 3G82C 1Z6YA 3ZCQA 3KEOA 4Y6GB 2FMKA 4B35A 1NRJB 4HUJA 3QOWA 3NTQA 3SHQA 2WM8A 4BECA 4QXQA 5D01A 3LWNA 1Q0RA 5LYJB 2DWQA 1TMGE 1I1QB 2CLFB 3KZOA 2IT1A 5JS2A 1JHAA 3VNAA 4OHWA 1QRTA 4V38A 4FB4A 4OFZA 4GC5A 3FFXA 1T9ZA 3H6GA 4IJMA 1M1YA 4EI9A 3U4IA 2X42A 2G06A 2HU7A 3I4CA 3RUDA 5K45A 1L4UA 4YA6A 1M2HA 1CBUA 4YJDA 2VH5R 4HF7A 4PONA 4TL6A 4K6HA 4O4IB 3U1TA 2M32A 2HLPA 3PWZA 5F9FA 1T6NA 4Q01A 1H23A 3ER6A 5KHOC 1PP4A 3I01M 4PC1A 2IW3A 3D1LA 3L05A 4UBJA 1KYZA 2WM9B 3GBPA 5A5FA 3AP2A 3OAAA 4NCXA 3N0TA 2O3UA 3CIFA 3OE7D 4PY2A 2V65A 3UXHA 1DINA 2D4AA 5DGHA 5F7XA 2Q8NA 2JJ1D 4PC3A 4TMKA 1P33A 4EA6A 3KXKA 3AM4A 1XZLA 1Z3IX 2V4UA 3H1FA 3BJEA 1JWLA 1FF9A 2CVQA 3DP7A 4ARZA 5C5IA 5JMWA 2MJLA 2MU1A 4BFYA 3IEIA 1UEJA 4UTZA 4RY2A 1KXJA 1HE3A 4N7BA 4O33A 1OPXA 1COWD 3DO8A 5HW0A 1LWNA 5JNLA 1IZ0A 2A7QA 3VR2A 3CRNA 3L8YA 2J1LA 1SU4A 3I9JA 2PZBA 3BD8A 4G23A 1C0PA 1UMDB 3EXIB 3H9CA 4M1OA 1Z25A 5C1IA 3BQNB 4OQFA 1OCEA 4HBGA 1U0RA 2AYZA 3EIOA 4JI6B 3T3DA 4GDMA 3MMZA 1H22A 3ZKWB 4PTZA 1MO4A 3H75A 2L69A 3ES9A 2IOHA 1MJFA 2IYTA 4FWBA 4J6FA 3KYJB 4ZI3A 5DTQA 2Y6VA 1IQUA 2AOUB 2NQTA 2Z3VA 4GVPA 4WXPA 5SYAA 3Q5EA 3W1EA 1E2EA 3L8FA 4A0GA 2A1IA 2A59A 5EESA 4CDMA 1SCIA 1TL7C 3UMGA 1DAFA 5KINB 1XU4A 1T9GS 2A2ZA 2R4UA 4TVBA 5FCDA 5I5GA 3ZHZA 2TSYB 1KI8A 3QFSA 4CV2A 5K9ZA 5KSOA 4N12A 4B3TB 2MWMA 4LGYA 4EB6B 3TLJA 3QHAA 4J0CA 4Q1EA 2XCTB 1GZ6A 1G6KA 1Q1BA 1U9ZA 4V2UA 1D4ZA 3TZCA 3KQQA 1T9DA 3Q1LA 2PRYA 2AG8A 1HEUA 3ZIUA 4KXVA 4OP2A 4EHBA 3TZKA 4ZAZA 4RZSA 4PLVA 1DE0A 3U1BA 3D8HA 3AUSA 1WMDA 4TM7A 3EZFA 5C8ZA 4UZEA 5K3OA 1EXWA 1O58A 4IZOA 4U7TB 3R3VA 3VR6A 4RZIA 1EZ4A 2RHDA 5I9MA 3TH5A 1PJ4A 1QIGA 3CUSA 7REQA 4QRHA 4JV5B 5E1BA 3Q9NA 1ORTA 5EUMA 1F4LA 1NJ6A 2N47A 1KOGA 4X93A 3L7LA 1W0KD 3DLCA 1XA0A 2JS7A 4CM6A 3KXLA 4Q3LA 5BNTA 2FFJA 2ECPA 3IQEA 3HJHA 3BTUA 5CFPA 1NGSA 2EERA 2CL5A 2VJMA 2VWGA 5LLSA 2PJZA 4M7PA 3W5JA 1LX7A 2J3JA 2WSSD 1D1PA 1ONNA 3OPQA 5TS2A 4TTAA 3RGWS 4ALMA 4CL2A 1ULUA 2ODNA 1DXQA 5BSHA 2W42A 4FINA 4KVZA 2D3TA 3IAHA 4WE3A 2QTLA 2XRZA 1QE0A 2AMFA 4YRPA 4OFBA 3UGKA 4JLDA 1NR7A 4NBSA 1Q1EA 5B7QA 4MCIA 4MX8A 3DVAB 1JG3A 4LNAA 5H4GA 3NHAA 1XD2A 3P2YA 4C30A 2O2CA 4CLRA 3C5HA 2E0IA 3HP1A 2VJAA 2OD9A 4CFZA 4QT4A 2RGWA 1SQ6A 4H3VA 5LZ4A 2WJIA 1J1IA 2GCOA 3SZMA 4RJTA 3JRNA 1EM8B 2I7XA 3C3KA 4ND5A 1BKDR 1H5QA 1LXCA 3EIHA 4IFBA 3NKFA 5ESRA 3WRXC 2N0SA 3GNQA 3IQHX 3MCUA 1TI7A 2UUOA 3KSMA 4RK1A 2ZE7A 3D9QX 3ZW8A 5ELXA 1MA3A 1QLHA 2FHSA 4IXDA 4RQBA 5K20A 5M34A 3FNFA 1ZM7A 3KJFA 4YTEA 3PBKA 2N9UA 2CXOA 2HQOA 4JBHA 1B0AA 4X20B 4EEXA 4ID9A 3R9IA 4RLHA 4IOJA 4UHDA 3TL3A 2D1SA 1LDEA 3IIJA 3M4JA 1XDWA 3FJ1A 4W5TA 4D43A 1NDHA 1SNYA 1EMDA 2ZSBA 3DOUA 3EPPA 5KREA 4CEIB 2ZT5A 1D0VA 3W5IA 1NW8A 3VDMA 1ABFA 4O63O 1TVMA 2Q3FA 3SQMA 4B82A 2D0PB 5EJMA 4BNJA 4HFMA 3FTDA 3L7NA 2A0YA 3UKDA 3TINA 4DV0B 4TM8A 3W2EA 3JVEA 4BQQA 4WLUA 1N5LA 1UDRA 3IEXA 1FXUA 3COWA 5D3ZA 3U7RA 5JXIA 4QU8A 4AS1A 3W77A 4MICA 3EUAA 2V59A 1KU0A 1FUIA 4Y2YA 3OEEA 2QSJA 3MXTA 2JJ2A 3COZA 1L9KA 5FWDA 1U2DA 1GQYA 4UTRA 1XRMA 4TROA 3STTA 1Q15A 4RSGA 4PPYA 4WUVA 3ER9A 5HWSA 1OB2A 3PHGA 3JPYA 1K3TA 2NXCA 2Z2XA 1WU8A 1RZRA 2QN6A 2LKDA 4FYPA 2A9VA 3GUCA 1QWOA 3QIVA 3ZWVA 4RPHA 4BMYA 2YWHA 1SOUA 3EMDA 3I9FA 4Y8VA 2DR2A 3MTIA 4IIVA 4P4LA 3LZDA 4PBTA 5A2QA 3TTSA 3OZVA 4HX2A 5BVHA 3UZUA 4JQSA 3SZOA 3UJ3X 5LQNA 3AL2A 2PKEA 4QTXA 2Y71A 4DR2B 4YDQA 4UTOA 4M1YA 5FBRB 3TN7A 3A05A 4GZ3A 4LECA 3KZNA 4W1SA 5A1TA 2WM3A 1M1YE 1XRQA 1PK8A 1KMIY 3FZQA 3O5AA 4CG0A 2PX3A 1NM5C 4E0BA 3AEUB 2GRAA 4F60A 2F4NA 1JQEA 3CC8A 4HLCA 1VCOA 1IHPA 5FWXA 1YC5A 1EFUA 4GZLA 2JGDB 4DIBA 2Z5LA 2ZRFA 4FR5A 4ZK2A 2G0NA 2PGDA 1N2CA 1ZVVA 1AK2A 1OR8A 1J20A 2XTJA 1CUSA 3H2IA 2CBGA 3I6ZA 5GPBA 1Z4NA 4TRJA 4XCQA 3GG9A 4GRIA 3IP1A 4FPXA 5LQUA 3OIGA 3A9SA 3ZPXA 4QJ4A 4UCXA 3WMEA 2WWHA 1AS2A 3SLRA 1BEUB 3IP9A 5CNKA 3QOXA 2Q46A 1MCZA 3WFJA 3NC4A 1F38A 1L5KA 4G1FA 1GPLA 5K8VA 3G6KA 3ZWKA 1KBOA 4JJKA 1UKCA 1CF9A 3A1VA 3LWZA 2W2LA 2RK4A 1GILA 2W2OA 3K15A 1YZVA 2QRUA 2JB9A 3I6YA 4C4AA 1ML3A 2IDMA 2X13A 2ONZA 5ERGB 3SSAA 2DEUA 2BTOA 1IZ7A 1UJBA 2V0CA 3QF4B 4YEDA 3GJQA 4M9RA 4I3GA 4GFDA 4JCOA 4MULA 3HY3A 4ZAYA 3BJZA 2OOKA 4H1UA 5EMKA 5ESWA 4E5MA 2YJ3A 5E4FA 5JANA 4ZI7B 5JNUA 1SBQA 2FWBA 2X4LA 5HF6A 1QORA 5IASA 2HWWA 3IOBA 2XYRA 3JXEA 2FZ5A 4Z9AA 4ARIA 5JG7A 3G85A 2LCIA 1X1QA 1HI9A 2QNIA 4P4TA 2XNCA 3PC8A 3ED5A 5EHIA 4WLVA 4HLUA 3T95A 3QA3E 5BVGA