4MR7B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist cgp54626
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
415
structure length
403
Chain Sequence
b'SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 142
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B01
3H5LA 4MS3A 5IC5A 2A9PA 2GX6A 2JRLA 1ZH2A 1ZESA 3KYJB 3DLBA 3I42A 4Z4CA 4MRMA 3OM1A 2MSWA 4QYMA 3IP6A 4RV5A 4S05A 1PNTA 2FEPA 3GA5A 2RJOA 3T6KA 1XHFA 3JY6A 4KRFA 2CHFA 1W25A 1ZGGA 3CRNA 1YS6A 4EVRA 1DC8A 5TPZD 3OLXA 1VKRA 2AYZA 1B00A 2R48A 3OM0A 4JAVC 1YK1A 3BREA 1FFSA 2PKXA 3H1EA 2YHBA 4WXMA 5TQJA 1KRXA 2HQBA 4HNQA 1RZRA 4MYRA 3HV2A 4WZZA 3QLVA 4G0OA 4RK1A 2HJ9A 1RXEA 4NCAA 2ZAYA 2ZWMA 3MF4A 3M6MD 4Z99A 3RH0A 3HEBA 4UHKA 3CG0A 2QW1A 3OQNA 2IKSA 4MS3B 1XWWA 5JNRA 5BRJA 2GBPA 3B2NA 1QP4A 3RVLA 1JYEA 3NBMA 3TMYA 1DCMA 1EHCA 2B4AA 3HDVA 2IDMA 7ABPA 1JX6A 2M98A 5JNSA 3N0WA 3QEMA 4MLCA 4O1HA 1ZGZA 2WB4A 3LOPA 1A2OA 3HDGA 4NV3A 1D2AA 3M9WA 3H5WA 4RWEA 4N47A 5TQ0B 1SRRA 4MGEA 5CNJA 5CNIA 4H60A 3F6CA 4IGAA 6ABPA 3QELB 2HQRA 3H1FA 1NXTA 4YR7A 5JS1A 4QYWA 1JYFA 5EWJA 2FMKA 3I09A 1JFVA 5BQ3A 3VNBA 4Q6BA 2CHEA 3OO1A 1GUDA 4RK6A 4HYEA 3G85A 2E4YA 4G0QA 1NXOA 2PAFA 1QO0D 3RVKA 2QV0A 4RXUA 3N6VA 3QX8A 2JBAA 2PL1A 4RU1A 5I4CA 2FEKA 1MIHA 2IOYA 3SY8A 3UK0A 3QLVC 2IPLA 3LTEA 5EWMB 3HSYA 3MA0A 3G1WA 2FTKE 2QVGA 1ZY2A 2V0NA 1NXXA 2FLWA 4EGSA 4M88A 5CNMA 1Z2EA 2JVKA 3KHTA 4EVSA 1ABEA 5IUNC 3N8IA 1JHZA 4GPAA 3HCWA 3KYIB 2QR3A 4YRZA 3O1JC 2JVJA 4O5AA 1YS7A 2GI4A 5KC8A 2PUDA 2E4ZA 2JB9A 4YCSA 2MYTA 1VPWA 3GRCA 3W9SA 1QQBA 4MQEA 5F64A 5EWJB 3I5AA 4XASA 1RXIA 5FWYA 2H0AA 4RK5A 3LKBA 1E6MA 1NXPA 4B09A 3H6HA 2TMYA 4YGXB 5C5EA 3CHYA 4TLLB 1PNRA 3CTPA 4ZMRA 2FQWA 4G0PA 1D1PA 3URMA 1SXGA 4Z4FA 2JBAB 2P4UA 1L5ZA 2VUHB 3LUHA 3FFTA 1BA2A 1DRJA 2IYNA 9ABPA 1Z2DA 3N0XA 2HQOA 1RZRD 3SM9A 2E4VA 5KWSA 1DZ3A 2RDMA 4IMJB 4W5RA 3F73A 1CEYA 1W9HA 4G0ZA 3SQNA 4KQCA 4WWHA 5GQSA 3EQ2A 1A0OA 1KGSA 1SD5A 2FN8A 3C3KA 3GBPA 3HJFA 3SNKA 2OENG 3VNAA 2HSGA 3EQZA 3OLYA 1PUXA 3F7NA 2YHAA 3O74A 4WT7A 1BDJA 4PZ0A 4RK7A 3RVPA 3HK2A 4MQEB 1P2FA 3ILHA 3O2QB 1J56A 1DP4A 3CG4A 4F12A 2FKAA 1YTUA 1QKKA 1USKA 1Z16A 1A04A 3OLWA 3FFWA 3O21A 3CFYA 5KC9A 4EUKA 2B1JA 1CHNA 4PE5B 4D6XA 4RS3A 3A0UA 3HS3A 2JVIA 4Z0NA 4FE4A 1ZVVA 1UDRA 3SG0A 3CKMA 1Z26A 3H5TA 3QLTA 4XAQA 3CZCA 3GYBA 1YK0A 3Q7RA 4Q7EA 4QICA 1AB5A 5JNVA 5T7BA 4IMIB 2FEWB 3MM4A 4JASB 1ZDMA 4F8JA 5IUJC 2NZVG 2JCGA 4G0XA 3A3KA 2ID9A 5IX8A 3LUAA 2P9HA 3QX9A 5TQ2A 2PUEA 4H3HB 3H5VA 3NHZA 3LUJA 1DJMA 2E4XA 2FXIA 1Z12A 1DCKA 1NTRA 4XXHA 3OQOA 1JDNA 4NCBA 2RGYA 1Z13A 3IP9A 3BRQA 3OMWA 4NICA 2NUBA 5T3YA 1DC7A 3L49A 2R47A 4XARA 2QZJA 1EWVA 2WJAA 5DGCA 2FVYA 4IILA 4Z9AA 4S04A 4KPYA 4Z4IA 3NNDA 1CYEA 4TLMB 5C5CA 1LBHA 4LE0A 1QP0A 2FLKA 3EAFA 1D1QA 1GCGA 2X7XA 4DQDA 2GWRA 2LIVA 1EWKA 1JFSA 5DLEA 5IEBA 4O1IA 4CBVA 1LJLA 3DBIA 2PE5A 1T34A 5KQPA 4MRMB 1EWTA 2FSPA 2R25B 1TMYA 4KNYA 5B3JA 3OLVA 1JWLA 5TQ2B 2F8SA 2FQYA 2H3HA 4E7PA 4L85A 1YMUA 4JOQA 1D5WA 3BILA 1YIOA 1GCAA 4L4UA 3GL9A 3MIZA 4KZKA 5FWXA 1NXVA 3FMVA 4LDAA 4PICA 4OLAA 1E6KA 3JS5A 5IEJA 4RK0A 4TN5A 1AB6A 3CU5A 3JPYA 4KQ9A 5E3JA 5FBHA 4G86A 4G97A 2QXYA 1BDIA 3IPAA 3K4HA 1P6QA 3CLKA 1DBPA 3JTEA 1JH9A 1DG9A 4ETMA 1JLKA 2L18A 4YS6A 1JFTA 2CD7A 5D2CA 1MB0A 3RVJA 3QLUA 3LUKA 2PUCA 4DN6A 4ZYLA 2LPMA 4OBBA 2I6FA 2MYPA 1PHRA 5FBKA 3T38A 2FMFA 3ROFA 2QSJA 5JNUA 3OMXA 3E3MA 3QEMB 3KTOA 4MR9A 1I3CA 1SXHA 3N75A 1U8TA 4P1ZA 3HVRA 1GUBA 1S8NA 5FWXB 5ED4A 2FMHA 3HXMA 4EYKA 1TM2A 4KMRA 1IIBA 1D4ZA 3O1IC 2FMIA 3EODA 3HUUA 5B3JC 4RKRA 5KQLA 1QPZA 5BRAA 4Z4GA 1QQAA 4KFCA 4YWHA 1NATA 4KK3A 1XHEA 1TLFA 3GBVA 4MS1A 3CS3A 1DBWA 3HUTA 4MPTA 4N0QA 1LK0A 2VUIB 1OXBB 1MAVA 1QP7A 4H3KB 1BVHA 5KQGA 1E6LA 3SAJA 5DKFA 2BGGA 4RY0A 1BAPA 3QK7A 2L2QA 2FW0A 2LP4Y 4W5OA 1MVOA 3IP5A 4Z4HA 3F6PA 4RZSA 4MR9B 2W42A 3M9XA 1LBIA 1M2FA 3MYYA 2E4UA 2JK1A 1R8JA 1YMVA 1Z18A 2M1ZA 1NXSA 4YLEA 5BR1A 1ZN2A 4JA2A 3C97A 3EGCA 3QLUC 4ETIA 1PEYA 1KMIY 4XFKA 2MSKA 3Q7SA 4GNRA 4MQFA 3A10A 1M5TA 3EDCA 4OTZA 3GWGA 1Z25A 1ZAYA 4JB0A 3HO1A 2PJUA 5FWYB 4RDCA 3OQMA 5JS2A 4MR8A 4MS1B 1WETA 3O2JA 4Z4EA 4UHJA 4MS4A 4EVQA 5IUKC 2NT3A 2A9QA 3N0RA 3RVRA 3T95A 1JL3A 1ZHHA 4F11A 4YO7A 3I45A 5ABPA 3KLOA 4QPJC 4XLTA 4OATA 3H1GA 1FQWA 1GLGA 3NHMA 3CNBA 3O75A 1M2EA 4P98A 1ZH4A 5HKOA 2E4WA 3DGFC 1FFWA 3N53A 3JVDA 3H75A 1ISSA 1EAYA 3H6GA 3T8YA 4KREA 4ETNA 3KCNA 1DCFA 1NXWA 4MQFB 4RY8A 3JVIA 5KI6A 3IPCA 3C3MA 1ZITA 2XDYA 4LRQA 2PL9A 4LDZA 5IULC 1P6UA 4MR8B 4EYQA 1FFGA 2O20A 3EULA 3Q9SA 4N41A 2KYRA 1QMPA 2NT4A 4MS4B 4PYRA 2PMCA 3H5IA 3UKJA 2OQRA 4W5NA 1FSPA 3RVOA 5TQ0A 1U04A 2IPAB 3TD9A 1M5UA 4Y9TA 4YV7A 1U0SY 4HNRA 4LX8A 3RQIA 2PUFA 3QELA 4OG2A 3Q15C 3LUGA 3Q41A 4FB4A 3DGEC 3NNSA 1NY5A 2VK2A 1RNLA 2FN9A 4OLBA 2L19A 1C4WA 3BBLA 5HSGA 4KVFA 3LFTA 4N03A 3ROTA 1K66A 4ML3A 3RVMA 2VYCA 2RJNA 1ABFA 3R0JA 3P9YA 3DLHA 3KS9A 2PLNA 2J48A 2IPNA 2ID7A 5EWLA 1JDPA 2HPHA 4LE2A 4NQRA 3LUDA 3HM9A 5EWMA 4EYOA 4HNSA 1Y1LA 3GV0A 3UUGA 1KRWA 3D8UA 3H5OA 4IRXA 8ABPA 5DTEA 1BDHA 1USIA 4WXEA 4FE7A 5IBQA 1F4VA 4D74A 4ZMSA 1DRKA 3IDOA 5GOTA 1QNLA 2PUGA 2F8TA 1YVUA 2IPMA 5JNWA 4RK4A 2WWVD 3K9CA 4YP9A 4DADA 2A9OA 3KKEA 2FQXA 3TO5A 3E61A 3RVSA 1P8AA 3FFXA 4MAAA 3TX6A 3ILYA 5KQMA 1MB3A 5TPZA 4F06A 3OO0A 3OLZA 3JPWA 1H9CA 4G0MA 4KK4A 5EWLB 2L17A 1U2PA 1VRVA 3MQ4A 4ZPJA 4KV7A 5HQJA 3LUCA 2WY2D 2WMYA 2WRZA 3LUFA 4JB2A 4N76A 1VLZA 3DZDA 4Z9BA 4WUTA 1K68A 1USGA 1LJUA 4N0PA 1EFAA 4MLDA 2N9UA 1SXIA 5HM6A 2MSLA 3KSMA 2PUBA 5JNTA 1JBEA 4D6YA 3GT7A 3C3WA 1F51E 2MYUA 3RVQA 4E7OA 1PEAA 5TE9A 3QEKA 3KLNA 1ISRA 4JP1A 1Z17A 1OXKB 4G0YA 4MR7A 2QVCA 4RKQA 4TMYA 3MMNA 4PEVA 2GKGA 3BRSA 3KJXA 3D02A 3LKVA 2MYNA 3NNNA 4ZJPA 5TPWA 5CHYA 3HZHA 3CZ5A 5DCLA 1E2BA 4W5TA 3O2SB 5PNTA 1L5YA 1U2QA 3O1HB 4RXTA 2A9RA 1JF8A 1DBQA 1C0EA 1TJYA 2QU7A 3A0RB 3FGZA 2WJWA 2Q5CA 4W5QA 2CWDA 3IP7A 4RXMA 1HEYA 3Q7TA 1QO0A 2AYXA 3C6QA 3FDFA 3LMKA 4RY9A 1APBA 6CHYA 4EY3A 2PUAA 2DRIA 1Z15A 1URPA 2R4QA 2LUOA 3KG2A 4MR7B 4LZLA 4Q6WA 1TVMA 3S99A 2LBPA 4EYGA 4RSMA 4LE1A 3TB6A 2NZUG 4F3TA 4IF4A 5TPWB 1RPJA 3RVNA 3EJWA 3L6UA 5CNKA
chains in the Genus database with same CATH superfamily
3HZZA 5A4DA 1C7IA 3MB5A 4Q1BA 4YP6A 5KYKA 2G76A 1TIKA 5I51A 5I4KA 1ZH2A 2AQIA 3DLCA 1JS1X 1ZA2A 4JR1A 4DKXA 3L1IA 4BJHB 3OZXA 4ETMA 3IP6A 3W9YA 3AG5A 1T1JA 4M7WA 3LHDA 1T5LA 4YUXA 4RZXA 1JG4A 1UWCA 2X42A 3SQLA 4XYLA 4C7OA 3W7VA 4W63A 1O8BA 1DC8A 2PSFA 4R4JA 4K9PA 2Z5VA 2ZB8A 1WF3A 2QORA 3OM0A 1ZCZA 1CQWA 3H1EA 4FQ5A 4MEJA 4MV1A 1DS6A 1EGQA 3CUEF 3IT1A 4PLVA 1RZRA 1BWSA 2D1YA 2QI9C 3ZGXA 7AT1A 2GJ9A 5K01A 1WTCA 2WHEA 1RZVA 5TMEA 1TZMA 4P84A 2AQHA 2BVNA 4R8MA 1GHTA 2OZPA 4CTKA 3VTAA 1KK3A 1MGPA 1CKEA 1J90A 2JGLA 2VZLA 1XKTA 5FWAA 3FTDA 4V38A 4CYMA 4AMBA 1RC1A 5JVDF 2IS2A 2YOFA 1VSVA 1CZHA 2V97A 2ZRFA 3ZBQA 4J49A 1YQWA 2JC3A 1WV0A 3OX4A 3KWFA 3IAAA 3T3DA 1QP4A 5BP7A 3D54D 2OTCA 4YK7A 3DEIA 4DZTA 3N0WA 5GONF 3T4XA 3HVIA 3SR3A 1SUBA 1ZGZA 3MHTA 1GLNA 1A2OA 1JG2A 2C98A 1D2AA 3DQPA 4Q15A 4N47A 2Z1DA 1P4GA 5C7YA 1T4CA 2DPLA 1VA4A 3WB1A 3ED1A 4IGAA 3SJCA 3QELB 2NUPB 4BMZA 3GLVA 3F78A 3R5XA 5AYVA 1W8IA 1R6BX 4W99A 4YR7A 3DMFA 2YWDA 3TZKA 3RBZA 3QSGA 1JXMA 4FGLA 4C4XA 1YV9A 1MFPA 3HFGA 2JGIA 3GLFE 2HMUA 2B2XA 1MU0A 1OIVA 2HCJB 2QTAA 4I08A 3G85A 5ERYA 3PJFA 2FZ4A 1OROA 2O8NA 1T8TA 2Z9CA 3HJNA 3KEOA 5ALKA 2HYDA 1WQ3A 2PAFA 2AXPA 4L7QA 4MJ3A 3FWZA 1V43A 5ELXA 3RYHB 3G2QA 3KQQA 5BT9A 5F2NA 4BFXA 3MBOA 4M0UA 3SZMA 3V4ZA 1VBMA 1OIXA 1A7AA 1NRJB 3HSYA 4I36A 2FTKE 2HPVA 4K6OA 2RGDA 1FZTA 1SUDA 1FTSA 2RONA 1LDYA 1G3QA 4RTLA 3NOQA 2I0FA 2JLRA 2P6RA 1W0CA 1ABEA 1KY2A 2HU2A 2OGSA 1GZ7A 3P19A 1WHTA 2FPOA 1RVV1 1XD8A 1OZFA 3PV0A 2BSQA 3RRBA 2B6HA 2Q3EA 3L7BA 3QOWA 4JBGA 2Y6VA 2YIDA 1Z4IA 4EH1A 3REQB 1UJNA 4MAFA 1XWIA 3I5AA 5B2ZA 3SJZA 1GFIA 3HN6A 3DD5A 4P7KA 1ADBA 4RYLA 5LB2A 3LVQE 4K1XA 1EGMB 4R2HA 4DR7B 4XM0A 4MMZB 3IAUA 4MA5A 1OV4A 1IBKB 1N2CA 1NRWA 1UC8A 1XTQA 4Y2PA 2EXXA 3RT9A 1BMFD 1DFIA 2M6SA 1RLIA 2NSJA 2O0JA 2WJIA 3BTOA 3HYTA 3NYRA 3ZWOA 4CR6A 2AFHB 1SXGA 2P4UA 3LUHA 3RIMA 1KU6A 3EPPA 4DB4A 3P9QA 3UPTA 1ECGA 2XVMA 3KU1A 4M54A 3PE3A 4QU5A 1NNSA 5E6SA 1RAIA 3KSDO 3OD5A 3M5CA 4UU1A 2FSHA 4CWAA 2FQ1A 3TEFA 1W5AA 1VKNA 5IEJA 4LYEA 1F1BA 5C3MA 2HRDA 1KXJA 1T9ZA 4H1VA 3RU7A 5HVNA 5KX5F 4ZGWA 3W5DA 3CZPA 5EE9A 4E11A 5I9LA 3PEFA 5G40A 1JQJC 2Z95A 3G23A 1Z08A 2XMCA 3L6BA 3ZWXA 3LZCA 2Q07A 3FE2A 3FPJA 3K1TA 3MMSA 1ATIA 4R1SA 2Y1WA 3K6JA 5CAEA 3F5DA 2DWUA 3TQSA 3P26A 3TD2A 3O21A 3IV6A 4G1MB 4L9RA 1TUEA 5CYPA 5IABA 2QWXA 1CQIA 1A9ZA 4RS3A 1NP7A 3SLRA 3SBEA 4YT2A 3F5FA 4LJ4A 1D2HA 2GPWA 3K05A 4PTZA 5ER9A 4HI0E 1R0SA 4Q7MB 5CXXA 4KPFC 4ETWA 2N1BA 3GYBA 1JW9B 4I55B 1VCHA 3SXPA 2O2YA 3LWZA 3IL2A 4D5GA 3LE8A 3IOMA 2FYTA 5E4YA 1CP2A 4DCNA 4I9UA 4P0TA 3MEQA 4AU1A 4E2YA 2DLNA 4G0XA 2GGSA 3CT4A 3T9AA 4D8UA 1P75A 5BV0A 3K35A 4X3CA 1BSVA 3KDPA 4DB2A 3PNOA 1KEEB 3GJZA 5A3VA 1Z12A 3AEZA 5EHIA 5KQRA 1HZZC 8MHTA 1YL7A 4GM1A 4KX5A 4DKJA 3CCCA 3QZUA 5DLQC 3OQOA 2AI3A 1MO5A 2PRYA 4EEZA 4ZPXA 4C7MA 1Y5MA 3RWBA 2FW9A 1WUJS 4N18A 4QTXA 2CZGA 5B7QA 1P1JA 4NICA 4PQEA 3ELWA 4CM7A 1KS2A 1YZQA 1DAGA 1JJFA 1M2VB 1JFRA 4PHHA 3ENQA 3KWLA 2BCGY 3C6YA 4C2AA 1QP0A 3CSSA 2IWRA 2ZQYA 4E33A 3EXEB 1E62A 2FSVC 4UQOA 4RPLA 3RYTC 5JSUA 2ZJFA 1YONA 2QXUA 1T34A 4V0RA 1ND6A 5BN5A 3RUPA 4H7JA 1I4EB 1LKZA 4AKHA 4JSRA 1KP2A 3OLVA 1JR4A 3ZQ6A 2GJKA 1ZGHA 3CO0S 3NONA 2XB6A 2YV2A 4D9GA 4ARZB 1UKYA 3F4BA 1H8HA 1OGJA 4KQHA 1OIWA 1WVMA 4BEWA 1J33A 3PDIA 5B3AA 1IB6A 2XYVA 2PEZA 4O2AB 2J07A 1U9JA 2IEAA 3UHOA 1H4QA 4P6VF 3BH7A 1CZRA 1MT0A 4F2DA 2X7JA 1DG3A 4P4SA 2QRVB 4FYHA 3OC0A 4KQ9A 2F4NA 3V8RA 3IPAA 1Z5WA 3JTEA 1WAMA 4CMCA 4YUWA 1EVKA 3QE9Y 1EBBA 5D86A 1EMDA 1NN3A 1GRRA 3LPAA 4WJKB 2PJRA 2BMEA 3PJRA 2JHCA 1CUZA 4UAUA 2CUTA 2NSDA 5DGTA 1NLMA 1ZD5A 4IR7A 1I2DA 4F91B 4MDEA 5ESXA 4O4IF 5DBHX 5DV9A 1MQ8B 2JRCA 4QJIA 1CQPA 1U9ZA 1XWFA 4AURA 4BE7B 5ALVA 4KN8A 1I3CA 5IHXA 3AI3A 3PQ4A 1BWQA 1B1AA 4EHHA 4NXNB 1J2EA 1YCDA 2DM6A 3IIEA 3N6XA 5AO9A 4I5FA 1FRQA 4G25A 3DZBA 4Z9XA 4L76A 1GUBA 3H9EO 1Z6YA 4EG3A 4JLJA 1J2RA 3F4KA 3ZV7A 2YJTD 4JVNA 2WJ3A 2HADA 4JEMA 5K8JB 5TSDA 3K0EA 3D7NA 3NGXA 1E6CA 4Z3KA 2QNIA 4CKBA 1U90A 1FSZA 2XMSA 4YAWA 1QPZA 4EATA 1YA4A 2P6PA 3TQIA 1BS9A 1HDIA 2QLJA 3GAAA 1LK5A 3B1KA 3OWXA 5DE3A 2FXVA 2OG2A 5DLDA 1RJEA 3E4DA 4BMNA 1FTYA 4R71A 1E1NA 2ZVJA 3IQGX 4JR2A 3PZBA 4Y9RA 2JFZA 2IBSA 1BWRA 4IVRA 4Q3BA 4GKJB 2EJTA 3B3QA 2J45A 4JBLA 3G6WA 2G40A 3M6UA 2OAQ1 2JIZA 2VSOA 3Q5GA 4G5XA 4J0QA 4HAWA 4KXNA 4F85A 1LVUA 4BEVA 2ATXA 4Z4HA 1AXRA 4M0PA 4PLCA 4ER3A 1Z74A 1H2BA 1O54A 1PGQA 1H2HA 1LBIA 1U1DA 3WLLA 3WWDA 4FZRA 3KXPA 3TX2A 4TPKA 1CY2A 3W0LB 1M2FA 1T6BY 3O4RA 1IC6A 3QU5A 4BNTA 3I52A 1RWQA 2G63A 1RRFA 1Y4SA 1ZN2A 1Q2UA 2PK3A 5JV5A 1JRLA 4JB3A 1KMIY 3AETA 1U0TA 2ZATA 3NOVA 4LNUA 2UZ0A 2CHQA 4XIFA 2XF2A 5ERGB 1M5TA 3LF1A 2UXDB 3K5IA 5DM1A 4D9FA 4E4RA 3I64A 5JCJA 2H4YA 4R1UA 4RGVA 1OLSA 1GKKA 2GQ0A 2PJUA 2I29A 4HLNA 1YC2A 1KEPA 1PGNA 1T9GR 2AKYA 2RG7A 3DR3A 5LZ7A 4MS1B 5E3IA 1E0DA 3NORA 3PGLA 3GD7A 2C97A 2GN4A 3N2NA 3ILVA 1MB4A 1CUXA 1OXMA 4TL7A 4DR3B 3N76A 4J3NA 3T1NA 1BCSB 1E3WB 1Z56C 2UZIR 2ZR0A 3MTBA 1E59A 4QPJC 3DG9A 4P3XA 4AJNA 1XE3A 2XQJA 1KMQA 1SC6A 1YL5A 1M1YA 4GX1A 3RS5A 3MFYA 4QDUA 3UJ9A 3VR4A 3BWBA 2UYQA 2MHCA 2CDAA 3CIFA 2VP2A 4M9CA 5SYAA 1TRHA 2CZCA 2GVDC 1XTRA 1PX2A 2EL9A 1OQAA 3QJGA 3HWRA 4FQ8A 3JVDA 3ITEA 3VU0A 1NRIA 1HE5A 3H75A 1O0CA 3D64A 5IJAA 1MO3A 5AKIA 4ARBA 2PYDA 3GVIA 5KVAA 3CN9A 4A8JC 1AHNA 1TMOA 5F4ZA 3F5QA 2PT7A 2ZDGA 1H9AA 3PQ3A 4EQ6A 2R3SA 4AXBA 3T9FA 3JQPA 5B58C 2WSBA 1PR5A 3DBHA 1C1XA 4J03A 4KBFA 1SCBA 4FFRA 3DZHA 4GM4A 1YR3A 1W4ZA 4N41A 1UXHA 2QM8A 2Z0MA 3HGQA 3ILSA 13PKA 2QK4A 4P22A 2V3CC 1SPXA 5CVUA 4UULA 3N6RA 4GFDA 4GRIA 3PICA 4S0ZA 4UTZA 3R7NA 2JJ1A 3TTWA 2FG6C 1UJMA 3LO8A 4C20A 1I1OA 4YO8A 5LSAA 1UIRA 3Q41A 3OPYI 3OUUA 5EXXA 5KOIA 3PEUA 1LXCA 2G36A 2XGGA 1MDFA 5BN1A 3NHBA 4QXRA 2IV2X 3RK0A 2L19A 3Q9LA 3QKSA 1K66A 4BUJA 5EUCA 5JYCA 1BWPA 1KSFX 1EFDN 4MI3A 4JI2B 5CXQA 2ZM5A 4RSGA 2J48A 2CVQA 4TRNA 2ID7A 1KAMA 4Y9UA 4WDQA 2ZK7A 2HPHA 2OA0A 3E7FA 2ZIZA 1KJYA 3TINA 3KHSA 2O8BB 3P0EA 2P11A 1QG6A 1GGMA 1WB6A 2Q3FA 3R5SA 2FCRA 1VG1A 3PC2A 3LZDA 3RYIA 1GQFA 1O94C 1PJSA 2CFRA 2WWRA 3H3FA 3L1HA 3JYPA 1XSEA 4S12A 2K2QB 3TUIC 3CZ4A 4X90A 4XYEA 3CINA 3I9V1 2GBIA 3ICOA 1T5IA 4WXEA 4BP9A 3JZDA 5ENZA 2FR0A 1VSTA 5DB4A 4ZMSA 3VYVA 3FOFC 1E69A 4W4TA 4M2LA 3FPCA 5GOTA 4RHCA 1L5HA 1G4AE 4MVWA 1ZH8A 4WZBE 2WWVD 3N8DA 5TRTA 3ROQA 4LJ9A 4HH3C 5A0FA 4C4OA 3FFXA 4X7RA 3ZTWA 1ZGJA 3EZNA 3I1YA 3T0GA 3GRKA 3TMAA 3KQKA 1UOQA 2PS9A 1XC7A 1DOZA 2LZ0A 3CW8X 1I6KA 5GWXA 3GARA 4KK4A 3L40A 3U3MA 1Q7TA 2WT8A 2K7FA 5KAMA 2DECA 1RJ9B 5LQNA 1OVMA 3OEHA 2GLUA 3GPBA 2Z83A 4PNPA 2COUA 4TQAA 4U2BA 5GZ6A 5J4VA 3R9WA 4Q7JB 5TF0A 1YDMA 4DJDC 1SUSA 4F7DA 3OH8A 1EFAA 3JVVA 2BTQB 1W52X 2DPMA 4ZCQA 3PB3A 4LOHA 4ITUA 4BFTA 1C81A 2BKLA 3Q2OA 2C2BA 1J21A 1F3LA 1F48A 2ZWOA 3GT7A 1Q0ZA 2AEMA 2IYSA 3EFEA 3U80A 1F51E 1F6DA 2XYGA 1OBVA 4MUGA 5EJGA 4ZARA 3LDAA 2X5XA 4ALMA 5KNDD 1I1QB 5IBRA 1JDTA 4JP1A 3MELA 2R6GA 3BPSA 3I6IA 4K5QA 3OX3A 4MR7A 4Y98A 1LI7A 1RP7A 3MMNA 4QU9A 2ZTHA 1DWUA 1PK8A 1ZIDA 3SN6A 3L4EA 2MYNA 1VIVA 4YDSA 1LPPA 2GM9A 3VHXA 5CHYA 5CA1B 1TGVA 5FT9A 3WIUA 1W35A 4QTYA 2N3ZA 3FHJA 5PNTA 3ENNA 3L6DA 5A2GA 3IKLA 3VR6D 1RI5A 1XZIA 3G9TA 4GR5A 3AF6A 4MJLA 2EATA 2X19A 3L5OA 2XGSA 5H0IA 1JHUA 1SCKA 3EF3A 3S2UA 4GECA 4DJ5X 3E9MA 4G5YA 5A5GA 2YCLA 1DRWA 3X43A 1UJ6A 1HFWA 5A7HA 1W46A 1EHYA 2QU8A 4GUAA 2PUAA 1FL9A 4R31A 1NI4A 2IUFA 1G7CA 1GNLA 3PF9A 3R2JA 3BA1A 4EFNA 1B3RA 1U2GA 5JR3A 1L6RA 3PWSA 4HPJB 4N3AA 1JWAB 2O7NA 5F4BA 3VX4A 4C89A 2VTBA 4PIPA 3EQ6A 3FGOA 1MJNA 4GX2A 2AQKA 2O1EA 4DLWA 4HN9A 5JG7A 2BGLA 5CFLA 1YRHA 3HLYA 4MQ6A 4KUEA 4WCDA 3DLBA 1JG6A 2R7NA 1PT9A 3GMTA 3NWPA 4HDNA 4FLEA 4U5QA 5H02A 3GP8A 4DNXA 3ST7A 2Z5LA 1GZHB 4HDKB 4AY4A 5IZCA 2A9FA 4FD3A 5FX2A 3GELA 4DPKA 5H3LA 2EFEB 3CLTC 5I7RA 2FV8A 4QTZA 1MAUA 2R8RA 3ZX5A 1Q0SA 3R7DA 3O4JA 2IUUA 1VKRA 4Y0VA 5AM4A 3OU6A 3TAXA 3TVDA 2HQBA 3DVAB 4QJ3A 5DSXA 2ZRDA 2XYRA 4XE5A 1A4UA 4LGMA 4DL9A 1M1NA 5FR2A 3INTA 2ZREA 3DWIA 3MJVA 4AZ0B 2YHSA 4QHSA 1ZX1A 1RXEA 2B5VA 2CJPA 1QHHA 4G1CA 1ICIA 5G2OA 3ND9A 3RHZA 2XKKA 1OD6A 4UHKA 3OWOA 2OHIA 1PWEA 3PCXA 4FCCA 5T8KC 1N1EA 2AXNA 5HRUA 1YC5A 3SOPA 3TRDA 4HP8A 4TWZA 3KB1A 2D8AA 1R6VA 3UVEA 1LCIA 3A1NA 1TM1E 4EA7A 5JNSA 2PXHA 3QF7A 2G80A 4PC3A 4BBJA 2POCA 1VPDA 2D1SA 1IG3A 3A9WA 4ZV9A 3UJDA 1RQ2A 4DF3A 2EP7A 4KWTA 4YCAA 1GPDG 4JJKA 4ZODA 1SMKA 2ZS7A 1EUQA 4W7SA 3DYIA 1TYDE 4YJKA 3ER8A 1ACMA 4YASA 5HIMA 5JS1A 2O0LA 2MOKA 2C9OA 1A69A 2LDXA 4R9RA 1TK9A 3TH5A 2FMKA 1FTGA 1I0IA 3ROEA 5BSFA 1ZM4A 4CF3A 1UIMA 4M7OA 1S2MA 3TQRA 5AVTA 1L4EA 4AX8A 1NVDA 4TZKA 2EW2A 2V9PA 2JBHA 2YH2A 3B3JA 4OKIA 2J9FA 5FEMA 1JQDA 1Z0AA 5GPBA 1NVWQ 5INTA 1D2NA 2ZB7A 4GW3A 4KGXA 3DOOA 1KKLA 2WYIA 1OWLA 1M10A 5DWVA 4PC2A 2PMEA 2EF0A 2B36A 3O8QB 4YJGB 4DCVA 5I4CA 1P80A 3VH1A 4YJDA 1BN6A 1TW2A 1IM8A 3G1WA 1O87A 4X20A 3SX0A 4OX9Y 4UM9B 2VHCA 1NXXA 1X70A 4B34A 2C07A 2HBZA 5E0KB 2FEAA 1AMNA 1R5NA 2HYIC 3SHWA 3AY7A 3NALA 3PFFA 1OLUB 4R8RA 3KYIB 3BFJA 3DBVO 4G5RA 4HNHA 3G9ZA 5IK2A 3OEEA 4YRAA 4LRXA 4H18A 4OOFA 3C8MA 3GRCA 4MW6A 4CCYB 1I14A 3DMRA 3UMYA 4GGMX 4H4CA 2Z6UA 3BMQA 2G25A 1WCYA 4CIAA 4OMUA 2BGUA 1PK9A 1F06A 2WJVA 4XASA 3GLFB 4N8DA 3E22A 4WN3A 3TSAA 3D2AA 3ZJ4A 4G4IA 1XZHA 4KJZA 3ZBTA 4PFJA 4A91A 4ZVMA 3KV1A 4H3SA 1A4RA 2X0RA 3ASZA 3ZH2A 1MHTA 1PN3A 5J1TB 3LQRA 1L5ZA 4D0RA 2GSWA 4XDZA 3OCUA 4DWVA 3AESA 1W88B 2PZ8A 4XCXA 3HY4A 4LGVA 2EZ9A 4BMYA 4ADSG 1C7FA 4XGRA 3OQPA 3BBPA 4IFTA 3C5CA 1GUFA 2JGMA 3VU9A 5HGXA 1IAVA 3H86A 3THYA 1Q7RA 1P8JA 3P0IA 1ODIA 5F23A 3EGXB 2RFLA 2HK9A 4DC1A 4C5AA 3AUJB 3F7OA 5B64A 4HLQB 4WLEA 2ODBA 3H2SA 5JYBA 1F9AA 4D02A 4ERXA 4RMHA 2J5RA 1IXYA 1KZ4A 5I7HA 3ZY3A 4B8YA 3HCEA 5CG1A 3IEXA 5M7EA 1ZIOA 2BJWA 3LQQA 4NARA 4N3GA 3JWIA 4KPGA 1SVKA 2VA9A 1B23P 4KWIA 2J09A 4Y2TA 3ZI4A 3H5TA 3AG6A 4KE7A 1SZJG 1DIRA 4QOJA 2IY9A 3R1IA 4RQBA 1JHDA 4FDAA 2PL3A 3CZCA 4DNFA 4GH5A 2VBCA 1AB5A 4JASB 3U7QB 1ZOSA 1O9BA 5A9SB 2O23A 2W2QA 4L5IA 2X41A 1CJBA 3U1BA 4LHXA 4FOPA 3T1HB 4B31A 1OWOA 3IR5A 2H1LA 3JCZA 4XJXA 3FI9A 4BECA 4LRYA 1Q77A 2EQBA 3K9QO 1RTTA 4GC5A 4WECA 3PEWA 1QPBA 3AI2A 2I3ZA 1WABA 5E2AA 2QTMA 1IDOA 2QTTA 3I9FA 3AM3A 5TNXA 2AOTA 4FMCF 3D0KA 1LVHA 3MG9A 4O4LA 1D1SA 1JPVA 3CE9A 4P2BA 4X84A 1OILA 2PNFA 3GRUA 1VCMA 1AQUA 3WZMA 1M72A 3KNZA 4DQLA 2WJAA 3MWLA 4YBRA 1E9RA 3IAFA 1U2TA 5CH5A 1U7DA 3EAQA 1C1DB 4UM7A 5LDGA 5SZJA 4U8GA 1ECFA 4DZZA 2GBGA 3G1TA 3Q3VA 2OEPA 2YMLA 1KWGA 3BL5A 1Y1KE 3RUEA 3SIWA 4BNWA 2F8LA 1NG9A 2X76A 4YAGA 1COWD 1KMMA 2SCUB 4J0JA 1TYCA 1T5TA 3HWWA 4ACAA 4AMUA 4JLPA 4NC9A 3AK4A 4EPRA 2DQSA 2V03A 3EXHB 2D4AA 3VPGA 2IHUA 1EWYA 2A57A 2HWWA 3P71T 3HDJA 1YZNA 4UHCA 5BYJA 1T0BA 3OTQA 4B1FA 5IM4A 1QF6A 1G1MA 2B1IA 4GAEA 4OQZA 5HMLA 4E7PA 1AV6A 1C3OA 3TJRA 1S2OA 3GGOA 5HCIA 1NWCA 3CLTD 3MWKA 4L0CA 1QTQA 3MMXA 2Q6OA 4H7FA 4JP3A 1YZGA 4OLAA 4ARVA 4E6EA 1WXEA 3F9RA 4MPJA 4EB3A 1NUUA 3TTVA 5A62A 2H59A 2DHDA 2VJMA 2HDNB 2CB0A 2I6SA 3EXHC 4HQKA 4XSHA 3V1MA 2WUGA 4KOEC 3PUIA 3PS9A 3RIEA 1VSQA 4LDPA 2E85A 1I8TA 2FPXA 1NOJA 4EJ0A 1X92A 3P9SA 3SQDA 1WD5A 3TJZA 1H2AS 5LMCA 1DG9A 4A8HA 4KO8A 1TQ6A 3G49A 2E6KA 1G8SA 3B7WA 4YDRA 1ST2A 1TPYA 4OK6A 4BVHA 3NAMA 1OX4A 4H59A 4CL3A 1ESCA 2VRCA 3EYAA 4Q3DA 1E7MA 3BGSA 4JIMA 4UTVA 1JSRA 4B73A 3LWDA 3T38A 5CCXA 1PS0A 5ALGA 4YDQA 1U6JA 2WMNB 1DIGA 3WZLA 2ONJA 2VYQA 4DLZA 1RKQA 3OBIA 4HWRA 2FWMX 5CDSA 2I80A 4DV6B 2JPDA 1F1JA 4V1CB 4RTMA 3NETA 4XIIA 5IH3A 4BP1A 2C9YA 3TM5A 4H4EA 4I5EA 3FPEA 3WGOA 4HEQA 1RQ7A 4GBMA 1RMTA 1GQYA 2P9CA 3SWWA 3DAGA 3O93A 5B3JC 1KJIA 1RWNA 2Z6QA 3FTEA 1RZ3A 1TGYA 5BRAA 4Z4GA 5FL3A 5BVHA 3EXFB 4LZJA 5B2FA 3W5HA 3MRTA 1QDLB 3LC1O 4X85A 3BD8A 2RH4A 4HWGA 4IOLA 5ICMA 5KCMA 4COKA 4AYWA 5DX1A 1U9YA 4FBMA 4K8OA 4TGLA 3FW1A 5KKNB 3AM5A 4PGAA 4RY0A 4BC0A 5AJZA 3OJWA 1R9MA 4EGFA 4KZPA 1OVGA 3T1TA 1YR9A 2VJDA 2Z3ZA 2IY7A 1B0PA 3EGOA 3IJEB 3JASA 1Y3IA 3BMOB 4IDNA 4NAUA 4G4GA 4K3VA 3GNLA 1AK1A 4TL9A 4MHTA 1Z6QA 1UH5A 1Z18A 2WUVA 3MWYW 4HOYA 1NIJA 1Y8QA 2CNBA 2GZAA 5KPDA 3R3VA 1OB5A 1OHHA 3KSZO 3CCBA 1MH1A 4XFKA 3RS9A 1PW5A 2QNBA 3ZQKA 1A95A 3BKXA 4L6AA 3NHJA 5CW1A 4CLHA 1HY3A 2XMPA 3ZCRA 2QRQA 1TAGA 3JZMA 4H17A 5D7NA 5EEGA 1QGUB 3LP5A 1FNCA 2JFPA 3NEYA 5FWYB 1MIOA 5E0OA 2HK8A 4IWXA 4II3A 3R0IA 1HC7A 5KREA 4XPZA 4O02B 5DNYB 3CX3A 2JF0A 2CF5A 1R18A 4OXXA 5AKHA 1CUVA 3NTRA 4YB8A 4CMIA 2O8VA 2Y05A 1H3FA 1Y4DE 4R6WA 1W94A 2QUZA 1A76A 2PKQP 2AVDA 3MVEA 3PQ2A 4GF5A 5JAIA 1TTTA 1ECPA 2J6CA 1XCPA 3A3OA 3BJMA 2BGNA 2EGGA 2V4MA 3NIFB 3AKZA 3L0DA 1C1YA 3NT4A 2QTGA 2BUCA 1LF5A 3PNLA 4FI3F 4MI1A 5JAZA 4QOIA 3DLPX 4XFJA 3BGIA 3CLVA 2DFVA 3G0BA 2Q1XA 2JLWA 3ZNPA 2KX7A 1E64A 5HRCA 1E5XA 2PD4A 2VI5A 2VF8A 3QYAA 3I28A 4UVDA 5CFQA 5ISMA 1EM8A 1N2ZA 2V7GA 2DX7A 1V1RA 3M8KA 4KSYA 3AR7A 4MVJA 1Z68A 2W6NA 3STVA 1WDWB 3WIBA 3IEMA 2HMWA 1J0CA 2OYRA 4B7CA 1G4HA 3CUVA 5BWMA 3UJNA 1PQYA 3HKDA 3SQOA 821PA 3EMBA 4FDUA 4REQA 1GQOA 2OBMA 1GAJA 3RHFA 1ID8A 2FK7A 1XXLA 3MOGA 5FOXA 1LDGA 2AXQA 3I53A 4HUQB 1RVDA 4UHBA 1BMFA 1M5UA 1Q2XA 4GGPA 2FZVA 4KNWA 3GUUA 4ROTA 5T4HA 3FROA 1QFYA 1H8EA 1W4BA 1ZC4A 1K06A 3OZUA 5G0SA 2Q4EA 4JT8A 1OFUX 3FYUA 3LPDA 3GJXC 2FE1A 2NW6A 2Z5GA 1DLJA 3EASA 4NMWA 3F97A 3D3EA 4C03A 1KO4A 4GRDA 4YMLA 3KR2A 2VYCA 4MUBA 1ABFA 5EINA 5IW8A 3DBRB 1U8XX 3R5JA 3DLHA 2VL7A 1NA5A 1H23A 1ULHA 1UZLA 4K7JA 3HYSA 4WK2B 5B53A 4XVRA 1XK7A 3E7PA 1FUYB 3KSRA 4N9QA 1G7SA 2PQ0A 3B5IA 3GFFA 5F1KA 1KO1A 2CMKA 2TMDA 3HMQA 3JD3A 2DFLA 3WKEA 1AN0A 4CMBA 1KRWA 5G02A 3PKIA 1R9GA 1ZICA 2IP1A 2Q9CA 4BWVA 3ADDA 1E3MA 1JFLA 4ZYUA 3KR9A 2LD4A 3PXUA 4QO8A 4BX0A 4XI9A 2GPYA 4NEHB 5KHLB 5H8WA 1FS6A 2FE4A 4Y2RA 4ZRNA 4C06A 4DSAA 4ZCPA 4D9BA 4MKFA 1W34A 1L0BA 4ZFNA 3QGMA 1X2EA 4L08A 4YT4A 3A6LA 3AR5A 4GOOD 3FKSD 3TX6A 3TO5A 1DMRA 3RVSA 1E61A 4I4LA 2ZUWA 4UTRA 2IVZA 3PUKA 2VXYA 5A06A 5KQMA 4ZAGA 3GLGA 3ZE9A 5CIQA 2A33A 2GRJA 2HA0A 3DE3X 1KSGA 4ECEA 4INAA 1UBHS 1XMQB 4F4IA 1U7OA 3EW9A 4YLYA 4I1SA 2ZRGA 4KV7A 2JAHA 4JNCA 4G1UC 3WMRA 1SCJA 3DAYA 3ZZ1A 5CD9A 3E9QA 2JKVA 3G2LA 4G1EB 3N3BC 3RS8A 1NVVR 3IR7A 1USGA 2IEYA 5AVUA 1GNRA 3CH6A 3CUSA 4MVCA 2Q7XA 3AHJA 4PG7A 4U2DA 1TNDA 1Z22A 3ELDA 4X94A 4ZOCA 4BB9A 4Q3KA 5EKDA 2CXTA 5ADVA 3BIWA 1QVRA 4CIVA 5FPTA 2X9GA 3IKJA 3PENA 1ID1A 2DF8A 2JAUA 1EAMA 1YBFA 4LF7B 1Z07A 3GFVA 3FLEA 3PUZA 4LY6A 2JG3A 2QPLA 1X80A 2GEJA 3VOSA 2WWHA 3D02A 3KJXA 4LC1A 4D44A 2HSEA 3GAMA 1NULA 4I4CA 4ND7A 1DI0A 3PC7A 4MZDA 1BRTA 3RNOA 2IW1A 3AJDA 3W2FA 3ZWNA 5EAIA 2A59A 4KG7A 3JX9A 4QPDA 4Q4HB 1QE3A 3KU4A 2IK8A 2HO5A 2XMDA 1RAEA 2F43B 2IXTA 1TJYA 3KQLA 2P41A 2R8XA 4N01A 2A0YA 1NFFA 1QVWA 1RYFA 1U7XA 1JDBB 1OX6A 3LH5A 5JJLA 2CWDA 1O57A 4DV1B 4C5CA 2V8BA 3KPYA 3ESAA 4V2UA 2J85A 3IELA 1JQ3A 2QG9A 3O7MA 5D5PA 4ZI7B 3QIAA 4LJKA 1NUPA 3AEKB 3F49S 5WRFA 4FW8A 4BO8A 1OBOA 1B0AA 2C5FA 2HA6A 3FR8A 2QLMA 1W4CA 2WILA 2QY9A 4Z53A 4X1KB 4ME6A 1KH3A 2Q28A 2QN7A 1RAGA 3ABOB 1Z15A 2GXSA 2G67A 3RF7A 1I94B 4MUMA 5K05A 1T10A 5AKKA 5IS2A 3KT6A 5AVOA 4KWEA 4CKEB 2I4LA 2H31A 4EUNA 1K0UA 2W7TA 5CNKA 4EKEA 2P27A 4JJEA 2EKPA 5ILGA 4QYIB 3MJCA 5KNBA 1JQBA 1Y80A 1NW9B 5IC6A 4XRGA 1MABB 3M2PA 1TO1E 1Z5OA 3RYCB 2H52A 3FTCA 4JX9A 4R69A 4MRMA 3WL6A 3NVAA 4GP6A 4L57A 2GN9A 1FB5A 4CJXA 5L95A 4NJMB 3QVMA 2WPDD 1AE1A 1B6TA 1SD1A 3HCPA 2CHFA 1RLMA 1W25A 3BRCA 3IRVA 3NWJA 4I5GA 1EJBA 1PG5A 1SQ0A 1QDUA 4CRWB 5CURA 2OB1A 3L8HA 3ORHA 3V34A 1VZ3A 5E8JA 2HSZA 5IFLA 4F46A 1AQIA 2NUPA 5JD4A 3BREA 4OB8A 3E82A 1Z0ZA 5TQJA 4FW9A 4J0CA 1GGHA 3KQPA 5HMMA 2ZBEA 4G0OA 1ZMBA 1PU2A 4RE6A 3N8NA 1EXWA 4HDRB 4EI7A 4DWOA 1V4VA 4GZ5A 1DXYA 1TM4E 1I0ZA 1IQRA 2D3TA 2EC5A 4EJ6A 2GN8A 3M6MD 4J7UA 3UENA 3SKYA 2C58A 2IKSA 2QG6A 4F60A 1ZOLA 3L77A 1V48A 2HU5A 3ZLTA 2CGEA 3R44A 3PX2A 4KAJA 3ESBA 5AKXA 3RLIA 1M76A 2Q1UA 3RYHA 5F51A 4ZEWA 2AG1A 3K0AB 3NBMA 3CRVA 5JXIA 5L7WA 3D4IA 3PYXA 1ENZA 2XUPA 3QEMA 4RVHA 5AUNB 5AOAA 3GEMA 3JR3A 2WB4A 4GP7A 5K03A 3HDGA 2BY4A 3WLIA 4JC4A 2ZU6A 3A06A 5IDVA 3I9V6 2BD0A 2J8ZA 3M1LA 4WPGA 3M6WA 1ULZA 1Y42X 2AG0A 2JA1A 2BE7A 2G8LA 3LC2O 4AJLA 3WYDA 2HIHA 1BXRB 2YASA 2FDXA 3A9TA 4CFSA 4IIUA 4BX9A 4RH1A 4I2NA 1L7NA 1HLFA 2QTFA 3PHIA 4QYWA 3REQA 4D8YA 3I09A 1A4XA 1Y1SA 3E3OA 1RHUA 3KEFA 1U3UA 3B1VA 1N6KA 3EUAA 1FS5A 3PFBA 3ZWBA 1XCGB 2Q1SA 1ECBA 1KIMA 1U0NA 4S24A 4LF4B 4G0QA 4XWYA 1SIUA 3JAWB 4CCSA 3OE5A 3RC9A 1JQEA 3E9EA 3VYWA 5AESA 2AFHA 4HH0A 4O4JB 4PBSA 2V9CA 1NUHA 4PSCA 3UA4A 3V8EA 4QLAA 4IKEA 3CNQS 5F5XA 3WSTA 2QVGA 3GAZA 4A2WA 3FX2A 1T2FA 1YBVA 2H2DA 1N32B 1PI3A 2DBVO 3H6KA 4NOMA 2R66A 1W36C 4GPAA 4EFLA 3OOWA 3D43A 4LYGA 3Q1KA 1STOA 4DLLA 3RIXA 3LW7A 4Y2HA 2BDUA 1O95C 3AHGA 5AJWA 4C4AA 1T9AA 2SNIE 4AF7A 3F6BX 5KBYA 4KMMA 4UU7A 1AM4D 1THGA 4UVHA 3PT5A 5EFOA 3WRYA 3VM6A 2CN1A 3HXOA 2H7VA 3I9NA 4FGJA 1JR6A 1GEGA 2YDXA 1C8KA 3LKBA 4MWCA 3T0IA 3H6HA 4KXFB 4YGXB 1HZZA 3KVOA 3QUCA 1C7QA 2FW6A 2IOHA 2VA8A 5D87A 2FQWA 3DL4A 1D1PA 1SRQA 2Z8ZA 5CT5A 4DGQA 4ESVA 1G42A 4B40A 3FFTA 2CXUA 3PC6A 5HZMA 1VLMA 3DBLB 1NM5C 2HQOA 3N0XA 3QKRB 3BG5A 4PBRA 4DMCA 2B21A 3B9PA 4J0FA 4LZZA 5F2OA 3G7SA 3T5GA 2V3VA 2ZTLA 5BMVB 3F73A 2V3WA 3FNIA 3N2YA 5GGXA 1JKFA 3GFPA 2HHJA 1AA6A 1KEEA 5GOZA 5JHGB 3I05A 3LL4A 3PQ8A 4LVCA 5KYWB 1Z45A 2FSVA 2P78A 3AKYA 3QTBA 1SEVA 4RK7A 4DGSA 2G9UA 1JKIA 5EJ5A 2CKDA 3QVVA 1DP4A 1FP1D 2GMWA 3GEEA 3LA6A 2B8WA 1USKA 4D1YA 5KNCA 3CKKA 1LBQA 4FFLA 2KW5A 5DN9A 3I6ZA 1M2VA 4G6ZA 1AO0A 2P4EA 1GTZA 2YV4A 2CNLA 2JS7A 2ZJBA 3O4IA 4FE4A 4UEQA 3WKCA 4DJEC 1OGIA 1KR2A 1T1IA 3EXEA 3R8CA 3BZUA 3GOHA 1U3TA 1WXWA 4ID3A 1JA0A 1D4AA 1NLUA 4BZQA 3LHSA 2PH5A 1QCZA 3E1KA 3M5DA 5FPSA 1I9GA 3INRA 4MARA 2IV7A 3C2QA 1RM0A 5EWLB 4CKCB 3FZGA 2R60A 3QMMA 2PH7A 1VI5A 2ZJAA 3E23A 3LUAA 3QX9A 2BZSA 4WFJA 3ZE8A 3WYAA 1G63A 3UANA 3OJ0A 4ARZA 2BCJQ 2ZBFA 3VYTB 2ZBQA 1IZ9A 2XA2A 4Q3EA 2R1ZA 3B2QA 1BU8A 1UDWA 2V7PA 4BRSA 1IJBA 3OCWA 3A6DA 1C30A 3QQPA 4HQ0A 4O2AA 4TUYF 1X8KA 4BKQA 1IY1A 3ZDDA 3RRYA 1ANKA 1TEXA 2A78A 2QRVA 4Z9YA 1ECCA 1P1FA 2QMOA 3JWGA 5HS4A 2ZI7A 5KNDA 2R47A 4HG2A 4ZU1X 3ZI0A 5KAPA 1BYUA 1KA9H 5DGCA 1ZQ9A 2NXJA 4LJ6A 2D0DA 1U8CB 2MU1A 4BGDA 3EPKA 4J16A 3O26A 4UBMA 3TD6A 1U28C 1IEQA 1GCGA 3O95A 5HJEA 4IEFB 3CNHA 2B34A 4DEYA 1QR6A 4F8YA 1GM5A 3AL3A 5CT4A 2FN7A 4MRAA 3VNQA 3K9HA 1TMYA 4C4RA 4JDPA 1OI4A 5TQ2B 2OXCA 2J7PA 3GNSA 4DXAA 3PQ5A 1YMUA 4RPKA 9ATCA 2OYCA 5A2QA 1HYQA 1K3FA 1QE5A 2EBWA 3I12A 1GCAA 1EP9A 4MUNA 3GL9A 5DGDA 3LWBA 4GKKB 3F3KA 2JKYA 3B7PA 4QVKA 2WM8A 2EV9A 3HO6A 3KV3O 4RD0A 4Q4CA 2I7XA 4FS3A 3WLOA 3GQVA 4JXXA 3IGFA 3PQ7A 1BDIA 3PXBA 3T5CA 5DJ5A 2XB4A 4IZOA 3JYOA 4J9UE 4RM2A 2IV3A 4KPYA 3UUFA 2B37A 4IWNA 1V3UA 2JGKA 4DNPA 1TYBE 3FPLA 1K6MA 3GJ8A 4OD0A 5FD8A 3RVJA 1W48A 3ZUPA 1F7VA 2LIPA 3MPUA 4YALA 1H1TA 2EYUA 3WWCA 4Z51A 3JAMA 1NNLA 4R3NA 1L3CA 4QOHA 4DARA 2X0KA 1ULBA 5JNUA 1VGRA 3PIDA 2GT1A 4XX1A 4ND5A 4CL2A 3AFOA 2BGRA 1X9HA 4MUAA 3CLHA 1UC5B 2PU5A 4PX3A 4HBGA 5JADA 4BV9A 2LCIA 4MKZA 4C3OB 4HX5A 1FZQA 2WTXA 1JHAA 3HDHA 4MPRA 4M83A 4J3JA 1JB9A 2H7XA 3BIJA 2HA5A 3LF2A 1UQRA 4PYKA 2VRNA 2ZLBA 5CLGA 4BX8A 4Z1MD 5JJCA 1IHUA 1UBRS 2VYND 2GCEA 2VJPA 3BSYA 3F7MA 4NZPA 1LW7A 5KS2A 3O90A 1T8WA 3LOQA 4IJWA 4LDQA 3ZE2B 1TLFA 2PZMA 2QN1A 2PH3A 3Q0TA 4MS1A 1YFJA 1JQ5A 1HT0A 4PAMA 2OO5C 4H0NA 4PLWA 4EPXA 2I3BA 2IRWA 3W4IA 4F2GA 5JY6A 1KZ9A 2JH9A 1UPAA 2JCBA 4PHGA 2YFQA 2C8JA 3I3SR 3V4SA 5AR1A 4A8JA 5A1TA 3PGMA 1EXNA 3Q8MA 1FMTA 3BEDA 4WKOA 4HFJA 2C04A 3LBNA 4LXYA 3N2EA 2FW0A 3W6UA 5ICEA 2BMAA 3W5JA 1DAOA 2UZ3A 2YYSA 1LLDA 3PD0A 2BEVA 1VCNA 2WWXA 3L04A 3NUGA 4P58A 3WTBA 3RB8A 2EHDA 4AN0A 4DQVA 3GXBA 5FEUA 1NBHA 3VJKA 5C8DA 1R8JA 1G19A 2IUTA 4FFWA 4ZYVA 2DFKB 4QGGA 4OHUA 4URXR 2PAAA 5B55A 1IJKA 3SSMA 2XADA 1W36D 3Q7SA 1MRZA 4BFSA 2VZEA 1L7DA 1F8GA 4G9BA 3C4JA 3JQQA 1O95D 2A3RA 2QP3A 4ODIA 4BB6A 1TZJA 2CLIB 3MGKA 1UAYA 5EGNA 1HDOA 2OBLA 3F71A 4JROA 5ADHA 5JS2A 4XB6B 2ZZMA 1MV5A 4Y6GB 2H4XA 4K9OA 3GLUA 2WFLB 4Q7LA 5L7YA 3V8VA 1VLLA 1KMHA 1JLSA 2CNOA 4MVJG 1DTWB 3OZDA 3H9QA 2NT3A 2NO7A 3BERA 4ZJUA 5FULA 1P62B 2DSTA 1VC2A 3KYDA 4DILA 2VXBA 2RBEA 1JALA 1SIBE 3MGAA 1J2YA 4NDZA 5BUZA 1E8DA 1W44A 2AMFA 2I76A 1PFYA 3PPVA 4C4YA 3I1FA 4KACA 1L7QA 1SXJE 1EYZA 1S1MA 2Q4DA 2QIPA 3KC2A 1W7AA 4NKRA 3VAAA 5LJLA 1X14A 1W6RA 3AZPA 3EEQA 4HRAA 4WD3A 3WB0A 5AKYA 1O94A 2HDHA 3PHJA 2ABWA 5H4GA 3VDMA 1BKDR 2WWWA 4FFVA 3W79A 2IDKA 2BAGA 1RBZA 5A7GA 1J06A 3C3MA 4DWWA 4D57A 1T43A 1Z5VA 1ZBDA 4JHXA 5JAHA 3H4MA 3SQWA 1H1DA 1YAJA 3THXB 3G0HA 2VNJA 4ZWNA 4ZEXA 1KQNA 2O8BA 5FOUA 2IT1A 1ZR4A 3AWIA 3KZKA 1E8NA 4GLBA 5C5DA 1G9TA 1VJDA 1ADYA 2CMGA 3NDPA 4MS4B 4KAFA 4Y2QA 3ZJYA 4XX0B 4EW6A 4Q03A 1O5IA 1M6NA 2ZRIA 3DHEA 1BC5A 2VP4A 2IPAB 3RVOA 3N8KA 3D5QA 4HS9A 5B1DA 3ROKA 5IFKA 1A9RA 5JATA 5AI5A 4UTNA 3Q3HA 4K6CA 4ZIRB 4FOTA 2VK2A 1Y63A 4IHQA 4LHVA 4CKYA 4S1TA 3HB1A 3MUOA 5JAMA 4IEIA 4L5BA 4LZAA 3H8WA 4B32A 3RLFA 2EZ4A 3VV2A 4ZTZB 4KVFA 2IZ5A 3S2EA 2B9VA 4TT8A 3TSYA 4UEJA 3GCGA 3RSLA 2WWTA 3B8HA 3KDAA 4K9NA 4NENB 5AUPB 2WQ6A 2Z04A 3KUKA 1D7AA 1K1EA 1MTZA 4EPWA 1TK3A 4KIJA 3AHFA 1ZJJA 3F74A 4LE2A 2J33A 3NT2A 1RJ9A 5FOVA 2UU9B 3GLKA 4V0LA 1DT5A 4A0FA 4B6OA 1PG2A 3GV0A 2GTHA 4FZVA 2C42A 3B8EA 3H5OA 1ML4A 4NS4A 2HWXA 2JHAA 4QDOA 4NYJQ 4BIMA 4NONA 2WDPA 2BTQA 1P2UA 5G4LA 1N4AA 3DKKA 4BDTA 2CW5A 4MGZR 5GINE 2HIGA 3U61B 1J25A 4QAQA 2MR6A 5HFAA 3WGLA 4FB5A 5IBQA 2NSHA 3IC5A 5FI3A 2ASEA 1X7HA 1AQYA 2VDOB 5IDWA 5J2UB 3OFSA 5IASA 5JCZA 5HUJA 4IS3A 2B9EA 3QEOA 3RS7A 2J3IA 3HC7A 9GPBA 3MPOA 5F5LA 4QELA 5AVZA 1K3UB 1QJCA 2FFJA 1P9WA 1VE3A 5LXTB 3K9CA 4OP2A 5HQTA 3AF3A 2A9OA 1QRRA 2A0UA 5DCYA 4ZCRA 1OBFO 3EC1A 4F4UA 5D84A 2ENUA 1JSCA 1JIVA 1QV7A 5AHWA 3IBGA 4Q93A 4OHKA 3TAUA 3SC4A 3VZBA 5CA1A 3EMDA 4Q82A 1IOVA 2XUHA 1R37A 2HU8A 4X8HA 1CE8B 2Q46A 1U2PA 2ZIFA 3MQ4A 4PQFA 1NSYA 1XTVA 2Q5FA 5CH8A 4F4CA 4B4OA 2XCLA 1R88A 1NLFA 3CGGA 2HHAA 2OFWA 4L4RA 3VZSA 5BORA 1E4OA 4WUTA 1S8OA 2GCPA 1IZ0A 4JKOA 4IDBA 4YRIA 1NE7A 4WBXC 3NC0C 1E3QA 5HM6A 4ZAXA 3PIRA 3FFBA 1ZVMA 4Q01A 1GG5A 2PUHA 1ZN8A 5CJJA 3S68A 2VHWA 3HNRA 1OBHA 3VSAA 1TEZA 5FQNA 1GNSA 2OOSA 1GT6A 5TE9A 9LDBA 3TNFA 3QH4A 2ZBPA 3VR5D 3AUXA 1NMSA 2B4TO 1N0HA 2CUNA 1VG9B 3DZJA 3F67A 3LBYA 1S02A 4YPFA 3W8EA 4OHCA 2QVCA 2W2KB 2GKGA 4PCLA 3K0FB 5E1DA 2LTAA 2Z6VA 3NPAA 4Q3NA 4P5DA 1I4OA 3A9SA 3ETGA 4TVKA 5A5EA 3IAHA 5CG2A 1PTKA 1XKLA 1G5TA 4ZXFA 3W5CA 1VYTA 3ZGVA 1CUDA 2Y1XA 1T3GA 2OUIA 3EMVA 4I9FA 1C0EA 3VYRB 5JFOA 1FDIA 4PWZA 1UBTS 2BRUC 1ZKDA 4H6XA 4URFA 1GKUB 3ZHXA 3DDCA 1P77A 3ZV6A 1XTJA 1S2IA 2FR8C 3WMWA 4RHYA 2P91A 4O8ZA 3D6NB 4F97A 2GM5A 4TTRA 3EVDA 5E2IA 3L41A 1IM2A 1TKAA 3UT6A 1JG7A 1S4MA 5T8KA 3V48A 2QYHA 4YA6A 5B12A 4Q9NA 4YHHB 4FGZA 1N3YA 1I32A 4UAVA 3VOBA 4NL4H 2B0JA 3N58A 1EH5A 2R4QA 4DIEA 2GPAA 4Q4AB 5HR5A 1NTOA 4AZ0A 4CFZA 4LE1A 1ESEA 1MOZA 1ZUIA 2GKOA 3EDMA 1WY7A 1K8ZB 1DBSA 1HM5A 2FDRA 1NWHA 2WU1A 4JBHA 4X41A 3STTA 2NTVA 2UVPB 3SFZA 3UC9A 5K0CA 5CDUA 4NZ9A 1GUZA 2B1QA 3DHWC 5LL6P 1S5PA 1T0UA 1YE5A 3UH0A 4RIFA 5KTPA 4JEIA 5LM3A 2JRLA 2OGTA 5DW3A 1P9RA 3KQUA 3B36A 1XO1A 3AF5A 4RDIA 1YUMA 4ZALA 5REQB 2X1MA 2GPSA 5DYNA 1NW7A 5CCDA 1L9KA 3TFOA 1NT4A 2XXBA 5LQAA 4PG4A 4CLXA 5TMDA 1F0KA 1XU7A 3QXXA 2PX4A 1W47A 4X97A 3MB8A 4DIMA 4UHHA 3PFNA 4HAXA 1NBIA 3IVCA 1GIAA 4OU5A 3R3SA 1U2SA 3H5RA 2I34A 3FNGA 4U7WA 2ZJ6A 2NV0A 2O1XA 4ACBA 3MUEA 3DJFA 3GUZA 3L4BC 5DULA 3TZCA 4IX1A 3PXGA 4AKIA 2PO5A 5L51A 1PSZA 1I2AA 4IINA 1JWBB 1KTVA 2ZTMA 3DW3X 4KR6A 1B6GA 3EIOA 1N2BA 1P1RA 4M86A 1ND5A 3OQNA 5FDFA 3O5AA 2YWXA 1RI4A 4UDNA 1Q1NA 4ERNA 4LQLA 3PNSA 1XCBA 2BH9A 5DLPA 1CRPA 3O8QA 3RRZA 3GCDA 3KZVA 2O06A 1IM5A 1G1AA 3EG9B 4P36A 5J40A 1TU0A 1G2OA 1JX6A 1M0TA 1KQ3A 1VI2A 1VMIA 2G71A 3AERB 2ZJ2A 4L9AA 4MUYA 1L8OA 3HI6A 3LOPA 2QE7A 2OHJA 2YW2A 2WSLA 4FZ3A 4ARIA 2C94A 3J7AC 3IMKA 4GLOA 1BD3A 2VLBA 3KSBC 3OIVA 4B84A 1OLUA 3I58A 3W7AA 5EIHA 4ZO9A 1OA1A 1L7VC 5KOHB 2LXNA 4HVLA 5GY7A 2ZQZA 1X13A 1DQSA 1DWOA 3IVXA 3QKUA 4R40A 1PJTA 1Q92A 1VBKA 1PK7A 3KVVA 3OZFA 5FBQB 4OK3A 3TQQA 2CDBA 2AXEA 5BSGA 3CW9A 3C6MA 4RPJA 1KJWA 1YOBA 2VQEB 3PNYA 1XZJA 2QQEA 4WEQA 1MOPA 2OHGA 1I5RA 5EZYB 1ILWA 1B16A 1Z8NA 3OTHA 1DOAA 3TOSA 1MG0A 1N8NA 4O29A 1X1CA 3WLRA 3HZOA 2WAMA 3IUMA 4DSZA 2B4RO 7REQB 3RUHA 3QLVC 1DBVO 1W88A 4MKXA 1OFGA 1CVRA 2FZEA 1GTG1 1RI1A 2OD2A 3COPA 4KLAA 4B71A 2BC9A 4PHTA 5FPHA 1LB1B 4ZI5A 4CU5A 3LTNC 2BDTA 3BORA 3QMWA 4JV5B 2VHTA 1S7GA 2IHYA 1AGYA 1GNQA 3EK2A 1GJRA 3S8MA 3HUFA 4P4NA 3V4OA 1XKQA 1GRVA 1YA8A 2BZ1A 4UDXX 1T2VA 4YRZA 5EHZA 3EGXA 2V1UA 2I6QA 3HKBA 4JBYA 1AKTA 5J58A 1P0FA 3RG2A 2IYPA 2D54A 3R0XA 4DMRA 3LNCA 1IVSA 2BGMA 4M1QA 5B6PA 1Q19A 2XNDD 3TFWA 3W8RA 1F12A 4REOA 2CLCX 4US0R 5KUTA 3IOBA 1WXGA 2IBMA 4NNOA 4Z8YA 2HPZA 3NTLA 1BH6A 4JUAA 5C5EA 4EYSA 2B8JA 4S1WA 4HVCA 3SC2B 2RH8A 4HGOA 3ZWMA 2CLMB 4JZYA 5A4KA 5AOCA 4ZI2A 1VI6A 1CUCA 1KAEA 2EW1A 2Z09A 3U7QA 4CG1A 2V4ZA 2EG5A 4C7VA 4D9IA 5TJ9A 4B3GA 2WW8A 1NZFA 1SG9A 3QXCA 1JEJA 2GFIA 2XX3A 3H1TA 3UW3A 3QYJA 1PT6A 1C14A 1IOLA 3NOOA 3W6OA 2HPAA 3CEJA 2PANA 3A4YA 4KB5A 1RIIA 1T13A 3ELUA 1UWLA 2HSGA 3DVLA 5E9JA 3RTAA 4EA8A 1PL6A 2PL5A 3ILXA 4D98A 1J1UA 1P5JA 1Z5UA 2FW1A 1ECJA 2G8NA 2HLDD 3WWZA 5KSZA 3AUTA 5LNK1 2QT1A 1WSWA 4MV3A 2XCSB 3PQCA 4FDLA 1DAHA 2GR9A 3W3ZB 3OSUA 4IIJF 3IBCA 4LMRA 1GXSB 4U6NA 1CD5A 1KYVA 1VLQA 5E7JA 4DXDA 1SVUA 4YY3B 3IT0A 2GAIA 3DXZA 5EEHA 1C1DA 4PE5B 5FFFA 1P60A 5KIAA 4WIAA 3ZTYA 2JD0A 3L82B 1DOHA 4YRDA 5HYVA 2C5AA 4M53A 2O48X 2P9ZA 1Y1QA 3TUJC 4ZOQI 3VI4B 3S1AB 2E3JA 4MULA 2SCUA 3KYBA 4WNCA 5CB0A 5JTUA 3EXHA 1RBMA 2LCFA 2WUEA 5JSQA 5LKRA 2BDEA 2QW0X 2QUJA 5B7NA 1RAFA 2ECOA 4CVNA 1M83A 1PZNA 4XWWA 4WKGA 2HXGA 2FXIA 4GBED 2DTDA 4L4YA 1TUBA 1XGKA 4KHZA 1YQTA 2R5FA 2AFIE 1XZFA 2JIOA 1JDNA 1P4HA 3MCZA 3P5SA 2BMWA 4Q1DA 4NCBA 4OO3A 3KKNA 4QHTA 2XKBA 2XB8A 2BI8A 3GRZA 1DCTA 2VH1A 1N2HA 3BSFA 2NYUA 3DE0X 5TT0A 3TNYA 1LX6A 4OHWA 5K0BA 2WSYB 3DBOB 5KOJB 5LP6C 3OIWA 4L78A 4TMVA 5FXMA 1F8UA 2HRRA 4S04A 2P65A 3AIMA 4Z6KA 2VSQA 1D09A 1XB2A 3REOA 5C81A 2DETA 5CT8A 3ZX4A 4RE5A 2QGFA 4MW5A 4OKNA 1G5HA 3EHEA 5C32A 1IQUA 4X44A 4DR5B 1SO8A 3MQFA 1ZD1A 2XZDA 1FUIA 5KQPA 4D45A 1V6CA 1G7TA 2JI6A 2AOVA 1WEHA 2ZYHA 2IU6A 3O38A 5I7VA 5B3JA 4WINA 3THSA 1GPNA 2G1AA 2QEQA 1L7XA 1YE8A 2FQYA 1TA0A 2I4NA 3BXZA 4Q9JA 3HYLA 5JWOA 1U8FO 2R6R1 2JI4A 2H0RA 4V1CA 3PNKA 1WY5A 3RSSA 1C1HA 2R8BA 4CEHB 3LL7A 3LX5A 4PLPA 4AMZA 1M8KA 1NR5A 4RVDA 1I2MA 3Q88A 3LGAA 3IIMA 2NZ8A 1U94A 2W2TA 1IDN1 3N2GB 4URZR 3AM4A 3IUNA 5HA5A 2XW6A 4KQ6A 4P4TA 5BSRA 1TIBA 1DBPA 1Z4KA 1LDEA 2ES4A 1F4LA 1FW8A 1UKBA 4K6FA 2O2EA 3ULKA 1JFTA 2NXNA 3NWEA 1UK7A 4QHYA 5D2CA 4A16A 1XEXB 5GONB 1G5PA 3IKVA 3VBCA 4MPDA 3GROA 4RD2A 5EIAA 1P0PA 4NF2A 3UT5B 3EQ8A 2PH1A 4OBBA 4QFCA 2X0DA 1QU2A 1WXIA 3QVXA 2IY8A 4MDYA 3VU1A 4E2WA 3AFHA 2FPPB 4WOCA 1R0XA 1U8UA 2CLLB 4G4SO 3ZD9A 3GGCA 1U8TA 3BMOA 3SBOA 4CLRB 5IJWA 3FOAA 3W2HA 2WPDA 5I3CA 1UEIA 2B3TA 3QI7A 4UU0A 1PR9A 5TGDA 1C9JA 2WVHA 5D7BA 4ENPA 2J0VA 2BI7A 3K1AB 4NPCA 3VKHA 4N9WA 4EA6A 1GL3A 3R9KA 5KYNA 4RANA 1ORWA 2OO3A 4XWKA 4HN4B 1E66A 2B78A 1QGUA 2DTEA 2XI4A 4MUKA 4RKRA 3OP4A 1M2KA 3QPUA 3R5KA 2IZ0A 2DP4E 4NAVA 2P0AA 4UCWA 3FTFA 1JB1A 1JLRA 1LK0A 1L5OA 2GWHA 2IYXA 2X9NA 1RPNA 2EX0A 2WFZA 4UMEA 3ELBA 1CUGA 1LDBA 1RSZA 4LOIA 3UMBA 4CT5A 5I8WA 1Z6GA 1K97A 2ZTVA 1V41E 1S96A 3RYFB 2ZT7A 3NU1A 3GVHA 2ZSIA 3EVFA 4GS5A 2C7GA 3LCRA 4JC0A 4GZLA 2HF9A 5AI0A 4YQYA 2UV8A 1V7CA 3N0VA 3RUIA 1Q95A 4CV1A 4U02A 2H85A 3M6IA 5IYZF 3K0SA 1Q11A 2J6BA 1VIAA 1ZBQA 5HFJA 3ZCVA 2ORVA 1WP4A 3EGCA 3ENZA 4UAGA 5EE0A 2I8CA 3LZ6A 2BLNA 4H0FA 1GKYA 1E5TA 1XIVA 1Q16A 2PXXA 3EDCA 5FO0A 5KJ1A 2HMTA 1NVXQ 2O50A 4L72A 3RH0A 3HM2A 1SHKA 4C0JA 2GCIA 1WETA 3TSWA 3NAGA 4BWGA 2WHQA 2AVNA 4HUQA 4AJHA 2V7QD 1EK1A 3ZV5A 5C46F 3LJKA 5IF3A 3IQFA 1S4QA 5KX5B 2CNNA 4K9LA 3O82A 4PONA 2Q3CA 4KBGA 4BO0A 3EOZA 5HKAA 3GMSA 3D0OA 1KVRA 5B6JA 1R6XA 3IQXA 1E18A 2RHWA 3KFVA 5EZQA 3ZHVA 2CK3D 4IV8A 1NDUA 1ZH4A 2AH5A 3R20A 4IUCS 3VU8A 3B1XA 1RABA 2H1RA 2FP3A 3M4JA 1DPGA 5BQ5A 1ISSA 4I4IA 4DG9A 3HTXA 2X8BA 1XDUA 1E77A 2A94A 4B35A 1WG8A 3DBRA 4MQFB 1VIYA 3IALA 3LXMA 1Z35A 1R1DA 3CRQA 4AB1A 1BIFA 3AKCA 4PRZA 4LRQA 1QRSA 5FPPA 3EY9A 3H05A 5FTJA 5H5JA 4ZYTA 4OJKA 2RIRA 3WLAA 1O6BA 2C2MA 2KYRA 3L1UA 4ZVKA 4YMWA 4XD7A 3HJBA 3MSCA 1NJ6A 3GLTA 4DIFA 2GN0A 1WJGA 2Y1EA 3FF4A 3MTGA 4IIDA 3ZU5A 3STUA 3V3KA 4ZHQF 1DAMA 4FDMA 4PR3A 3KQMA 5FBVB 5FTNA 2F4VB 5MN6A 2ZI5A 1KYIA 3KQOA 1GFWA 1WBJB 2OV8A 2FGKA 4QPZA 1SUCA 3O1LA 4D3FA 4F5ZA 1FIUA 2RAPA 3K9LA 3RARA 2KMLA 4U7GA 4Y6RA 5SY9A 3SLKA 3EF1A 1J39A 3OE7D 2MT9A 2GN2A 3NHWA 4LHSA 5H7XA 4S1NA 3R0JA 1PNOA 3L84A 4QT4A 3HYCA 4ZDKA 4N5LA 1J1IA 2OZEA 4R1QA 4EFDA 1XVUA 3QFFA 2GFHA 1SCUB 3FPKA 2OXIA 1W2HA 5DOZA 1PT5A 5JLAA 2C7QA 2BKEA 2C20A 6Q21A 2QB5A 1MX1A 2R96A 3GPDG 4LCJA 4ZK2A 4FCWA 1NQOA 3BT7A 4DA6A 1Y1PA 1I9CA 2PT9A 2IU3A 5TX7A 5GJWC 1A2QA 1P3DA 4KC0A 1AKMA 5TVGA 4CLEA 5JWRA 1XZCA 2HA4A 2N47A 3H4TA 1H1LB 1MORA 3NWOA 2YWFA 2VG8A 2G0NA 3IAS1 2OGWA 4FFPA 1FPMA 3UWPA 1M8PA 2M32A 3KPJA 3SYNA 3V8BA 2QGNA 4HTFB 1MN6A 3FB1A 1NC3A 4ZOAA 2ADMA 3CPEA 2FG7C 2HSDA 3T1QA 3TL2A 3ORRA 4YUYA 5EPUA 3K9NA 2XZLA 4F6RB 4YEDA 3LDHA 4C0HA 1NKVA 5EJEA 4I1IA 4Q19A 1V8PA 2FEOA 3M2TA 5K3CA 2IP2A 4N0DA 2CE7A 3CVOA 1KQOA 1ZWKA 3D0QA 3JPWA 4WY2A 4KQGA 5A5FA 4P92A 2O5EA 4Q4HA 5BRNA 4G0MA 3L05A 1ZG3A 1I7DA 4WADA 2F43A 4O4IB 3FDZA 4JYPA 3DXXA 3DZIA 3MJTA 3NVKI 2WMOB 2CV0A 4JLNA 2J3LA 4R7GA 1VMDA 3U62A 4YMTA 2QX6A 1ML3A 5IM5A 3SHTA 2J3MA 1QIIA 2OT3B 4EY5A 2VPTA 3ZIAA 3ADKA 4KH1A 1JTEA 4URVR 1AZSC 5K20A 4AKSA 1YZUA 4GUDA 1FSFA 2HK7A 1E5VA 2MSLA 1X7YA 4POAA 4DIDA 5JNTA 3EFBA 1IWBB 3AEKA 1ONNA 1ZQ1A 2E37A 3KHUA 4OM7A 3R76A 1YKFA 2PWYA 1ZYUA 4OQEA 4PCAA 3P45A 4X1KA 4BWFB 3PDWA 1V9CA 2ZUVA 3AF4A 3DC7A 1FNNA 3KRTA 3PLRA 5CDTA 3ASUA 5JARA 3A9UA 4YVFA 1K6IA 4BFCA 4DSOA 3KPVA 1JEEA 1P6XA 2Z43A 3IUPA 1V7ZA 4TXJA 1I30A 4WFKA 5E6UB 4MRRA 1O6GA 3BZWA 1ZL0A 2QHXA 3QOYA 4FS8A 4FNGA 3TFQA 4CKEA 2XUAA 1FU7A 4NWIA 2ERYA 3X1MA 4JEHA 1KBQA 2WKQA 4FXPA 4MROA 4QYIA 1GSAA 1DTSA 2ZBDA 1NYRA 1PD0A 2VTVA 3G13A 1G5FA 2H51A 4MV0A 5ANRB 5H83A 3FBGA 4KW7A 4RXTA 2YWCA 3RYCA 1PYDA 3DNPA 4YJ2F 3SF8B 2VP6A 2DLDA 3I8OA 1V5FA 4NJMA 1ILEA 2H00A 1UXKA 1RJFA 3WNCA 2O3SA 2P40A 1H3NA 2XAUA 3DAPA 5B4UA 3TI7A 2Z57A 2GK7A 2A88A 3QXSA 1J00A 3FDXA 4ZZ1A 5DHAA 1BE6A 4N54A 2OQVA 3BTVA 3EJ6A 2CXQA 3LMKA 5HCNA 2MMGA 4OUDB 1JI0A 4LJ7A 5I9MA 3OIGA 4QARA 4MCAA 2YVAA 4CUJA 3PTAA 4Q3CA 4Q6WA 2B20A 2QZSA 4D43A 4B3TB 4HDRA 5NULA 1K6JA 1FJ2A 2V8OA 2YWJA 2PVSA 2WP0A 3ABSB 4KOAA 3T34A 1P18A 4DRXB 3D5TA 2B2CA 2ZJ5A 4KPUB 4MYDA 4NRDA 3I62A 2ZWVA 1EX1A 2BR4A 2OCYC 2HLPA 1SBNE 3AV3A 2HFJA 1SCIA 2GYWA 4HY3A 4JNKA 4R2IA 4Z1MA 3WIEA 4ZDIA 1UPBA 3KYJB 1XMXA 2VYNA 3I42A 4I1OA 3RTGA 3WX0A 3FJOA 5EE3A 3PRKE 3AP3A 1E1QD 3QRWA 3ZD7A 1Q83A 5CB6A 1HBJA 3CZ9A 2CLOB 1TVEA 3Q8WA 1XELA 2VJCA 3TRHA 1FFXB 2F90A 2RD2A 4FJ0A 4QFMA 2XTZA 1ZCFA 3LXRA 1AGXA 4XLLA 3NHPA 3O94A 1B00A 5TPZD 2YVQA 1BXRA 3AFMA 3ZXIA 4FLMA 4DCUA 2P7HA 2ZETA 4IS2A 2WJYA 1WUKS 1J1ZA 2QIOA 4JN6B 5I7OA 2CXOA 1ZIYA 2F3TA 4DDTA 3HCFA 5BW4A 5EZ6B 4A5SA 5CBKA 4UNSA 1OH8A 2J0SA 1ZUWA 4B83A 2ZI6A 2J3DA 4EYEA 4E6PA 4LHWA 4N3CA 3HB7A 3VC1A 2ZYUX 3JAWA 4AJ4A 1XQVA 1JLMA 1YI0A 2B7CA 4Z3OA 4ENVA 4O4JA 3FTQA 2EGUA 5JC1A 4TT3A 4QIHA 1FRFS 2QN9A 2FSSA 4NBWA 3CRZA 1ZI9A 3WBKA 1NYLA 1K9SA 1DJNA 1THZA 3FJ1A 2P75A 2VRBA 4IDAA 4MV8A 5LA6F 4A2QA 2OWEA 2HJWA 3GCZA 2ZB3A 3VC2A 1P2VA 2YN0A 3L0YA 3LBHA 4L8YA 4E2XA 4MEAA 1WLSA 4ZN6A 2QMHA 4GIBA 3HNOA 2V6JA 4UVGA 5IARA 2BELA 1E2QA 1NYQA 5ENDA 1CZUA 2R8ZA 2PO7A 2PM8A 5B3LA 1GUDA 4OMCA 3P9ZA 1WXFA 3C16C 4ZVRA 1RLTA 3PGXA 3SMQA 1L8XA 1WOYA 3NYQA 1VXRA 2GCNA 3CWZA 2P62A 4MP6A 3VQTA 1ZO8A 4XA8A 3T41A 2PVCA 4YMHA 3HN7A 4ZZ2A 2WJZB 2VSNA 5DT9A 1F2UB 3UT0A 5B2EA 4IJQA 4DWJA 1Q6ZA 5EWMB 3DBLA 3QKRA 1JQKA 1A1SA 2NU9B 3JATB 1ODCA 3A1UA 5BMVA 4MKRA 1Z0KA 1L8AA 3TZHA 5MDHA 5B30A 2JVKA 1N8TA 2FW8A 3KUCA 4OMDA 4MQMA 4RD4A 3AM1A 3CX8A 4N3NA 1XAGA 3DQQA 5F33A 3W4JA 4Z0HO 4A73A 5KYWA 1X9IA 3DOIA 5LIPA 2CJWB 1GQRA 3RSOA 2E4ZA 4IZHA 2PLAA 3ROZA 1H2EA 3VVLA 5ICGA 4QXMA 2GS9A 3WQQA 2BR5A 1AU9A 1KJ9A 3TR5A 4WLNA 5E4TA 3HSKA 4G23A 1DAKA 1PFKA 2PA0A 5AVVA 3UNXA 2B3DA 1A72A 3H5NA 5IVDA 2VOEA 2R4UA 1KO5A 1G6Q1 4M1MA 5EMJA 4EDHA 4ZMRA 1L4LA 2BHNA 4OM8A 3LCCA 4ARCA 3GGSA 4HAYA 4D4KA 3PPIA 1B8UA 4CKCA 4L5JA 2OYSA 1SGWA 2WM2A 1KHHA 5KWSA 1OAOA 1DZ3A 2XCTB 1CT9A 1LQ2A 2KLHA 2N46A 4M1EA 3R74A 1CEYA 2AHOA 4Q0MA 1E7WA 4H15A 3QNWA 4LBYA 3UXYA 4B5LA 1R0RE 4LRUA 4LYHA 2D4HA 2P3LA 3AF1A 3KALA 1U28A 2IXGA 3LPCA 3WIDA 2BM9A 2W6ID 1YFZA 5HIJA 4OSOA 4W1PA 3PRJA 1F38A 3RVPA 3RGGA 3T7EA 3TTUA 2EFYA 2NVOA 1PWXA 1DARA 2HTFA 4R81A 4RVOA 3TL3A 2RGWA 2BLLA 1XDZA 4DLUA 4HQFA 1BVYF 4DM7A 2FZCA 3DNMA 2XNCA 2B0CA 3QFHA 4MB6A 5FYDA 2I67A 3HVJA 4G09A 4OQ4A 4CV3A 4RVGA 1P2TA 1U4SA 2WF8A 1GU1A 1NR7A 3W3AA 2QQ5A 4Q7EA 1AG9A 4URYR 3B38A 3IUSA 5IT4A 5JPCA 1KARA 1OZGA 2Y0DA 1Y0BA 4IGFA 1OKKD 2NZVG 4LK2A 2AK3A 2YRXA 2A4MA 2E2WA 2ZXFA 3PFHA 5TQ2A 3K5WA 1QH9A 4NP6A 3WHLA 1C4XA 2Q21A 1XLUA 4PXSA 1CHDA 5TS3A 1Q14A 1DCKA 5KJCA 5L6LB 3TNLA 3ZKWB 3EZFA 2QX4A 3OQ1A 4HF7A 3X1DA 4KUGA 2QN3A 2C0QA 2QR5A 3HA7A 1G3UA 1Q7EA 4YCDA 3ZHZA 4IJKA 4PFSA 4B8WA 4XARA 3V6MA 4ABYA 2HO4A 5CDHA 3NYWA 3I5XA 2P3QA 4FINA 2ACWA 2Q8QA 2UUBB 4LJAA 4Y1RB 1A96A 1HSZA 2CL0X 3MCVA 1AGNA 3ZXYA 5AW2A 2X5OA 3RT1A 1C9EA 1MJ5A 1JIXA 2AMVA 3A6EA 3NC1C 1JKJB 2BKUA 1XUOA 3PCTA 5E7IA 5G0WA 1RHMA 3UJPA 4RC9A 4C4TA 4CPDA 2RMKA 3ADPA 4EPYA 4GPTA 1J42A 2ZPTX 4HZUB 1XXHB 1S01A 3PI6A 4QYSA 4HNAB 2ZI3A 1SCNE 4EHLA 2OL4A 3V8NA 1CEEA 1M67A 1WD7A 2R25B 3EAGA 5G1OA 3PQFA 2O54A 2P9JA 4HGRA 5JLJA 2D7CA 1NJGA 1XVLA 6PFKA 5FWDA 3WWYA 2DR3A 5KVCA 1O5TA 1XEWX 1X7WB 2OO5A 4TLEA 3H1PA 3LRXA 3IB6A 2Q4TA 3FMVA 3W78A 2AFIB 1E79A 1JSXA 1M1UA 1QGDA 1S3IA 3OQJA 4YT5A 5ULLA 2Y0EA 4MI6A 4WKCA 4B4WA 1EA5A 2PZLA 4EY6A 1QK4A 2EARA 3JPYA 3BXEA 3QX7A 1OV6A 4G86A 2QXYA 1Y3FE 1L7BA 3HXTA 2N75A 2QTLA 2ZIXA 4FSDA 1SU6A 2VNIA 4Q37A 4AL4A 2Q3HA 1MQSA 1QZUA 4LTDA 2A4KA 1EM6A 3CKYA 2L18A 3VO8A 2CD7A 4AUEA 4RCYA 3ORQA 2GK3A 1ZCBA 1ZSNA 3MWJA 4QUJA 4DDUA 1II0A 4ZXPA 3OZIA 4PU0A 1FW6A 1X7ZA 1WIWA 2QRHA 1R0CA 5D3ZA 3IUYA 2VT2A 1A4IA 1UP6A 1N75A 3SQMA 2W00A 3JQ8B 3T7TA 1SWVA 1A50B 4LDJA 1D6SA 1L4YA 1RYMA 3WLFA 3CX7A 4HNTA 1ZVJA 4PZZA 4QPCA 3QUBA 4AY3A 1A77A 1GAQA 4MVJM 1RP1A 5HE8A 2ZCJA 3H2BA 1Y37A 5KSPA 2YJ4A 3VU3A 3WLMA 5FWXB 3U7HB 5DHRA 2HFKA 1FDOA 3V1UA 3LP6A 5FNVA 5AKEA 5K0LA 4A2PA 1G59A 1NONA 3A6KA 1UCFA