4MR7B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist cgp54626
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
415
structure length
403
Chain Sequence
b'SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 142
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr7B01
4G0QA 1Z26A 1RZRD 1XWWA 2WJWA 1TMYA 3UK0A 2PE5A 4QYMA 5B3JC 3OQNA 5DCLA 5DLEA 1UDRA 3O21A 3NNNA 4MQEA 1ZH4A 3JS5A 3CZ5A 4KQCA 2GKGA 4S05A 4NCAA 3LUGA 5JS2A 2QZJA 4PE5B 1ABFA 1DG9A 3F6PA 3QK7A 2PJUA 2FKAA 3OLZA 3TB6A 1SRRA 5GQSA 3IP7A 2CHEA 4MYRA 1BDIA 3OLWA 4YS6A 1JYEA 2FN9A 3BRSA 1MIHA 4O1HA 1YMVA 5FWYB 1D4ZA 3Q7TA 1Z2EA 3UUGA 3EODA 1DCMA 5FWXA 2IPAB 4Z9BA 1W9HA 5T7BA 5EWJB 1QQBA 2WY2D 4HNRA 3FGZA 4O5AA 3C3WA 3CRNA 3GV0A 3Q15C 3RH0A 1DBQA 4RY0A 1E6LA 1QO0D 1P2FA 2AYXA 3H5TA 1ABEA 3ILHA 5IX8A 2PUBA 1KRXA 5KQPA 1CEYA 2NZVG 3MIZA 3OO0A 1Z16A 2R25B 3TMYA 5KQGA 3E3MA 3H5LA 3GT7A 3RVRA 3C6QA 4EYQA 1P8AA 4KZKA 2MYUA 4MR8A 2E4ZA 3F73A 1OXKB 2QW1A 3MMNA 4RK4A 1RXIA 2JVJA 3VNBA 1OXBB 1K66A 2LBPA 3CKMA 4F06A 5CNMA 1PNRA 3QLVC 3JVIA 1LJLA 4MQEB 3MA0A 4OG2A 3LUHA 5CHYA 1YK1A 2B4AA 3QX8A 1VPWA 1ZVVA 4EYOA 1Z12A 2FXIA 5TE9A 2FVYA 3BBLA 5BRAA 4YO7A 1JFSA 4W5NA 4LE0A 1ZDMA 3RQIA 1JBEA 2ID7A 3DGEC 1P6UA 2MSWA 3SM9A 1DBPA 4JP1A 3OQMA 4Z4EA 4Z4HA 2IKSA 4W5TA 1JLKA 4PYRA 2A9QA 3H1GA 3LOPA 4Q6BA 3FFTA 3QLVA 3G85A 4XAQA 4ETNA 5FWXB 4P1ZA 5D2CA 1ZGZA 2WMYA 2PKXA 3RVOA 4KREA 4KPYA 3DGFC 5JNVA 3HCWA 3CG0A 1PUXA 3QEMA 5GOTA 5KI6A 2WJAA 4NQRA 2IPLA 4ML3A 2CWDA 2A9OA 2RJNA 3OM1A 4DN6A 4W5QA 5IEBA 2RDMA 3QLTA 3KTOA 3HUUA 3O2QB 4MR8B 1LBHA 3D8UA 5IUKC 2ZWMA 1QPZA 1QP7A 2V0NA 2P9HA 4G86A 2PL1A 4LE1A 3FFXA 4FB4A 1WETA 5I4CA 3G1WA 1DRKA 1SXHA 4RY9A 4E7PA 1EWKA 1JF8A 4ZYLA 2R48A 1K68A 1KMIY 3N0XA 3LKVA 3M6MD 2M98A 4RSMA 3EJWA 4ZPJA 1PEAA 3M9XA 5IUNC 2R47A 4EYKA 4N47A 5HKOA 2JCGA 4M88A 1EHCA 3H1FA 1ZY2A 4IRXA 4D6XA 1GCGA 4Z99A 1MB3A 4UHJA 3HDGA 2WWVD 4Z4CA 2H3HA 4KRFA 1FFGA 4KQ9A 1RXEA 4N76A 4WWHA 1JYFA 4S04A 4G0PA 1JHZA 1JX6A 2JVIA 4KK4A 5PNTA 1DC7A 1U04A 2LP4Y 4ZJPA 4RK6A 4YV7A 1RNLA 1DCFA 2L17A 3KYIB 3LUCA 1TLFA 1DP4A 1Z25A 3CLKA 3MF4A 4ZMRA 3LUKA 4YGXB 1XHEA 1M5UA 1Z15A 4QYWA 2JK1A 4JB0A 1YK0A 3A0RB 3IPAA 4PEVA 5JNRA 3QEMB 1EWVA 4WZZA 3FFWA 1YTUA 1PNTA 2ID9A 4G97A 2ZAYA 5DKFA 5B3JA 3SNKA 5HM6A 5KC9A 1FSPA 3EQZA 3CHYA 4NICA 4RDCA 4Y9TA 1HEYA 2J48A 2VYCA 3NBMA 4MR9A 2FMIA 3JPYA 4G0XA 3OLYA 3TD9A 1R8JA 4FE4A 5IC5A 3IDOA 4GPAA 1E2BA 1QP0A 5KC8A 4KMRA 4RXMA 4RK0A 4ETMA 1APBA 4XFKA 2E4UA 4L4UA 3CNBA 1BDHA 2FQXA 4W5RA 5TQ2A 1SXGA 3HK2A 2PUDA 4D74A 3MYYA 1NTRA 1YIOA 2FEWB 2L2QA 4NCBA 3KSMA 3LFTA 1NATA 4RWEA 3GL9A 4TLLB 4Z0NA 1S8NA 1VLZA 4NV3A 5CNKA 1NXVA 4DQDA 4EUKA 3I5AA 5BQ3A 3DLHA 2MYNA 3RVLA 3H75A 1DRJA 4RKQA 2LPMA 1CHNA 5JNUA 4WT7A 4O1IA 3CFYA 1RPJA 8ABPA 5HSGA 3HZHA 3JVDA 3BRQA 3KLOA 3QELA 5FBKA 3B2NA 1GLGA 1FFWA 4RK5A 9ABPA 1A04A 5ABPA 3LUDA 3H5WA 3I09A 4JOQA 5DGCA 1BDJA 1D5WA 3GRCA 2FEPA 2GBPA 2PLNA 3H5VA 5TPZA 4OLBA 4IGAA 3HV2A 1LJUA 4OATA 2HQOA 3CS3A 4JB2A 4MS1A 3T8YA 2HPHA 1W25A 4XXHA 3SG0A 1XHFA 4FE7A 3O1HB 2NT3A 3IP5A 3Q41A 4UHKA 3F7NA 3IPCA 3HXMA 3JTEA 2IPMA 2L19A 3N75A 5EWLA 2P4UA 3GBPA 2WRZA 2PAFA 4OTZA 2IPNA 4LDZA 3KYJB 1MVOA 2E4WA 3RVJA 1VRVA 4MRMA 1M2EA 1TJYA 1L5YA 2L18A 2MYPA 4MS4A 4MR9B 3O2JA 3KKEA 1QNLA 2FMHA 3I42A 3HVRA 3OMWA 2YHBA 2JBAA 1M2FA 1IIBA 1Z2DA 2FSPA 1QKKA 3L6UA 3Q9SA 2FMFA 2O20A 2QR3A 1C4WA 4F11A 4RZSA 3RVKA 2FQWA 3H5IA 3BILA 3HSYA 2VUHB 1Y1LA 2QVCA 2R4QA 5TQ2B 1CYEA 3IP9A 1ZN2A 2E4VA 4F3TA 4DADA 2NZUG 2MSKA 3OLVA 2PUAA 3HJFA 2VUIB 3GBVA 4TN5A 3EAFA 4LDAA 5TPWA 7ABPA 1NY5A 2FLWA 3URMA 4RV5A 3LKBA 3D02A 2FQYA 1AB6A 2M1ZA 4XLTA 2DRIA 3OQOA 3N8IA 3VNAA 3O1JC 4IMJB 4G0ZA 3H1EA 1U2QA 2I6FA 1L5ZA 3DLBA 4H3KB 2KYRA 4JAVC 1SXIA 3KLNA 2B1JA 4GNRA 1KGSA 2NT4A 1GCAA 3QELB 5TQJA 2MYTA 3RVMA 1A2OA 2W42A 1F51E 2N9UA 4RS3A 1Z17A 1MAVA 3NHMA 4G0MA 2YHAA 2A9RA 1PEYA 3T38A 1B00A 4XARA 4OLAA 4MS1B 4RU1A 3SQNA 1URPA 5E3JA 3LTEA 4EGSA 1ISSA 1ZH2A 1F4VA 2E4XA 4KK3A 5EWLB 4F12A 4EY3A 2PUGA 3LUFA 3A10A 1JWLA 5IEJA 4KNYA 2TMYA 1LBIA 1FQWA 1NXTA 2PUEA 4RK1A 1AB5A 2PMCA 2QU7A 2E4YA 6ABPA 3GYBA 2FMKA 4YCSA 5C5CA 4MRMB 5EWMA 2HJ9A 2LIVA 1QQAA 3OLXA 4MS4B 3NNDA 1JDPA 3RVNA 3A3KA 4ZMSA 1RZRA 4Z4IA 2WB4A 3QEKA 3K9CA 5ED4A 2CD7A 3OM0A 4YP9A 2JBAB 4YLEA 1JFTA 1VKRA 1NXWA 1JDNA 5TQ0A 1ZAYA 3CU5A 3SY8A 1EWTA 1I3CA 2GI4A 3C97A 2IDMA 1BAPA 1P6QA 4KVFA 5IULC 1U0SY 4QPJC 3HO1A 2OENG 1FFSA 3W9SA 4MR7A 3QLUC 2BGGA 5DTEA 1DBWA 3MM4A 2QV0A 4WXMA 2PL9A 5IBQA 3Q7SA 1USKA 5JNWA 5TPWB 3H6GA 4MPTA 5T3YA 3LUAA 2LUOA 4YR7A 2QSJA 3F6CA 1JH9A 3O75A 2PUFA 3KS9A 2X7XA 4Z4GA 3O1IC 1SD5A 1C0EA 3HDVA 1ZHHA 1EAYA 1BVHA 4H60A 1USGA 4HNQA 3CTPA 4KFCA 3RVQA 1DZ3A 4E7OA 3JY6A 4YRZA 3TO5A 1D1QA 1NXXA 3EDCA 2QVGA 2A9PA 3QLUA 4TLMB 4N03A 3TX6A 1QO0A 4LRQA 1YMUA 2OQRA 3CZCA 3HEBA 1NXOA 4KV7A 3O74A 4TMYA 3ROTA 1DJMA 4IF4A 4LZLA 3H6HA 3N6VA 4H3HB 2JVKA 3LUJA 4MS3A 2HSGA 4L85A 3EQ2A 4N41A 5JNTA 3ROFA 3I45A 1M5TA 1KRWA 4RXTA 5CNIA 2FLKA 2H0AA 3FDFA 1D2AA 5EWMB 4JASB 1U8TA 5CNJA 3MQ4A 5TPZD 4EVRA 5C5EA 5JNSA 4W5OA 3HUTA 1J56A 2VK2A 3E61A 1NXPA 3UKJA 4Z4FA 4B09A 1E6KA 2FN8A 5TQ0B 1QP4A 1ZESA 3RVPA 3KHTA 4MAAA 4WUTA 3A0UA 3P9YA 4Z9AA 4F8JA 4MR7B 4IILA 4EVQA 1USIA 3HM9A 3NNSA 4CBVA 5BRJA 5JS1A 4HYEA 4JA2A 4N0QA 4MQFA 1QMPA 3ILYA 3H5OA 3KG2A 1NXSA 1YS7A 5BR1A 3JPWA 4RY8A 5KQMA 1D1PA 3EGCA 4Q6WA 1H9CA 4RK7A 5F64A 3SAJA 2FEKA 3NHZA 1MB0A 1ISRA 4MLDA 2JB9A 1TVMA 1JFVA 1ZGGA 3GWGA 4IMIB 2QXYA 2F8SA 4HNSA 4N0PA 3R0JA 2NUBA 3L49A 4Q7EA 3OMXA 2HQBA 3DBIA 3S99A 4D6YA 3K4HA 1GUDA 2IYNA 3EULA 1BA2A 3M9WA 2CHFA 4P98A 4EYGA 4RKRA 1DCKA 2GWRA 1E6MA 5HQJA 2XDYA 2RGYA 4EVSA 1JL3A 1YS6A 3C3KA 4RXUA 3C3MA 4PZ0A 3FMVA 1Z18A 4PICA 5IUJC 5FWYA 3Q7RA 3T95A 4YWHA 1ZITA 3CG4A 2RJOA 3O2SB 4WXEA 4MS3B 5FBHA 1PHRA 5KQLA 5KWSA 3DZDA 3QX9A 5EWJA 4G0OA 2AYZA 3BREA 2MSLA 3RVSA 3GA5A 3OO1A 4XASA 2FW0A 1TM2A 1T34A 4LE2A 1EFAA 1YVUA 2JRLA 3KCNA 3T6KA 1LK0A 3HS3A 4MGEA 3N0WA 3N53A 1A0OA 3IP6A 6CHYA 1U2PA 3N0RA 1GUBA 1Z13A 2Q5CA 2IOYA 2PUCA 2F8TA 1DC8A 4OBBA 4MLCA 4LX8A 3KJXA 3LMKA 2GX6A 4QICA 4G0YA 4ETIA 2HQRA 2FTKE 4MQFB
chains in the Genus database with same CATH superfamily
3P20A 4YALA 5AW2A 1YT5A 1Z0SA 2CXHA 5L51A 1VIVA 1U3GA 4HGRA 2UUPA 2EFDB 1RAAA 2QTWB 3V4FA 2YNMC 3GMTA 3M6FA 1UF9A 4RSRA 4IJWA 3OIWA 2CJXA 1WL8A 2G9ZA 2R7AA 5I4BA 2CXTA 5AM0A 1CFZA 3E8MA 5BURA 3CPSA 2HBYA 3QXXA 3HKBA 1XNJA 2Y93A 1DKPA 1BW9B 2AI1A 2XQJA 2O1WA 3OZAA 4WY8A 5GJBA 3HCCA 3TB6A 2AYYA 1RQ7A 1EUQA 5EKXA 1U0GA 2HXYA 5JPIA 3NS7A 2EOAA 5SZHB 4WZAE 4E94A 5DLYA 1U7PA 3B78A 1A88A 4FGSA 3RU7A 2FE4A 3WQRA 5AM3A 1M72A 3F5DA 3QKTA 4S1NA 5AJXA 5JR3A 3LP8A 3Q40A 4PF1A 3BH6A 4U2CA 2BLNA 1Q1NA 2OOKA 2C4TA 1KI4A 2AE1A 3KQNA 2DKNA 2GPAA 2ZPTX 4LK2A 3VSBA 5CVTA 3HB1A 3DXZA 2JIBA 4Z1MA 2XUQA 4E5UA 2IGTA 1O54A 2YXDA 4R2IA 3ETHA 4PG4A 3VQTA 5BWOA 2FR8A 1VKNA 1TK3A 3DMRA 1P1HA 1P7CA 3WLHA 4JEIA 1Y9DA 4M1YA 5AI5A 5FJIA 1WCXA 4BCBA 1CUXA 3TFOA 3ILHA 3LVQE 3OWOA 2PUBA 2Z3VA 4V39A 1II0A 3NDIA 1DDGA 1B8OA 2B21A 3MPOA 4RH0A 3D7NA 3LY7A 4LDQA 1XCGB 1ZGJA 5F73A 3VDMA 4F5EA 1GZ7A 4BATA 4MR8A 1E9SA 3I64A 4UZSA 5FHQA 2O06A 1H65A 1XWFA 4OHXA 2YW2A 1QFYA 1E6EA 3M5WA 4RORA 2YXLA 4BNDA 3PNKA 4F4DA 1DARA 1GQQA 2ECKA 2XRYA 5EJ4A 3WK9A 4HATA 2AJCA 2HA3A 5T4HA 2H0QA 2OP0A 2WLSA 4B5LA 2PZMA 3ECCA 1TB4A 2NQ2C 1YRBA 4GPBA 2YOFA 1SUWA 4J29A 5EQJB 3JQ7B 3AKDA 3UJ6A 1FDSA 5K8IA 3SXPA 3NBQA 4NCNA 4ZZ1A 3JV7A 4KQGA 1LS1A 3O4HA 5EUBA 4JOSA 4CQMD 4L50A 3UA4A 2D2EA 4FCVA 5DYIA 2ZPAA 1VKOA 4DA9A 4DANA 1G2OA 3R09A 4JWTA 1QCCA 4B44A 1CUSA 1ENZA 1D1TA 1Y3IA 1GP2A 1PSDA 3LOPA 3K05A 4XAQA 5D2CA 3ZIAA 2BJVA 2QZPA 1DG1G 5B6JA 5JT1A 1M7GA 4XUDA 2P7HA 2II6A 4F93B 2H65A 1E7YA 3WJ2A 1OJLA 1K7CA 2WWFA 3PUYA 4EG1A 1KZGB 1B23P 2Q5FA 3VOSA 1KMMA 5G2OA 5ADUS 3O93A 3LLUA 2E55A 2RMKA 2XUFA 1CZOA 1E6UA 4K88A 3ENQA 1G8AA 3GLUA 3I5XA 2XYHA 2FZVA 3WZMA 1F5SA 1HY3A 2O7RA 4G5XA 1YZYA 4KN6A 3SK0A 2DB3A 1S1CA 3CNNA 1XD9A 4MMZB 4GRDA 4F86A 2JLXA 4TS9A 3QLTA 1DELA 1C7FA 2D1YA 2FWAA 3OCJA 1TKRA 1UXKA 3EISA 4JYCA 2V0NA 2WG0A 3MEQA 4R1LA 5K4GA 5A4KA 2V55B 2PLWA 3VZCA 4UPDA 1R5NA 2PMFA 3EIOA 3PKZA 4A27A 4RY9A 2ZKLA 5SY4A 3FOAA 4AJ2A 4TXLA 3OHMA 3H11A 1QZTA 2PQMA 4ZVKA 3HYNA 1Y33E 3IBGA 4FHZA 1WXEA 1NMYA 2B4YA 1KI6A 2ASVA 1W52X 2WD8A 1ZXBA 3UXHA 4N47A 5K99A 1MDBA 2MU1A 4I5FA 4QELA 3JRXA 2F9FA 5BSUA 4DRYA 3A4NA 2PG3A 4S1TA 3CSUA 3EUWA 1PTJA 3TB4A 1MG5A 1PG0A 4B85A 5A3RA 1C7EA 4TTPA 1U8XX 2GLXA 3H8VA 3ZNQA 4KQMA 3RSHA 3N2GA 4DKXA 5LM3A 3DNMA 2E37A 5T67A 3FPAA 2B0CA 2H52A 3ED5A 1TO2E 3GI1A 2R4UA 4GLJA 3D7MA 4XEHA 1ND6A 3I6IA 3RRZA 2IPOA 2QTFA 1U3CA 3D6AA 3H0EA 3QVUA 1R0CA 3KTAA 4PQYA 1ETHA 4IH4A 4QU8A 4R8RA 1DVRA 5EMMA 1IZ7A 5DSZA 2JKYA 1ELOA 2ON6A 4JROA 4NSNA 4U7FA 3M6XA 3WL7A 2HW8A 5JH7A 3DT8A 1U90A 1JDSA 1ZK1A 2EHDA 3UCFA 3VNRA 4BFLA 1Q77A 1DWOA 3VVCA 4KPUB 2J32A 2O0JA 3DBLA 2H48A 3AY0A 4O2AB 3ETJA 4Y6GB 4ZI5A 1DJQA 4DSNA 2RHJA 4MVJD 4OLHA 2YVKA 4QDZA 3SNKA 3ZWQA 4EG4A 3AM4A 2AFIB 3LVFO 5L4LA 1AY0A 2YJGA 3GHYA 2J48A 3OIVA 5GPBA 1QE3A 1EDOA 2FMIA 4FEEA 1H4VB 4W7HA 2QLMA 3MTQA 2JFBA 4BC1A 3P9NA 4PO9A 2AUTA 2H3EA 1ZGBA 2PD6A 1L4BA 1EGHA 4HN4B 3ZHRA 2WJ3A 3PXUA 2G06A 1APBA 2XD9A 3L7IA 3IOYA 1FSSA 1JR2A 4WKOA 4HH3C 4PCLA 4TWZA 3HYLA 4LGVA 1VKJA 1W1IA 4CMKA 2PCLA 2H4JA 1SG6A 3A1VA 1B42A 1HT1E 1NTRA 2FHSA 2GPNA 4E5KA 3KYCB 3LFTA 3Q7PA 221PA 2MMGA 3GL9A 3WXMA 1NU8A 3ZHZA 3E53A 2BDEA 4BO4A 3DLHA 3KOXA 1AS0A 1W9MA 4IS2A 3IFSA 5KVQA 3JWGA 3ZHBA 4IIXA 4DBZA 4LRSB 1J0EA 1Z36A 2KM1A 2VHZA 3FSJX 3OJLA 4O1IA 5LA6B 3CFYA 2ZWVA 1ZRNA 4FKZA 2NLOA 4AXXA 1NI5A 1U0OC 4RLFA 1FNSA 3H13A 4FYXA 5DHAA 4V02A 3INRA 4JP5A 3NR2A 1N4DA 2VWQA 3PFHA 4MV0A 4P22A 5HX7A 2H1IA 2ZB3A 4G1UC 3D1LA 1L5KA 4I8IA 5IDYA 2REOA 2VQ6A 2PUWA 3KUKA 5GTDA 1QU3A 4UFOA 2CXPA 3L6OO 1KI7A 1WHSB 2P90A 1BCSB 1P2VA 4ZV4A 3DLPX 4MS1A 3NM6B 1P0CA 2ZKIA 5CXUA 1KHHA 1L4HA 4QOSA 4FE7A 4L4XA 4UHKA 1FYWA 3BS4A 4OJTA 4PU0A 1N2JA 3AFGA 2IPMA 3OOWA 2GK7A 4IKOA 3ZE7A 3SF8A 1Z0DA 4O4JF 4FS3A 4I3GA 1TDJA 1GIAA 3EGDB 2P9GA 3GEHA 3IAFA 2Q6IA 2X5JO 2HSZA 4FOPA 4UBMA 1SCUA 3TTYA 1DUSA 2BW0A 4YO8A 2YOGA 4C08A 3R7WA 4A6XA 4MCJA 1T9ZA 2QDKA 3LCMA 3G2MA 2HGZA 4NYIQ 4ZDIA 4PLZA 3KKEA 2NO7A 3EBPA 3I42A 3MG9A 1HKUA 1EEHA 4Q01A 3CSDA 5F35A 2W2KB 4HVTA 1TPZA 1BMTA 3ICVA 1CY8A 1FZQA 4GOMD 1YASA 2QR3A 2R8PA 3DONA 4OL9A 1CS0B 1YVEI 1XZPA 2FQWA 4H3VA 4RZSA 2VDKB 3FH0A 3KVVA 4E2XA 1TF7A 4YRJA 3USES 3DAFA 3C24A 2VHUA 4EGQA 3ZEAA 5DW3A 4DDMA 4NOJA 3PGKA 3NALA 4B3RB 4XB2A 3DOHA 3QXJA 5H80A 5FI3A 3AP2A 2QG9A 1T8WA 4LQCA 4IHJF 3I6ZA 2QSUA 1ONPA 2R6JA 1D03A 4G0ZA 1PT7A 1TC2A 5F2EA 1FK8A 4TL8A 1LTQA 3R0XA 2ZR9A 1MUUA 3LHSA 5CVDA 2ZRBA 1GCAA 4F9FA 4HBZA 2MTBA 2ODBA 4TN1A 1ZKDA 3W0LB 3K4QA 2WAYA 5IJXA 1WABA 1I4LD 2ONJA 1E4YA 1EJBA 2DBVO 2JGKA 2OGSA 4CLOB 2MR6A 4Y2GA 3IDQA 3WTCA 1THZA 3D0QA 4IZ6A 1LC0A 3AR8A 1MV5A 3GR6A 4MV9A 2GN9A 1P2TA 3AEZA 4KI7A 1B00A 3MBKA 4EWLA 2H2HA 3CUTA 3E9NA 4WA8A 2OSVA 1NE2A 4JKYA 4DMGA 5K0TA 4GF5A 1KMHA 2QQGA 3K8OE 2O3RA 1VLQA 5ALJA 4B3XA 1FZTA 2K7ZA 1NVXQ 2N0SA 5BN5B 2ZJFA 3FNGA 1LBIA 1M3SA 2PUEA 1NVUQ 1Y1PA 4RK1A 5AJYA 1ORTA 2O3QA 4FFWA 4KAAA 5BQPA 5AVUA 3GYBA 2IDJA 1YR6A 4QC2A 2OLKA 4QO8A 5B58T 3RB8A 1AOXA 3AOEC 2ZJBA 3WSVA 3AR9A 1EDZA 3Q3JB 3LQFA 4AS2A 2JFFA 2JGFA 3GAZA 2B98A 3MWDA 3N7TA 4ZMSA 1RZRA 3GCXA 3K9CA 2J8ZA 4QOFA 5DNUA 5CFQA 2JLSA 1V1RB 3HC7A 3KBBA 1N2CE 1NXWA 3PHGA 2QMOA 2Q5LA 4WCFC 1K06A 1PO7A 3MSCA 1IB0A 1J2YA 2HDHA 1EWTA 3LWZA 5M3BA 5JJKA 4Z0PA 3EWAA 1I5RA 4M9RA 3AILA 4WOKA 3PYLA 1KYYA 3FFAA 3E7FA 2PFKA 1YDHA 3PI7A 2P78A 3A05A 3N58A 3Q72A 4BWGA 4P33A 2X8JB 3DPSA 4B9EA 4JC5A 4B7XA 2O8FB 3RK4A 4NU5A 5ALKA 5F1OA 1EINA 3QWIA 1MO5A 1UOEA 2J08A 2OFWA 4N5HX 5D5HA 3R4CA 3MMPA 3S2ZA 5DGIA 3PNLA 2FWIA 3JQBC 1YA6A 1KZ1A 3C6BA 4M83A 4GL4A 5EPEA 3WISA 1UIMA 2BHTA 3WLEA 3ZBPA 4U39A 3W05A 4FFPA 1C0EA 4YMLA 4F56A 5H1YA 2DLCX 1DXQA 2XIJA 4IIBA 3JZAA 1DAOA 2OWDA 1D4OA 3MFYA 1Z2NX 1RYDA 1ZJ5A 4RVDA 3RD5A 1HGXA 3E58A 1UADA 3F4LA 2G0NA 3VHLB 1Z9BA 3SE7A 2GJAA 1QWSA 2O0LA 4JLPA 2ZYWX 1MT3A 4X1IB 5LD2B 3ACBA 4ENPA 4LZLA 3PRHA 4HGNA 3N6VA 3OJFA 3K1ZA 2OAEA 3B3QA 3PNQA 4WHMA 5L95A 3D0OA 4YY3B 1DWQA 1K98A 3I45A 4NENA 2NO9A 1SZJG 1NF8A 2F67A 1YRYE 2D13A 4L5AA 1KRWA 1QFJA 2B0JA 4PX5A 4R0VA 2ODPA 4PM4A 1N6HA 5A2QA 1EEXB 4ENVA 4JN6B 5CNJA 5CX4A 4GOXA 4HNAA 4D44A 3NWPA 2AOUA 2OCYC 4JOCA 4FC6A 5DDIP 3UM9A 1KNXA 2NSJA 2WZDA 1P62B 1SC1A 2OCXA 1ZESA 1O4VA 2V8OA 1TEXA 1U1EA 3I39X 2P79A 4PZPA 5UKDA 3ZXXA 3OQIA 4M9ZA 4O0LA 2QL7A 1RLOA 3H6KA 4IYRA 1I51A 3L8CA 2A7XA 4NK4A 3DW1X 1GPDG 1RWMA 2P9CA 4Z9AA 5K3BA 4BB5A 1BJKA 2A3NA 1JLHA 4ZO4A 3JALB 3ORYA 3TSYA 3ZCSA 3PZRA 4GGPA 4UW9A 1IXRC 4QA9A 1LU9A 1Y5MA 4MQFA 4QGBA 2J0UA 1PJAA 1T3GA 1G7RA 3H5OA 3T7IA 3VO2A 2Q27A 5L7YA 1OAKA 1Z8FA 4C07A 1M8JA 4IO1A 4L8GA 3A1CA 5D6OA 3U7FB 3SAJA 1IN1A 2LKDA 4RIHA 3UNXA 1MB0A 3OZSA 3PQ6A 2AHOA 1TVMA 1V5GA 1HTTA 2IL1A 5CVVA 3WYEA 3GARA 3ZCPA 3KUXA 4C7OB 1WPXA 5CCDA 2KMLA 2O2ZA 2F8SA 4RESA 1TCCA 2IBTA 3OZ7A 5EUQB 5TVKA 3IVMA 1BA2A 4YN3A 3OOJA 4ZZ3A 2WSYB 1L8AA 1TYCA 3F3MA 2AQIA 1UBHS 3N59A 2IS1A 1A9TA 3K0SA 5M34A 2QM3A 3KDPA 3ONDA 4C87A 1Z18A 1Z83A 2EQ5A 3B3AA 1QWOA 3DMHA 4B2YA 3WB2A 4BPBA 3RT1A 3L79A 1BU5A 1ZITA 1GDHA 2IXEA 1HDGO 1O97C 4YFYA 1C81A 1N6KA 2HSWA 4XGNA 1E3DA 2OZLA 2W2LD 1UINA 3WNDA 4C21A 5IT5A 1UM8A 3RFXA 1CJMA 1CYDA 4KR2A 1LVGA 1ULSA 2MSLA 1A97A 2IIVA 2W22A 3C8DA 3GLHB 3HDTA 4PSKA 5KYTA 1XMXA 3RS3A 2NAFA 2E87A 3CVYA 3DZ8A 1TPYA 1MVNA 1HDZA 1T34A 1ZBQA 1BHJA 1BJTA 1S1MA 2C77A 3CBQA 3HS3A 2AG6A 3FMIA 3JSXA 1SA0B 4D9EA 5ADVA 4Y2YA 1QRRA 4CEHB 4HAXA 2Z8XA 3N0RA 3FOFC 4J6FA 5KVVA 1Y1SA 1X1EA 4ZVOA 2A9JA 1EAMA 2GMWA 3I3SR 3NVAA 5FTJA 3TAXA 3AXSA 3BAFA 4PNEA 1M6VA 3BEDA 1I0ZA 1QG0A 1JBKA 4HDSA 5AYVA 5C3UA 5SZIA 2H92A 2ZBDA 3ESRA 5C1PA 2QB5A 1NT2A 3FVTA 4NFHA 2PWBA 3BA6A 1HNZB 2HQRA 3LCCA 1F1BA 4AT1A 3ZZ0A 4KCGA 1B2LA 3GJTA 1PU2A 2WJWA 2G17A 3FAZA 5B3JC 3IOCA 5U9CA 3DG9A 2H7XA 4BB0A 1QE5A 1Z4QA 3D43A 3DZFA 3FE2A 3QU7A 4PZUA 3MW8A 4TRNA 3ZOKA 1Y7PA 1NLYA 1EVLA 4KQKA 4ENSA 1ZI9A 3G9UA 3IEPA 1K88A 3M1YA 3PPIA 2ZWAA 1ZA1A 1E8MA 1KAEA 1SVKA 4BLPA 1C8LA 4NCAA 5JS2A 2GEJA 4DDTA 2O2JA 3FUWA 1U3DA 3DE5X 3IERA 1D2RA 1KWGA 1M2NA 4UCQA 4D4KA 1EUZA 3PJEA 1MC8A 4G5RA 4LF9B 1QANA 2NSLA 3FJ1A 5D6NA 2C5EA 3AUAA 4JUIA 2VUTA 1HLFA 1O3YA 1TT5A 2EZ9A 3U7HB 4U3JA 2HU8A 2NU6B 5KYNA 3ZDXB 1I4WA 1N2BA 3P9ZA 3VYRB 4H0CA 4DNOA 3CVUA 5IJZA 2IPAB 3FTCA 5T7BA 5KB3A 1S4QA 2BUCA 4XFDA 3WAJA 3LW8A 4HEA6 3U9TA 4H7JA 1GXSA 3IE1A 2P3SA 4Y30A 2NPFA 4A15A 1ZU5A 3PC8C 3MUEA 1OX6A 4RWZA 1UKAA 4DV5B 1OLXB 1VL6A 3IV9A 1OA1A 1VYVA 2PRKA 1MRSA 2A78A 2GBIA 4KOEC 3H16A 2C8VA 5AXAA 3N2NA 1CUBA 1MO3A 2C20A 2F3TA 3DULA 3L1KA 3WWCA 3ZU2A 1Q11A 2C7BA 4HWRA 4KR3A 2NZVG 5GONB 3GVHA 2H2IA 4LZOA 2HMSA 4OQXA 4CI9A 4HC4A 6LDHA 3AEUA 1RBYA 3RVRA 5JDIA 3WHLA 5F51A 3RSOA 3L8EA 4RUKA 3LXMA 2WM2A 3DB1A 3TJMA 3USZA 3E7WA 3ZWVA 1R18A 3AQIA 3GNSA 2Q29A 3B1JA 3WK6A 3LYHA 1OQAA 2X8AA 2D4AA 1P1RA 5L6LB 3C85A 3HHPA 5H83A 1ZRMA 1K7YA 5AP9A 2C3UA 4OSEA 3NLLA 3QLVC 2C5HA 2VYNA 3AR4A 1P3DA 3RABA 3I6MA 5K3DA 3J80A 1MR3F 2G8NA 4YBRA 3WK5A 2HWWA 4BMOB 3LUHA 1ZJWA 1KSFX 4ZQIA 2OVFA 3PC3A 4YVFA 5HA5A 5B55A 1P39A 2UVQA 1LEHA 2NGRA 3KFVA 3SSNA 2F3SA 4GO1A 4LE0A 2B2XA 3OD5A 1WS6A 4F1JA 4LHWA 1UOQA 1W29A 3CUSA 3SJ7A 2XE7A 4YB8A 1JLKA 3GMSA 2DHRA 4BQOA 3SHWA 4YAIA 3PFCA 4QXAA 1RWWA 1DQYA 2OBLA 4HOYA 2JLYA 1F0PA 5CCEA 4RPKA 4E6PA 3RK0A 5I9IA 3FSRA 4YEDA 2PX5A 5BWNA 3I9NA 2EP7A 4KMOA 3EAQA 4CR6A 5FEUA 4PS1A 4BGDA 3N8GA 1PNOA 3QXGA 2IV3A 3DTYA 4URWR 3ABSB 4RHYA 5JNVA 4X24A 1XYGA 2J5XA 5A3VA 4BQFA 3I30X 3LJKA 2C5LA 3BXEA 3IQHX 3QEMA 5AUNB 2ZM5A 2F62A 3FROA 3GMDA 5LLDA 5D1HA 1KEKA 2KS6A 1L5NA 1MPTA 5EXPA 1IUPA 5ELXA 4R2WA 1ZJZA 3D3WA 2PJZA 4R7ZA 4LMPA 4BNYA 1SUCA 1M83A 3MMXA 1N2XA 3ORRA 2XAAA 2AT1A 2NACA 4M86A 5EEGA 3PNMA 5H68A 3BTVA 4RHXA 3RLIA 4BDTA 2JDID 1WG8A 4IDNA 4RQBA 5IKOA 5JVDA 2GVNA 2ORVA 2ZROA 3LBNA 3QF7A 5LZ2A 3DV9A 3T7SA 3WLRA 2Z2JA 4II7A 5I4CA 1DKQA 3LNTA 3E9CA 3AZPA 2GR9A 1UFOA 1W5BA 1Q7BA 3AR2A 2O2XA 1U3UA 4L1KA 5SY6A 2OAQ1 3B1KA 4CV2A 1XJQA 2IZ1A 3EXHC 4ZZIA 3EYWA 3UF0A 4V1CB 3WI7A 2J87A 16PKA 3BULA 3ENKA 4ZPJA 3HY6A 1G41A 3FCCA 1ORDA 4BQIA 2B5WA 3UW1A 1U8UA 2QTHA 5DWVA 1I13A 1EHCA 3JD1A 1SD2A 2IXTA 1LH0A 4MWTA 4IRXA 4TL9A 3QA3E 1GCGA 1I4TD 4GWGA 4Z99A 3WIEA 4A6DA 1T8TA 2YV2A 3HDGA 2LCFA 4YJFB 1O94D 1UEIA 4OLFA 5HJEA 2Y0EA 2EW1A 2YVLA 1DINA 4IS3A 3ERCA 4C30A 3U4MA 3PIIA 3LBYA 1E8DA 3RDPA 4D4GA 4BKMA 1CIPA 4AMYA 1FJHA 1VLHA 2X8LA 4WA7A 1EUCB 1OY1A 1DCFA 3R7WB 4CT4B 2QNBA 4EEXA 5EHXA 5JPDA 2VHXA 1VHLA 2F43A 1U0BB 3AVXA 2DR2A 3N7UA 1KYTA 3SM3A 1ZUNA 1H69A 5CXQA 1GNSA 1R4MB 1JJAA 2CUNA 3FHJA 3VR6A 3WLKX 1H85A 3IKVA 4ZKDA 1DBRA 2IIPA 2FHPA 2NADA 4JUFA 3PDUA 4P4SA 3RHFA 3IPAA 2FWMX 4JYBA 2IH2A 2XUOA 1D07A 4RMNA 1PVVA 2ZUTA 2W6MA 2YFKA 5DKFA 5KC9A 3LDUA 1P60A 4JKIA 4PZ9A 4DHEA 1N5DA 1V4VA 4J2OA 2GK6A 3FCEA 3WWZA 2BZSA 3L77A 4LW8A 4G0XA 4X44A 4P82A 4WKBA 3V1NA 2DPXA 2VPYA 1ADGA 2VDWA 3A1UA 3AHJA 3OSUA 5A7FA 4DMUB 4NCJA 3V4PB 4A0RA 4EG6A 5AUPB 4UARA 4ETMA 2DHCA 1KA9H 3JYOA 4I50F 4W7IA 3A2KA 1H2BA 2HSEA 1EM8A 4S0XA 4AYTA 2B4QA 2RAFA 1JB9A 4D9IA 4Q4AB 4P80A 4QUIA 1XVIA 1WV0A 4OUKX 1GWNA 1MORA 4PZAA 1ZD4A 1NC3A 4DC1A 1NE7A 1JEAA 3HBJA 5HS4A 2RHWA 1ZSYA 5BYAA 1EFTA 1ZN8A 5AW5A 1Y6QA 1UC5B 4PG7A 5F5XA 1ZINA 1XZFA 2QTVA 2VAWA 3HADA 4MV3A 3VU9A 4F8YA 2CK3D 5IXJA 2W6CX 2GPJA 1ZM7A 2UZ1A 4JWKA 4KZPA 1L2TA 4V0QA 4B82A 1A8IA 1XT6A 4N7RA 4D26A 2X8WA 1B0AA 1BGXT 2WMOB 1FXSA 3QELA 1DEAA 1OWLA 2D0DA 5H16A 3SCZA 4WBNB 5FDFA 1A04A 3ZY6A 2A59A 2ZBEA 4ZEWA 3ZYCA 4CM7A 5CT5A 1EX9A 3LNCA 1BXRA 1P44A 1QFZA 2Q4RA 2P4SA 2YBEA 3K0AB 3V80A 2G9RA 1E77A 4ZVLA 4J76A 3IQIX 2OFPA 2H1FA 3EW7A 2HPHA 5EJFA 2CNDA 4OHMA 2WKSA 2QOEA 2P8JA 1C9MA 3F7NA 3IPCA 2VT3A 2L19A 4JJ4A 1MGPA 3SZLA 3ZXYA 5CYPA 5D86A 5F98A 1VHTA 2FR1A 2PAFA 5EHZA 4IXWA 5B36A 4LDZA 1R6UA 1K2VN 1PDOA 4H35A 4OGGA 1KR2A 4ZVPA 5T4EA 2BFCA 5D84A 4PSAA 3QKIA 4UBIA 1R6BX 3SS7X 1YDEA 4I5IA 1C9JA 3QYAA 4OJNA 3TLAA 3D6JA 4PYKA 4C0WA 2Q8QA 3TG2A 3O2JA 3I2GA 3K31A 4WINA 4ZO9A 4YQFA 2FMHA 3HZOA 1C1XA 1SOWA 2VF8A 2QL9A 2WPDD 3L06A 4QTTB 3VO1A 3NWBA 2GXSA 1M2FA 5JSZA 1NIPA 1UAYA 2FUEA 1IIBA 2QM7A 3MNFA 4GS5A 4IDGA 4D5GA 4B3GA 1NMSA 3CVJA 3M3DA 4Y7CA 4EDHA 2EC5A 2G9NA 1BMQA 2QU8A 1SUFA 3BILA 3IVRA 2C84A 2FJUA 2JLAA 1G2PA 1G19A 2FPMA 4YONB 4EY6A 4W9NC 4AXBA 3DVAA 1P1BA 1XZNA 2PTHA 4CKBA 1JA9A 3UICA 1S9HA 4F7WA 2YR0A 3GBVA 5IH3A 1VLMA 4JUBA 2FLWA 2QJTA 1GG5A 4RQTA 4LSZA 3D4BA 5ALFA 1KTIA 4LRYA 1EWQA 1KJYA 3FIJA 4HB3A 4RPHA 1E5TA 2BDUA 5GJWC 3DVLA 1AKMA 1X0XA 2ZCVA 4H1HA 2I67A 4MDHA 4Z9XA 2QS9A 1NJ5A 2B8NA 4DIDA 3K09A 3LQQA 3KU4A 2FWBA 3KZVA 3LZ6A 3PPWA 4MKFA 3TK1A 1RPZA 4NPHA 5KJ6A 2TMDA 2V0GA 4U8GA 1XDWA 1RPAA 2H1LA 1Y6GA 4MIEA 3U44A 4TV9B 2YHAA 1LQUA 4FNGA 4EMTA 2QM0A 1PN3A 1YHNA 2YWXA 3H2HA 4JH0A 3V46A 3BA1A 3GVIA 5AJUA 3RKSA 3TW8B 4LYAA 4OLAA 1PV2A 1PR3A 5M2QA 3IH5A 3AF5A 1OGIA 2BELA 1YZFA 4FZ5A 1N5JA 1BN6A 2FA9A 3YASA 4BQRA 5HJ2A 3A10A 2ZATA 4PCVA 1DLJA 1RKXA 1NVBA 4I55B 1DGQA 3FGPA 2GPTA 5H3LA 1I7NA 4I14A 3MLAA 3FWHA 4YUVA 1MNAA 5E2AA 2A58A 4A2CA 3ND7A 2VJMB 1TVCA 2XMRA 4GMHA 4B17A 4MEAA 1JECA 5G4KA 3VU1A 1Y42X 2QRVB 3M4XA 4QPNA 4UQLA 4D9CA 1RHMA 1FVOA 2RHCA 3A3OA 3ZX4A 4CL8A 3PX3A 4KXWA 1RLTA 1I8TA 4K2AA 6REQB 2HMYB 1UMDB 4M7WA 4NU6A 3QE0A 3TGWA 2V3CC 4URFA 3NGXA 5HFJA 1T2AA 2QRNA 3QPWA 1Q0SA 5AR1A 2IXBA 3DAYA 4Q82A 1PL0A 2A9KA 4URXR 5HRCA 1MH9A 4BMSA 4IEEA 1WUIS 3FG9A 3C8HA 2VJLA 4NHOA 4W5WA 5DP2A 4ZV7A 3BWMA 4G36A 4RD3A 4I3HA 1W5TA 1GRRA 4UJ3A 4UATA 1OLUA 2F17A 2H4HA 4S24A 3U7QB 4UD2A 3HM2A 1E2PA 2WFLA 2WINI 2YX1A 1Y3FE 4M89A 5F76A 2QRHA 5FOUA 3DXXA 4G56A 1C0LA 4V0OA 2ZYIA 4TSRA 4W5HA 2QV7A 3VU0A 3HO6A 4JP2A 1E58A 5IYZA 2VXBA 2YWGA 4YMWA 2HT6A 3AJRA 4KFCA 3DE7X 1OKKA 1VHQA 4E7OA 3TW4A 4KO2S 3IBFA 3C3PA 4OUDA 1IPFA 4IXDA 1FMTA 3ELBA 3PWTA 4HLUA 4F2GA 4MDFA 5HQ3A 2XXJA 3I0NA 5JAZA 2WTMA 5JROA 4XSGA 3ESBA 2IDKA 4E22A 2V6BA 1YQTA 1CY2A 1EMDA 3D4PA 1XP8A 3OC6A 5AW3A 4KXFB 2POQX 3DE0X 3WL5A 4DEXA 1GKKA 2FDCA 3QPCA 4FW9A 1QYIA 5AKIA 2XDAA 3BFPA 1RXWA 5JC1A 4CDRA 1AHNA 2PSFA 5BR7A 3NHYA 5LZ4A 1SOUA 1VSVA 3PTZA 1U8TA 3B2EA 3TSWA 2R7KA 5ALQA 4FI3C 2BMVA 5CD9A 2NTVA 4XH9B 1KSGA 5ALEA 2H9AA 3G8DA 4LY9A 4OH1A 1QP4A 1G6KA 1JFFB 1I2BA 5CDTA 5FOQA 1OWMA 2B6NA 3QKSA 4HQLA 5J4LA 4N01A 1FXUA 3KAQA 1QOZA 2CUTA 1P7ZA 5JQGB 2BFFA 4HQOA 4P38A 1DXOA 1USIA 1WKVA 4UUPA 2IE8A 2OLJA 4RTPA 3NNSA 1WXFA 3HFSA 1KJ9A 1NPDA 4YAKA 4YCCA 2OXIA 2TMKA 2NTYC 4UEKA 1PQWA 2SICE 4RY8A 3COWA 1UOPA 3QMMA 2FNAA 3H42B 4NZMA 1Y8AA 2FAXA 3H2SA 4E2FA 3LCUA 3S5UA 3FMPB 2W8BA 2HH9A 4RHTA 1GADO 1FJ2A 4IEIA 4YJ3A 2CMGA 3DAOA 3O95A 3N1UA 4JX9A 1RC8A 1QRAA 5AJHA 4ZOEA 3W2TA 1C9YA 4QGAA 1KFBB 2CHFA 4HNUA 3TDMA 4D1YA 1N1DA 1KDOA 4LV8B 3VJLA 1SC6A 4GZ5A 3LSYA 4JLDA 1W96A 1J42A 2GN2A 3RU3A 1RHRA 5IUJC 2BL4A 2IYZA 1PFUA 3E84A 3Q7RA 4IPTA 2ZBPA 4MW1A 4BGVA 2WWHA 3C7CB 1VQ1A 5KX5F 1R9NA 1ZM3A 2OYSA 2RJOA 4P3OA 4R8SA 1HE3A 1BXZA 3D8BA 2XNCA 3KB6A 5FBHA 5G41A 5AW7A 4D9NA 1YU9A 4A91A 1XZQA 1B93A 4FMDB 3RVSA 3ZH2A 2D0OB 3K6SB 1C7ZA 2BFDA 2I66A 3AEKA 4YDHB 4BAGA 2KJQA 1NW4A 3GWZA 1COWA 1WEKA 4XKJA 3V4RA 3WK4A 5K9ZA 4F8EA 3Q7EA 4O2BB 4WK0B 5ALUA 2LCIA 3KQVA 3N53A 1Z0ZA 2PLAA 3HJBA 1C80A 4J94A 1GUBA 2DBRA 2WA1A 5LNK6 2GYYA 2PWAA 2HR1A 2P9BA 4WNCA 2QD2A 2PZKA 3PWKA 1PVDA 2AX3A 2ZW9A 3CMCO 4IDEA 2C7QA 5HJ7A 1B3RA 2GCPA 4JY7A 1TRHA 2DT8A 2I3ZA 2AHRA 2SBTA 3KKLA 4YK7A 5E6SA 4CW7A 1OT3A 4AECA 1MW8X 3MS4A 1J00A 2ZXUA 2FTKE 3DTNA 4PXSA 3UATA 4CCSA 1JRLA 1JDTA 2OTCA 1U0LA 3QM1A 2FZ5A 4BB6A 4D8UA 4FEYA 5EESA 2QPTA 4YRAA 3PD1A 1GA6A 4PNZA 4DCPA 4K86A 1QVVA 1XLUA 2VRWA 2R11A 4MYDA 5EIWA 3JS5A 3CXRA 1M2OA 3ZE0B 1UZUA 7REQA 3KOOA 2C29D 1RBQA 3SKVA 5IN5A 2BSXA 1C0PA 3R77A 2QAGB 2Z2KA 3OCWA 5TLSA 4WY5A 1HOXA 3DLIA 4MQ6A 3GT0A 2OCGA 4ZQCB 1KXJA 3TZEA 2ZI6A 1M6HA 4P81A 5DEOA 3STXA 4MA5A 3RC7A 3HN6A 5BW8A 5HUHA 5CCBA 1Z56C 3X2EA 1DWPA 4EHDA 1LRJA 4FJ1A 1ST3A 4WW0A 1D4ZA 3AUSA 1QGDA 3MGAA 3Q7TA 4HMPA 5GADl 2QPAA 2V7WA 4PYJA 1YJBA 4JDPA 3WGNA 5EWJB 2GOYA 2JW5A 3VPDA 4JLAA 2Q4TA 3KXLA 2JJ8A 2WQ7A 2FW9A 2DWUA 3WJ1A 1XZ8A 3FGZA 2IE0A 1D2NA 2CBXA 2IYFA 4BQPA 1GZVA 3M1IA 1UK9A 5FD8A 4E32A 1N6NA 2OE2A 4JCCA 4MHOA 4AWXA 3Q8MA 2PQ2A 5FOWA 2PT6A 2BTQA 1U5CA 4GKVA 5JG7A 5LUBA 3ULKA 1YFJA 1OT5A 1I9CA 4Q4CA 1OVGA 1B0ZA 2C5AA 5C7OO 3I1IA 1MJHA 1PR2A 4O4LF 1LVHA 4JBYA 1UBLS 3B60A 3F96A 3PJGA 1ZM2A 4IIJB 4X85A 3UYLA 3GC6A 1P74A 1GUFA 4BN0A 4WN9B 3LBAA 4YGYA 3C74A 4WESA 1ODFA 4K40A 4Q34A 3O31A 2Y4NA 4ITVA 4ALLA 1B8PA 2OFFA 3EC1A 5CGZA 5DNWA 1RXIA 1SNYA 1TYZA 3GOHA 3HEMA 1K6EA 1I30A 2I1VB 4OVKA 3QSYA 2LBPA 3KKNA 2GAJA 4XCQA 3V6MA 1TD9A 3IQDB 5AVJA 4XFJA 2WUEA 1M1YB 1T35A 1T4DA 2CJYA 3B38A 3WX0A 4O2LA 3EFBA 1D0VA 3B1XA 3BQ9A 2A0WA 2JI7A 5HOEA 4UXJA 2E6KA 3NIBA 4HEHA 3ZTWA 1EQ2A 1FMJA 1YA8A 4D3YA 3F8WA 1W88A 3NUGA 1PI3A 2QQ0A 3K9GA 3BCUA 4AZ3A 4X45A 4TYPA 4R3UC 4H0FA 2ZULA 2ID7A 4GAEA 3ZZTA 3BM5A 4PSDA 3EEOA 5DN6A 3SM9A 1P8JA 4JP1A 5TMDA 2XOEA 4KN9S 2X0EA 3BWBA 3IQZA 1S3SA 4FFDA 4H08A 4PQGA 4PHGA 4R1MA 4WLEA 1JSZA 3ZOZA 1YH3A 3R8XA 3IL2A 2NO4A 5CCXA 2O19A 2D00A 2V7BA 2BFBB 5LXTF 3QITA 1ZUD1 2A5DA 4D7AA 2O8BA 2F1OA 2O8VA 4NK5A 4YRCA 4DILA 4X7MA 4HZUA 4WTOA 3FI0A 4JGGA 4XJTA 2AI2A 2DC1A 2DF8A 1TTQB 2ZETA 3SDZA 1VTKA 2IDZA 4R40A 1E7SA 4RY2A 4KPYA 1FP7A 3OZDA 4NXMB 1M6EX 1PUXA 3FW1A 4RD1A 4DARA 3L4KA 3NIGB 4Z0TA 4D43A 4FD2A 1HMPA 5ILQA 1Y3HA 4GEGA 3WGGA 1BMFD 3EZYA 3P4XA 5EL0A 3BSSA 3BXGA 1YCHA 1RAHA 2Y0DA 3WGZA 1WP4A 4XWYA 1UMBA 3IMGA 4KB5A 4KGZA 4M21A 5IEBA 3SVZA 3WADA 5ICSA 1ZD2P 1OE0A 1JQAA 1E0SA 2YS7A 3O2QB 4PAOA 4X6YA 4LVUA 3BRCA 5KMGB 3PEVA 5KSZA 5IZCA 4GOLD 1NSFA 1PG2A 3AVVA 2OCPA 4V0KA 3C1AA 4HT3B 1GAXA 5I7VA 1XCPA 1E1DA 1W8IA 3QU4A 2QRQA 4ZYLA 4IZIA 3SHTA 4RKWA 1KMIY 1R66A 3JSAA 4K6CA 1JG4A 3R5XA 1JN0A 2FVXA 4H16A 4RSMA 3JYHA 1E0DA 4YAOA 4AJOA 2EGHA 4J8PA 1I2MA 1RWXA 5AKGA 4MVWA 5HKOA 1SAYA 1WIWA 3RF6A 2WB2A 1BWRA 3U7JA 3M5PA 2B4RO 2E6UX 4QPZA 3HJNA 1WLYA 4BLTA 1WU8A 3A3PA 4LRWA 4KE7A 4RNCA 2O6HA 4NOLA 3U7RA 4OYYA 1UZLA 4KEAA 4OIMA 1QYRA 1V37A 4XUEA 2H3HA 2WWVD 3L41A 3S2YA 2IUSA 3DNPA 4BLVA 2PBFA 5CTAA 1Z34A 2ANBA 5GGXA 5HOQA 4R3WA 2LXNA 3R3JA 5PNTA 1DC7A 1NM5A 2SKEA 2W2QA 4CUKA 3HKDA 4ZJPA 3ITEA 1N7IA 3UIEA 3AVTA 5J5CA 1S89A 2DVMA 1FX0A 2QT1A 2H1VA 3I1JA 3OQBA 2NQTA 4FYWA 4GLBA 4RTSA 1Z33A 1N7JA 1WCIA 2CYBA 2EEZA 2YUTA 4LNUB 1XN4A 1WUHS 3LQRA 4RD2A 4GGOA 2J59A 4ZALA 5KHAA 2GPBA 5CP8A 2W6IA 3QHPA 3UB3A 1G8YA 5G1PA 1ZU4A 4HG2A 4AMBA 2P41A 3SYTA 1OF1A 3ZC3A 4BFCA 5IT4A 3THYA 1VSUA 4W8HA 1TT7A 3A11A 2FSSA 2NVUA 2QY6A 4CGZA 2Y0PA 1FSPA 2JFZA 3IIIA 4EF4A 2C5GA 3NXSA 4LXTA 3NBMA 1DTWA 1MX9A 3ZNOA 1N2GA 3CVOA 1CP3A 1RRMA 2DHQA 2XUKA 3MJTA 2BGRA 7ADHA 4V0SA 1V3TA 2G4LA 3VUFA 2Z2YA 2QP3A 5FOVA 1J06A 3R44A 4AUKA 1QPBA 3CJTA 1N6PA 1R16A 1ZS9A 4DW8A 4TZ6A 3KAPA 4CKEA 5K6RA 1X74A 4M7PA 2QN7A 1MQSA 3C6XA 1VG0B 2YJZA 3HK2A 4D74A 1NWHA 4DQ0A 1VPTA 1DV1A 1C30A 2FEWB 4O4JA 3T5AA 2XYGA 1BDMA 2RAUA 1AIPA 1VLZA 2YWJA 4R1QA 4BHTA 4FDLA 1A9QA 3PC6A 5LSAA 4IUYA 4P53A 4YAEA 5EJEA 1AQ6A 3A04A 4X61A 3P1JA 2LPMA 5JNUA 2QJOA 3F8TA 4KE9A 1DAHA 5DXFA 4IF6A 2HK7A 1QCYA 1YCDA 4KQ2A 4Y1RA 1XR3A 2I4TA 3QBDA 4QQNA 4IHKA 3LDHA 2XCOA 1XA0A 2JATA 3X2SA 1CE8B 3LQYA 4CODB 4OBEA 3ZUPA 4NP6A 4XRRA 4YI5A 1D5WA 3MT8A 4CZ2A 4CCWA 3DTVB 3JQ9A 4Z9YA 4CKWA 3OE1A 1LJUA 1K92A 1VLLA 4JB2A 1N6LA 2D7CA 2QMZA 4A6PA 2PA0A 2X3YA 3OQHA 5EI5A 3RIMA 3WICA 4JEMA 2G08A 1XZLA 5KCMA 4IHJA 4IYJA 2CLHB 2F1HA 4RFVA 4LC1A 1JJBA 1LPNA 2CJWA 3DM5A 4DYVA 5BQOA 3TMKA 2OBBA 1Z4OA 1PE0A 2PSEA 2VDVE 3HA7A 4KP7A 4WH0A 2IPNA 3T1VA 1QS0A 4H7DA 5EERA 2ZEJA 2O3TA 3IGFA 4H6PA 1QCDA 4MGZR 1M2EA 1L5YA 2IIBA 2Q9CA 3OQ1A 5EP3A 2W2TA 2G5TA 1Z5WA 2SHKA 1ZFNA 4LYYA 1RHUA 1NN5A 4Q37A 3HB0A 3MT7A 4DZRA 3RJ9A 1ADJA 3OMWA 2UKDA 4A16A 3L5OA 5E9QA 2BFPA 2F59A 3DQZA 5CX1A 4XVQA 4A2PA 1QKKA 3RSQA 3IIKA 1FDRA 1SKBA 4GUDA 4MKRA 4B6QA 2QIOA 2IOFA 1NVKA 4F3KA 2QVCA 1RRKA 5BR8B 4EGFA 1T6NA 1R4NB 1WHTB 2ZRCA 3OTHA 1BHSA 3BN3A 5KBYA 4FFVA 4O29A 1QZ3A 2YIVX 2PH1A 4UDNA 5KSPA 4U2BA 2JHGA 2V6GA 5ADWA 1IZ9A 1N1EA 3FOBA 2FQYA 3LKBA 1N9ZA 3GT4A 3H65A 4RV5A 4TUYB 2PMEA 2CLDX 8OHMA 5JECA 4OUDB 5COAA 4AQDA 4HS4A 2GPYA 3L8YA 1RYMA 4NZZA 3UT6A 4Z54A 3I73A 1XEXA 4RLQA 4RM2A 1F38A 3Q12A 2E3JA 2MYTA 2WMDA 1OHHA 1IY1A 1Z17A 3KXPA 1M0WA 1CFJA 1U28C 2VDPB 2ZRPA 4Q21A 4YPFA 3RSZA 4CLRB 4AMGA 2O2CA 1D8TA 4PYQA 2JCVA 4X54A 5HIIA 3SEAA 2A9RA 3V34A 1RZUA 2FSHA 4G4SO 2X7HA 2A1TR 1FMLA 1IG0A 3N8HA 4XARA 2J6CA 3RUAA 1W0CA 3EH1A 1WW3A 4NJOA 3DL4A 4EJSA 1E5VA 2G09A 1YJ8A 2ZAOA 1OIXA 3ZI7A 4D82A 2CVZA 4TOIA 1QZXA 1HM5A 1JWLA 1E2DA 4KMMA 1IY8A 1CQJB 4LVCA 4B7AA 5B7NA 4OI0A 7AT1A 3B12A 5KTMA 1WUKS 1CZUA 4G4IA 4KAFA 2PSDA 1TYAE 3NW9A 5EWMA 4KW7A 4P3NA 3DLTA 4FLMA 4KE6A 1M2KA 5E6UB 4FK8A 1UPXA 2P9JA 5EOVA 3RIHA 1FU8A 2BM8A 3ZKWA 3VVBA 4OAPA 2IHJA 2DFVA 3OM0A 3U17A 1JHPA 4ZJZA 2P6OA 5B2FA 4H7KA 3H05A 1JDNA 3KB1A 4H6WA 5TQ0A 3W7VA 4C5BA 1GCIA 1ZRSA 3CE6A 3R6TA 4XGKA 4YRMA 1ZAYA 2GI4A 4Q0MA 2O54A 2V7QA 1BAPA 3HO1A 3B6JA 1F4LA 3AJ9A 3W9SA 1G0NA 4HQNA 1WX1A 2VWGA 4Q93A 3O82A 5A05A 2VNIA 3ENWA 3MM4A 3HKEA 2QV0A 4WXMA 5KU7A 5EQDA 3H1PA 1UPFA 1Y6RA 3WKEA 3CEHA 4XB6B 2WTBA 4TTRA 4Z3DA 5LZ8A 3II6X 3AB8A 1D8AA 2DUNA 3GLRA 3IHLA 2FPIA 4PPGA 3RYTC 1IZZA 1LQ2A 1MU0A 1UT6A 1Q16A 4PN3A 1W85B 4I08A 2WFZA 3QUCA 2X7XA 4P9NA 2UU9B 5I7RA 1D4FA 5DVZA 2ZS8A 2QUZA 4PLCA 3IJ5A 5FTLA 4MUIA 3EPLA 1Y5RA 4FYMA 4I1UA 4Q4HA 2X77A 1DXYA 1T0UA 4HS9A 3AVYA 2XZDA 1CP2A 4MW0A 1D1QA 1FLDA 3ELDA 2EF0A 2H5LA 5DTIA 1UP7A 2DR0A 2YH2A 3AYZB 4C1BA 1EGVB 1KO4A 4BX8A 2WE8A 1M66A 2XWPA 5CDYA 1X0VA 4EHLA 4KDCA 4TMYA 4EJ6A 4F4FA 1JEDA 1CIVA 1T1RA 4ZOLB 3TL3A 3FWYA 4IL5A 5TY0A 2XNJA 3B9RA 1H66A 3GEBA 5L53A 2PX2A 2XVMA 1NL3A 3H3XA 2C31A 4JEHA 4PLGA 2I80A 4RHEA 1YD7A 4ZTBA 5HYVA 1OTXA 5CNIA 5G4LA 3EC2A 4IJUA 1P1FA 3AVOA 3GB9A 1D2AA 2VA9A 1A8HA 3VSDA 2BKUA 3PSAA 3CZRA 2P6UA 2AJ8A 4LKOA 4NMMA 1LZKA 3OIUA 1TUBB 1HPLA 3PXEA 1YFLA 5B6PA 1PJ8A 4UTPA 3SBOA 1WBBA 2W90A 1E1MA 5DBGA 2D8MA 2ZI9A 3NAMA 3P7MA 5BV0A 1Q0UA 1DKNA 3I8SA 3AFIA 3ABZA 2V65A 1H2YA 1V8ZA 3AB3A 3GJ0A 1W0KD 3OEHD 4NVRA 1FTGA 3CUYA 3A0UA 3VH4A 2PGXA 4P3YA 1F0YA 1KQPA 1CTQA 2FKNA 3L0ZA 3JAKA 4QWMA 5CH8A 5KTPA 1EIWA 2VIIA 4IILA 2IODA 1PBNA 1JLRA 1ZVKA 3QY0A 4HZGA 1QORA 3STYA 2WZQA 4FGJA 1G1MA 1WXXA 1HMYA 4RVGA 5CPFA 5GOZA 4GOOD 2CL0X 3AIIA 3KB8A 4LFAB 4RGYA 3ZG6A 3KG2A 4MRRA 1A5AB 821PA 2UUOA 3JPWA 1C4OA 2GJSA 4OJMX 5LYJF 3L7CA 3L7DA 1TZJA 5B6IA 2JFVA 2FEKA 1H42A 4OYHA 3ZWOA 5CBKA 3DDOA 5KTSA 3LRXA 5EJGA 4DIEA 2AMVA 2RHGB 3R8CA 3W6ZA 4W63A 3GWGA 3ZI0A 3FA2A 1G6Q1 5IF9A 5JS7A 1CVLA 2WIJA 2QXUA 3BWXA 4MRSA 3W6PA 2GGSA 4HR7A 1ZZGA 1CUYA 3EZFA 1ADFA 4FSDA 4BXOB 3GBSA 4B81A 1L6RA 3MUFA 3QV1A 3SN6A 4QRHA 1GRQA 1IDOA 3CN7A 4RV9A 3ZWYA 3MWGA 2VXCA 2GNAA 2QLFA 4JMLA 3I32A 4KVGA 2ZIAA 4DBLC 4EJ0A 4OI2A 4IVQA 4PLYA 1VL5A 1E0JA 3KQSA 3TD2A 3KVYA 3M5CA 1U3TA 5B7GA 3HFRA 3A6JA 4LE2A 4W99A 2I6SA 4MVCA 2AOVA 1O6BA 3EVGA 4FI3F 1QOPB 2XAUA 2IOHA 1Z0FA 2YASA 3LS2A 1SBYA 2V3VA 3RU9A 4N8EA 1B7GO 5KOIA 2C4HA 3CONA 2XMSA 3TVTA 2Q5CA 5HIKA 4MUMA 2FXVA 3F5FA 3CINA 3GLKA 4KNWA 5K8LA 4I81A 2B37A 1KGDA 1RACA 1TX4B 1E3WA 1NQXA 3G9TA 3KSRA 3PEEA 2CLCX 2WVHA 3CW9A 3SYLA 4A03A 2Y6VA 2AOXA 1E1CB 3BX1A 3PUHA 5JI2E 2Y27A 2EX1A 4Z51A 1DMRA 1ZI6A 4ND6A 4OSPA 4NE7A 3QVXA 4OI4A 3PLNA 4X62B 3W1WA 3CH5A 2J6HA 4H3SA 3UO8B 4CU2A 2C2WA 2P9TA 2PE5A 3NHRA 1AUXA 1F2TB 3N9IA 2JAOA 3R3HA 4UBNA 5DLEA 1EUDB 2DQ4A 3AUTA 1BCRB 2VKQA 2CDBA 4FQ5A 4U1RA 5ENVA 4ZDWA 3KFLA 3SD7A 3ZU5A 1Y1QA 1CR0A 2AC4A 1WPGA 1CPYA 1H1LA 3CZ5A 3N3BC 4GZMA 4FVTA 2DP4E 4I4TB 2IYUA 4U9UA 1RAIA 1SCQA 1QC5A 2FUG1 3L8FA 3W9BA 2OC9A 3EVBA 5JTTA 5IRCD 1UPUA 4K03A 2NTEA 1NF9A 4K6HA 4R69A 4AO8A 1BDIA 2PV7A 3JARA 3OA0A 3OLWA 4KIJA 4KQ6A 3ZE8A 1HG0A 2PX6A 3AF6A 2XIQA 2PUVA 4DUGD 3AY3A 4O0MA 4O1HA 2IYXA 3T12A 1IM5A 3LL4A 4HN9A 4FFSA 3V8BA 3E22B 4CQNA 1K7XB 1U63A 3KJIA 4C0SA 1PGPA 4Z9BA 2ZFUA 4BWVA 1PS0A 3VR5D 2WHPB 1GFZA 1RKBA 2W6OA 1QQBA 2X58A 1K9VF 1CQWA 1PK9A 2O2DA 2WD9A 1HUQA 1R00A 2O8NA 2P30A 3QFHA 5J59A 5IBPA 4DB2A 2DPGA 2GILA 3H7AA 3HEAA 3Q15C 2DJ5A 1QO0D 4L9WA 2XGSA 3H8SA 5I8ZA 1DU4A 3VBCA 1XDZA 4M8SA 4HDMA 5TMEA 1TEVA 3OCUA 1NX9A 1WRBA 3P8ZA 1CQIA 3LK7A 4M0DA 5I4IA 2Q2VA 5KJ1A 1QHHA 1EM6A 5MFPA 2EBHX 5H4HA 4L9SA 4ASUA 1VM6A 1I4EB 1RYYA 2HC9A 3BB3A 3W9UA 4BUCA 4BVGA 4LF7B 2GJKA 3M81A 1E79D 3LDFA 2ZIXB 4MVJF 1DRWA 4HDNB 1UBTS 1YDFA 1ZQ9A 2G77B 2WIGA 4TVOA 4JI8B 4RGVA 5FFNA 3RWMB 4DDWA 1BHQ1 3U4HA 5I7AA 1J4AA 5ETJA 3DW3X 1UAGA 5CHYA 1H3NA 3CJQA 3OE7A 2J3EA 1YK1A 3KZKA 5EG5A 4BWYA 2J45A 4A7PA 4J0CA 3LPDA 1NBMA 4G01B 4NAUA 5L7WA 4QJ4A 4JJ7A 1U7OA 4P4NA 3RV3A 4US1R 1JAHA 2BY4A 2G7MC 4U0KA 1HXHA 2J1LA 4I9GA 5JXIA 4RVOA 4ZVTA 1U65A 1YR7A 3CZMA 1GZ6A 5DI3A 3W04A 4ZCSA 3G5LA 1CT9A 3P2EA 2WU4A 3B89A 5SYAA 3JASB 3VO8A 4BECA 2Q2QA 3HCDA 3Q88A 3STWA 1OC2A 4EA9A 1QM5A 3L4BC 2IHNA 3CX3A 3OUZA 1BA3A 2A8YA 3PVSA 5EKSA 2J9FA 5KYXB 1Q1BA 3WL8A 4RF2A 1Z2OX 4TGLA 3WGOA 2PZBA 3PVCA 5KO2A 1Z28A 3EEYA 4RD6A 4C20A 4AY5A 3ETEA 4OOFA 1BTOA 1UPBA 5GINE 4L3WA 1D09A 1T5HX 2C0CA 4CE6A 4UTVA 1J0AA 2WUWE 3U4QA 4DEVA 1FNBA 1QHYA 1H8ED 3I01A 4XM1A 1XLWA 3WIBA 5A4MS 1GSHA 3BIOA 2PH5A 4UM8B 4WKCA 2CWDA 4YIHA 1HSZA 4CHGA 1VZ3A 3SX0A 5BMVB 3I2JA 2O2GA 1FF9A 2EQAA 4CTNA 1OLSB 3Q1KA 4Y9RA 1QG6A 1K8QA 1RVV1 5KOHB 1YOVB 3HUUA 1LBHA 4GE0A 1QPZA 3VOAA 1G17A 4L57A 2VHYA 1ECFA 1OWOA 1SBNE 3KUCA 4LRUA 4G37A 1IQ0A 2HMUA 4U7TB 1ZN7A 2BC9A 5HF9A 1UC4B 3UA3A 4C4ZA 3ESAA 4ZRMA 3EWSA 4AWBA 5C8VA 3RAFC 3E9MA 1DT5A 4E7PA 1RC1A 2X40A 4D3SA 4HAIA 4Z7NB 1T4BA 4OQQA 3WSWA 2RGRA 5JOQA 1EYZA 4Y6SA 1KOLA 1OV6A 3FDZB 1HQDA 4LJKA 1OTYA 4L2IB 5C18A 1Q6YA 3LPAA 3DC7A 5IUNC 1PP4A 4EYKA 2B7CA 2ZXEA 2WT8A 1VCOA 2W6JA 4DV2B 4CMGA 5DM1A 1BMDA 4M4SA 5AH0A 5FTKA 1Q0ZA 2R68A 4HVAA 1TCVA 3DUFA 2ZYRA 4UUAA 4BNIA 1MO4A 3UXYA 3UW3A 3R2JA 4HB2A 5L6MB 2P1ZA 3U60B 4I50A 3PE3A 3PYXA 1MQ8B 1ZR4A 5ERYA 2ZVJA 1UKYA 3L93A 3I5UA 3EARA 4HWKA 1LDMA 1QS0B 2Q9BA 3N6XA 1QJ4A 2XMDA 3LBFA 5AOBA 3CBGA 3MTDA 4KBGA 3VKWA 4NJEA 5BV8A 3C4VA 4GX1A 2W6ZA 5ALOA 1Z7WA 4U9HS 1Y9JA 3HJRA 2ZJ6A 1FX1A 2C3PA 3CLKA 2RHMA 3P96A 5K3FB 1Y9AA 2ZCJA 1K0UA 2AJDA 3PQEA 4OP3A 5EUCA 2QN9A 4J16C 4E14A 2DEUA 1Z6YA 5FPKA 2C0QA 1BRMA 1PT5A 1T4MA 2CN1A 2GAIA 1YC5A 4HLQB 3BORA 4WZZA 1CRZA 1XV5A 1PNTA 3FUUA 2ID9A 5LB4A 4D9BA 2ZDHA 3EWIA 4PIMA 3INYA 4GXRA 2HLDD 4G63A 3TZKA 4O4IF 3HVHA 2CDAA 4YQZA 2E48A 1TYBE 5D01A 3KTDA 3RHZA 4BKUA 2F6RA 5B7QA 5IJ0A 1KBOA 2HRZA 3T94A 1UQTA 3NP7A 3ROMA 3EGIA 3DZJA 2L82A 2PRYA 1E60A 4YUAA 4R1SA 2A94A 3PL1A 2FFHA 3MWEB 2FF5A 2B35A 4X20A 1ZVMA 4IO0A 3FPGA 3SC2A 3CNBA 1ESDA 1BDHA 1OXUA 2FK8A 4HDRA 4CVNA 1S8OA 3Q4GA 4LCJA 3I61A 3MYYA 3PFGA 4EW3A 1WB9A 1V8OA 4HX9A 3CRW1 3O0DA 2KLHA 4ZQFA 1N0HA 2KSQA 2WFAA 4NULA 5LB2A 4BLOA 2EBFX 1WMFA 5M5BA 1JWAB 1SVUA 4WVFA 4EKYA 5BQ3A 4YXWD 1AN0A 4GKKB 1T2DA 2IT1A 3WAGA 2VK4A 1WDKA 5AVYA 1CHNA 3A4MA 3LTNC 5T3UA 3O4FA 4IKPA 4D3FA 2J31A 2R4TA 3PE6A 5BUZA 5C7YA 2UDPA 1FRNA 5HF8A 3T9AA 1A98A 3RAEC 1E2KA 5E1OA 3PUVA 2AC7A 2B5OA 4WE3A 1JEQB 3L8GA 4OLBA 1L7MA 3D2LA 3DWFA 4Y2UA 5HBRA 3ZJ4A 1LQTA 4F3RA 5EE0A 1OH5A 2HQOA 3B1WA 1KETA 1VCMA 5IJWA 1U2EA 1S96A 4J1TC 4LJRA 4L75A 2ABWA 3KHUA 4J03A 3SZRA 3DS8A 1VBFA 5DNVA 3MMZA 4D0LB 5IABA 1GDTA 3N75A 2HD4A 3F1LA 4MW5A 5C3MA 2BKXA 1FDUA 4OTZA 3ONFA 3ZDCA 4PBRA 5DLDA 2D2FA 3CF0A 4L8YA 5EIAA 1M76A 2E4WA 1EG2A 5C1DA 4E2ZA 3DCJA 3EPRA 1QNFA 5JALA 5KDDA 1EVJA 3ASYA 4NCXA 3F9RA 2L18A 2I7VA 2O1EA 2RHTA 3HA3A 4EMSA 2BKVA 1QYWA 1DBVO 3AKEA 4N5LA 3DFZA 3LYAA 5FYQA 1Y7TA 4BPRA 5LMZA 2FSPA 3HN7A 2AV6A 3L6UA 3HV0A 1OOEA 4TSFD 4I0WB 4WN3A 3TSAA 2D7JA 1NZFA 1NG9A 4F11A 2PPVA 3IURA 4AP6A 1VP9A 1ZOPA 4TX1A 5EA2A 1PT9A 1A4UA 1JQEA 1XYYA 3NKVA 4Q7LA 4TMKA 3X1ZA 1YQ9A 3GZNB 3G7NA 1TMOA 4EB6B 3EG9B 3IJRA 4L4SA 4RKFA 5LD2C 3L4JA 3AOGA 3FRHA 3EXIA 2YWDA 3OFNA 4YJ2F 5LLTA 2ILVA 3AF4A 3IT3A 3RODA 1RQPA 4LY0A 4CMIB 1UXHA 3ROXA 2C88A 4XPZA 1BEZA 3BGWA 3GRAA 2K2QB 1YQDA 1RCFA 5TQJA 4G5OA 3W6NA 1B74A 2N9UA 2QMHA 4WAUA 1PBTA 3QI2A 121PA 3DE6X 4XM2A 4GBGA 2OM6A 2CVFA 2XVAA 3LY9A 5BVGB 3K6JA 1H1TA 1RLMA 4D0RA 1C3EA 3AFHA 3H5NA 2Y1WA 3KEFA 2R2GA 3CZ9A 3F3YA 3C8ZA 1T4GA 1G5FA 2WVGA 5FL7D 4XD2A 3ZE6A 5IMSA 1VJTA 1NDHA 3N2YA 2V3WA 3S7ZA 5BPFA 4OQLA 3SOPA 2C99A 2TMYA 4R16A 1FP2A 5HKBA 5KTOA 3HPRA 3N0TA 4CIAA 1RYBA 5BRNA 3BWVA 2VYFA 4XIIA 2RGDA 3H2ZA 3BSYA 3LH5A 4MRMB 3N76A 4M55A 4I5GA 4FFLA 2XTNA 4PXAA 3DTVD 1LDEA 4LHXA 1QGUA 1QRSA 5KVSA 3WYNA 5FNVB 2IU6A 1DLIA 4IRMA 4NAHA 4MHSA 5A5DA 1S9DA 4NPAA 3R20A 4IV0A 2NPOA 1I3CA 2ECFA 4ALNA 2AKAB 1LWNA 5ILOA 3NOXA 1DEHA 1Q0HA 5E9JA 4WNAB 3UENA 4J07A 3TOXA 3EA4A 5EUMA 4KU4A 1ECGA 1MVLA 5FPHA 3IEIA 4QZVA 3EIUA 4Q3OA 4HY3A 4LJ9A 1QTQA 2PKWA 1V11A 4CM3A 2OCIA 5FWAA 3ICQB 1PGNA 5L9AA 5DTMA 2QRLA 1ZK4A 2I2DA 2K4MA 4Q00A 2WDPA 2GEDA 1J5XA 1YQEA 3ELYA 2XGMA 3OZWA 4Q7MB 4W4TA 5CIWA 4ZVSA 1N5OX 3AOEA 3K35A 4FTWA 4OX9Y 5CHEA 2R97A 4WPGA 4ZP1A 1CZRA 3SKYA 2ZRLA 3LRTA 5BQ5A 1CF9A 5EPOA 1TUEA 3NKLA 4OA8A 5AKKA 3DNFA 3AVPA 2CEKA 3IELA 3MT9A 3WVNA 4CQMB 4WCFA 3QKWA 1P19A 5E0KB 2YQ5A 5C7IO 5JAHA 4DPKA 2EU8A 1GNTA 4OHUA 4ZICA 1VRCA 4BNHA 1WULS 4D41A 5F2NA 4K6FA 4C4YA 1SVMA 3ZJVA 1NFFA 3I34X 2OO5A 3RTDA 1AKRA 1Q0LA 4J6EA 4X6LA 1I14A 4QT4A 2WAXA 4RW0A 2JKZA 3H6HA 1UC8A 4Q3EA 2JVKA 3LUJA 3TAHA 3OKFA 1E1YA 2VRBA 2WF9A 3JQBA 1G38A 3TNDA 1LDBA 1JDUA 2GZHA 3CNLA 1M5TA 1IWBB 1PZMA 2BGNA 2PZ8A 2VNAA 3EVAA 4B3IA 2E7ZA 1HFEL 1UMCB 2W2VA 3AI2A 3BMCA 3FDFA 5BO5A 3WTBA 4NFSA 1GVNB 2XSZD 4ISCA 4O6VA 1VIMA 5C5EA 5K3OA 1L6IA 2RONA 4PRLA 3HGTA 1A5ZA 1JYSA 2AMFA 1G2QA 2C7GA 1MAAA 4V2UA 3KU1A 4YIKA 1SU7A 2D1QA 4EHHA 3QXHA 2P75A 5TGDA 2H00A 1NF2A 1TA0A 1VPLA 2EL9A 3L0PA 1IU9A 1U11A 2HWUA 2QYSA 1TF2A 3GLTA 3M49A 4K3VA 4TZTA 1Q92A 1YOBA 5FR1A 1TM1E 3BGIA 1M34B 3V4OA 2BWJA 4IY1A 2GEBA 2IHUA 3DBRB 3UOAB 3P0EA 2HNBA 4AX4A 1I33A 5KX5A 1V16A 2Q2WA 2AVNA 1L0BA 2JGJA 2P2GA 1FP1D 3QWBA 4FHGA 3CZAA 4MB6A 1XPRA 1AS2A 3R5KA 3IIJA 4M2LA 5CRIA 3QBEA 4RQUA 1JT9A 4DGSA 3NANA 3IYLW 5I4KA 2WF5A 3CO0S 2XE8A 4NZ9A 2AXQA 4RK7A 3JQFC 1CUIA 5AHWA 2EG5A 4JXZA 1GGVA 1UIRA 3L01A 1J07A 4URVR 4MLDA 5AXDA 2XXAA 4MUHA 1JFVA 3OP1A 4B8YA 1ZGGA 4IZHA 4D02A 1SQ6A 3DT9A 3G5MA 4Q4JB 1KVUA 3LAWA 3L49A 3IAUA 4N9QA 3OMXA 4XVHA 4BZPA 3G0IA 2OV6A 2QMUA 1TUGA 2EX4A 2JF0A 3M9WA 3NDPA 4NH4A 1G21B 1STOA 1TJ5A 1T4CA 1W4RA 2ZUWA 1FMCA 3D64A 2Z58A 4B4KA 4IG9A 5HQJA 3V4LA 1NIJA 1WUYA 5KTYA 2GB4A 1SCIA 3W78A 1ESMA 1G3QA 2OXFA 2CYAA 2WIFA 3EIWA 1KI2A 2NZ2A 1SZPA 2R6GA 3NT2A 4LRTB 4WXPA 1E1QA 4MS3B 1Q3TA 4CKCB 4JIGA 3OX1A 4Q1AA 3UT5B 2QP9X 1P5RA 2GBCA 2PZLA 3LFHA 3JVEA 4ZAXA 4EA7A 2FPPA 4C0HA 3AM1A 1T6BY 3T7TA 3M82A 2F1KA 1NLZA 5A02A 3D2CA 4L5BA 2O0MA 3KCNA 3T35A 1EK2A 3HCAA 3PHCA 2V1UA 3UEOA 4HNHA 2BMJA 1G3MA 4F96A 1HO3A 4K9RA 1IWOA 5JHGB 3C3XA 2GRJA 2G67A 2KE5A 4MUJA 2JGAA 3EXFB 1ONBA 4PZEA 2HCBA 3OEED 4M0FA 2I4MA 1U0TA 2BGJA 3FNIA 2X5KO 2HAEA 3UWDA 1WBJB 2IH4A 4EM6A 4IV8A 3AKYA 3K0KA 4ME6A 1R9MA 2GJ9A 1KK1A 2FPKA 2V5AA 3C1UA 5TDHA 4ETIA 4KIUA 1N5LA 4E3ZA 1I9GA 1V6AA 4HXEB 1D3AA 2Z5VA 4OY3A 2FWRA 3OAAA 1IB6A 2D2VA 1FTSA 2RBEA 2QNIA 3TM5A 1F8YA 4QG7A 3MJEA 3DZBA 3TPZA 5LUAA 2O7NA 4D8XA 2R7LA 2V45A 2YRFA 4ZOCA 4C7MA 1U6JA 3JX9A 3LUGA 2OWEA 3R7DA 3VSAA 3X0DA 1A9PA 4O4LA 4YRTA 4YP6A 2J0QA 2XNDD 3AVQA 2ZIGA 3OLZA 5AI6A 4R6WA 4L76A 2RGUA 5SICE 1TU0A 3S2GA 3TLMA 3ZUGA 4QVIA 3PBKA 2EW2A 4Z2AA 3GG2A 3V48A 3KQUA 4YS6A 4W6QA 4F45A 3ZVMA 3ACDA 3AJDA 3OZUA 4WUVA 3WA6A 4FC7A 1K6MA 4BO5A 3NYIA 4IQ4A 1IZ8A 3BXOA 3HYTA 1TCUA 3AL0C 3IUBA 1DOZA 2AXPA 1XAGA 2QSZA 3OIDA 1OXTA 2VTVA 3GNQA 4RFSB 1DRUA 5H3HA 5ESDA 4CMAA 2XHZA 1AJEA 3OVMA 3HKCA 3D9QX 4LWZA 2QMEA 5COBA 1AG9A 1GZHB 5LQAA 4GI5A 2RHLA 4D42A 1GGHA 3IQEA 4GMGA 3HRHA 4HAZA 1TIBA 4JCOA 2WNIA 4P86A 1R6VA 3QU5A 1Z7EA 4R5HA 4AJJA 2B2NA 2YZGA 1VI5A 3QXCA 5HZGA 3JQAA 3G0OA 4YJGA 3BZWA 1X1TA 1JG2A 4FONA 2R7NA 2V5VA 3GT7A 5BN4B 4DMKA 4TYQA 3HU5A 5TGTA 3RYIB 4KZKA 2QQEA 2WWXA 2E4ZA 5LXTA 4I9FA 2WLTA 1WDTA 1J8FA 1ATZA 2E21A 3TRFA 1ZUIA 2YV3A 4IHQA 4F4UA 3FPKA 5F5LA 4K05A 4AY4A 5JRDS 4FHDA 3PC8A 5IXYA 2NVWA 2VWPA 4I4LA 5F7ZA 1PD0A 3J7AC 1R1DA 1Z0KA 3QP9A 2YTZA 1KP9A 1LJLA 2ZIFA 3D3NA 2O8EB 3LBHA 4E2WA 3U26A 4Q66C 2Y1XA 2W2XA 3KJGA 1UP4A 2X19A 5IM5A 4RTJA 1IPHA 3IA7A 1YZ3A 3L7BA 4HB4A 1AGPA 3HCRA 3UMSA 1QU2A 1OYVA 5I8PA 2X6TA 2XXBA 4IFTA 3I5YA 1CUEA 2W7TA 1U7HA 1NDQA 3UC9A 3B70A 5G3YA 2ACWA 1KZ6A 2HNAA 2HU2A 3KUUA 1RJ9A 4J9UE 5IN4A 5JBIA 3TSCA 5LOVB 2AF4C 1OFUX 3AHCA 1L5LA 3QLVA 1DCTA 1K8XB 3AJEA 4HTFB 3SZGA 5JQWA 5K8VA 4FOLA 2L0XA 1G8JA 1ZGZA 3IEUA 1RW4A 3P0HA 4PQFA 1XL1A 1MC5A 4DLYA 1SVOA 2GUWA 1QE0A 3BD7A 5IJ9B 3ZCTA 1OH7A 3T5MA 1UXIA 1G4HA 2LGJA 1C5KA 3PTLA 3PXAA 1H4SA 4ZT2A 2AJTA 4PR0A 4TQUS 3OPMA 3DL2A 3WWOA 1AE1A 1FP4A 1RHQA 2XUIA 1F7UA 4NEHB 1L5HB 1R0RE 1OWNA 5CDFA 4Q9LA 2VJKA 4IJMA 4D3DA 4YPOA 1PYOA 3KVOA 5K1ZA 1GJRA 5AESA 2XUGA 5TJHA 3RS8A 3UGJA 4W1RA 1U98A 4NECA 1OX4B 4PAQA 2Y77A 5IUKC 2VZLA 2OV2A 4TMFA 3FOZA 2BJWA 3FMGA 3GLVA 3MHTA 3F90A 2PS3A 1U2RA 3F8SA 4EMBA 4RLSA 2I78A 1P45A 5KDOA 1SPBS 3E35A 1WETA 1OROA 4Y2VA 2YC2C 4B0PA 1ONNA 2PLRA 2W5UA 2GZSA 5JO0A 3FSGA 3PUIA 3PKJA 1IIRA 3OLQA 3NU1A 3V33A 3EJWA 4QUAA 3TECE 2BGMA 2FFBA 3N8NA 3EPHA 3RFUA 4P93A 2BP7B 1THGA 4X1YB 1TXGA 4AQ7A 3BSWA 4Z49A 1UT5A 1MV8A 1UZMA 2WSSA 4AKSA 2G71A 4O2AF 3FTPA 3VJKA 4C7JA 2XMBA 2FG5A 3AXTA 4X8MA 5AK3A 3PHHA 3QG5A 4RJIA 2O4CA 3K70C 3EY9A 1JDJA 4PRKA 1WY5A 1AKTA 1M10A 2AR9A 1YIDA 2B69A 2I29A 4IIHA 1GUYA 3PWZA 1H5NA 1KJZA 4N7MA 4N76A 1A7AA 4ID3A 2CZCA 5GM2A 2DT5A 4RADA 2X9LA 4EMUA 2FE1A 4AN0A 4RYLA 3QNUA 4KQ1A 1E0KA 1KJQA 1PWHA 5DNCA 2GZ2A 3KYIB 2BN4A 1TQDA 3GU3A 1X9HA 4MKXA 1GGNA 1QH1B 2D1TA 2QJWA 3IPYA 1AGRA 2VSYA 3PU6A 4ISBA 4QBIA 3W34A 4BNMA 2LZ0A 4ZCMA 5L3QB 2CCGA 1GQFA 4ND5A 3CNHA 3RHSA 1IONA 3A9WA 2G40A 4XWGA 1P2BA 1V4BA 1KO8A 1S2MA 1KIAA 3K0BA 3KYDB 3QSGA 5HCUA 2MWMA 3NH9A 3V2IA 5FO0A 4ZYVA 5BQFA 1J2UA 1HETA 2EV9A 2H54A 3FWPA 5B58C 2PGJA 1Y80A 4JT8A 4GM0A 4NICA 5MDHA 3W77A 1GYPA 4TROA 1TAGA 5LA6F 3VZRA 2EP8A 4NMHA 4UTOA 1JR4A 4EKIA 2XQFA 4YCAA 4FE4A 2IV7A 2XVXA 4A0FA 4GPAA 3KAKA 3F2VA 4Z86A 3EXIB 3KZNA 4RXMA 2BR5A 4FDTA 4RK0A 4C5AA 1W2GA 1JLLB 2PZJA 2OZEA 1CX9B 1QG4A 1PJ3A 1MQ9A 3CNEA 3MS2A 3LYUA 4FFNA 4INZA 4TKLA 4D3XA 1N77A 2C1XA 2V5UA 5EJAA 2EHJA 2AN9A 2VHWA 1NNLA 5AVWA 1XJ5A 5MHTA 3AR6A 1PVOA 3IBTA 3BWYA 4N12A 2IWHA 4AZTA 1IQRA 2A1UA 1RCUA 4PYIA 1EK1A 3GG9A 3PNYA 2C9OA 3ESDA 1UXOA 3QVTA 3JU3A 5DYNA 3SYMA 2AR7A 1WSAA 2B9VA