4MR9B

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist sch50911
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
415
structure length
403
Chain Sequence
b'SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 141
structure length 403
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr9B02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mr9B01
3EJWA 1D1QA 2TMYA 4MYRA 2J48A 4L85A 4LDAA 4G0PA 4ETIA 4PEVA 1USKA 2FW0A 3KS9A 3RVQA 3M6MD 2MYNA 4MPTA 3SAJA 1APBA 2QZJA 3B2NA 3M9WA 4HYEA 1KRWA 2VUHB 3QEMA 4WZZA 2OQRA 3ROTA 2GX6A 4EYGA 2L2QA 3DZDA 4RXUA 1S8NA 4M88A 1Z18A 4XARA 5C5CA 5TE9A 3O21A 2KYRA 3LUFA 3E61A 2LIVA 3LUJA 1TJYA 4DQDA 1ZESA 3TX6A 4YP9A 3OLWA 1P8AA 3OQOA 4JP1A 3LUAA 1YMVA 1PUXA 4RU1A 5TQ0B 2PE5A 3KG2A 4LRQA 3RVRA 2A9OA 2JB9A 3I09A 1QPZA 3FMVA 4G0YA 3DLHA 1E6MA 2MSLA 5D2CA 1JLKA 3F7NA 1U2PA 3L6UA 3ROFA 4WXMA 4OBBA 1XWWA 4MR7B 4RKRA 3IPCA 4D6YA 2IYNA 3LUKA 2B4AA 1DZ3A 1RPJA 1RXEA 3A3KA 5GQSA 1E2BA 1DP4A 4OLAA 3SG0A 3QLUA 3RVNA 1ZH2A 3RVLA 3Q7TA 1YK0A 3W9SA 3I42A 3GBPA 1NATA 1JX6A 3GT7A 4JOQA 1LJUA 3GL9A 1E6KA 3KLNA 1GCAA 3HO1A 4FE7A 1QP4A 2NZUG 5B3JA 1EHCA 4Z0NA 4UHKA 2PL1A 3NNNA 4F3TA 1ZVVA 4Z4HA 4TMYA 3IPAA 5IULC 1NTRA 1QQBA 5B3JC 1RNLA 4N03A 2QU7A 4JA2A 2WMYA 2FSPA 1MAVA 2OENG 3ILYA 4OATA 5JNVA 1ISSA 5TPZD 2NUBA 3GV0A 3BRSA 4RK4A 5TPWB 4EVSA 4O1HA 3QEMB 1E6LA 4HNRA 4FE4A 1YS6A 5IEBA 1ZHHA 1OXBB 1JDPA 5FWXA 4RK6A 2HSGA 3HDGA 4G0QA 2JBAA 1C4WA 1NY5A 3RVMA 2IKSA 3O2JA 2LUOA 3C3MA 4XASA 1RXIA 4NICA 4Y9TA 3RQIA 4NV3A 1DCMA 1D2AA 4MQEB 4YGXB 2A9RA 2FEWB 3KTOA 5C5EA 3OM1A 2PJUA 5TQ2A 4MS3A 3D02A 1T34A 1MVOA 2LBPA 3K9CA 4DN6A 1DRJA 1U0SY 4YO7A 3F6CA 3OO1A 3MMNA 1PEYA 4RSMA 2QSJA 4N0PA 2PUBA 2LP4Y 3RVSA 2MSWA 5JNUA 3O2SB 1ABFA 1ZITA 4WWHA 1D4ZA 1MB0A 3I45A 2GKGA 1BDJA 2WJAA 5FWYA 1FQWA 1GCGA 3URMA 2PUCA 1EAYA 4LE1A 5EWJA 4RS3A 5JNWA 2F8TA 3FFTA 3MF4A 4G0XA 4G86A 1SXGA 3BREA 1XHFA 2IPAB 3N53A 2JK1A 1VPWA 1HEYA 3LOPA 2HQBA 3EGCA 3H5IA 1M2FA 4KQCA 2PUDA 4N47A 5KQGA 4QICA 1TMYA 3HZHA 5JNTA 3VNAA 2L17A 4O5AA 3A0UA 3A10A 5KC9A 4W5QA 2M1ZA 4XXHA 5PNTA 5ABPA 3Q15C 2ID7A 4KQ9A 4W5OA 3IP7A 3MIZA 3G85A 4MLDA 3HK2A 4JAVC 3UUGA 4KK3A 2QW1A 3KYIB 1QQAA 4ZMRA 4RZSA 5TPZA 3SNKA 1JYFA 2FMHA 1I3CA 2H0AA 3DBIA 3KKEA 5FWXB 3OQNA 3L49A 2JBAB 4IRXA 5IC5A 2YHBA 2JVIA 1RZRD 3BILA 3N75A 1YIOA 3CZCA 3SY8A 4ZJPA 1YTUA 1EWTA 1R8JA 1TM2A 3QELA 1ABEA 2PL9A 1SXHA 1JBEA 3CG4A 1LBIA 3QX8A 4LZLA 2L18A 1JFTA 2PUFA 5IUJC 2IPLA 2RGYA 3LKVA 2FN8A 2FMKA 2NT3A 3H5WA 3H5TA 5CNJA 1QP7A 3DGFC 5EWMA 5FWYB 4MR9B 4JB0A 5HKOA 5EWJB 1ZGGA 5KQLA 1PNRA 3H75A 3GRCA 1SD5A 4IMJB 2R47A 1C0EA 4MS1A 2WY2D 4LDZA 3T95A 1EFAA 4W5NA 2X7XA 3I5AA 3N0RA 4MGEA 5IUKC 1FFGA 3C6QA 5IUNC 1YS7A 1BDHA 4MQFA 1CEYA 3CFYA 2FTKE 4P1ZA 3IP6A 1EWVA 4OLBA 2YHAA 3OO0A 1TLFA 4RDCA 4JB2A 2JVJA 2O20A 3BBLA 3KJXA 4NQRA 3BRQA 2MYPA 1ZDMA 2CHFA 5IEJA 3E3MA 1JYEA 1YVUA 4KK4A 4EVRA 4S05A 2FQXA 1B00A 1NXPA 2A9QA 4O1IA 4P98A 5BR1A 3O2QB 3JS5A 2PLNA 2RJOA 2WB4A 3FFXA 4KPYA 3NHZA 3GYBA 1QMPA 4PICA 3TB6A 4NCBA 2QXYA 5DTEA 3SQNA 2Q5CA 4PZ0A 5T3YA 2PKXA 1BAPA 4KMRA 4Z4GA 4RK1A 1QP0A 1K66A 3QLVA 1ISRA 2FMIA 4N41A 5F64A 1A04A 3LUGA 4KRFA 2R25B 3EQ2A 4TLLB 1JL3A 3ILHA 1W9HA 3VNBA 1BDIA 4N0QA 2PAFA 3QLVC 2IOYA 2W42A 1KRXA 1H9CA 3GWGA 5DCLA 5CNIA 2B1JA 1Y1LA 1VRVA 3MYYA 2V0NA 3KLOA 3H5VA 4Z99A 4W5RA 1RZRA 1FSPA 1DG9A 4KV7A 1M5TA 1M5UA 1SRRA 1PHRA 2M98A 3C3KA 4ZYLA 2WRZA 3OM0A 1URPA 1EWKA 2QVGA 3EAFA 5FBKA 2VYCA 5KWSA 3O74A 2GWRA 2HQRA 4IILA 5EWMB 1NXVA 4EVQA 5HSGA 3T38A 1DCKA 3H6GA 1DJMA 5GOTA 5ED4A 4OG2A 2FVYA 1P2FA 4LE0A 1Z12A 4QYWA 3OLZA 3KHTA 3Q7SA 3QEKA 1Z26A 4RK0A 3RH0A 4B09A 4W5TA 4TLMB 4Z9BA 4IMIB 3HXMA 3HUUA 1VLZA 1KGSA 2JVKA 1F51E 5TQJA 1SXIA 3HM9A 1A2OA 1NXSA 3A0RB 4YS6A 3RVOA 2E4VA 3JPWA 2ID9A 4IGAA 1WETA 5JNSA 2WJWA 4CBVA 3TO5A 3JPYA 2PMCA 3HUTA 4KZKA 2XDYA 3IP5A 3CG0A 3G1WA 4LE2A 4Z4FA 2A9PA 4MAAA 2CD7A 3LUDA 3R0JA 4D6XA 4ML3A 1LJLA 1JHZA 1USIA 4MRMA 5CNMA 3CKMA 4N76A 2F8SA 2NT4A 1Z17A 4WT7A 5E3JA 4KFCA 3JVDA 1JFSA 4KNYA 3MQ4A 3HSYA 5KQMA 1XHEA 3OLXA 1Z16A 1K68A 3C3WA 4G0OA 3CNBA 4RK7A 4EYQA 6CHYA 3LTEA 4RXMA 1ZAYA 4YV7A 5KI6A 3P9YA 1QKKA 3FGZA 4RXTA 1DC7A 1MIHA 2GI4A 3GA5A 5JS2A 3MA0A 2FXIA 3JVIA 2N9UA 3EQZA 2E4UA 1OXKB 4TN5A 2I6FA 1BVHA 4EYKA 5CNKA 1YK1A 1AB5A 3N0WA 3O1HB 5EWLA 1Z2DA 5TQ2B 4MS3B 3TD9A 3EULA 1ZN2A 3QLTA 1VKRA 4PYRA 4F8JA 3JY6A 2FLWA 2CWDA 2PUAA 1KMIY 2QR3A 4JASB 4MR8A 1PNTA 3OLVA 1LK0A 3H5OA 3H5LA 1W25A 1JFVA 1DBWA 3Q9SA 5CHYA 1FFWA 4F06A 4YWHA 1D5WA 8ABPA 3Q41A 4Z4CA 3Q7RA 7ABPA 3T6KA 5TPWA 2E4WA 2P9HA 4GPAA 1GLGA 4F11A 1P6UA 3UKJA 1Z25A 4OTZA 1ZH4A 4UHJA 3TMYA 3LUHA 3NNDA 4ETNA 1U8TA 5HQJA 3F6PA 3HS3A 3K4HA 3CTPA 1JWLA 2NZVG 3QK7A 4GNRA 4RY9A 3T8YA 3H1EA 1LBHA 1QO0D 3NHMA 4MRMB 3CRNA 5DLEA 4FB4A 4LX8A 1AB6A 3F73A 4MQEA 3DLBA 2LPMA 1GUDA 2RJNA 5FBHA 2IPMA 3LKBA 1U2QA 4D74A 3HDVA 4Q7EA 4YR7A 2DRIA 1NXOA 3SM9A 4IF4A 2HQOA 5JS1A 2MYUA 3C97A 4MLCA 3IDOA 3NNSA 2R48A 2E4XA 4QPJC 5BRJA 4HNQA 4YRZA 1J56A 4DADA 2RDMA 5I4CA 2AYZA 3H1FA 3QLUC 4G97A 4F12A 2AYXA 4QYMA 2MSKA 2R4QA 3QELB 2FQWA 5EWLB 3FDFA 3KSMA 4NCAA 3FFWA 4MS4A 3O1JC 5DKFA 4S04A 3S99A 4EGSA 1UDRA 5JNRA 2FEPA 1DBQA 1USGA 1A0OA 4Z4IA 4Q6BA 1CHNA 2IPNA 2ZAYA 3QX9A 4MR8B 3GBVA 1Z13A 3RVJA 4XAQA 4EYOA 4WUTA 1IIBA 3CHYA 2E4YA 1NXTA 4HNSA 5BQ3A 1ZGZA 3LMKA 1NXWA 4RKQA 3EODA 4ZPJA 1BA2A 6ABPA 4MS1B 2E4ZA 5IBQA 1JH9A 1U04A 4RV5A 1PEAA 4KVFA 4MQFB 1CYEA 3KYJB 4PE5B 4XFKA 9ABPA 3HV2A 3LUCA 3HVRA 3HJFA 2JRLA 3OQMA 4KREA 1F4VA 4ETMA 4L4UA 5HM6A 1FFSA 5T7BA 1DCFA 3EDCA 1P6QA 4H3HB 1D1PA 1QNLA 2CHEA 5KC8A 1QO0A 3LFTA 1L5YA 1DBPA 4Q6WA 2P4UA 4RK5A 1Z2EA 2QV0A 3N6VA 4YLEA 1YMUA 3IP9A 3N8IA 3OMWA 5BRAA 5DGCA 2FKAA 3JTEA 4G0ZA 4Z9AA 5TQ0A 1DC8A 2WWVD 4Z4EA 3NBMA 3D8UA 4MR9A 3MM4A 3DGEC 3OMXA 3CS3A 2BGGA 4H3KB 2FEKA 3HEBA 2HJ9A 4MR7A 3O75A 3OLYA 4G0MA 2L19A 2FLKA 2HPHA 3CU5A 2PUGA 1ZY2A 1L5ZA 3H6HA 3O1IC 4RWEA 2FQYA 3HCWA 1JDNA 2ZWMA 3UK0A 3CLKA 2FMFA 4MS4B 2VK2A 3H1GA 2QVCA 3RVKA 2PUEA 4EUKA 4EY3A 1MB3A 3M9XA 4WXEA 3N0XA 5IX8A 4H60A 4E7PA 3CZ5A 2MYTA 2JCGA 4RY8A 1M2EA 3KCNA 2FN9A 4YCSA 1TVMA 4ZMSA 1JF8A 1DRKA 1GUBA 4XLTA 4RY0A 2H3HA 1NXXA 1Z15A 2VUIB 2IDMA 4E7OA 3RVPA 2GBPA 5KQPA
chains in the Genus database with same CATH superfamily
3EJWA 3F0TA 3QYPA 3DBHA 2YH2A 3MT7A 2I55A 1S2LA 2C58A 1EFKA 4DUGA 1D0IA 1OX4A 1EQAA 3FN4A 3LHKA 2GHIA 2ZKIA 4NU6A 3RV4A 4XCVA 4BQRA 1QX4A 3LAWA 4QIHA 3KSUA 1AO0A 3OBIA 1H94A 1L0BA 1M8KA 4RDHA 4ZQBA 1CIVA 2J0UA 1LPAB 2JNWA 4JT8A 2VUHB 3FOCA 3DAPA 2CXHA 3K0CC 3BJEA 4YAWA 5K0NA 1FMFA 4Q7JB 1CJBA 4MVJH 2QE6A 3QUQA 4YDRA 3R3YA 4JJAA 1ZD5A 4S1VA 2Z8YA 1N2SA 3D6JA 3HDTA 1R0LA 3JARB 1UK7A 3RBXA 3E6AA 1LRJA 2NX2A 4CUKA 4G5RA 3Q2OA 1N3BA 3B9RA 3KX2A 4H7DA 1JJIA 3BWCA 2WPDD 4UMVA 5ERXA 4KNVA 3KT6A 4HMPA 4RS4A 3LUAA 3TZCA 4BGEA 3BXOA 1YD7A 5SZHB 4PS0A 3RJ5A 4Y2XA 3RVRA 1LI7A 1R0BA 5DIZA 1DQPA 5EXXA 1PK7A 2A94A 1CUGA 2P7IA 3FJYA 3PU6A 5D2CA 4U6NA 5BO5A 4BO1A 2HA4A 3QI2A 5T4EA 1FJ2A 3DDWA 4I1YA 3GDFA 1QANA 1ML4A 1VPTA 2OXRA 2A0XA 4F5DA 3QQ5A 4O33A 4W1SA 3NANA 3A3KA 2PNFA 4BAUA 4BWFB 2ZYAA 1MW9X 4M36A 1ZH2A 3HY6A 3RVLA 4MRNA 4RM3A 2Z4TA 1HURA 3I42A 2X0DA 1YBFA 2NUPA 1A7JA 2IYYA 3SDSA 1J6UA 3H2KA 3TSWA 2GR9A 2DERA 3KLNA 4ZGGA 1E3EA 5DK4A 3IBYA 2BMEA 1SXJB 1P60A 4L8VA 3WIEA 1XN1A 2NSHA 3OU7A 1CZOA 1LK5A 2QTRA 2P1ZA 4YCAA 1EHCA 1JMKC 2IYRA 5HBGA 5HZMA 1LF0A 1PWZA 3FYUA 4QDKA 4QXRA 1ZICA 4TL6A 4YJKA 4Z51A 1MC1A 1YZ3A 2Q1UA 1DFIA 4IJWA 1UKEA 5FUMA 4ZZ1A 4YFVA 3V2HA 3TR5A 1E3TA 1YRYE 2IITA 1GVHA 3BQNB 2BUBA 3DVAB 2ATXA 4P5EA 1R5OA 3QXCA 4C6TA 2OZPA 5JNVA 3NX4A 4Y2PA 2WJJA 1L7MA 1SVSA 3ZWYA 1XTVA 3MC1A 3W6ZA 3UPUA 2J31A 3ZWVA 1Q20A 3K0BA 4K88A 4EVSA 1LUAA 1H69A 2AD1A 3QEMB 1RWPA 5KU7A 2RMKA 2OOSA 3TUJC 4E15A 1V8OA 1UJNA 1ORWA 4DM3A 3L7CA 4PX3A 4R71A 1TMKA 3BJMA 3RFCA 2WA2A 1GAQA 1DXYA 2OORA 5FD8A 5GJCA 3RVMA 1RQLA 1W0CA 4ZDJA 1NQTA 2C9BA 2D1RA 2JK0A 3HA3A 3MWEB 5F2OA 1KQFA 4PY2A 4R54A 4PCUA 1N9KA 1D2AA 1E5VA 2WOOA 4HDNA 3T3MB 2B4YA 3KTOA 1G5IA 3OURA 1PJ2A 3OZGA 1U28A 4XM1A 3QMVA 2OFOA 3K0KA 3IAFA 1RAFA 5IJXA 3N7UA 1NE2A 4OYYA 4QVKA 2C2ZA 1FMLA 1ZJJA 1RJGA 3H5RA 3K09C 4NPHA 4A3SA 4F56A 2ZXUA 4ABTA 2YUIA 3ZI4A 5CVEA 2TRSB 3WGMA 2Z9BA 3NCHA 1IUOA 1L1EA 4WCDA 2ZTHA 3N2EA 1RQ7A 2GKGA 4TMTA 4AZTA 1ZMRA 2PX0A 4YCJA 5IHPA 3URMA 2FN7A 2V96A 5CEEA 3I6YA 3LT4A 4ZPXA 4ZI7B 1ULTA 3WBKA 1K1EA 2JK1A 4V1CA 3OOEA 1N5DA 1QGYA 5DZSA 4HI0E 2OCAA 2PRKA 4WXPA 3LUBA 5CD9A 2CVOA 2GFHA 3COWA 4M0DA 5HTKA 1L5FA 3I9KA 3FBGA 3LVQE 3I83A 1IHYA 1H4SA 1NVXQ 5LP6A 1EFRA 4MAMA 3HG7A 3QP9A 3EWNA 2C9YA 3F47A 3HZHA 3OU2A 3PYMA 4DBLC 4DM4A 1DAOA 1O95A 3D8HA 3BZUA 1QH1B 3S70A 3QVMA 4F7WA 4LNUB 2FUEA 5JSKA 5FOQA 4ZV9A 5KC9A 5JTUA 2Y1LA 2HRRA 3BG5A 2V0CA 2ZRJA 1I6WA 4QDUA 3G85A 3DFIA 3N7AA 3PYXA 3DS8A 1AK9A 2WC1A 4M0UA 1U8CB 2ATVA 2BMVA 2VQ6A 4H77A 4QQNA 3S7ZA 1JSXA 1QQAA 3DT8A 3KWFA 4EY6A 2C88A 2F55A 4YMTA 5TPZA 1I3CA 3EA5A 2WT8A 3QFTA 3T5MA 4C6SA 3ADCA 2OHHA 3JYLA 4IRXA 3WJ1A 1GZDA 3PRHA 1IXYA 4L8GA 3BILA 1PT9A 3DO5A 4FSDA 3B1YA 3SX0A 1MA3A 2DETA 1M54A 5FO0A 1AF7A 3DEAA 3VVMA 3R7LA 1XLTA 1TQDA 4TYPA 4XWOA 1K8QA 3G8BA 4U7FA 1NR7A 4P7KA 4G67A 3EAQA 3BQ9A 2E37A 4TLEA 1IBRA 2QLTA 4UPDA 1NDHA 2PK3A 1LTHR 2YXNA 3FYHA 4H15A 4YA6A 1EFLA 3OZFA 5DW0A 1PAUA 4G09A 4KIFA 2BM0A 3U16A 5FI1B 5I7FA 1GGHA 2DULA 3QVXA 1QP7A 3E9ZA 1U65A 3LHIA 1H8HD 3G2LA 4ZEXA 1PNRA 5EZQA 3E7PA 2DTEA 2FETA 4MGZR 1SD5A 3EXHB 2R47A 3U37A 1SMKA 3ZQUA 4D98A 1E2FA 1KNQA 2FHSA 1JR2A 2V6FA 3KQPA 1CW2B 4GPBA 3ZCXA 5IUNC 3DCNA 1O5OA 4AB1A 1BDHA 3PXUA 1CEYA 3DEIA 3CFYA 4WAUA 3V3TA 1LBQA 1XTSA 3ANMA 1S5PA 4QVIA 2XDQB 4FFMA 4B80A 5DNYB 3ZVKA 1M1ZA 5LYJA 2XXBA 3M34A 1J1ZA 1CY7A 1I36A 3LCMA 1COZA 2JKVA 3DEKA 2IEGA 4NQRA 3ELYA 4DNXA 5FAKA 1ZDMA 2EERA 3PX2A 1JIUA 5JYDA 2PGDA 3VDQA 1OFGA 2WF9A 2ZUUA 4C4PA 3IDQA 3CWCA 4YCBA 3QMPA 2XYRA 3G0OA 4W7IA 2PLNA 3C8HA 3K16A 3FFXA 4Q3KA 3VQTA 2PDAA 1C3LA 5F7ZA 3AG5A 4HATA 4KJZA 2QZ4A 4UNSA 1CS0B 4PZ0A 2PKXA 3QKUA 4HQOA 3GVIA 4NZZA 4IGFA 4RYLA 4EFDA 2IW3A 4CMIB 1ZOOA 4XUGB 1BE6A 4A0SA 1U8AA 1UBCA 3RODA 4YX9A 4C89A 1Q1BA 4OI0A 1XRMA 1RLOA 2ZJ1A 3PQEA 1K7CA 4N0QA 2IOYA 4CM3A 4MNTA 1LFDB 4WECA 4L7QA 4F6RA 1RXWA 4FX2A 1WUHS 4B1FA 1F1BA 5BSEA 4ZVSA 4W5RA 1JALA 3OY7A 2NU8B 1GXSB 4NZ9A 1U5CA 4KE8A 4NCKA 4F5ZA 1DAHA 1J9GA 5IT4A 5JECA 2Z1NA 2H7XA 1KO8A 2AWNA 3CWZA 2XWSA 1CY4A 2XB6A 1P1IA 5JCJD 4UXHA 4WLVA 1J9ZA 2BFDB 1IBSA 1Z0FA 1U2RA 3UMRA 1AT1A 4J3FA 3VC1A 1I6LA 2QBYA 5AM4A 4YCDA 1T3SA 2SECE 4C1NA 2H52A 2QAGC 2BKAA 4D4LA 4JR1A 5ESWA 3JQ6A 5IJWA 2IEIA 1IY8A 1A4RA 1SO8A 1X42A 5M5BA 2QTNA 4EH1A 4RK0A 3RH0A 5BUQA 2WU3A 4WINA 1QCDA 5HUHA 2VRWA 1IQ0A 4QEDA 3R7AA 3KQQA 4PIPA 1VLZA 3NUGA 4EHIA 4DB2A 1AMNA 4CEJA 5BNWA 1PFQA 1YTLA 1VIVA 4P31A 4CLXA 3VO1A 4MJLA 2R7KA 3HO6A 1RAAA 1EEXB 3NPAA 4UQOA 4E14A 4ENVA 1IB6A 4K9OA 3TR6A 3PT9A 1SUSA 1PFWA 3P20A 2QL5A 1G19A 4K6GA 2RK6A 3R0JA 4OQFA 4RL6A 1CY6A 4W5WA 2IRWA 4ASUD 2EGUA 3EMVA 2X3UA 3TVTA 5JCOC 5EQFA 2EDAA 4G4GA 3D3WA 4BFYA 1ST3A 2WVHA 1NRJB 3W6PA 1DG1G 3R24A 1T5DX 2X23A 4OGGA 1W85B 2BH9A 3FFAA 4WESB 2PUWA 4XGIA 2HX1A 3SDBA 5BXYA 4R1QA 1UPCA 4QE3A 2IJGX 1KEEB 2F8LA 4JJEA 5HM8A 2GF9A 6LDHA 3QSYA 3LHFA 2C82A 5CGZA 1TE2A 3M6FA 4GWGA 1Z73A 3PWTA 4RK7A 2QZ9A 3SIWA 4FMDF 1BS1A 1PQYA 2C2KA 4M6WA 2F3UA 1QKKA 1C3VA 3P9YA 1Q0UA 2EWVA 5A06A 5B7GA 1Q0ZA 4WBNA 1GZHB 4XGKA 2GVDC 3C6KA 4ZRNA 3TW6A 4E08A 3CR7A 4ANFA 3L04A 1IVYA 5JI2E 3KP1A 1SXPA 2WYIA 4FN5A 2FXIA 3D5QA 2RGNC 5BW5A 2N9UA 4OO3A 5AH0A 2AJDA 4TN5A 4ZDKA 3EEIA 2FCAA 2VBCA 3AOGA 3FROA 3IO5A 5IFKA 3F2IA 1AB5A 2GM4A 4K9QA 1GTZA 2QIOA 1RSZA 3AGQA 4JFAA 3SC4A 5CH3A 1T2FA 1GZUA 1RHUA 2QS9A 4A23A 2Z2IA 1STOA 1KJYA 5IKPA 2V4ZA 3Q12A 1KMIY 4HQKA 1Y9AA 3AIMA 3LC0A 1XJCA 4RQUA 3L02A 1XLUA 3WLOA 3OZVA 2OCDA 5HZHA 1T6YA 2J0EA 1XZDA 3O83A 1OZHA 3AL2A 4A8JA 2G3YA 4Y7CA 3CB2A 5ELLA 1IXKA 3GX1A 4INAA 2F64A 3TTYA 2DMRA 1UR5A 1MO3A 3OTOB 3TNJA 2NLOA 4QFMA 2H31A 3HCDA 3DZFA 4BRWA 1US8A 2JIDA 4QGHA 5C9ZA 1I4DD 3F6PA 3IEPA 3TRJA 5HJ5A 1A2BA 2QN1A 4YRAA 3T8YA 2Q4OA 1DC5A 4RIEA 5EG5A 3SMQA 1BEEA 3PICA 2D00A 4P83A 2RJNA 2C4MA 3KK0A 2HYDA 2W2OA 3GZJA 3NQ41 4KB5A 5EP4A 4A6PA 5I7OA 2WWXA 1JP7A 2BN4A 3I9NA 4I4TF 5G1NA 4GOND 3AR5A 4MB6A 3Q11A 4R2KA 4C5BA 2II6A 4EKIA 1Z28A 4H7EA 5DHPA 5CIQA 5H70A 2E4XA 3RTGA 1ZU5A 5SY6A 3KE8A 3GEHA 1OB5A 3PEWA 4RZHA 4YRZA 1EDEA 3NHAA 3WICA 3PNSA 3KSAC 1Z68A 4MHSA 1M7BA 3OUUA 1THGA 2BCEA 3C7KA 3H1FA 4RF2A 4G97A 4KDRA 3MJTA 2GCIA 1R4MB 1FDTA 1FYXA 1H6AA 4KIUA 4QYMA 5LUBA 2DOKA 4WBSA 4B3XA 3O91A 2W2PA 2QQEA 3OQJA 1CERA 3DTVD 5CPBA 3HLTA 5IJ9B 4ZI5A 3P32A 4S04A 3L8DA 4RD3A 3C1AA 5HS4A 1UAGA 2EFJA 1SXJD 4CWAA 4D80A 4ZYTA 5JU6A 4QYTA 1NN3A 3L8CA 1DBQA 3WLHA 3DE0X 4JYCA 1U31A 1L7RA 3MUFA 4DA0A 1P5FA 4IGIA 1SKMA 1V9SA 2WU8A 3DW1X 1XJWA 5GJVC 5HZKA 3F3MA 4KUEA 3WKBA 3K0FA 3HB0A 4JT9A 1CTQA 1ARZA 2ZB4A 3KVYA 1CDDA 2E4YA 1B8OA 3ZDQA 3KALA 1G20B 1JQLB 1YL6A 5LFAA 1GDTA 3CRVA 3DE1X 1CNMA 2FHPA 3PNPA 4HH4A 3WLMA 1XVIA 3TTVA 1DG3A 1JHQA 2AB0A 2P3QA 2X8LA 3K53A 4RV9A 4RQBA 2O07A 3UXYA 3VSCA 1RM4A 5KYNA 2JLZA 4YHHB 2B2XA 2P9QA 4PE5B 2AKEA 4U7WA 1E69A 2CVZA 5DHAA 5EMHA 4U6QA 1JN0A 4IHJF 1HDZA 1WZUA 3HKDA 1BE0A 3ZK8A 5KIAA 2G77B 1ENZA 3PWSA 4F72A 1Q50A 1JILA 3K1AB 3BMOA 1IBMB 3C5EA 5KJFA 3CE9A 4JVNA 1BEUB 2ZJ6A 2AN5A 4NECA 1GO2A 5G4LA 4DVGA 3WNDA 3ED1A 4J6EA 5EAIA 4OLHA 4G9BA 3K72B 3L4JA 2WV9A 3DL4A 2ZSAA 4YJHA 4XUDA 1H2YA 3OMWA 4RVDA 1OV4A 4N5MA 1WUTA 4D3SA 5DGCA 4FVTA 4S1TA 1VIMA 1ZM9A 2AJ8A 3BF7A 4FFSA 1CUEA 3U3OA 3S81A 3L06A 2R84A 3EQ6A 3QUTA 4DW8A 2HUPA 5C1OA 1TA4A 5KYYA 2DPMA 1EBBA 1G5TA 4G0MA 2AEEA 2Z2YA 2HPHA 4DCVA 1IBKB 3GLHB 3T9FA 4PN3A 1D09A 1SUCA 4HVAA 4L3OA 3JD3A 3AONB 3NATA 4CKCB 5A1JA 1BXZA 2IC5A 4CLDA 3A70A 1S3GA 1HDYA 2XTAA 3NEJA 2BDEA 5K3DA 1RYZA 2FFRA 3CZ5A 3E15A 5FBRB 2QY6A 3BCHA 3SC2A 3DM5A 1J4AA 4KN6A 1OY1A 3PTZA 3RUFA 5J58A 1KDOA 2UUAB 3AVVA 2V5VA 1D2CA 1KMNA 3JQ7A 1E61A 4TXNA 3U4GA 2Q2OA 3AJRA 1UFVA 1JBKA 3FLBA 3AP2A 1H5QA 2ZULA 2BVNA 2IEBA 3FPLA 3FMPB 1ESZA 2FEAA 1KKLA 2PZKA 4EY4A 3WQHA 4GLLA 3UH1A 5G3ZA 2R2GA 5IDYA 5SICE 4AP9A 4CTNA 1OH6A 5T67A 2CJPA 3OOWA 4GHWA 3L82B 1YZTA 2HQSA 4G0PA 4L85A 3YASA 4B3HA 1XUOA 2OCLA 4BBAA 2NQ8A 3R3XA 2GCOB 3F2VA 4D2IA 4E0BA 2R1VB 2HV9A 1C30A 3D9QX 3WIOA 1BWRA 2QNIA 2CVPA 1II0A 4K9PA 2WF5A 5TQVA 2XVYA 2YWDA 3EF1A 3EVBA 3RUCA 4IX1A 1ZD3A 1T5HX 2FX5A 2ZUTA 3RS0A 2VP2A 2QD5A 5KNCH 3LDHA 4ZHSA 2AUTA 3KQMA 1PUXA 2OCIA 4B9AA 2PE5A 3O8QB 3PEYA 1BMTA 3RU2A 2CDNA 4E46A 5B7QA 3WLQA 1C1YA 2JJ2D 3SIRA 4HHEA 1Q11A 2J3QA 3T5BA 5T4FA 2I78A 3SJUA 4KX3A 4I5IA 4MWDA 4MVJG 1GYRA 1YCGA 2YNMC 3UT5A 5A5EA 4OXYA 3L9WA 2Z2KA 4M1SA 3QLUA 3R5XA 1UPAA 4TKVB 5I9LA 1HOTA 3JQQA 3Q7TA 2GMWA 1LLUA 1BCRB 2HPVA 3P2IA 5DT9A 3WMGA 5LP6F 3DKKA 4XCQA 3GRZA 3BGIA 1JX6A 3PL1A 3L4EA 1GILA 2GPAA 2W9XA 4H27A 2E21A 3NIFB 3UO8B 3R5JA 1SUAA 2H2FA 5CPFA 1Z74A 1DFGA 1H0HA 2P77A 5ALYA 4TS3A 5B3JA 4MARA 3R09A 4XVCA 1QG6A 2I5PO 4GF5A 2Q0SA 2RKWA 3CCFA 2ACEA 1GRQA 4G8DA 3T9CA 1JAHA 4KW7A 1U0GA 2V6BA 2A9VA 3V4LA 2C3YA 2X77A 1FFXB 4ARBA 1PW5A 3FR8A 4Y0NA 5IU6A 1QQBA 3KTFA 2PEZA 1BHSA 2XZDA 3WTBA 3ICCA 5K09A 3U5ZB 3QHQA 2O7QA 2NU7B 2C07A 4MIEA 4DCMA 4ED9A 4Z7QB 3DDCA 3HP4A 4LNHA 2B36A 5IVDA 1JUDA 4O1HA 3VZBA 1NRIA 1YB2A 5FEMA 2BCGY 2ZWPA 3T3EA 4K6OA 5JWOA 5ALTA 3THXA 4HT3B 1ADJA 4HFNA 3COPA 2HL6A 3GLTA 1ZXXA 1RI4A 4D9KA 1FTSA 1NLYA 3EEFA 1U6IA 2JGMA 4QJ3A 5CFMA 1LVHA 2GQ0A 4GICA 1KMCA 4O4IF 1NYRA 2RGDA 1USWA 2G06A 3JR7A 3UB3A 4PAQA 3I2YX 1GV1A 4HYYA 1X1TA 3K6JA 4YB8A 4OD0A 2H17A 4WA8A 4ZDIA 3KIPA 3ND5A 2BWJA 2Q3HA 4YO7A 1GU7A 3VAZA 3FHJA 3OO1A 5ALJA 4INZA 5EQDA 4IVPA 4UEWA 5COAA 4CKEB 3GJ4A 4RIIA 1F12A 2GZHA 3M5CA 2AC4A 5EPOA 1YE8A 3O2SB 3TPFA 1EFHA 3PE6A 4HJXA 4WWHA 3FPEA 4J8PA 4F97A 5TXGA 1V6CA 4JXKA 5H3CA 2PUCA 1U8EA 4Q3NA 2I34A 3C3YA 2HRZA 3FGPA 2ZBPA 3FFTA 5AJWA 4QPDA 1QGUA 2HUNA 2CYBA 4ZXPA 5H5JA 3VZPA 3DQQA 1L7XA 4PSUA 3AB7A 4QU0A 3JQ8A 2B61A 2B30A 3ZIDA 1A8QA 4BX2A 1NJ1A 5AMXA 3UCEA 2IZOA 1NW6A 4XR9A 4ZZIA 2WJZB 3T3IA 2ZDQA 4AC9A 1DINA 4HAXA 1CJTC 3AILA 4M87A 3VI4B 2ZI5A 3JR3A 2H57A 4IIVA 1EVIA 4UUMA 4Z53A 4RLFA 4BFWA 1RTKA 3GW8A 1F8FA 4XLZA 3L0DA 4ZWNA 2HO5A 2RHJA 2REQB 3F3YA 2IF2A 4NVRA 4KPEC 3NT4A 2M1ZA 1GGKA 1K0UA 2OHVA 3Q15C 4R8RA 4BTLA 9LDBA 4HNAB 4FWTA 1ZVMA 2BFCB 4TYYA 3Q3IA 1V96A 2PX3A 2EC5A 1XTJA 2YUTA 5L40A 1ZIOA 3JZMA 2QRZA 1LDBA 4ZMRA 2OPHA 4B2LA 4EL5A 4LCJA 3IT1A 1CEEA 4LHSA 1UDBA 1RBZA 1VKZA 2H0AA 3REGA 1XDBA 2XKJE 4ZARA 1KYZA 3M7IA 4I50B 3FX2A 4G8JA 4MGYR 4DLUA 1BW9A 5L53A 4S1WA 3RS3A 4K6HA 1KC3A 3QELA 5HRUA 1FFCA 4YJFB 4C5CA 1R7RA 1V5WA 3ZZNA 5HK9A 3S5UA 2O5CA 3LJKA 3MUEA 2NPFA 2YR0A 3CLHA 1O6BA 1WDMA 1EM8B 1Y7IA 2PU5A 2PUFA 2SNIE 1DLJA 3ICVA 1N32B 4ZCPA 5A5DA 4Q3AA 3WG9A 2ZUDA 1YOVA 1MP0A 621PA 4J2TA 1XBTA 2NT3A 2YWHA 1Y98A 4XM2A 3LYUA 3M33A 3K9HA 1UBSB 2ERYA 4HZUA 5FUVA 4OGWA 3F9CA 3ZD7A 2YWCA 1C81A 1D03A 2JFWA 2DLCX 4B6QA 4DA9A 2FSGA 1XQXA 4TV8B 1YVRA 3IT2A 4X20A 4UU7A 1J20A 1XCBA 3WYDA 3VR0A 1EJBA 1ZW1A 3RNOA 3IP6A 3GN1A 3R6TA 2FZ5A 4RDCA 2OD7A 4O2RA 4OCZA 4LYHA 3CZ4A 1U0BB 1SM4A 1UBNA 1E2PA 3INGA 5JARA 4R8SA 3ANTA 3OJCA 2P9BA 3TOVA 1U0HC 2BV3A 3NVKI 4MVJP 1WEKA 4UBJA 8GPBA 3T5GA 2O2GA 4DR1B 1QH8B 1FFDA 4XGNA 4IRMA 4QUIA 3BULA 1NM5A 1WB6A 1ZL2A 2D8MA 1DLIA 2JLAA 4PICA 4RNDB 5T8KC 2XUJA 1JIQA 1CY1A 4GNKA 4HXYA 4MW7A 3TSAA 2X8JA 3LH5A 2IEZA 3FOBA 1K66A 4GXQA 4WBNF 2VDLB 4B74A 1GZSA 1EUDA 2FFHA 5FCDA 3W3AH 1DIAA 1E0KA 2C9DA 1BHJA 1X7YA 3NIDB 4WKPA 5JT1A 4RA6A 3KC2A 1W5BA 3MLBA 4BNZA 4ZA2A 4DZTA 3REQA 3AQIA 4FDAA 4TV9B 1KXJA 4Y2SA 5B5SA 1VHTA 1U1EA 3DYIA 5HX7A 4L2IA 1NVTA 3VU1A 2IL1A 1T9DA 1OD6A 2F9MA 4GC9A 3MYYA 1WM1A 2VR1A 2ZIUB 1XD2A 2Q21A 2XE8A 1UKCA 1N2HA 3BXEA 4R5MA 3RGWS 1CS4C 3VTZA 3T7TA 4C76A 3KR9A 4RH1A 1M3SA 1E4OA 4KV7A 4TMWA 1W59A 1PHRA 2AK2A 5C1IA 2P9CA 4KIWA 3H11A 1KI1A 3S27A 3HHEA 4BJ3A 1VSBA 1T9BA 4Q1BA 5AVSA 4QX6A 1N6IA 1URPA 2GDZA 2MSNA 3PQFA 5CH8A 1UMCA 1DAMA 3PR3A 4FDMA 5DHRA 1UCFA 1P9NA 4YI3A 1AKUA 1IDN1 2ORIA 3WGTA 4W9NC 3FKSD 3ZHRA 4IJUA 5J5AA 5JFGA 2XNSA 2J0VA 2A0UA 2BHTA 3K0HA 3MCTA 4OG2A 1SUBA 3A1SA 1C7ZA 3B7GA 4RJJA 3ZHZA 4B79A 1Z7GA 2WMDA 3RS7A 2X9QA 2PS9A 1OQAA 2FSHA 1Z7BA 3IA2A 3SQLA 5JRZA 3RVOA 5IABA 3JZAA 5IYZB 4U7PB 5ENDA 1KI4A 1Q91A 4MRSA 3VU8A 3OA0A 4AURA 1K9VF 2OGZA 4IVNA 2J9XB 2V9CA 2KJQA 1PN3A 1I5EA 2PXAA 5JNSA 3STVA 3H0KA 3ZOKA 1QIIA 1UINA 2F3RA 1W5FA 3PLRA 2BLNA 4B3IA 3UMYA 4ML3A 2MDTA 4JZYA 5JH7B 5C46F 3L8HA 2R6AA 3OEYA 3OHMA 4HYQA 4QJ4A 3RT9A 3WYAA 4KHPB 1WDKA 2CBXA 1ZK3A 2OGSA 2GUGA 1J1UA 1Q6YA 4G2NA 4FKMA 4I9NA 1N8TA 5ALKA 5ITZB 1FDIA 2QRJA 3H2GA 3I72A 3IURA 4Q9JA 1KETA 3TNDA 1LBTA 1PKXA 1XLWA 2CLEB 5EJFA 3AYZB 3N8HA 1JPUA 5JZSA 1MB9A 2C03A 2R4TA 5D84A 5HXAA 4J03A 5IHXA 1CJUC 5J2TB 3FIUA 3S1AA 3CLVA 3UG6A 1JHPA 3VXKA 3ZHXA 2L0XA 4P7BA 2N47A 4O2BB 4WY2A 1DIHA 4W82A 4R8MA 5THQA 2REXB 5BSRA 2JI9A 1JA9A 1SKYE 4OVKA 3C1UA 3EZXA 3HH8A 5JSZB 3C70A 4LRWA 3TQFA 1DHRA 1OUMA 1XA0A 1Z8NA 2ZU0C 4K3VA 3ROEA 1L3BA 2EP7A 1JG2A 2X13A 1IRIA 1D2GA 3IELA 3KQSA 1E2MA 4F1KA 3F5MA 3FDIA 2X7HA 4HWTA 1FZQA 2WZQA 1U7ZA 1C1XB 4MW6A 4YP1A 1LI4A 4I46A 5DHFA 1T24A 1UOQA 3PE4A 4G1UC 1ZN2A 1UOPA 1T13A 3L4SO 2OZEA 3MTJA 3TW8B 1DXOA 3G5AA 3AXSA 3PNMA 3JD0A 4NBRA 5LA6B 3RRNA 1HT2E 4NOKA 3FTDA 3A11A 3MMZA 2UYYA 3P9XA 2FF5A 4L74A 4W1PA 3SEFA 521PA 1GGNA 1T36A 3HCOA 1R4NA 4FHDA 4NJMA 4ZQEA 2OBXA 1NMXA 5H3LA 1DEOA 2OK8A 4X92A 4BMCA 3AR6A 4YWHA 2IYZA 4PIVA 5JXJA 2QVXX 2ADOA 2I7CA 3Q7RA 4FFVA 1A8UA 1X94A 3GJRA 5KU1A 3NBKA 4UXJA 3V42A 4F5WA 4PGFA 5K3EA 1H1LA 4PRZA 3MJRA 3RUAA 1IN1A 5G4KB 3SSNA 3HDYA 1W8DA 4FR5A 4DL9A 1SUEA 1ACMA 1KBZA 1VRWA 2DUNA 4GGPA 4M86A 1YL7A 3SGLA 4BLTA 5JSQA 1JJAA 1QO0D 2AYYA 1AXEA 4L8FA 4PLPA 4JLUA 3KR2A 3G5TA 1U80A 2KHZA 1SD2A 5LDHA 4JLWA 1KY2A 5FBHA 4AG5A 4QPNA 4D74A 5DM4A 1U4NA 4LZWA 4QGBA 2HK9A 3KU1A 1NXOA 1I4OA 2HQOA 2PV0A 5IJZA 1ZUNA 1CC1S 3PFBA 1M0SA 1PWXA 2EF1A 2OXCA 2WFAA 4YAFA 2ZSKA 4BQFA 2UYCA 3C6MA 1EVQA 1NBMA 2R85A 3FG9A 2GF0A 4BCBA 3E3AA 2HC9A 2ZT5A 2GK6A 1T29A 3ZY5A 1JJBA 3WL4A 2ZAIA 3LLCA 2NXCA 1O5TA 2XOKD 1FXUA 1RIIA 3LD9A 3OAAD 4IYJA 2QN7A 2OMEA 3CRMA 4RTJA 3VKVA 3GLFB 1GTSA 2EL7A 3ZU4A 1IMOA 3GUYA 1N6HA 1XEFA 3NC0C 4I1PA 2B6HA 2CNBA 2IT1A 3LP5A 2VAWA 5JAOA 2PQ6A 4M99A 4BZZA 2QMYA 3F6BX 1JH8A 4MYCA 4ZQCB 3IO3A 5I9SA 3B6MA 2G40A 4YRPA 3ILSA 2OHFA 1YNSA 4MMZB 5E7MA 1Y1TA 3L7LA 1EFVB 3CGGA 4S1PA 3JSAA 3LNTA 2CE7A 3ESXA 4QGGA 1UK9A 2AT1A 3FYSA 1G6KA 1O96B 1LJ8A 3TCXB 4MV4A 1U3UA 3GELA 3KXDA 3LMKA 3ZWAA 3NRCA 5IDQA 2FDCA 4J0FA 1FF9A 1M5RA 3WWCA 2FPRA 4MS1B 3ZWOA 1RWOA 2A4MA 5DSXA 2Q2WA 2VYNA 3KSDO 3UW1A 1P7WA 3ZZUA 3J80A 2VT7A 1KKUA 1CYEA 2MCFA 5HFAA 1EE9A 2C20A 1QK3A 3GC6A 3E22B 3GXOA 1DTEA 3IKMB 4JC0A 4NBNA 1XK7A 2QRLA 4MZDA 1FUUA 1JEOA 3IEVA 3ASYA 3K7EA 5HNKA 4OI2A 3CVJA 2EJTA 4KIGA 2AR9A 1M2JA 1U0JA 2W2KB 2YC2C 3GGDA 5L95A 2JARA 4X90A 3L40A 3VR5H 3I5MA 1P18A 4CQMB 4B43A 3H7AA 5FNZA 1H2BA 3E1SA 5AR1A 1T8RA 4N48A 3SI7A 1UPXA 2YXBA 3B8EA 1N4AA 1F5NA 2QUJA 3UMSA 2ES4A 2WWVD 1ENPA 2JJ1A 1P2SA 2H7VA 5DCWA 3FDXA 3SHFA 3R7WB 3PNYA 2QLBA 1GNRA 1NZFA 3KQOA 3DTNA 2QUAA 4R40A 2NU9A 3HXLA 2HNKA 3ACBA 3BXXA 3IFSA 2GPBA 1E3JA 3QVSA 4QTTB 2OO5A 2UYGA 3DPIA 3ZK7A 4EYKA 3W2HA 4RWEA 2FQYA 1C9DB 2BEUB 2GBLC 4J29A 4MWCA 4PLTA 3RJTA 3ASVA 1YZNA 1Z4NA 3LOQA 3OPVA 2PBLA 2JCGA 4LMBA 2I2WA 1JHUA 3BJRA 5DP2A 3ZGVA 2P2SA 1M0TA 1VHQA 2AFVA 2CLOB 1K4KA 2CV2A 2SICE 5FP0A 3I37X 3R5HA 4YI5A 5BOSA 2FZ4A 1VA4A 3MN1A 4LYEA 2UZ4A 2V7WA 3N9IA 4XM0A 3D1VA 2QJTA 3KJFA 1UMBA 2I2FA 2VUIB 1SHUX 4IQFA 4QSMA 2XCUA 3LCVB 3IUJA 5LC1A 3UF0A 1G5FA 1WCWA 2AL7A 2OFWA 2XCIA 3LC7O 3O73A 2RGCA 3ORRA 3ITKA 4OXQA 4EJSA 4YAUA 5HIAA 2RSLA 3Q5DA 4JL8A 3FRJA 3IEXA 3AIOA 1E62A 4R9VA 4YXWA 7REQA 2GAIA 3WQRA 1DAPA 1UPTA 2HK7A 2H1HA 5FV4A 2XV1A 1GV0A 4BECA 1N0VC 3LKDA 1XZMA 4I55B 4WZZA 3V46A 3ZDCA 2C4UA 5IAEA 4C2BA 3HACA 4QPPA 3ZWBA 2DM6A 3IKTA 4HEA6 2VDWB 3PI6A 4P3KA 1CETA 1H3FA 1Y1QA 4R84A 1E9AA 4UAVA 4UVGA 4F4HA 1M8JA 3O9MA 3N86A 3KQLA 1II8B 2H92A 8LDHA 2OT3B 5LJIA 2PQ2A 3DZCA 5KSOA 4OOFA 5MN6A 5AK5A 1FX0A 1JJFA 1P8AA 1U2ZA 2WHEA 2WLTA 2X5XA 2QE7D 4FC6A 3PKZA 4G1VA 5ADWA 4B7ZA 1R0SA 1MZPA 3KZ1E 2H5JA 3CUWA 3V4VB 4G0YA 1HI9A 1GKIA 2J8ZA 121PA 1WIWA 2XB9A 2VF8A 4JEMA 4AMZA 1A9PA 1IAVA 3U7GA 4N82A 2AOWA 2EX0A 3T3DA 2ZIZA 2O23A 2GN1A 3KAQA 4Q9NA 4CMCA 4HDOB 4OL9A 4OLAA 2R5NA 1TM1E 2ZFUA 3C5HA 4JI8B 1ATZA 2CK3D 2H8GA 5CDGA 1DAIA 5LM3A 2PMKA 4LYDA 4RJIA 4TPKA 2WSMA 4L95C 3OFKA 3ZUGA 4F38A 3GBPA 3PIRA 2YHIA 1S2MA 1B1CA 2CNWD 4LZOA 1R0ZA 5EEHA 2PT9A 1T2AA 1N1DA 1OBHA 3F46A 2XZTA 1EB8A 4AL4A 1ID8A 4FE7A 1SVNA 4K8RB 1ZVJA 5EKSA 1UWKA 3T4EA 3V1TC 4A1FA 1DKMA 1QUEA 4DPLA 3DTYA 4EWLA 3ZHCA 3KDSE 2O50A 1OVMA 3OKCA 4FGUA 5AW5A 4EW6A 1YR3A 4NSNA 2RAPA 5DGTA 4Z7JA 2B2NA 3K8ZA 3TZKA 1SB8A 1NSTA 2WEKA 2FR8C 1NN0A 1WCYA 3WLKX 3SM3A 1W8IA 1MAUA 2X42A 2AJBA 1E18A 3GZ4A 3P9IA 4N6OA 4KFSA 3FYUC 4G5QA 4O63O 3BS4A 1ADBA 3G0CA 3SR3A 4DRYA 3NHPA 3UJCA 2F43B 4BGIA 1T2VA 2ISCA 3UMBA 3THSA 2VTVA 2H4ZA 3ASZA 3IV6A 4C87A 2J0QA 3UICA 4BNMA 2DWPA 2CFRA 2PSDA 4UHBA 1O97C 4ZU3A 1USVA 4J0GA 5AFSA 3G5UA 1JEJA 1IJBA 2FOXA 1M33A 3M3DA 1DAKA 1JR3A 4MLPA 1OIVA 1RW4A 2XQKA 4WFQA 3GD5A 4RULA 4BNFA 3W5SA 5FA8A 2IKSA 4XASA 5HQ3B 1RKQA 3X2FA 1NBHA 1F0YA 2JAPA 1FJXA 2OECA 5AW6A 3H8JA 1M1YE 4KBYA 1QZZA 5TQ2A 2OORC 3L8FA 4NE9A 3TQHA 1KI9A 8ATCA 3JQGB 1W4ZA 4QVGA 1Z6QA 4ND6A 1TYZA 2PUTA 4N0PA 1HOXA 2YWXA 4IUCS 1NUSA 1LTKA 3GLVA 4QWMA 4YPVA 2P2DA 1ABFA 4KR3A 3L9XA 3LFHA 4Y2QA 3RS8A 2PMBA 1BMFA 5DNAA 5GV8A 1KA9H 3AF2A 3EDRA 2P35A 3W8DA 2R5FA 1KZ6A 3V3KA 1ZK0A 2A0KA 2EARA 4DG8A 4UEKA 4DLSA 5B36A 1Y4UA 4DBVO 1VZ3A 2EQAA 3JATB 1HSOA 1CE8B 2FRDA 5ER9A 3GEMA 5J1SB 4C1BA 5KX5A 1KYVA 3T7IA 1HF3A 2R97A 1H2HA 1HMYA 3D31A 3GBSA 1M2FA 4IIXA 1N0UA 1I5OA 1WG8A 1JS1X 5AVUA 2X6TA 4JQOA 4K9KA 4UBLA 4FCCA 2XMDA 2TMKA 1HGXA 3G9UA 3VNAA 3HYTA 3WZLA 5TMBA 4PC3A 3TI7A 2JFQA 1DI0A 5AESA 1SULA 2JGFA 2VH5R 3A0UA 1N5RA 3A10A 3I04M 4E2ZA 3U44A 1UADA 2FU5C 1Z5NA 4GKVA 4EM6A 2B1IA 4TS1A 1KP2A 1TPYA 2QMZA 4C4RA 1E9CA 3CXRA 4CG3A 3JQ9C 4PAWA 3H5NA 3TQRA 1NBME 1BCSA 1Z5PA 2O0JA 4FYKA 2VRNA 5B55A 5AVYA 2FMHA 1MXHA 2H2HA 4JNCA 4K6FA 4UHEA 4XD2A 4WY8A 4BRSA 4HEJA 4DCJA 1OHHD 2XUDA 3F6RA 1AKMA 2DJIA 2Y77A 3EXFB 1CZLA 4IEEA 5D5PA 4FNGA 1Z6AA 4HGZA 1ABEA 3ZVRA 5HKBA 4ZN6A 1NOIA 1MABA 1DRWA 3Q3EA 3TVDA 1KTIA 4DV6B 1Y4SA 2IYLD 4NEHB 4E5VA 3WRXA 4QTZA 1XDZA 2I65A 3TLBA 1DWUA 4PZ9A 4AAYA 7AT1A 1AQNA 2GUWA 3M3PA 3K8QA 3QFRA 2Y2VA 5BSVA 1E6WA 1QX3A 4TWIA 5DWVA 3IOEA 2IS1A 2J87A 5JWHA 1ZSNA 1A9OA 2BEWB 1YQEA 1B42A 3BZWA 3R44A 1EX9A 4MEBA 4NS4A 2K2WA 3AY6A 4WOKA 3SKYA 3VO9A 1L4HA 1EBUA 2OHJA 3PPIA 1ULHA 2CJXA 5IUKC 1NPDA 3C6XA 3DXXA 4LDPA 4AJ2A 2BGKA 2EDCA 2DKNA 3BBLA 4GZMA 3I2KA 3NOVA 1NC3A 1XVTA 3FRIA 2WTEA 3GJ3A 2QG6A 2WT9A 3IS3A 2RG7A 1YVUA 4HX5A 3CPSA 4DIBA 3E84A 3WKCA 4CETA 1VPDA 4MEJA 3TKYA 4RPLA 2YVAA 3CO5A 5CB4B 3GH3A 4WVLA 3PITA 4NBUA 3FSGA 2GEJA 1NHGA 1G0NA 5FPTA 1Q0QA 4PS1A 5AKGA 4OQQA 1A27A 3PPVA 4X6XA 1UWLA 4QG7A 5G0VA 2PGIA 4RF3A 5TSDA 1K6EA 5KVAA 1T1RA 1VHWA 3F5DA 1ZN8A 3LUGA 5F64A 2UZAA 4RA6B 4C5AA 2I2XB 3BHNA 4C4TA 1SVMA 5AKJA 2H6EA 2R62A 3HKCB 5CBPA 1IC6A 2PMDA 2ZIEA 4CVNA 4EGAA 5IMSA 2WAAA 2O1WA 3V7UA 5EOVA 1NVKA 2R7AA 2V4MA 3OUTA 5ALHA 4BLQA 1JU3A 5J23A 1HL3A 2DFNA 4MUJA 3ZY2A 1KARA 1AVTA 1S0UA 3BMCA 4I3HA 1GPBA 1TQ2A 2FWNA 2VJOA 3TN7A 3C1TA 2BLLA 4EFMA 2LDXA 3ZDEA 3EC7A 1JG7A 4D97A 4P2BA 2PX8A 3DBRB 2UZ0A 3EAFA 1T10A 4GU5A 1P1FA 4LECA 4F7DA 1I94B 2HHCA 2NSJA 2Q1TA 3QXGA 4NYJQ 4EVQA 2XCQA 3AETA 4QGSA 5I8PA 3H0EA 3EDMA 3UAZA 1CUBA 1QS0A 4MA4A 4N9QA 2GJKA 2XHZA 4DUGD 4ER7A 2FVYA 5D7NA 4KOEC 1VJGA 3VC2A 5LNK6 2I2DA 3FKQA 1M1NB 1QAOA 1R0XA 2BFBA 1XMIA 4FGLA 3KV1A 1CZHA 5KNDH 3A6LA 4JIGA 4PTZA 1KGSA 1PJTA 1TIPA 2JJQA 4KSBA 4U3JA 4UASA 3SBEA 4BLVA 1CUVA 2W2VA 4II3A 3LDFA 1MV5A 1OU4A 4I8XA 5BV8A 3R3WA 1B4DA 3BKWA 4HN2A 3C7TA 3BGOS 1PHPA 1LPBB 3IMFA 3R3VA 3NXKA 1NQVA 1S3SA 5EKXA 4LE2A 3USCS 4C4OA 4CMHA 2CD7A 3O4FA 1RBQA 4W6QA 1I4WA 2F1RA 1KRHA 2J4DA 1SIWA 5HUQA 4CQMD 1YI8A 1GFSA 5CNMA 4EEXA 2OO7A 5CLIA 1T8WA 2C8KA 2ROQA 3BH6A 3H17A 3PJGA 2HHLA 2I7XA 2ENWA 1SNYA 2I1VB 3OPYI 2OO3A 1J21A 1OFTA 1PQPA 1NN1A 1JZQA 2NTVA 3GJSA 3L6RA 3MQ4A 1RI3A 1GPAA 1IZYA 4EG0A 4K9DA 4HL6A 3WAKA 5I8WA 2Y66A 3O4GA 4CM6A 3PWZA 4IINA 4UTRA 1OGIA 3PEEA 4R5HA 4WCFA 4UM7A 4BP8A 2O4CA 1MIHA 3OZRA 5B4VA 4S2UA 2ZBUA 3PSHA 4KR0A 1KP3A 2EV9A 4G4JA 1UF9A 4K03A 4OHUA 2VDQB 3JVIA 2JANA 2PGJA 2XNHA 2NO1A 4IR7A 3FYTA 4KRGA 4GPZA 1N6LA 3CF6R 2IHJA 3MB8A 1BVHA 4W6ZA 5IDWA 1MENA 4E11A 1EFPB 3L2OB 3VH3A 1XHLA 4HOYA 1Z2DA 2JI6A 4FD2A 3WR5A 2FFAA 2H1IA 4AZ3A 4DPMA 3GT4A 5CCBA 3UK6A 3ZXIA 3UWDA 2ZPAA 1F7VA 2KSQA 2ZB2A 1FUIA 4NP6A 4F9FA 2PTHA 4AM8A 5HTOA 4JASB 4QDXA 2AJLI 4BFLA 1V6AA 4ZO8A 4HH0A 1YR7A 2Y93A 4TKMA 2TECE 2EJCA 3ESZA 1QHNA 4GPEA 4BLPA 3Q9SA 1D4OA 4XWTA 2I87A 4LG1A 3QRWA 5F3DA 1XVUA 4OQ4A 1AURA 1NJFA 4TQ9A 5FDFA 5AKEA 7ABPA 1NI5A 1V7PC 3B5EA 4XUCA 1QOPB 5JPIA 5HKKA 1D2MA 2FPIA 2UZ3A 2J09A 2PVPA 3AF0A 3CB4A 3EVNA 4GI3A 3EW9A 1JR3E 4LVNA 3UGTA 1YQWA 4A8JC 3JASA 3ETLA 4M7PA 4N65A 2FPMA 4UHJA 2WUFA 2FVXA 2IWHA 1PCXA 2FRVA 2IUTA 2OAGA 1IM8A 2R8RA 3C1OA 3OT4A 1KH2A 3OEHA 4QREA 1FP4A 2V7EA 3OCXA 5AUQA 5AXAA 2IEDA 3OM9A 4J4HA 1J39A 3HVKA 1E9FA 4H7HA 5GZ3A 3ZKWA 3O8OA 1WZCA 1GUDA 1I7LA 1M2GA 3HXQA 1SURA 5LZ2A 2NUTA 3EVAA 4RH3A 3W1WA 2IHNA 3SEQA 3AZQA 2AMYA 2G67A 4DV3B 4P4GA 2O14A 1ZJ4A 4HDAA 3QPBA 3R7BA 4J94A 4KU4A 2CLDX 5DBEX 3ZWKA 5EZYA 3M82A 5EMLA 5LZ5A 3HUEA 5J2UB 1O8BA 1U3GA 3C5WP 1SIUA 1FC0A 3NV7A 4JJ6A 3IEMA 5JFOA 1VJ1A 2WBLC 1HEIA 1JHVA 3UT0A 3DMPA 5AW8A 4UCWA 3TD6A 3DAYA 3VZSA 2VKTA 4NCAA 4NI5A 4CDRA 3O1JC 1Y8RA 2GN4A 1YGPA 3Q3VA 1Z5OA 3IBGA 3ES9A 5DRTA 1WB5A 1XVLA 1RI5A 2FEPA 4K40A 3ONVA 5TARA 5LQKA 3P1JA 1USGA 1G63A 3WMWA 2JAQA 5BNZA 2QX8A 3CR8A 4YCNA 2A0FA 1RD4A 2AEMA 4EYOA 5A5FA 5I7UA 1E1MA 3AIKA 1Z2PX 1N7JA 3IR5A 2J9FB 3D0KA 3INTA 4BLWA 2ADMA 1AKNA 1BA2A 1N5JA 1P4HA 1BRTA 1C0KA 1PFYA 3L8MA 1RC8A 3H1TA 2AXPA 5DSTA 1QGZA 4EX6A 3T1HB 1Y3DE 2JJYA 2VHVA 3MD0A 4Q37A 1E9SA 3HPQA 1TZ2A 2Q3CA 1CJMA 4OHMA 4F6CA 1RYFA 2GB4A 2AFHB 2Q5QA 1WPQA 5IARA 1MDFA 3F6YA 5FYQA 2JI4A 2O3QA 3CJTA 2ORED 3ZC3A 5BN3B 1GUFA 1BZYA 1JQEA 4DABA 4GE0A 3LDGA 5KYXA 3UB2A 4PYNA 4PZEA 3TIIA 2PZAA 3RWMB 4BB0A 3EZNA 4IWYA 2O57A 3HYRA 5C8ZA 2OGWA 2EKDA 1QHHB 3D43A 2NYUA 1G21A 2VO1A 4B48A 1JDZA 2B69A 2E55A 4X61A 2B4RO 3ZNNA 3A6PC 3C7DB 1TGYA 3BFKA 3MTGA 2PKWA 4E03A 4ZAWA 3S2GA 3JTEA 2O8CB 4MV7A 3BE4A 2DEUA 3MJFA 1C9KA 1GNTA 3MM4A 2EWMA 2X2EA 3DEFA 5CFOA 3O8NA 5BNIA 5CM2Z 1MC8A 4JP5A 1RLJA 1UFRA 3AVXA 2NP6A 1XO1A 4L27A 4L78A 1GPWB 4A03A 2ONYA 4NFLA 2UU9B 2J7PD 2J9GA 2HWYA 2XY4A 5CFPA 4BASA 4B81A 3NT2A 2ZIFA 3ZDDA 1NW7A 3CLKA 3IILA 5DM70 4F4JA 2VK2A 4ZYUA 3A9CA 3IPYA 3U0VA 1IHUA 1A5BB 1H3EA 4RKFA 4C7OA 2XYPA 2VP3A 2YFKA 3IEUA 2AG8A 1K5GA 2WTXA 3F6SA 2QAGB 4I8DA 3KUXA 2ZQZA 4J7CA 1W0JD 1GITA 4YCSA 4KQWA 1M2OA 5KZMB 1EI9A 1UJ5A 1DX6A 4Y2HA 1NI4B 3TTXA 2XSZD 4RY0A 4WK0B 2XQVA 1TKCA 4FE3A 4KMSA 2QRVA 3CLSD 1Z62A 2ACKA 3ENZA 1IN4A 1QZ3A 3CBQA 2J3KA 4OK5A 2NGRA 4CIBA 2IW1A 4RIHA 1A9ZA 5EXEA 1R0YA 4MYRA 5IKOA 3TQIA 3VTAA 4TUYB 2PT5A 2N0SA 2A5GA 1KI8A 3ZHBA 1MTOA 4JQYA 1CG6A 3UQZA 4TRMA 2KBFA 3W5BA 4ZIRB 1NTOA 1K98A 1SU6A 3EZ2A 4IDNA 1V4BA 3V6LA 2LRHA 5I7EA 1QQ7A 3GCXA 1XVAA 2IH2A 4GYWA 3DZDA 4RXUA 3PV0A 1A95A 2CY0A 1Z4LA 1JHXA 1X39A 1GRCA 2A4KA 5DN6D 4P3NA 2JATA 4TZTA 4XH9B 4YP9A 3R3ZA 3WO1A 5JDCA 3CEMA 1TEZA 4JT2A 4UM8B 3I09A 1QM5A 4ZMBA 1QPZA 1Y3FE 3OM8A 1Q0LA 5IWAB 1G42A 4M1QA 2V74B 1ZCZA 3ZTWA 5FADA 3TRDA 5AQ1A 4MW4A 4OX9Y 3KVOA 3SSOA 1TRKA 2XH8A 1Q1QA 5KX5F 2VYVD 1E92A 4JLBA 5EMJA 5FJJA 4WLEA 3F6EX 1PV4A 3EGOA 2A92A 2C5GA 3GI1A 5J47A 1WLYA 2BMFA 4MW2A 1WDWB 4TTAA 1SBHA 3UUWA 3NOQA 4WNYA 4C3UA 3GFPA 1RPZA 4TSFD 1B43A 4G3XA 3ZY3A 1SA0A 5HR5A 2PR7A 1MNAA 3FCOA 3CUEF 3G13A 1LNZA 4TTQA 2NO9A 5AHWA 2PRIA 1XAJA 2PZMA 4QOJA 2ZYWX 3C3CA 3EH2A 1AHNA 8OHMA 1F38A 3I39X 4AIIA 3OZSA 3DHYA 2FB9A 3O47A 4Z4HA 5C3MA 4ZT3A 1XDGA 5ADHA 3ZW9A 3SJAA 1EQUA 3MAGA 3NDJA 5B3JC 2Q29A 1I1HA 3GNSA 1A9XB 1JU4A 1Z0DA 5EHIA 3PK0A 4MUHA 4C01A 1U0NA 3GV0A 2O8EA 1DGQA 1DRUA 2A84A 2ZRAA 4IXTA 4JGBA 3PVCA 4QJBA 5TPWB 3E9CA 5J5CA 3RSQA 1GADO 3F1KA 3GAAA 4I7EA 4Q47A 4X9XA 2ODAA 3OJWA 3AHEA 1KDVA 1E32A 2PX4A 1T0HB 1KFBB 3UWPA 4DMGA 3THWB 2PJZA 2AZDA 4BYMA 3S2IA 1NUAA 4I6GA 2KLBA 1ZGJA 4B17A 1S89A 1XRPA 2BD0A 4KDEA 5EFZA 4CKXA 2X40A 3GDGA 3IUMA 4X1YB 1B8NA 3S40A 1ISJA 3E9QA 4DNFA 4MQEB 3L7BA 5T5QA 2H1CA 3A6JA 4WFJA 1OLSB 4FLEA 3L6EA 5C5EA 1Y42X 2I71A 3GUHA 2OZVA 3VDXA 3PFCA 1UUFA 4JUBA 2HJGA 3RSZA 1Z4KA 2O06A 4DLLA 4F60A 3QE4A 4IHQA 2A6PA 4NENA 3D2LA 1Y4ZA 3PUVA 5CFRA 3RD5A 2HTEA 1PWHA 4RHFA 2GZSA 1VBKA 3AI1A 4UE3S 4PLFA 3KQUA 1FTNA 4D3YA 1YQXA 1GEGA 2J7KA 5BT9A 4R51A 3ICEA 3HCPA 4KXXA 3A06A 5JYCA 4G86A 1TUGA 1V8FA 2VPWA 2OCGA 1TC2A 3TG2A 3GN2A 3DFFA 4L76A 4OP2A 1B14A 1L4NA 4D5EA 3U4QA 5FBLB 2QTAA 1VSTA 3KEQA 3MBOA 4L08A 3PF9A 3RVBA 3VGJA 4ILKA 3H04A 5GVRA 1I3MA 3IQXA 3SC3A 5JY6A 4K6KA 1Q2XA 1HKHA 3A4VA 4DR4B 3VR4A 2O3JA 3F5QA 2XUHA 2N1BA 4KG7A 1BXGA 1EESA 3W4IA 1MJ5A 1SOVA 1A8SA 1FYEA 4IO0A 1S1CA 1LW7A 1NV8A 2FWPA 4L9AA 4W99A 1YB4A 3GOQA 3VX3A 5HPYB 3D4IA 1KO1A 1L4GA 4IIBA 4KQKA 2NSDA 3SDZA 3SX2A 3UXMA 1G4UR 4IUYA 4DJ5X 4ZVTA 1MFZA 1JYFA 1AOXA 2F2TA 2G83A 3EZ7A 5IAOA 2Y4OA 3MHTA 5A2QA 1RYBA 2YJ4A 2YHBA 4GP7A 3ZHUA 3N76A 2PVCA 4QATA 3N3BC 5CDTA 4J9UE 2JD0A 5TR9A 4FQ8A 1UBKS 2H63A 4PAMA 1GSHA 5K03A 2QVLA 3N6RA 4PX9A 4M1WA 3RTDA 4D4JA 5JVDA 2CCGA 4RVUA 3AR3A 1MZVA 3QX8A 4TX1A 4DJFC 3HU5A 5L4LA 3GK3A 4C88A 1TM3E 1AC5A 1XROA 1YZHA 3IHWA 1T4CB 3KJGA 2DWOA 2NN3C 4MP3A 3UMFA 4E3ZA 4ND3A 2J5BA 5IVKA 3AR2A 4BS9A 5E4JA 4ZVMA 2FQ1A 3EVTA 2FGKA 3BJIC 1KJJA 1REQA 3OG9A 3VBEA 3AF6A 3GGCA 3CBGA 3MB5A 4BV9A 5HKOA 5EWJB 1FPMA 3HN2A 5FV7A 3TQCA 5A04A 2GJAA 1ZIYA 1JKMA 4QOIA 4XE5A 5EIFA 4NU8X 1C0EA 1Z0IA 3OF3A 4ZTZB 3PQ5A 5BT8A 5CEJA 1N6RA 4LOKA 1Q0PA 4BRZA 4EDHA 2ZRPA 4MI1A 4KGZA 1H8ED 3VJMA 1WOMA 2ZJYA 5D1NA 4O4LB 2PWPA 3QVVA 4KO1S 2XADA 3D0RA 2UXBB 4DMUB 3NG1A 3K1TA 3AL3A 1ZD9A 4HO1X 3BRQA 4E51A 2MYPA 3BXGA 5KVVA 5DTJA 1H2FA 4LTMA 2AOUB 5H7XA 6AT1A 4L5BA 4YUZA 2BGNA 4XSGA 2Q49A 1XOIA 2VWGA 1G21E 4ZQIA 4YV1A 3KJNA 3F1LA 2GARA 1YR8A 1CCWA 3V1MA 3ZD9A 4F4DA 1TFRA 1B6TA 3IIMA 3FTNA 4D0LB 5CR9A 1IN6A 4ZO9A 1U1GA 5LMUB 1JJVA 2G76A 1NM5C 4KWCA 1DIGA 4KRFA 5DNEA 3DKPA 4G07A 1ISFA 1YKFA 3K96A 1HYGA 3SYMA 2FEOA 1QPGA 4BFTA 2JGLA 2HR1A 1V1MA 3NP7A 4X00A 2R1TB 4C22A 4OHKA 4I6EA 4ZHQB 1W4AA 1WPGA 4HWKA 2WJYA 3OUZA 3P26A 2ZLBA 4R9SA 4UM9D 1E20A 3JV7A 1JGTA 1E3SA 3OIYA 3RB8A 2XBUA 4BIMA 4D92A 3BTUA 4BGDA 5LXTB 4C4ZA 2HA3A 4IM7A 4QELA 1M5TA 2UXDB 5AI4A 4X0EA 4M0CA 4ZZ2A 5IN5A 1Z08A 4Y18A 2M98A 1P77A 1EB9A 1U02A 4W1RA 3LZCA 3ETCA 4XYGA 1EFDN 5HSGA 1LLDA 1G8MA 3T38A 5EFOA 4DR2B 1ZEMA 4NC9A 2ZCUA 3FUCA 3NAQA 1K8RA 2M6RA 4MVJD 4HEA1 3W9BA 4YP6A 3H2IA 2O8BB 1YIAA 1Z12A 3KYDA 4JYPA 5KVCA 3KLMX 3KHTA 3OLZA 1I3LA 2HDOA 4R3UC 2DQ4A 3AHIA 2V7GA 4ILEA 1T9CA 4LJ7A 4B6FA 3MFYA 4Z9BA 4F84A 3HXMA 2F3PA 2CL7X 1E77A 1I51A 1LWOA 3CPJB 4MQMA 4NL4H 5DYTA 4RTNA 4QYIA 2WZCA 4OQNA 3ETEA 3QE9Y 1YCDA 3HM9A 1SH7A 3IDFA 1E1CB 3DD1A 4NXNB 5J9FA 4L28A 4YRRA 2X7JA 4HTAA 1MAWA 4L16A 3LCCA 4CBVA 2JLQA 5DASA 5EUMA 5FULA 5HDQA 2PH5A 1P1CA 2XE7A 4K9LA 1DX4A 1T9GS 3QPAA 3F5SA 5F33A 3CRZA 5JRJA 3PVSA 4D6XA 3KFLA 2FR1A 1P0FA 1KWGA 1YJXA 1USIA 5JY1A 5IVHA 4FFDA 4GQIA 1E7RA 2F8SA 1QH0A 1XCLA 3DOOA 5JCZA 3Q5GA 3DPUA 2Q4EA 3KBOA 1NZJA 2WFLB 2ZW9A 1DBIA 3OVMA 1GZ3A 4GSKA 4ZC8A 1BGVA 1QHSA 3IQFA 4H4EA 1ND6A 3DVSX 1R27A 2HNAA 4WACA 2CE2X 1Z9BA 1ZN9A 1B93A 3DE2X 4AKTA 1DC7A 3T3PB 4IH4A 2XNCA 4B6RA 1V1JA 3TECE 2IBSA 1C0IA 2VAMA 3Q3CA 3AERA 5CJJA 3V8MA 3OJLA 4UVEA 4EFLA 5A4MS 4RTOA 4H0CA 4CI0B 3HYCA 5L4SA 2WYOA 2ZI6A 4EB6A 4ZOLA 1WU8A 1YK1A 1J2YA 1ZIXA 3E9MA 5D8DA 5IK2A 3ISJA 3S2YA 2WD9A 4JC4A 3ZGYA 5JXIA 3TLGA 4MDYA 1VDMA 2JGEA 5JD5A 3V8NA 5KWIA 1USUA 3J81k 1VKRA 1U9IA 4QKQA 1G8AA 3CUVA 4D9BA 4AUNA 4FQ7A 3ZNQA 4D57A 4A7PA 1Y1RA 3UC9A 4MQBA 1QVZA 2CMKA 3OZCA 4WDRA 4EW1A 4LY9A 1JFVA 1JVNA 1N6OA 1SBIA 3QXJA 3RO7A 3ZK9A 4MA0A 1W36D 4R41A 5C4GB 2PUJA 4K26A 1K89A 4TMKA 1M66A 2XUQA 5G0TA 3UMGA 4DYHA 3K4QA 1P6UA 2PFKA 3H9QA 4DPKA 2DPHA 2QTWB 2QSYA 4FS3A 2LIPA 3Q85A 1ZMOA 1MQ8B 1F20A 2WHPB 5DE3A 4QUHA 2ZG6A 3WP1B 3GDHA 1TYBE 5EJ9A 1T2CA 3EY9A 3K0AB 2UXCB 3NHMA 1C3OA 3R7FA 2EQ5A 4GI5A 3K5HA 1AB6A 4G4SO 2WINI 3ZNPA 3RAFC 1UP6A 4P0QB 3HBFA 4CKWB 3IKLA 1XTUA 2GS9A 3KOYA 5CG2A 1X0VA 5DSZA 3FTEA 3CQ9A 4EQ6A 5B2ZA 2HMTA 2ZR8A 4RA9B 5A9SB 2BSXA 3CNHA 3MWGA 2M6KA 1PO7A 2IZ0A 3L07A 4HAOA 3I34X 1ESMA 1Q7EA 1UBEA 1LQUA 2NNLD 2W43A 2ZXFA 1T4BA 3TGPA 1ZNYA 1HLDA 2I6QA 2BH2A 1D8AA 5CFLA 3LBFA 1FYVA 2PG3A 2QRHA 2VQDA 1NNUA 2ZWIA 2OFFA 5C4MA 5EMMA 4JS0A 4F5EA 5E9QA 1TYAE 1K06A 3GFTA 3NVDA 2CDBA 3G8DA 1YDEA 2HU8A 3F5FA 1GAEO 2QTHA 4DR5B 2FDRA 3HE3A 4ODIA 2REOA 1Y4DE 2WHYA 1S4MA 2QT0A 5CIWA 3ZVMA 4M76B 4QFCA 2WFZA 4MHTA 1LW6E 4KWEA 5IG2A 1VLHA 2AE2A 2P69A 3ACDA 1R5JA 1QGDA 2EZ9A 5AT1A 5AK0A 4A4DA 2B2CA 4X62B 2I7VA 4JIMA 4US0R 3VPGA 4BUZA 2IV7A 5K5EA 1KEKA 3TFQA 3FM9A 4HLQB 1C80A 3E0QA 4CM8B 3TL2A 5F12A 1N9GA 2O1SA 3VZCA 5CJ2A 1XU7A 1JT9A 1Z13A 2OYRA 2W8BB 4M60A 1KE1A 3BMQB 4K5QA 4RELA 3CRW1 2H1SA 1L6RA 1R10A 1ZNQO 5AJVB 5H3HA 3BX1A 4V0KA 3I62A 1OFVA 1Z6PA 2VBIA 4LGCA 2XWBF 3UH0A 1Q2UA 1XQYA 2BJHA 1IQPA 6ABPA 2DHDA 3KZXA 1AX9A 2VEOA 1U8FO 2D4AA 3JYHA 4YN3A 3AJAA 3RYIA 3AJ9A 3VNQA 1PJQA 1R9MA 1UIMA 3KYJB 3M1YA 4R8VA 3GEBA 5ALIA 4NMWA 1I3OA 1C9NA 3T12A 3QWFA 4FMCB 1J7KA 4PPYA 5DLYA 1N8NA 5MN5A 2P6NA 2HZBA 1FFSA 5CH5A 1ZMXA 2OBNA 1EGAA 1QE0A 2RI0A 3S4YA 4Q15A 1AKEA 1K0FA 3AK4A 1D1PA 4D26A 5KYUA 2C2XA 1J8VA 3BMNB 1V16A 1U90A 2VCHA 3WA6A 1N7HA 1DDGA 3T7JA 3INYA 2RAUA 3NTVA 3C3DA 2IDZA 3ORQA 3QUSA 4ICIA 1JWBB 1TQ6A 3ABOB 4NBVA 3VJLA 4MR9A 3LQRA 5TB5A 3WSVA 4RCVA 4GZ3A 2BFOA 3UOWA 4JMLA 4HVTA 1CV2A 2IYQA 1NW4A 3RPEA 4RADA 1IYZA 1Q12A 3MWDA 4YJGB 5CEFA 2A1IA 5JXWA 2Q4TA 4MQ4A 1S02A 3FH0A 4IFBA 4LJ4A 1W1WA 2C0CA 2EFGA 2Z04A 3HCWA 4HPJB 5E6SA 2EYQA 2YJTD 1KJQA 4C78A 1WQ1R 3VR6H 2W6PA 3H9JA 4JJ7A 4U02A 3DKRA 4OSEA 3VI3B 3BDIA 4WH0A 5M7EA 2B25A 3D5TA 3PG5A 4NDAA 1AF4A 2CKMA 3O4IA 5A71A 4AKEA 1A5ZA 2SBTA 4QO8A 4PCAA 3B13B 1PYDA 1E3QA 2ZJFA 1FXWF 1P4GA 1J5XA 1IHXA 3L0YA 1DRKA 2DC1A 2DY1A 4UU0A 3GPBA 3ZYCA 4ZMSA 4PZUA 2PH3A 1Q15A 1U0EA 2IYXA 5THKA 1JI0A 2R60A 3HFSA 1E89A 2OAEA 5M3BA 4E7OA 2QLNA 1Y7TA 3NS7A 1DNPA 4RETA 5IH7A 1XEXB 1IULA 2GCGA 2NV6A 5FNVF 1OZFA 3BAFA 3D2CA 2YWFA 3FIJA 4C04A 2A7XA 1P75A 4MP6A 1V5EA 3HJAA 1JVSA 3ZIAA 3DEYX 5ITVA 2HF2A 1E7QA 1L4EA 2FW0A 4UNRA 1QO9A 4FGSA 4MPTA 2C2BA 2QZJA 5DULA 1J0AA 2JGDA 3QNWA 5FUWA 4GQBA 2W98A 3GGSA 2ZPTX 3D4LA 3MT9A 4I6JA 2GYWA 2VJMB 4RD1A 4EYGA 1FW6A 2XXAB 5FLYA 5LNK1 1QIFA 1SN7A 3TSZA 2P2NA 2HCTA 5C5CA 2FSSA 2KYRA 5ALXA 2D2FA 3DHNA 3O6VA 4FEAA 5HWSA 1ZESA 5D5QA 5CA0A 3NIGB 3OQPA 2P8SA 3D7LA 4BUJA 2P75A 3I4FA 2Y1XA 4O2AF 4C7KA 5TQ0B 4DV2B 2B99A 3OPNA 3WAGA 1BWSA 2QG4A 3LDUA 4GRIA 1NLZA 2RGBA 1X74A 3RE1A 4YECA 1RHKA 3U3XA 4CG1A 1TAQA 1Z5UA 1OBOA 2XB8A 4XDHA 4ZTBA 2F6RA 2R6HA 3MINB 2HN9A 3HTXA 3G5LA 3ULKA 4I5FA 3ZGNA 1XKXA 3O0TA 1UMDB 3M89A 2JL1A 3B6KA 1P74A 3TG8A 4TZ0A 1XZJA 1E2LA 2AVNA 1RWNA 2ODEA 1KYTA 1SUFA 1TLLA 3FDZA 9GPBA 4AJKA 1FFEA 1LJUA 1JNXX 3W6OA 3ADOA 3CNNA 1W1UA 3IYLW 5CLGA 1ZZGA 2I2AA 2FMUA 3VPXA 3S8EA 2AN4A 1PDWA 3I4CA 3N2NA 1OFHA 1QAMA 3L1HA 2DCMA 1KMHA 3QY9A 1XVVA 4IIFA 4Q03A 2UYHA 5A4IS 3M70A 1YB5A 2W71A 2XUZA 2JH9A 5EP3A 1AZWA 4EUFA 4QXMA 1E8MA 3IPAA 3R5KA 1IXSB 2BRUC 2PZLA 3FCSB 3U62A 4N03A 4ENSA 4JH0A 3OD5A 2FEXA 2YWJA 3JW8A 2XZLA 3ONEA 2WWFA 3SC6A 1N3LA 1UK8A 1Y6QA 4MGHA 1L1FA 3HL4A 4PHFA 2NUBA 3Q3GE 2FPOA 3DVLA 1UBUS 2DFDA 2BM1A 3NWPA 1UJ4A 4HNRA 1JSRA 3EBOA 4MITA 2K87A 5BN4B 1VE9A 1ZHHA 3UJDA 4BP1A 5JVDF 1V8DA 4AY5A 4B83A 1U98A 3IE2A 1G9XA 2ADFA 3BL8A 3R5TA 1AKTA 4NBTA 4WW0A 2AF4C 3RLIA 3NAZA 3O2JA 1XMSA 2B8JA 2CXSA 3GCZA 4OJKA 1DCMA 1L4KA 3BJZA 4EA8A 2Z43A 4OFBA 5EP2A 4U5XA 4CR8A 5TS3A 1O94C 1ENYA 3ZXYA 2ZIGA 4MS3A 4BLSA 4E1BA 2G07A 5ALNA 1GT91 4L5AA 2WPDA 3FF4A 2OD9A 4HNVA 3P9NA 2NUAA 2DLDA 4LSMA 2HEGA 3DYBA 4DIOA 4EG3A 2OBBA 1OXVA 4RSMA 2IXEA 3RRBA 4E1AA 5KKCA 1JFFA 1WHSB 4DS3A 3BZBA 3FD8A 1JECA 1L8LA 3UW3A 3RHTA 4NV0A 5DM0A 3B1JA 2F4VB 5FWYA 2Y3IA 1RHJA 3HLKA 1XE3A 3D7MA 2R68A 1S8OA 1WCIB 3GCWA 1JLSA 1P3DA 3LVRE 2F8TA 2QTZA 2A1TR 3RIMA 4R05A 4XDGA 1VZ2A 1H2EA 5KHLB 1CY0A 1S2IA 4FMDB 4D8TA 4DLRA 2RG1A 1RQRA 2OLKA 2VHTA 3MK31 3OTHA 4MUGA 3K9GA 1D5CA 1NUPA 4UULA 1B2RA 1CZKA 4X7PA 1H9CA 3AM3A 3TE6A 4P4TA 2YJ6A 1ZI6A 5HK8A 3KR1A 4LJ9A 3MRTA 1YUMA 4QICA 5H02A 3A6ZA 5C3UA 3BHJA 4AF6A 4FKZA 4ND7A 4HVCA 3I8OA 1FVXA 1UODA 4KMMA 2X15A 3NLLA 3OCWA 1KJ9A 4D5GA 2PL5A 5K0SA 3DAFA 1SCKA 3DFKA 5IBRA 3S8MA 2WF8A 2ZAMA 4FYMA 5K0GA 1SG9A 2V4UA 2NAPA 1O57A 1V5GA 2WTUA 2HDNB 2Z57A 4K2HA 5DMXA 1ODLA 4J1NA 5A7GA 4UTPA 3IXQA 3H1PA 5F1OA 1CUUA 3DBLB 4RSGA 1JB1A 4YIHA 4BGUA 3PXDA 5AK6A 1WD5A 5CFNA 1FS4A 2PS1A 3GFSA 2XWJI 5MN4A 2CMDA 1TYCA 5EE5B 5LZ8A 5IC5A 4A1OA 5E3IA 1T5LA 3JD1A 4GZLA 4RMJA 2JJMA 5JHGB 1YIOA 3WWYA 4KO3S 1DIBA 2J30A 2X0IA 2AUMA 2QTVB 4B73A 4FMBB 3W77A 2GJ8A 3OWHA 2CFTA 2V7UA 3H9UA 1NJ6A 2YVLA 5F5XA 3ADDA 4QHTA 4BNWA 2JFFA 4MHOA 1NVEA 4MUIA 3WYFA 5LQSA 4MCIA 4ABYA 1A88A 4PGMA 4LZLA 3NYQA 3T7RA 5BMVF 1RIFA 1L4LA 2H4XA 3WWZA 2IIPA 2ZK7A 3BWYA 5LQAA 4R1UA 3D6TB 3OZBA 2WJIA 4EF6A 1N5IA 2QM0A 4XX0A 2AHOA 2VAPA 3EPPA 5EGSA 3TL6A 4BVHA 4OXRA 5L3QB 2R2AA 4AFNA 3ZZMA 1FU8A 3OOSA 4TOIA 2AJTA 1XZCA 4H17A 4QRDA 3T7SA 4CHGA 4YLGA 5E0OA 5CBKA 3VSEA 1PP4A 2G25A 4I4TB 1FDUA 1AA9A 3MWKA 2NV0A 1KGDA 1KFKB 1NIJA 2MINA 1W2WB 3O3NB 3ZDFA 4A2WA 2PKRA 3D4BA 3SHVA 4KXQA 4WLUA 5KKNB 1YR6A 4TT8A 4OLBA 3LP8A 2IX3A 4RZ2A 2VF7A 1VMDA 1XCPA 2JG3A 2BZ1A 1JEQB 1LI5A 2KWIA 1OH8A 3L7AA 2NPOA 4DCNA 2FA9A 1YT5A 3LQ2A 4C43A 4ENQA 4ARUA 2A1UB 2WTAA 1B7GO 2A9QA 3C5VA 3LF2A 3O7WA 4MV5A 4AMYA 2DUUA 3R4VA 4N12A 3V8BA 3QYFA 2J9YB 4JUAA 3BWMA 3V4SA 1A5SB 4KUHA 3PB3A 1JLLA 2ZKLA 3A1TA 4M0KA 4TXJA 2D2XA 1WMEA 2QTMA 1MDBA 2J3IA 1NF3A 2JHPA 2QRQA 2YOGA 3EG5A 1HFKA 3LRPA 3W9UA 1QP0A 3DBHB 1ZPDA 2EJWA 3QJ5A 4RZIA 1JKJB 3TZEA 3CVXA 4KBGA 1DMRA 1KY5A 4WKBA 3MQ2A 4PLZA 2AWOA 1EJ6A 5JANA 1U5BA 1XK6A 3Q0EA 2RCYA 3NFYA 1XNQB 1WABA 4ARZB 4XDYA 4ZOLF 2VTKA 3DR3A 4UBMA 1X0XA 4BFXA 1EIZA 3H5VA 3W05A 5DMHA 1R66A 3IQEA 1LQ2A 3A2NA 3G2PA 4ZCSA 2I03A 2OHIA 1TUIA 3L6CA 4C0JA 5J4LA 4IHJB 4JI5B 2HK6A 3KJIA 3OIGA 3LL4A 1FQOA 3NB0A 4JT4A 5F7OA 1C8VB 1T6NA 1YZQA 2XUOA 3GJ6A 3S2SA 3AP1A 4IYRA 2YY6A 4OL0A 1H2XA 5AI9A 3TINA 1LNSA 4HDKB 4PLGA 3M1LA 4AJLA 4D9MA 2QG9A 2RFLA 2A8YA 4JDUA 4Y2GA 3LU1A 5E1BA 3KKLA 1GD1O