4MSPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp22 (aka fkbp14) containing two ef-hand motifs
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
publication title Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mspA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mspA01
4PDZA 1SW8A 2MNTA 3DVMA 2LPVA 1CDPA 2PBCA 2OTGC 2L98A 3SG2A 3VRNA 4CLNA 3I5FC 4DZ3A 1AP4A 4GPLB 5JOLA 2D8NA 4DS7A 1V1FA 3O5EA 5KSZA 5J6EA 2JZVA 1IQ5A 1H4BA 1QX5B 4YGAA 1XFXO 3O5RA 1C7WA 3BUXB 2I7AA 1D6OA 3I5HB 3O5LA 1JFKA 1L2OB 4TYOA 4QJ4B 1YVHA 4ORBB 1XFZO 1NCZA 1UP5A 1B7TY 1FBVA 1QS7A 2CT9A 2ZNEA 3TUYB 4XYNA 1J7RA 3HX4A 4YRUA 1FW4A 2L50A 1CMFA 2Y1NA 1CB1A 2ZR5A 1K95A 1UHHA 2PVBA 2VN1A 1Q1CA 2XPAA 1IG5A 4TW6A 1FJDA 1TCFA 4OV2A 1F40A 2ZR4A 1QV0A 2OS8B 1IRJA 4U86A 2JULA 3SJSA 2KFWA 3EKHA 4QJ5B 2H61C 1UHJA 4DRJA 3I6CA 5CSNA 4W9OA 2JPTA 2H61A 4I5KA 3C1VA 4G2PA 1CDMA 2KHNA 1E8AA 3IQOA 3LK1A 1FKRA 1QVIY 1J7OA 1JF0A 2LV7A 1Y0VH 3I5GC 1PBKA 3WHTB 1NCYA 1AJ5A 3MDYB 4GGQA 1TNXA 4MRXA 5HKYA 1A29A 3OB1B 4O2TA 1KK8B 1AHRA 1GQMA 3BXKA 1B1GA 2RURA 4JFKA 1TNQA 2AUCA 1KQMB 1NIWA 1M63B 1RK9A 2LANA 1ZMZA 2NLNA 2LMUA 3FWCA 3UI4A 2VRGA 3BYAA 4U8DA 5HW8A 1FAPA 2XP7A 4C0KA 1B47A 1Y0OA 2XP9A 3ODKA 1UWOA 2L4IA 1A03A 2K8MB 1EJ3A 1LVCD 4WQ2A 1W7IB 2ZFDA 2ZRTA 4DCKA 2FAPA 1AUIB 1JSAA 2NCPA 2R2IA 1QPFA 3I5HC 1OMRA 2D9FA 2MLEC 1PINA 2A4JA 1L2OC 1S3PA 2SCPA 3GK2A 4P5OE 5DKRA 1K2HA 2PV1A 1RTP1 1WRLA 1S5GZ 1KFXS 1AJ4A 3GOFA 2JQ6A 3DVKA 5HYDA 2N87A 3KABA 1K9KA 1L7ZA 4I5NB 1M46A 3EKJA 4YGEB 1KCYA 4I5LB 4CIDA 3TUYC 1UHNA 1DMOA 1D7JA 4G50A 4TX0A 1EL4A 1SCVA 3DD4A 1XO5A 2E30A 4DIPA 5CSJA 1DF0B 1B9AA 1FI5A 2BECA 4GFTA 1DJZA 4YI9A 3NSOA 2MRDA 2CBLA 2M1UA 2KI3A 3UQBA 3BUOB 4DZ2A 4JPZB 4C0JA 5CSFA 4YGDB 4MGVA 2OS8C 2LVKA 3I5FB 4JWQA 1BF5A 2RUDA 4J4OA 2M7NA 5D69A 5PALA 2LHIA 1YTZC 1KT1A 1HQVA 3TCZA 2WNDA 1XFWO 3KAIA 1ALWA 1CLMA 3K21A 4GBAA 4PCWA 4CPVA 5HUAA 2OPOA 4MSPA 1B8CA 5TNCA 3GPKA 4W9QA 2KI6D 2LHLA 1YATA 1BOCA 3EVUA 2FJUB 3QRXA 1K94A 3TDIA 2F4EA 4PE0A 2K61A 3LL8B 1BL4A 1KK8C 3KACA 1U5IA 2PSRA 3KF9A 3WNXB 1KQMC 1SBJA 3FAPA 2ITKA 1B8RA 2I18A 2LMTA 4HRGA 4OVNF 4PALA 1YUTA 2ZQUA 3OX6A 3O6BA 3A4UB 2IS9A 3LK0A 1M45A 4PHMA 1SNLA 3I5IC 2M2AA 5F6TA 1K9UA 2BBMA 2BCAA 1FKLA 3KCEA 2ZN9A 1FKBA 1EYMA 3CS1A 5J3XA 2XP8A 1NPQA 1JNSA 1LA0A 2LAPA 3CWGA 1UUSA 2JNXA 1AVSA 2JTZA 3PSRA 4MN0A 1J4HA 3TS5B 5HT1A 4HSZA 3O5QA 2KI4B 1SPYA 3EVVA 1PRWA 3VRRA 2XP6A 4YGBB 1N65A 1TN4A 2CTNA 3O5IA 4R0XA 1JC2A 2ISDA 1NSGA 4W9PA 5I98A 3O5GA 2V53A 4DRIA 4A4CA 3RM1A 3PLFB 2JXCA 1A75A 1CNPA 3E3RA 2PRUA 4ODMA 4DRMA 2NZ0A 5DIUA 1DF0A 3O78A 1QTXA 1RWYA 2BCBA 1FF1A 1NMVA 4PHKA 2JT0A 5D75A 1NSHA 1Y6WA 3SG7A 5DITA 3CLNA 4ORCB 1JVWA 3H9RB 2PALA 1ROTA 1IGVA 4HREE 3PRBA 4DH0A 1FKIA 3OP0A 2JT3A 2L5XB 2QACA 3PA7A 1DJHA 1K9PA 1BODA 1XYDA 1QJTA 2L4HA 1XVJA 1QZ2A 2BBNA 2LJ4A 2K7OA 1OZOA 1BMOA 2AMIA 1Q80A 1YURA 1C9HA 2KO7A 1OZSA 1SL9A 1FPWA 2HQWA 1KFUL 1NUBA 1YRTB 5IBWA 1SL7A 2XP5A 1CM4A 3EVRA 1EH2A 4MZKA 4ODKA 1KK7Z 2M9GA 1IJ6A 2F3YA 1WRKA 5HLVA 3TDZA 3VGOA 3KADA 2I94A 1TOPA 1DJIA 3AAKA 1KT0A 3FS7A 4FQOA 4DRWA 4M2QA 4U85A 2LC5A 1DJXA 1D1OA 1NCXA 2WORA 3PN7B 1JNTA 2M08A 4IQCA 2HQ8A 3TS5C 1GGWA 1DJWA 2KYFA 1NX3A 2KI4C 5AEQA 3CGNA 2ZQVA 1C07A 1QASA 3AAJA 5HW7A 4IL1A 1F70A 1N0YA 2K2FA 1ZCNA 2MLFC 3FWBA 1C7VA 1CDLA 4BF8A 1U5IB 4GGNA 2KI6C 1UHKA 1YX8A 2COLB 2JTTA 1DVIA 1S36A 1SK6D 2MJWB 1UURA 1QLSA 3RFWA 2LMVA 3KPXA 5HWCA 2LVJA 3RLZA 3CZTX 4NQGA 2DG9A 2BL0B 4AOMA 1MQ1A 3I5IB 1BLQA 2LLSA 2FCEA 2BKHB 4GNKB 1CFDA 2JNFA 1N2DA 1CMGA 1CLBA 3UQAA 1LKJA 1FKFA 1YUUA 1H8BA 4BY5A 1CKKA 4BY4A 3F45A 2M8UA 4LAWA 1S6CA 1S6IA 4OR9B 3O5DA 5FYXA 2ZRSA 1N1AA 4PHNA 4ITZA 3O5MA 4P2YB 1Q6IA 5BXJA 4J4NA 2CNPA 2K8IA 3JTDC 1CTRA 1QLKA 1EG4A 2MLXA 1MWNA 4GGFC 4YGCB 2F2DA 3OOBA 2HF5A 3UQIA 4DUQA 1A75B 2WOSA 1KWOB 4DRNA 1LINA 4GGFA 4GUKA 3IQQA 1BU3A 1W7JB 3DF0B 2PPOA 4ODPA 4PHJA 2XP3A 3UI5A 1DGUA 3AKBA 1RECA 3DVEA 4GIVA 1YW5A 3CR2A 5HTGA 1PSRA 3O2PA 1R9HA 2WCBA 2SASA 2ZR6A 2F3ZA 1OQPA 5AXIA 2MA2A 1FI6A 2L2EA 2BE4A 3PN7C 1CFPA 3GK4X 2IF4A 2B1UA 3O5KA 4ODOA 1KK7Y 4TW7A 2BKIB 3LLEA 2KAYA 3SG4A 4USLA 1ALVA 1CFCA 3M0WA 1OSAA 2WCEA 1NMWA 4OKHA 4AQJA 3KAFA 1CDNA 1NX2A 4MVFA 1GJYA 3CGAA 2M97A 4R1EA 2F2PA 2FCDA 5I2LA 1RJVA 3NSIA 3D10A 2RSEA 3LUOA 2O60A 3SG5A 3OB2B 2JU0A 2LCPA 4Q04A 3O5JA 4F0ZB 1L1PA 2Q91A 1B8LA 2MLZA 2BL0C 1K96A 1LXFC 1R6PA 2KOTA 1SRAA 1NX0A 2KYCA 3O4YA 4HRHA 1B6CA 2G9BA 3CGMA 2BCXA 2ZKMX 1BKFA 1YR5A 3SG3A 4FAPA 1SMGA 4FTGA 1V1GA 3JVTB 2XP4A 4QIBA 3IF7A 3UF8A 3BUNB 1BG1A 1JF2A 3KHEA 1QV1A 1B7TZ 1DJYA 4AQIA 1WRZA 4MZLA 1MHOA 3PFVA 1MR8A 5HLOA 2JC2A 2ZNDA 1FKDA 2JWWA 4LAXA 5B8IB 4XJKB 2BE6A 3KZ7A 1XFVO 3BOWB 1ZUZA 3JYMA 1WY9A 2KGBC 3SIAA 3ZWHA 4LAVA 1NYAA 3NSKA 4DRQA 4ZCUA 1Y1XA 2AWGA 1TIZA 2WCFA 2KGRA 4WRIA 2KQ6A 2M1IA 1KWOC 4DRHA 1HT9A 1X02A 1OMDA 2PPPA 4CFRA 1DTLA 1S5GY 5AFPA 1F55A 1WDCB 4JYSA 3VRQA 4JFJA 3DF0A 3DVJA 1IJ5A 5G08A 5I2OA 1IQ3A 2Y78A 2KFFA 1R2UA 1J6YA 2Y4QA 1QVIZ 3KO0A 1QIVA 2LGOA 4TNSA 2EC6B 2DOQA 1SL8A 3FIAA 2PASA 2EHBA 4N5XA 2KBIA 3EK4A 2CCMA 4ODRA 1JBAA 2DG3A 1QPLA 3A8RA 1F71A 1F8HA 5DIVA 3NXAA 3PRDA 2Q5AA 1CM1A 1PK0D 1J1DA 2RUQA 2K2AA 2LNKA 2LKNA 2GGZA 3UI6A 3O5OA 3JTDB 3HCMA 2KAVA 4U84A 1RFJA 3O5PA 4OCIA 4LAYA 1IH0A 4ETOA 2K7DA 3NTPA 1KFXL 2LP2A 1PALA 2GV5A 4DRPA 5ER5A 3JYJA 1K93D 1Y1UA 1YUSA 2F21A 3JVTC 2FOTA 5ER4X 1OOJA 1ZFSA 3JXVA 1TCOC 4I5JA 4C02B 1J4RA 4MBEA 3B7XA 1G33A 1TNWA 5B8IC 1MF8B 2ZN8A 2MF9A 3IK8A 4XJKA 3BOWA 3KAHA 3TC5A 4N19A 4DT4A 1EG3A 1PVBA 1SR6B 1YX7A 2KBMA 2KFHA 2LP3A 2M29A 3VRPA 1G4YR 2MBXA 2KAXA 2JOJA 4YI8A 1MXEA 4NDBA 4PE7A 3IHZA 5CSIA 5HWBA 1MXLC 3D0YA 5K89A 1WDCC 3OX5A 1JUOA 1J55A 3ICBA 1XK4C 2K7CA 1KSOA 1S1EA 1U79A 4MLWA 1S6JA 4DIRA 1DJGA 1Q6HA 1XK4A 5GQQC 3TZ1A 3PATA 2NXQA 1BR1B 2JZIA 1PULA 2EC6C 2M1KB 4E68A 1F8AB 3VAWA 2Y1MA 5BPJA 1NWDA 1FKSA 1SYMA 1DGVA 2E6WA 2KSPA 3EK8A 4JQ0D 4CFQA 2M0RA 1T11A 4QT3A 1NP8A 3SG6A 4N1GA 4NDCA 2MAZA 1WLZA 2K7BA 5I2QA 5HKZA 1JWDA 1TTXA 2K0JA 4M2OA 4YBHB 1ROUA 4MZJA 4N1FA 3H4SE 4PE4A 2G2BA 2AAOA 3IKDA 3BUMB 1K8UA 1OE9B 4WQ3A 1AK8A 4IQ2A 2LUCA 3BUWB 3NRKA 3AKAA 1A2XA 1QXPA 1QX7A 5AERA 1J7PA 2TN4A 2MPHA 3TDUA 1J1EA 1TNPA 1J4IA 1VRKA 5HKGA 1ZK6A 1HXVA 1MUXA 3CR5X 3O5FA 1YRUB 2JT8A 1KQVA 3TDBA 1SCMB 1EQ3A 1ZOTB 4JFLA 2F33A 3SIBA 1BJFA 2CXJA 3ZNIA 5KTYA 1FKGA 2MLYA 4TNCA 2KDHA 3WH0A 2NCOA 2M3WA 1KFUS 1F4OA 1ODBA 4NDDA 4ODNA 2PMYA 4NNRA 2LVIA 1SR6C 1BT6A 2Q4UA 1WLMA 4QT2A 2GGMA 3CR4X 1IWQA 2LVVA 4C0LA 4FN2A 2F2OA 2PV2A 3PM8A 4M2PA 4IPXA 2PPNA 2L0PA 1CFFA 5JJGA 2OTGB 3PALA 3EY6A 1M5YA 2LLUA 2I2RE 1CLLA 2L51A 3KAGA 1GGZA 3NSLA 4L9MA 5I8NA 2OFNA 4ODLA 5D7FA 1UHIA 1XFYO 1J7QA 1P5QA 1FKHA 2HETA 2LUXA 1QX2A 3WXAA 1W26A 5CPVA 1TCOB 1XA5A 2JXLA 2QPTA 5DKNA 5HW6A 2L2SA 4D1EA 2JRFA 3EK7A 4DROA 2LLTA 2F8PA 5HKWA 3BQ3A 4TW8A 1S26D 1SKTA 1TRFA 3OHMB 1Q6UA 2PV3A 2RUCA 3NI6A 4JFIA 3RGCA 1QIWA 1JFJA 1B4CA 4GAOA 2RGIA 4JFMA 1BR4B 5DKQA 2MHHA 1ZACA 4MRYA 3D0YB 3MSEB 3VROA 2KE0A 1F4QA 4QJ3B 1PVAA 1SY9A 1M31A 1PSBA 1QATA 2XPBA 1KSMA 2P6BB 1FKTA 2KGJA 2WC8A 1LA3A 2ZQTA 3LCPC 2KQYA 1SCMC 2LE9B 1FKKA 4UPGA 4MEWA 2M7LA 5KU1A 4DRKA 2HPSA 2KFGA 2EGDA 2O5GA 2KR7A 1Y1AA 1K90D 1G8IA 1NX1A 3KEVA 4ORAB 1IKUA 2VCDA 2LM5A 1A4PA 4PE1A 5AANA 4ODQA 5GPGA 1D7HA 2M49B 1M39A 1DT7B 2H2KA 3GK1A 1YVLA 4ZCVA 1D7IA 2Y5IA 2DG4A 3CTNA 2FKEA 2RQSA 3I5GB 2ZQSA 3IKGA 1FD9A 1FKJA 3WHUB 1RROA 4ICBA 4A4BA 1XFUO 2KNEA 1F54A 1A7XA 1OMVA 1EXRA 2UZ5A
chains in the Genus database with same CATH superfamily
4PDZA 3DVMA 1CDPA 1ZBCA 2L98A 3I5FC 4DZ3A 1Z4HA 5JOLA 1V1FA 5J6EA 1QX5B 3ARWA 1XFXO 3BUXB 1L2OB 4QJ4B 4Z2IA 4MNKA 1YVHA 3NHIA 1CMFA 2Y1NA 4S3JA 2PVBA 5DEZA 4OV2A 1IRJA 1WNOA 2H61C 4DRJA 2JPTA 3C1VA 1CDMA 1E8AA 1PBKA 1Y0VH 3D76A 1AJ5A 1E6NA 4MRXA 1A29A 3OB1B 1KK8B 2RURA 2LANA 1M63B 2A3EA 3FWCA 4P8WA 3ARZA 4C0KA 2WM0A 2K8MB 1EJ3A 1LVCD 4WQ2A 2ZFDA 2ZRTA 2R2IA 2D9FA 4ZS6A 4P5OE 1AJ4A 5HYDA 1UHNA 1B9AA 4KR0B 4YI9A 3NSOA 1JCHB 2CBLA 2M1UA 2WLYA 4JPZB 4YGDB 1HKJA 2RUDA 5D69A 1JNDA 3TCZA 1ZBWA 2P71A 4GBAA 3K21A 4PCWA 3CH9A 4MSPA 5TNCA 2DSVA 1YATA 3EVUA 1XRVA 2PSRA 3WNXB 3FAPA 2ITKA 2LMTA 4OVNF 1NH6A 3A4UB 2WCKA 3ARYA 5F6TA 1FKLA 2JNXA 1J4HA 3TS5B 4HSZA 3VRRA 1SPYA 1PRWA 4YGBB 1N65A 2QEHA 1JC2A 4A4CA 3PLFB 2PRUA 2NZ0A 3O78A 1QTXA 1FF1A 2JT0A 1NSHA 1Y6WA 5DITA 1IGVA 5GQBA 3OP0A 2JT3A 2LJ4A 2K7OA 1LL6A 2KO7A 1OZSA 3EVRA 3BXWA 4ODKA 1KK7Z 3TDZA 3RM8A 1TOPA 1DJIA 4DRWA 4S3KA 4M2QA 2LC5A 3DXLA 1NCXA 1TWOA 3FE9A 1KFWA 5AEQA 1NX3A 3CGNA 2ZQVA 2KLEA 2K2FA 2MLFC 3FWBA 2KI6C 1UHKA 1YX8A 2COLB 3KPXA 3RLZA 4NQGA 2BL0B 3I5IB 2LLSA 4GNKB 1CLBA 1FKFA 2H8VA 4BY5A 3F45A 2M8UA 1H0GA 1S6CA 1OW4A 2KLDA 2CNPA 2K8IA 1QLKA 2F2DA 2HF5A 2WOSA 3WD3A 4GGFA 4WKAA 1W1VA 1BU3A 4PHJA 1DGUA 3AKBA 4GIVA 5HTGA 3OA5A 4QZVB 5AXIA 2L2EA 2B1UA 1LS8A 4ODOA 4TW7A 1CFCA 3SG4A 1GPFA 1ALVA 1TUJA 1NMWA 1NWUA 4AQJA 3KAFA 4R1EA 2JU0A 2LCPA 4Q04A 5EL2A 1LXFC 3O4YA 1SRAA 3ALGA 2ZKMX 1SMGA 1V1GA 2XP4A 3IF7A 1BG1A 4NZCA 3KHEA 1WRZA 1FKDA 1WY9A 3NSKA 4INWA 2KGRA 4XAKA 4DRHA 4JFJA 3DVJA 2KFFA 1J6YA 3D77A 2PN0A 2EC6B 2O92A 2A3AA 2PASA 4N5XA 2KBIA 1JBAA 1EDQA 3A8RA 2Q5AA 3UNWA 3UI6A 3HCMA 1OOHA 4LAYA 3CYZA 4DRPA 5ER5A 1Y1UA 1OOJA 1TCOC 4I5JA 5B8IC 2YBUA 2MF9A 3IK8A 3KAHA 3S0DA 1TUZA 4N19A 1SR6B 2LP3A 3VRPA 3IHZA 1MXEA 4PE7A 3D0YA 1EIBA 1WDCC 3OX5A 3WD2A 3ICBA 1XK4C 4DIRA 1ZU8A 2WC6A 5GQQC 3PATA 1BR1B 1PULA 4E68A 3VAWA 1IIOA 2E6WA 5I94A 1T11A 3EK8A 3SG6A 4NDCA 5HKZA 1TTXA 4YBHB 1ROUA 5DO2A 3H4SE 1K8UA 1QX7A 5AERA 1J7PA 2TN4A 1TNPA 1OGGA 1ZL1A 3SS5A 3O5FA 3CR5X 2JT8A 1VF8A 1ZOTB 2DSUA 4JFLA 4OZDA 3ZNIA 3CZ8A 2M3WA 1KFUS 3AS1A 2PMYA 4NNRA 1WLMA 2GGMA 5HBFA 3PALA 1M5YA 2IUZA 2L51A 3KAGA 2OFNA 5I8NA 5D7FA 1XFYO 2HETA 1QX2A 1XA5A 5DKNA 2JRFA 3EK7A 2LLTA 1S26D 1TRFA 4NSBA 3OHMB 4JFIA 1B4CA 1DQEA 2GTEA 1PVAA 1P28A 1HKMA 1SCMC 4MEWA 2QDIA 2M7LA 2EULA 4DRKA 3KEVA 4ORAB 4HBOA 2LM5A 3ARRA 3S0AA 1YVLA 2DG4A 2Y5IA 1FKJA 1RROA 4F7FA 1O6IA 1EXRA 1SW8A 2MNTA 4IJ7A 2PBCA 3VRNA 4CLNA 2L5YA 5KSZA 3RM4A 1ZBKA 1JFKA 1XFZO 1B7TY 1FW4A 2VN1A 1Q1CA 1IG5A 3S0EA 4Z2LA 1FJDA 1F40A 1CTNA 4U86A 4QJ5B 3PR9A 1UHJA 3I6CA 4W9OA 4G2PA 2H61A 2JPOA 3IQOA 1QVIY 4P8XA 4W5UA 1AHRA 1GQMA 4JFKA 2P70A 3BYAA 3WL1A 1FAPA 3RZSA 2XP9A 2L4IA 5D3OA 1W7IB 4DCKA 2FAPA 1JSAA 1QPFA 3I5HC 1X6LA 1PINA 1W1YA 3GK2A 3GU0A 4YGEB 3EKJA 3TUYC 1SCVA 1XO5A 1DF0B 1FI5A 1DJZA 1HJVA 2MRDA 4DZ2A 5CSFA 1BF5A 4J4OA 2M7NA 5PALA 2WCHA 1KT1A 3CZ0A 2G41A 1XFWO 2OPOA 1B8CA 4W9QA 4WKHA 2FJUB 3QRXA 1K94A 3TDIA 1OMVA 2K61A 1BL4A 3KACA 3KF9A 1KQMC 1SBJA 1ITXA 2ZQUA 4PALA 2I18A 4JD9A 3LK0A 1M45A 4PHMA 1SNLA 2M2AA 2BBMA 3CS1A 2XP8A 1NPQA 1UUSA 1AVSA 2L2CA 2DT0A 4R0XA 2ISDA 4DRIA 1D2KA 2JXCA 4ODMA 5DIUA 1DF0A 4R5EA 1NMVA 3L4LA 3SG7A 3D75A 2PALA 1ROTA 1FKIA 1XYDA 1QJTA 2L4HA 2BBNA 4UDMA 1BMOA 1FPWA 2HQWA 1KFUL 3Q8IA 1SL7A 3KADA 2B31A 1KT0A 3OBVA 2M08A 5HW7A 1CDLA 4BF8A 2JTTA 2MJWB 3CZTX 3L47A 1MQ1A 1CFDA 3AS0A 1YUUA 3N7HA 1S6IA 4PHNA 1Q6IA 4J4NA 3JTDC 2MLXA 1MWNA 3UQIA 4MNMA 2PPOA 3DF0B 2XP3A 3CR2A 1PSRA 4WIWA 2SASA 1UR8A 3PN7C 3GK4X 3M0WA 3RMEA 2YGUA 1OSAA 4MVFA 3EG5B 5DICA 3LUOA 3SG5A 4F0ZB 1L1PA 1GUVA 2MLZA 2KOTA 1NX0A 4HRHA 2G9BA 1OOFA 1EQ3A 3SG3A 4FAPA 4QIBA 1JF2A 1B7TZ 1Y0OA 1DJYA 5HLOA 3PFVA 1MR8A 2JC2A 2ZNDA 5B8IB 2KGBC 1NYAA 3DYEA 4ZCUA 1TIZA 2WCFA 2A3CA 2KQ6A 3WD4A 1KWOC 1OMDA 3S0GA 4CFRA 1F55A 1WDCB 4JYSA 3DF0A 5G08A 5I2OA 1R2UA 1WB0A 2Y4QA 1LL7A 1QVIZ 2LGOA 4TNSA 3FIAA 2EHBA 1WAWA 2DG3A 1W9ZA 1F8HA 4HBEA 5DIVA 3NXAA 1PK0D 1J1DA 2RUQA 2K2AA 2LKNA 2KAVA 3NTPA 2K7DA 2LP2A 1PALA 3ARTA 3JYJA 1YUSA 3JVTC 1GRJA 1ZFSA 1E6RA 1G33A 1TNWA 1LL4A 3QOKA 1OWQA 1G4YR 4NDBA 5CSIA 5HWBA 3PM2A 1JUOA 1XK4A 3TZ1A 2JZIA 2M1KB 1NWDA 1FKSA 2DSZA 4CFQA 4JQ0D 1NP8A 3ARQA 2K0JA 4MZJA 1HKIA 3IKDA 3BUMB 1OE9B 2LUCA 3AKAA 3QMEA 2MPHA 3ALFA 3CABA 1ZK6A 4WK9A 1SCMB 1E6ZA 3SIBA 1BJFA 2CXJA 2KDHA 2NCOA 1F4OA 1ODBA 1NWSA 3B87A 3CR4X 1IWQA 2LVVA 3GTYX 2PV2A 4M2PA 4ZPWR 1OGBA 2L0PA 2LLUA 1GGZA 4ML4A 1P5QA 3WXAA 1W26A 5HW6A 2JXLA 4PTMA 4DROA 1SKTA 2RUCA 3NI6A 4JFMA 1BR4B 3VB1A 3B6XA 3D0YB 2KE0A 1H0IA 1QATA 1C3ZA 1PSBA 1FKTA 2WC8A 3FE6A 2ZQTA 1FKKA 4UPGA 2HPSA 1ZBVA 1K90D 1NX1A 4ODQA 2H2KA 3PRAA 3CTNA 2FKEA 1FD9A 3WHUB 1A7XA 4A4BA 3B9DA 2UZ5A 2QEVA 2LPVA 3SG2A 3K1EA 4GPLB 4DWSA 3O5EA 1IQ5A 4IT6A 2DPEA 1D6OA 3I5HB 3O5LA 3WIJA 4MNLA 3FE8A 2CT9A 1UP5A 1QS7A 3AS3A 3TUYB 4XYNA 1J7RA 3HX4A 1W1TA 2L50A 3O4XA 4TW6A 1LJYA 1TCFA 2ZR4A 3RM9A 2JULA 3SJSA 3FXYA 2KFWA 3ARSA 2KHNA 2PYQA 1JF0A 4GGQA 1TNXA 3BXKA 2AUCA 1KQMB 2NLNA 2WCJA 3UI4A 1IX5A 2XP7A 1B47A 1UWOA 4MTVA 4L3NA 1AUIB 2B5UB 2SCPA 1K2HA 5DKRA 1RTP1 1KFXS 3GOFA 3KABA 1M46A 1KCYA 4G50A 1D7JA 3DD4A 4DIPA 5CSJA 1FFQA 4GFTA 1T14A 3UQBA 2KI3A 3BUOB 4C0JA 2OS8C 2LVKA 3I5FB 4JWQA 4LGXA 2WNDA 1ALWA 1CLMA 4CPVA 5HUAA 2DT1A 3G6LA 2KI6D 3W4RA 1BOCA 2WK2A 1U5IA 5FI7A 1B8RA 4HRGA 3BFBA 1YUTA 3OX6A 3O6BA 3I5IC 4Q7NA 2FDMA 2BCAA 1EYMA 4MN0A 3EVVA 2XP6A 1TN4A 2CTNA 1ZB5A 1NSGA 5I98A 3BFAA 3RM1A 1A75A 1CNPA 1UR9A 1RWYA 4L72B 3WQVA 4DWSC 4Q22A 2ESCA 3CLNA 4HREE 3PRBA 2FJYA 4DH0A 2L5XB 2QACA 3AROA 3PA7A 3B86A 1XVJA 3SS3A 2AMIA 1W1PA 1YURA 3B8SA 1C9HA 1SL9A 1NUBA 1YRTB 1CM4A 1EH2A 2M9GA 2F3YA 5HLVA 3VGOA 3FS7A 3WQWA 2DSWA 3B9EA 2WORA 3PN7B 1JNTA 2KYFA 2KI4C 3AAJA 1F70A 1ZCNA 4MAVA 1C7VA 5FI6A 4GGNA 1DEKA 1UURA 2PI6A 1QLSA 5HWCA 2LVJA 4AOMA 2G8ZA 1BLQA 3UQAA 2FCEA 2BKHB 1CMGA 1LKJA 1H8BA 4LAWA 5FYXA 3G6MA 5BXJA 1CTRA 4YGCB 4DRNA 2AOSA 1KWOB 5HL1A 1HJXA 3EIPA 1LINA 1QWVA 1W7JB 3IQQA 3DVEA 1E6PA 5GPRA 1YW5A 4IT4A 1R9HA 2ZR6A 1OQPA 2MA2A 1FI6A 2BE4A 1CFPA 2IF4A 3O5KA 1KK7Y 2BKIB 2KAYA 1DELA 4KYNA 2M97A 2F2PA 5I2LA 3NSIA 3D10A 1JNEA 3OB2B 3O5JA 2Q91A 1LG1A 3CGMA 3CHEA 1BKFA 3JVTB 3BUNB 4AQIA 4MZLA 2JWWA 3BOWB 1ZUZA 1E15A 3JYMA 3SIAA 3ZWHA 3AS2A 1Y1XA 2M1IA 1S5GY 5AFPA 3VRQA 3S0BA 1IQ3A 3KO0A 2DOQA 2QEOA 4ODRA 3PRDA 2GGZA 3O5OA 4U84A 5JH8A 3O5PA 4ETOA 1KFXL 1FFRA 1K93D 2F21A 2FOTA 5ER4X 3JXVA 3ARVA 3B7XA 1MF8B 1W9UA 2ZN8A 3UO9A 3BOWA 3TC5A 1EG3A 1PVBA 2KBMA 2KFHA 2M29A 2KAXA 1ORGA 2JOJA 1MXLC 5K89A 2K7CA 1KSOA 1S1EA 1S6JA 1DJGA 1Q6HA 1F8AB 1SYMA 1DGVA 4P8VA 4QT3A 4N1GA 2MAZA 1RD6A 1OOIX 4M2OA 4DWSD 4PE4A 2G2BA 2AAOA 1AK8A 3NGVA 4IQ2A 3BUWB 1A2XA 3TDUA 1J1EA 1J4IA 4Z2HA 5HKGA 1E9LA 3TDBA 1FKGA 4TNCA 3ARPA 3WH0A 2LVIA 2Q4UA 4QT2A 4C0LA 4FN2A 3PM8A 4HARA 4IPXA 2PPNA 2I2RE 1CLLA 3NSLA 1UHIA 1J7QA 1FKHA 3CHDA 2BAPA 1TCOB 2L2SA 4D1EA 3BQ3A 1Q6UA 3RGCA 5DF0A 1JFJA 3AQUA 3NHTA 4P8UA 5DKQA 1ZACA 4MRYA 3MSEB 1F4QA 4QJ3B 1M31A 2KGJA 1LA3A 2LE9B 2EGDA 2KR7A 2VCDA 1Y1AA 1IKUA 5GPGA 1A4PA 4PE1A 2M49B 1DT7B 1OOGA 3FY1A 4ZCVA 2ZQSA 4ICBA 1XFUO 1GM0A 2OTGC 1AP4A 2D8NA 4DS7A 4KQZA 2JZVA 1H4BA 4YGAA 3O5RA 1C7WA 2I7AA 2PQLA 2WLZA 1X6NA 4TYOA 4INXA 4ORBB 1NCZA 1FBVA 2ZNEA 4YRUA 3OGNA 1CB1A 2ZR5A 1K95A 1UHHA 2XPAA 1QV0A 4Z2KA 2OS8B 3EKHA 5CSNA 3R1VA 4I5KA 2DT2A 3CZ1A 3LK1A 1FKRA 1J7OA 2LV7A 3I5GC 3WHTB 5FI2A 1NCYA 3MDYB 4O2TA 5HKYA 1B1GA 1TNQA 3V2LA 1NIWA 1RK9A 1ZMZA 2LMUA 2VRGA 4U8DA 5HW8A 3CDNA 3ODKA 3DZTA 1A03A 3CZ2A 2NCPA 1OMRA 2MLEC 2A4JA 1L2OC 1S3PA 2QF8A 2PV1A 3PJIA 1WRLA 1S5GZ 2JQ6A 3DVKA 2N87A 1K9KA 1L7ZA 4I5NB 4I5LB 4CIDA 1DMOA 4TX0A 1LG2A 1XFRA 1EL4A 2E30A 2BECA 4MGVA 4DWSB 2LHIA 1YTZC 1HQVA 3KAIA 4AY1A 3GPKA 2LHLA 2F4EA 3LL8B 1KK8C 3DY9A 2IS9A 2BNXA 1NWRA 1K9UA 3KCEA 2ZN9A 1FKBA 5J3XA 1JNSA 1LA0A 2LAPA 3CWGA 2JTZA 3PSRA 1C3YA 5HT1A 3O5QA 2KI4B 4WJXA 3O5IA 4W9PA 3O5GA 2V53A 4DRMA 3E3RA 1W9PA 2BCBA 4PHKA 5D75A 1HJWA 3L4AA 4ORCB 1JVWA 3H9RB 3ARXA 1DJHA 1K9PA 1BODA 4MPKA 1QZ2A 1OZOA 1Q80A 2OLHA 4PT1A 1XHGA 1SR0A 5IBWA 2F23A 2XP5A 3B9AA 4MZKA 1LQ0A 1IJ6A 1SYTA 1WRKA 4FQTA 2I94A 3AAKA 4FQOA 4U85A 4URIA 1DJXA 1D1OA 2DT3A 4Z2GA 4IQCA 2HQ8A 3TS5C 1GGWA 1DJWA 1C07A 1QASA 4WKFA 4IL1A 1N0YA 2WC5A 1U5IB 1DVIA 1S36A 1SK6D 2LMVA 2DG9A 1K9TA 3WD1A 2JNFA 1N2DA 2A3BA 1CKKA 4BY4A 4OR9B 3O5DA 2ZRSA 1N1AA 4ITZA 3O5MA 4P2YB 1EG4A 4GGFC 3OOBA 4DUQA 1A75B 2O9OA 4GUKA 3D78A 4ODPA 3UI5A 1Z2CB 1RECA 4ZPVR 3O2PA 2WCBA 2F3ZA 2WCMA 3LLEA 4USLA 3BMBA 2WCEA 4OKHA 1CDNA 1NX2A 1GJYA 3CGAA 2FCDA 1RJVA 2RSEA 2O60A 2QEBA 3CHFA 3S0FA 1B8LA 2BL0C 1K96A 1R6PA 2KYCA 3WL0A 1B6CA 2BCXA 1YR5A 4FTGA 3B7AA 3UF8A 1QV1A 1MHOA 4LAXA 1SSEB 4XJKB 2BE6A 3KZ7A 1XFVO 4LAVA 4DRQA 2AWGA 4WRIA 1HT9A 1X02A 2PPPA 4ZPTR 1DTLA 3R72A 1IJ5A 3BJHA 2K60A 2Y78A 2YBTA 1NWTA 1QIVA 1SL8A 3EK4A 2CCMA 1QPLA 1GOIA 1F71A 4Z2JA 1CM1A 2LNKA 3JTDB 1RFJA 4OCIA 1IH0A 2GV5A 4C02B 3IVTA 1J4RA 4MBEA 4XJKA 1TFVA 3CHCA 4DT4A 1YX7A 2MBXA 4YI8A 1DC1A 1W9VA 1J55A 1U79A 4MLWA 3SS4A 3D73A 2NXQA 2EC6C 2Y1MA 5BPJA 3WKZA 2KSPA 2M0RA 1WLZA 2K7BA 5I2QA 1JWDA 1EHNA 4N1FA 4WQ3A 3NRKA 1QXPA 2WCLA 1VRKA 1HXVA 1MUXA 1YRUB 1KQVA 2F33A 2MLYA 5KTYA 3R1PA 1E44A 4NDDA 4ODNA 3ARUA 1SR6C 1BT6A 2ERBA 2F2OA 3R1OA 1CFFA 5JJGA 2OTGB 3EY6A 4MNJA 4ODLA 4L9MA 2LUXA 5CPVA 2QPTA 2KPHA 2F8PA 5HKWA 4TW8A 2PV3A 3BFHA 2ETNA 3WD0A 1QIWA 4GAOA 2RGIA 2MHHA 3VROA 1SY9A 3B88A 2XPBA 1KSMA 2P6BB 3D74A 3LCPC 2KQYA 5KU1A 2KFGA 2O5GA 1G8IA 5AANA 1D7HA 4JKTA 1M39A 3GK1A 1D7IA 2RQSA 3IKGA 3I5GB 3RFWA 2P4VA 2KNEA 1F54A 1HKKA 4PE0A
chains in the Genus database with same CATH topology
4PDZA 3DVMA 1CDPA 1ZBCA 2L98A 3I5FC 4DZ3A 5JOLA 1V1FA 5J6EA 1QX5B 3ARWA 1XFXO 3BUXB 1L2OB 4QJ4B 4Z2IA 4MNKA 1YVHA 1CMFA 2Y1NA 4S3JA 2PVBA 5DEZA 4OV2A 1IRJA 1WNOA 2H61C 4DRJA 2JPTA 3C1VA 1CDMA 1E8AA 1PBKA 1Y0VH 1AJ5A 1E6NA 4MRXA 1A29A 3OB1B 1KK8B 2RURA 2LANA 1M63B 2A3EA 3FWCA 4P8WA 3ARZA 4C0KA 2WM0A 2K8MB 1EJ3A 1LVCD 4WQ2A 2ZFDA 2ZRTA 2R2IA 2D9FA 4ZS6A 4P5OE 1AJ4A 5HYDA 1UHNA 1B9AA 4KR0B 4YI9A 3NSOA 2CBLA 2M1UA 2WLYA 4JPZB 4YGDB 1HKJA 2RUDA 5D69A 1JNDA 3TCZA 1ZBWA 4GBAA 3K21A 4PCWA 3CH9A 4MSPA 5TNCA 2DSVA 1YATA 3EVUA 1XRVA 2PSRA 3WNXB 3FAPA 2ITKA 2LMTA 4OVNF 1NH6A 3A4UB 3ARYA 5F6TA 1FKLA 2JNXA 1J4HA 3TS5B 4HSZA 3VRRA 1SPYA 1PRWA 4YGBB 1N65A 1JC2A 4A4CA 3PLFB 2PRUA 2NZ0A 3O78A 1QTXA 1FF1A 2JT0A 1NSHA 1Y6WA 5DITA 1IGVA 5GQBA 3OP0A 2JT3A 2LJ4A 2K7OA 1LL6A 2KO7A 1OZSA 3EVRA 3BXWA 4ODKA 1KK7Z 3TDZA 3RM8A 1TOPA 1DJIA 4DRWA 4S3KA 4M2QA 2LC5A 1NCXA 1KFWA 5AEQA 1NX3A 3CGNA 2ZQVA 2K2FA 2MLFC 3FWBA 2KI6C 1UHKA 1YX8A 2COLB 3KPXA 3RLZA 4NQGA 2BL0B 3I5IB 2LLSA 4GNKB 1CLBA 1FKFA 4BY5A 3F45A 2M8UA 1H0GA 1S6CA 2CNPA 2K8IA 1QLKA 2F2DA 2HF5A 2WOSA 3WD3A 4GGFA 4WKAA 1W1VA 1BU3A 4PHJA 1DGUA 3AKBA 4GIVA 5HTGA 3OA5A 4QZVB 5AXIA 2L2EA 2B1UA 4ODOA 4TW7A 1CFCA 3SG4A 1GPFA 1ALVA 1NMWA 1NWUA 4AQJA 3KAFA 4R1EA 2JU0A 2LCPA 4Q04A 1LXFC 3O4YA 1SRAA 3ALGA 2ZKMX 1SMGA 1V1GA 2XP4A 3IF7A 1BG1A 4NZCA 3KHEA 1WRZA 1FKDA 1WY9A 3NSKA 2KGRA 4XAKA 4DRHA 4JFJA 3DVJA 2KFFA 1J6YA 2EC6B 2O92A 2A3AA 2PASA 4N5XA 2KBIA 1JBAA 1EDQA 3A8RA 2Q5AA 3UI6A 3HCMA 4LAYA 4DRPA 5ER5A 1Y1UA 1OOJA 1TCOC 4I5JA 5B8IC 2YBUA 2MF9A 3IK8A 3KAHA 4N19A 1SR6B 2LP3A 3VRPA 3IHZA 1MXEA 4PE7A 3D0YA 1EIBA 1WDCC 3OX5A 3WD2A 3ICBA 1XK4C 4DIRA 1ZU8A 5GQQC 3PATA 1BR1B 1PULA 4E68A 3VAWA 2E6WA 1T11A 3EK8A 3SG6A 4NDCA 5HKZA 1TTXA 4YBHB 1ROUA 5DO2A 3H4SE 1K8UA 1QX7A 5AERA 1J7PA 2TN4A 1TNPA 1OGGA 1ZL1A 3O5FA 3CR5X 2JT8A 1VF8A 1ZOTB 2DSUA 4JFLA 3ZNIA 3CZ8A 2M3WA 1KFUS 3AS1A 2PMYA 4NNRA 1WLMA 2GGMA 5HBFA 3PALA 1M5YA 2IUZA 2L51A 3KAGA 2OFNA 5I8NA 5D7FA 1XFYO 2HETA 1QX2A 1XA5A 5DKNA 2JRFA 3EK7A 2LLTA 1S26D 1TRFA 4NSBA 3OHMB 4JFIA 1B4CA 1PVAA 1HKMA 1SCMC 4MEWA 2M7LA 4DRKA 3KEVA 4ORAB 4HBOA 2LM5A 3ARRA 1YVLA 2DG4A 2Y5IA 1FKJA 1RROA 1O6IA 1EXRA 1SW8A 2MNTA 2PBCA 3VRNA 4CLNA 5KSZA 3RM4A 1ZBKA 1JFKA 1XFZO 1B7TY 1FW4A 2VN1A 1Q1CA 1IG5A 4Z2LA 1FJDA 1F40A 1CTNA 4U86A 4QJ5B 3PR9A 1UHJA 3I6CA 4W9OA 4G2PA 2H61A 3IQOA 1QVIY 4P8XA 4W5UA 1AHRA 1GQMA 4JFKA 3BYAA 3WL1A 1FAPA 2XP9A 2L4IA 1W7IB 4DCKA 2FAPA 1JSAA 1QPFA 3I5HC 1X6LA 1PINA 1W1YA 3GK2A 4YGEB 3EKJA 3TUYC 1SCVA 1XO5A 1DF0B 1FI5A 1DJZA 1HJVA 2MRDA 4DZ2A 5CSFA 1BF5A 4J4OA 2M7NA 5PALA 1KT1A 2G41A 1XFWO 2OPOA 1B8CA 4W9QA 4WKHA 2FJUB 3QRXA 1K94A 3TDIA 1OMVA 2K61A 1BL4A 3KACA 3KF9A 1KQMC 1SBJA 1ITXA 2ZQUA 4PALA 2I18A 3LK0A 1M45A 4PHMA 1SNLA 2M2AA 2BBMA 3CS1A 2XP8A 1NPQA 1UUSA 1AVSA 2DT0A 4R0XA 2ISDA 4DRIA 1D2KA 2JXCA 4ODMA 5DIUA 1DF0A 4R5EA 1NMVA 3SG7A 2PALA 1ROTA 1FKIA 1XYDA 1QJTA 2L4HA 2BBNA 1BMOA 1FPWA 2HQWA 1KFUL 1SL7A 3KADA 2B31A 1KT0A 2M08A 5HW7A 1CDLA 4BF8A 2JTTA 2MJWB 3CZTX 1MQ1A 1CFDA 3AS0A 1YUUA 1S6IA 4PHNA 1Q6IA 4J4NA 3JTDC 2MLXA 1MWNA 3UQIA 4MNMA 2PPOA 3DF0B 2XP3A 3CR2A 1PSRA 4WIWA 2SASA 1UR8A 3PN7C 3GK4X 3M0WA 3RMEA 1OSAA 4MVFA 3LUOA 3SG5A 4F0ZB 1L1PA 1GUVA 2MLZA 2KOTA 1NX0A 4HRHA 2G9BA 1EQ3A 3SG3A 4FAPA 4QIBA 1JF2A 1B7TZ 1Y0OA 1DJYA 5HLOA 3PFVA 1MR8A 2JC2A 2ZNDA 5B8IB 2KGBC 1NYAA 4ZCUA 1TIZA 2WCFA 2A3CA 2KQ6A 3WD4A 1KWOC 1OMDA 4CFRA 1F55A 1WDCB 4JYSA 3DF0A 5G08A 5I2OA 1R2UA 1WB0A 2Y4QA 1LL7A 1QVIZ 2LGOA 4TNSA 3FIAA 2EHBA 1WAWA 2DG3A 1F8HA 4HBEA 5DIVA 3NXAA 1PK0D 1J1DA 2RUQA 2K2AA 2LKNA 2KAVA 3NTPA 2K7DA 2LP2A 1PALA 3ARTA 3JYJA 1YUSA 3JVTC 1ZFSA 1E6RA 1G33A 1TNWA 1LL4A 3QOKA 1OWQA 1G4YR 4NDBA 5CSIA 5HWBA 1JUOA 1XK4A 3TZ1A 2JZIA 2M1KB 1NWDA 1FKSA 2DSZA 4CFQA 4JQ0D 1NP8A 3ARQA 2K0JA 4MZJA 1HKIA 3IKDA 3BUMB 1OE9B 2LUCA 3AKAA 2MPHA 3ALFA 1ZK6A 4WK9A 1SCMB 1E6ZA 3SIBA 1BJFA 2CXJA 2KDHA 2NCOA 1F4OA 1ODBA 1NWSA 3CR4X 1IWQA 2LVVA 2PV2A 4M2PA 4ZPWR 1OGBA 2L0PA 2LLUA 1GGZA 4ML4A 1P5QA 3WXAA 1W26A 5HW6A 2JXLA 4PTMA 4DROA 1SKTA 2RUCA 3NI6A 4JFMA 1BR4B 3D0YB 2KE0A 1H0IA 1QATA 1PSBA 1FKTA 2WC8A 2ZQTA 1FKKA 4UPGA 2HPSA 1ZBVA 1K90D 1NX1A 4ODQA 3PRAA 2H2KA 3CTNA 2FKEA 1FD9A 3WHUB 1A7XA 4A4BA 3B9DA 2UZ5A 2LPVA 3SG2A 4GPLB 4DWSA 3O5EA 1IQ5A 4IT6A 2DPEA 1D6OA 3I5HB 3O5LA 3WIJA 4MNLA 2CT9A 1UP5A 1QS7A 3AS3A 3TUYB 4XYNA 1J7RA 3HX4A 1W1TA 2L50A 4TW6A 1LJYA 1TCFA 2ZR4A 3RM9A 2JULA 3SJSA 3FXYA 2KFWA 3ARSA 2KHNA 1JF0A 4GGQA 1TNXA 3BXKA 2AUCA 1KQMB 2NLNA 3UI4A 1IX5A 2XP7A 1B47A 1UWOA 4MTVA 4L3NA 1AUIB 2SCPA 1K2HA 5DKRA 1RTP1 1KFXS 3GOFA 3KABA 1M46A 1KCYA 4G50A 1D7JA 3DD4A 4DIPA 5CSJA 1FFQA 4GFTA 3UQBA 2KI3A 3BUOB 4C0JA 2OS8C 2LVKA 3I5FB 4JWQA 4LGXA 2WNDA 1ALWA 1CLMA 4CPVA 5HUAA 2DT1A 3G6LA 2KI6D 3W4RA 1BOCA 2WK2A 1U5IA 1B8RA 4HRGA 1YUTA 3OX6A 3O6BA 3I5IC 4Q7NA 2FDMA 2BCAA 1EYMA 4MN0A 3EVVA 2XP6A 1TN4A 2CTNA 1ZB5A 1NSGA 5I98A 3RM1A 1A75A 1CNPA 1UR9A 1RWYA 4L72B 3WQVA 4DWSC 4Q22A 2ESCA 3CLNA 4HREE 3PRBA 4DH0A 2L5XB 2QACA 3AROA 3PA7A 1XVJA 2AMIA 1W1PA 1YURA 3B8SA 1C9HA 1SL9A 1NUBA 1YRTB 1CM4A 1EH2A 2M9GA 2F3YA 5HLVA 3VGOA 3FS7A 3WQWA 2DSWA 3B9EA 2WORA 3PN7B 1JNTA 2KYFA 2KI4C 3AAJA 1F70A 1ZCNA 4MAVA 1C7VA 4GGNA 1UURA 2PI6A 1QLSA 5HWCA 2LVJA 4AOMA 2G8ZA 1BLQA 3UQAA 2FCEA 2BKHB 1CMGA 1LKJA 1H8BA 4LAWA 5FYXA 3G6MA 5BXJA 1CTRA 4YGCB 4DRNA 2AOSA 1KWOB 1HJXA 1LINA 3IQQA 1W7JB 3DVEA 1E6PA 5GPRA 1YW5A 4IT4A 1R9HA 2ZR6A 1OQPA 2MA2A 1FI6A 2BE4A 1CFPA 2IF4A 3O5KA 1KK7Y 2BKIB 2KAYA 2M97A 2F2PA 5I2LA 3NSIA 3D10A 1JNEA 3OB2B 3O5JA 2Q91A 1LG1A 3CGMA 3CHEA 1BKFA 3JVTB 3BUNB 4AQIA 4MZLA 2JWWA 3BOWB 1ZUZA 1E15A 3JYMA 3SIAA 3ZWHA 3AS2A 1Y1XA 2M1IA 1S5GY 5AFPA 3VRQA 1IQ3A 3KO0A 2DOQA 4ODRA 3PRDA 2GGZA 3O5OA 4U84A 5JH8A 3O5PA 4ETOA 1KFXL 1FFRA 1K93D 2F21A 2FOTA 5ER4X 3JXVA 3ARVA 3B7XA 1MF8B 1W9UA 2ZN8A 3BOWA 3TC5A 1EG3A 1PVBA 2KBMA 2KFHA 2M29A 2KAXA 2JOJA 1MXLC 5K89A 2K7CA 1KSOA 1S1EA 1S6JA 1DJGA 1Q6HA 1F8AB 1SYMA 1DGVA 4P8VA 4QT3A 4N1GA 2MAZA 1RD6A 4M2OA 4DWSD 4PE4A 2G2BA 2AAOA 1AK8A 4IQ2A 3BUWB 1A2XA 3TDUA 1J1EA 1J4IA 4Z2HA 5HKGA 1E9LA 3TDBA 1FKGA 4TNCA 3ARPA 3WH0A 2LVIA 2Q4UA 4QT2A 4C0LA 4FN2A 3PM8A 4HARA 4IPXA 2PPNA 2I2RE 1CLLA 3NSLA 1UHIA 1J7QA 1FKHA 3CHDA 1TCOB 2L2SA 4D1EA 3BQ3A 1Q6UA 3RGCA 5DF0A 1JFJA 3AQUA 4P8UA 5DKQA 1ZACA 4MRYA 3MSEB 1F4QA 4QJ3B 1M31A 2KGJA 1LA3A 2LE9B 2EGDA 2KR7A 2VCDA 1Y1AA 1IKUA 5GPGA 1A4PA 4PE1A 2M49B 1DT7B 3FY1A 4ZCVA 2ZQSA 4ICBA 1XFUO 2OTGC 1AP4A 2D8NA 4DS7A 4KQZA 2JZVA 1H4BA 4YGAA 3O5RA 1C7WA 2I7AA 2WLZA 1X6NA 4TYOA 4ORBB 1NCZA 1FBVA 2ZNEA 4YRUA 1CB1A 2ZR5A 1K95A 1UHHA 2XPAA 1QV0A 4Z2KA 2OS8B 3EKHA 5CSNA 4I5KA 2DT2A 3LK1A 1FKRA 1J7OA 2LV7A 3I5GC 3WHTB 1NCYA 3MDYB 4O2TA 5HKYA 1B1GA 1TNQA 1NIWA 1RK9A 1ZMZA 2LMUA 2VRGA 4U8DA 5HW8A 3ODKA 1A03A 2NCPA 1OMRA 2MLEC 2A4JA 1L2OC 1S3PA 2QF8A 2PV1A 1WRLA 1S5GZ 2JQ6A 3DVKA 2N87A 1K9KA 1L7ZA 4I5NB 4I5LB 4CIDA 1DMOA 4TX0A 1LG2A 1EL4A 2E30A 2BECA 4MGVA 4DWSB 2LHIA 1YTZC 1HQVA 3KAIA 4AY1A 3GPKA 2LHLA 2F4EA 3LL8B 1KK8C 2IS9A 1NWRA 1K9UA 3KCEA 2ZN9A 1FKBA 5J3XA 1JNSA 1LA0A 2LAPA 3CWGA 2JTZA 3PSRA 5HT1A 3O5QA 2KI4B 4WJXA 3O5IA 4W9PA 3O5GA 2V53A 4DRMA 3E3RA 1W9PA 2BCBA 4PHKA 5D75A 1HJWA 4ORCB 1JVWA 3H9RB 3ARXA 1DJHA 1K9PA 1BODA 4MPKA 1QZ2A 1OZOA 1Q80A 2OLHA 1XHGA 1SR0A 5IBWA 2XP5A 3B9AA 4MZKA 1LQ0A 1IJ6A 1SYTA 1WRKA 2I94A 3AAKA 4FQOA 4U85A 4URIA 1DJXA 1D1OA 2DT3A 4Z2GA 4IQCA 2HQ8A 3TS5C 1GGWA 1DJWA 1C07A 1QASA 4WKFA 4IL1A 1N0YA 1U5IB 1DVIA 1S36A 1SK6D 2LMVA 2DG9A 1K9TA 3WD1A 2JNFA 1N2DA 2A3BA 1CKKA 4BY4A 4OR9B 3O5DA 2ZRSA 1N1AA 4ITZA 3O5MA 4P2YB 1EG4A 4GGFC 3OOBA 4DUQA 1A75B 2O9OA 4GUKA 4ODPA 3UI5A 1RECA 4ZPVR 3O2PA 2WCBA 2F3ZA 3LLEA 4USLA 2WCEA 4OKHA 1CDNA 1NX2A 1GJYA 3CGAA 2FCDA 1RJVA 2RSEA 2O60A 3CHFA 1B8LA 2BL0C 1K96A 1R6PA 2KYCA 3WL0A 1B6CA 2BCXA 1YR5A 4FTGA 3UF8A 1QV1A 1MHOA 4LAXA 4XJKB 2BE6A 3KZ7A 1XFVO 4LAVA 4DRQA 2AWGA 4WRIA 1HT9A 1X02A 2PPPA 4ZPTR 1DTLA 1IJ5A 2YBTA 2Y78A 1NWTA 1QIVA 1SL8A 3EK4A 2CCMA 1QPLA 1GOIA 1F71A 4Z2JA 1CM1A 2LNKA 3JTDB 1RFJA 4OCIA 1IH0A 2GV5A 4C02B 1J4RA 4MBEA 4XJKA 1TFVA 3CHCA 4DT4A 1YX7A 2MBXA 4YI8A 1W9VA 1J55A 1U79A 4MLWA 2NXQA 2EC6C 2Y1MA 5BPJA 3WKZA 2KSPA 2M0RA 1WLZA 2K7BA 5I2QA 1JWDA 1EHNA 4N1FA 4WQ3A 3NRKA 1QXPA 1VRKA 1HXVA 1MUXA 1YRUB 1KQVA 2F33A 2MLYA 5KTYA 4NDDA 4ODNA 3ARUA 1SR6C 1BT6A 2F2OA 1CFFA 5JJGA 2OTGB 3EY6A 4MNJA 4ODLA 4L9MA 2LUXA 5CPVA 2QPTA 2F8PA 5HKWA 4TW8A 2PV3A 3WD0A 1QIWA 4GAOA 2RGIA 2MHHA 3VROA 1SY9A 2XPBA 1KSMA 2P6BB 3LCPC 2KQYA 5KU1A 2KFGA 2O5GA 1G8IA 5AANA 1D7HA 1M39A 3GK1A 1D7IA 2RQSA 3IKGA 3I5GB 3RFWA 2KNEA 1F54A 1HKKA 4PE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDZ A;  1SW8 A;  2MNT A;  3DVM A;  2LPV A;  1CDP A;  2PBC A;  2OTG C;  2L98 A;  3SG2 A;  3VRN A;  4CLN A;  3I5F C;  4DZ3 A;  1AP4 A;  4GPL B;  5JOL A;  2D8N A;  4DS7 A;  1V1F A;  3O5E A;  5KSZ A;  5J6E A;  2JZV A;  1IQ5 A;  1H4B A;  1QX5 B;  4YGA A;  1XFX O;  3O5R A;  1C7W A;  3BUX B;  2I7A A;  1D6O A;  3I5H B;  3O5L A;  1JFK A;  1L2O B;  4TYO A;  4QJ4 B;  1YVH A;  4ORB B;  1XFZ O;  1NCZ A;  1UP5 A;  1B7T Y;  1FBV A;  1QS7 A;  2CT9 A;  2ZNE A;  3TUY B;  4XYN A;  1J7R A;  3HX4 A;  4YRU A;  1FW4 A;  2L50 A;  1CMF A;  2Y1N A;  1CB1 A;  2ZR5 A;  1K95 A;  1UHH A;  2PVB A;  2VN1 A;  1Q1C A;  2XPA A;  1IG5 A;  4TW6 A;  1FJD A;  1TCF A;  4OV2 A;  1F40 A;  2ZR4 A;  1QV0 A;  2OS8 B;  1IRJ A;  4U86 A;  2JUL A;  3SJS A;  2KFW A;  3EKH A;  4QJ5 B;  2H61 C;  1UHJ A;  4DRJ A;  3I6C A;  5CSN A;  4W9O A;  2JPT A;  2H61 A;  4I5K A;  3C1V A;  4G2P A;  1CDM A;  2KHN A;  1E8A A;  3IQO A;  3LK1 A;  1FKR A;  1QVI Y;  1J7O A;  1JF0 A;  2LV7 A;  1Y0V H;  3I5G C;  1PBK A;  3WHT B;  1NCY A;  1AJ5 A;  3MDY B;  4GGQ A;  1TNX A;  4MRX A;  5HKY A;  1A29 A;  3OB1 B;  4O2T A;  1KK8 B;  1AHR A;  1GQM A;  3BXK A;  1B1G A;  2RUR A;  4JFK A;  1TNQ A;  2AUC A;  1KQM B;  1NIW A;  1M63 B;  1RK9 A;  2LAN A;  1ZMZ A;  2NLN A;  2LMU A;  3FWC A;  3UI4 A;  2VRG A;  3BYA A;  4U8D A;  5HW8 A;  1FAP A;  2XP7 A;  4C0K A;  1B47 A;  1Y0O A;  2XP9 A;  3ODK A;  1UWO A;  2L4I A;  1A03 A;  2K8M B;  1EJ3 A;  1LVC D;  4WQ2 A;  1W7I B;  2ZFD A;  2ZRT A;  4DCK A;  2FAP A;  1AUI B;  1JSA A;  2NCP A;  2R2I A;  1QPF A;  3I5H C;  1OMR A;  2D9F A;  2MLE C;  1PIN A;  2A4J A;  1L2O C;  1S3P A;  2SCP A;  3GK2 A;  4P5O E;  5DKR A;  1K2H A;  2PV1 A;  1RTP 1;  1WRL A;  1S5G Z;  1KFX S;  1AJ4 A;  3GOF A;  2JQ6 A;  3DVK A;  5HYD A;  2N87 A;  3KAB A;  1K9K A;  1L7Z A;  4I5N B;  1M46 A;  3EKJ A;  4YGE B;  1KCY A;  4I5L B;  4CID A;  3TUY C;  1UHN A;  1DMO A;  1D7J A;  4G50 A;  4TX0 A;  1EL4 A;  1SCV A;  3DD4 A;  1XO5 A;  2E30 A;  4DIP A;  5CSJ A;  1DF0 B;  1B9A A;  1FI5 A;  2BEC A;  4GFT A;  1DJZ A;  4YI9 A;  3NSO A;  2MRD A;  2CBL A;  2M1U A;  2KI3 A;  3UQB A;  3BUO B;  4DZ2 A;  4JPZ B;  4C0J A;  5CSF A;  4YGD B;  4MGV A;  2OS8 C;  2LVK A;  3I5F B;  4JWQ A;  1BF5 A;  2RUD A;  4J4O A;  2M7N A;  5D69 A;  5PAL A;  2LHI A;  1YTZ C;  1KT1 A;  1HQV A;  3TCZ A;  2WND A;  1XFW O;  3KAI A;  1ALW A;  1CLM A;  3K21 A;  4GBA A;  4PCW A;  4CPV A;  5HUA A;  2OPO A;  4MSP A;  1B8C A;  5TNC A;  3GPK A;  4W9Q A;  2KI6 D;  2LHL A;  1YAT A;  1BOC A;  3EVU A;  2FJU B;  3QRX A;  1K94 A;  3TDI A;  2F4E A;  4PE0 A;  2K61 A;  3LL8 B;  1BL4 A;  1KK8 C;  3KAC A;  1U5I A;  2PSR A;  3KF9 A;  3WNX B;  1KQM C;  1SBJ A;  3FAP A;  2ITK A;  1B8R A;  2I18 A;  2LMT A;  4HRG A;  4OVN F;  4PAL A;  1YUT A;  2ZQU A;  3OX6 A;  3O6B A;  3A4U B;  2IS9 A;  3LK0 A;  1M45 A;  4PHM A;  1SNL A;  3I5I C;  2M2A A;  5F6T A;  1K9U A;  2BBM A;  2BCA A;  1FKL A;  3KCE A;  2ZN9 A;  1FKB A;  1EYM A;  3CS1 A;  5J3X A;  2XP8 A;  1NPQ A;  1JNS A;  1LA0 A;  2LAP A;  3CWG A;  1UUS A;  2JNX A;  1AVS A;  2JTZ A;  3PSR A;  4MN0 A;  1J4H A;  3TS5 B;  5HT1 A;  4HSZ A;  3O5Q A;  2KI4 B;  1SPY A;  3EVV A;  1PRW A;  3VRR A;  2XP6 A;  4YGB B;  1N65 A;  1TN4 A;  2CTN A;  3O5I A;  4R0X A;  1JC2 A;  2ISD A;  1NSG A;  4W9P A;  5I98 A;  3O5G A;  2V53 A;  4DRI A;  4A4C A;  3RM1 A;  3PLF B;  2JXC A;  1A75 A;  1CNP A;  3E3R A;  2PRU A;  4ODM A;  4DRM A;  2NZ0 A;  5DIU A;  1DF0 A;  3O78 A;  1QTX A;  1RWY A;  2BCB A;  1FF1 A;  1NMV A;  4PHK A;  2JT0 A;  5D75 A;  1NSH A;  1Y6W A;  3SG7 A;  5DIT A;  3CLN A;  4ORC B;  1JVW A;  3H9R B;  2PAL A;  1ROT A;  1IGV A;  4HRE E;  3PRB A;  4DH0 A;  1FKI A;  3OP0 A;  2JT3 A;  2L5X B;  2QAC A;  3PA7 A;  1DJH A;  1K9P A;  1BOD A;  1XYD A;  1QJT A;  2L4H A;  1XVJ A;  1QZ2 A;  2BBN A;  2LJ4 A;  2K7O A;  1OZO A;  1BMO A;  2AMI A;  1Q80 A;  1YUR A;  1C9H A;  2KO7 A;  1OZS A;  1SL9 A;  1FPW A;  2HQW A;  1KFU L;  1NUB A;  1YRT B;  5IBW A;  1SL7 A;  2XP5 A;  1CM4 A;  3EVR A;  1EH2 A;  4MZK A;  4ODK A;  1KK7 Z;  2M9G A;  1IJ6 A;  2F3Y A;  1WRK A;  5HLV A;  3TDZ A;  3VGO A;  3KAD A;  2I94 A;  1TOP A;  1DJI A;  3AAK A;  1KT0 A;  3FS7 A;  4FQO A;  4DRW A;  4M2Q A;  4U85 A;  2LC5 A;  1DJX A;  1D1O A;  1NCX A;  2WOR A;  3PN7 B;  1JNT A;  2M08 A;  4IQC A;  2HQ8 A;  3TS5 C;  1GGW A;  1DJW A;  2KYF A;  1NX3 A;  2KI4 C;  5AEQ A;  3CGN A;  2ZQV A;  1C07 A;  1QAS A;  3AAJ A;  5HW7 A;  4IL1 A;  1F70 A;  1N0Y A;  2K2F A;  1ZCN A;  2MLF C;  3FWB A;  1C7V A;  1CDL A;  4BF8 A;  1U5I B;  4GGN A;  2KI6 C;  1UHK A;  1YX8 A;  2COL B;  2JTT A;  1DVI A;  1S36 A;  1SK6 D;  2MJW B;  1UUR A;  1QLS A;  3RFW A;  2LMV A;  3KPX A;  5HWC A;  2LVJ A;  3RLZ A;  3CZT X;  4NQG A;  2DG9 A;  2BL0 B;  4AOM A;  1MQ1 A;  3I5I B;  1BLQ A;  2LLS A;  2FCE A;  2BKH B;  4GNK B;  1CFD A;  2JNF A;  1N2D A;  1CMG A;  1CLB A;  3UQA A;  1LKJ A;  1FKF A;  1YUU A;  1H8B A;  4BY5 A;  1CKK A;  4BY4 A;  3F45 A;  2M8U A;  4LAW A;  1S6C A;  1S6I A;  4OR9 B;  3O5D A;  5FYX A;  2ZRS A;  1N1A A;  4PHN A;  4ITZ A;  3O5M A;  4P2Y B;  1Q6I A;  5BXJ A;  4J4N A;  2CNP A;  2K8I A;  3JTD C;  1CTR A;  1QLK A;  1EG4 A;  2MLX A;  1MWN A;  4GGF C;  4YGC B;  2F2D A;  3OOB A;  2HF5 A;  3UQI A;  4DUQ A;  1A75 B;  2WOS A;  1KWO B;  4DRN A;  1LIN A;  4GGF A;  4GUK A;  3IQQ A;  1BU3 A;  1W7J B;  3DF0 B;  2PPO A;  4ODP A;  4PHJ A;  2XP3 A;  3UI5 A;  1DGU A;  3AKB A;  1REC A;  3DVE A;  4GIV A;  1YW5 A;  3CR2 A;  5HTG A;  1PSR A;  3O2P A;  1R9H A;  2WCB A;  2SAS A;  2ZR6 A;  2F3Z A;  1OQP A;  5AXI A;  2MA2 A;  1FI6 A;  2L2E A;  2BE4 A;  3PN7 C;  1CFP A;  3GK4 X;  2IF4 A;  2B1U A;  3O5K A;  4ODO A;  1KK7 Y;  4TW7 A;  2BKI B;  3LLE A;  2KAY A;  3SG4 A;  4USL A;  1ALV A;  1CFC A;  3M0W A;  1OSA A;  2WCE A;  1NMW A;  4OKH A;  4AQJ A;  3KAF A;  1CDN A;  1NX2 A;  4MVF A;  1GJY A;  3CGA A;  2M97 A;  4R1E A;  2F2P A;  2FCD A;  5I2L A;  1RJV A;  3NSI A;  3D10 A;  2RSE A;  3LUO A;  2O60 A;  3SG5 A;  3OB2 B;  2JU0 A;  2LCP A;  4Q04 A;  3O5J A;  4F0Z B;  1L1P A;  2Q91 A;  1B8L A;  2MLZ A;  2BL0 C;  1K96 A;  1LXF C;  1R6P A;  2KOT A;  1SRA A;  1NX0 A;  2KYC A;  3O4Y A;  4HRH A;  1B6C A;  2G9B A;  3CGM A;  2BCX A;  2ZKM X;  1BKF A;  1YR5 A;  3SG3 A;  4FAP A;  1SMG A;  4FTG A;  1V1G A;  3JVT B;  2XP4 A;  4QIB A;  3IF7 A;  3UF8 A;  3BUN B;  1BG1 A;  1JF2 A;  3KHE A;  1QV1 A;  1B7T Z;  1DJY A;  4AQI A;  1WRZ A;  4MZL A;  1MHO A;  3PFV A;  1MR8 A;  5HLO A;  2JC2 A;  2ZND A;  1FKD A;  2JWW A;  4LAX A;  5B8I B;  4XJK B;  2BE6 A;  3KZ7 A;  1XFV O;  3BOW B;  1ZUZ A;  3JYM A;  1WY9 A;  2KGB C;  3SIA A;  3ZWH A;  4LAV A;  1NYA A;  3NSK A;  4DRQ A;  4ZCU A;  1Y1X A;  2AWG A;  1TIZ A;  2WCF A;  2KGR A;  4WRI A;  2KQ6 A;  2M1I A;  1KWO C;  4DRH A;  1HT9 A;  1X02 A;  1OMD A;  2PPP A;  4CFR A;  1DTL A;  1S5G Y;  5AFP A;  1F55 A;  1WDC B;  4JYS A;  3VRQ A;  4JFJ A;  3DF0 A;  3DVJ A;  1IJ5 A;  5G08 A;  5I2O A;  1IQ3 A;  2Y78 A;  2KFF A;  1R2U A;  1J6Y A;  2Y4Q A;  1QVI Z;  3KO0 A;  1QIV A;  2LGO A;  4TNS A;  2EC6 B;  2DOQ A;  1SL8 A;  3FIA A;  2PAS A;  2EHB A;  4N5X A;  2KBI A;  3EK4 A;  2CCM A;  4ODR A;  1JBA A;  2DG3 A;  1QPL A;  3A8R A;  1F71 A;  1F8H A;  5DIV A;  3NXA A;  3PRD A;  2Q5A A;  1CM1 A;  1PK0 D;  1J1D A;  2RUQ A;  2K2A A;  2LNK A;  2LKN A;  2GGZ A;  3UI6 A;  3O5O A;  3JTD B;  3HCM A;  2KAV A;  4U84 A;  1RFJ A;  3O5P A;  4OCI A;  4LAY A;  1IH0 A;  4ETO A;  2K7D A;  3NTP A;  1KFX L;  2LP2 A;  1PAL A;  2GV5 A;  4DRP A;  5ER5 A;  3JYJ A;  1K93 D;  1Y1U A;  1YUS A;  2F21 A;  3JVT C;  2FOT A;  5ER4 X;  1OOJ A;  1ZFS A;  3JXV A;  1TCO C;  4I5J A;  4C02 B;  1J4R A;  4MBE A;  3B7X A;  1G33 A;  1TNW A;  5B8I C;  1MF8 B;  2ZN8 A;  2MF9 A;  3IK8 A;  4XJK A;  3BOW A;  3KAH A;  3TC5 A;  4N19 A;  4DT4 A;  1EG3 A;  1PVB A;  1SR6 B;  1YX7 A;  2KBM A;  2KFH A;  2LP3 A;  2M29 A;  3VRP A;  1G4Y R;  2MBX A;  2KAX A;  2JOJ A;  4YI8 A;  1MXE A;  4NDB A;  4PE7 A;  3IHZ A;  5CSI A;  5HWB A;  1MXL C;  3D0Y A;  5K89 A;  1WDC C;  3OX5 A;  1JUO A;  1J55 A;  3ICB A;  1XK4 C;  2K7C A;  1KSO A;  1S1E A;  1U79 A;  4MLW A;  1S6J A;  4DIR A;  1DJG A;  1Q6H A;  1XK4 A;  5GQQ C;  3TZ1 A;  3PAT A;  2NXQ A;  1BR1 B;  2JZI A;  1PUL A;  2EC6 C;  2M1K B;  4E68 A;  1F8A B;  3VAW A;  2Y1M A;  5BPJ A;  1NWD A;  1FKS A;  1SYM A;  1DGV A;  2E6W A;  2KSP A;  3EK8 A;  4JQ0 D;  4CFQ A;  2M0R A;  1T11 A;  4QT3 A;  1NP8 A;  3SG6 A;  4N1G A;  4NDC A;  2MAZ A;  1WLZ A;  2K7B A;  5I2Q A;  5HKZ A;  1JWD A;  1TTX A;  2K0J A;  4M2O A;  4YBH B;  1ROU A;  4MZJ A;  4N1F A;  3H4S E;  4PE4 A;  2G2B A;  2AAO A;  3IKD A;  3BUM B;  1K8U A;  1OE9 B;  4WQ3 A;  1AK8 A;  4IQ2 A;  2LUC A;  3BUW B;  3NRK A;  3AKA A;  1A2X A;  1QXP A;  1QX7 A;  5AER A;  1J7P A;  2TN4 A;  2MPH A;  3TDU A;  1J1E A;  1TNP A;  1J4I A;  1VRK A;  5HKG A;  1ZK6 A;  1HXV A;  1MUX A;  3CR5 X;  3O5F A;  1YRU B;  2JT8 A;  1KQV A;  3TDB A;  1SCM B;  1EQ3 A;  1ZOT B;  4JFL A;  2F33 A;  3SIB A;  1BJF A;  2CXJ A;  3ZNI A;  5KTY A;  1FKG A;  2MLY A;  4TNC A;  2KDH A;  3WH0 A;  2NCO A;  2M3W A;  1KFU S;  1F4O A;  1ODB A;  4NDD A;  4ODN A;  2PMY A;  4NNR A;  2LVI A;  1SR6 C;  1BT6 A;  2Q4U A;  1WLM A;  4QT2 A;  2GGM A;  3CR4 X;  1IWQ A;  2LVV A;  4C0L A;  4FN2 A;  2F2O A;  2PV2 A;  3PM8 A;  4M2P A;  4IPX A;  2PPN A;  2L0P A;  1CFF A;  5JJG A;  2OTG B;  3PAL A;  3EY6 A;  1M5Y A;  2LLU A;  2I2R E;  1CLL A;  2L51 A;  3KAG A;  1GGZ A;  3NSL A;  4L9M A;  5I8N A;  2OFN A;  4ODL A;  5D7F A;  1UHI A;  1XFY O;  1J7Q A;  1P5Q A;  1FKH A;  2HET A;  2LUX A;  1QX2 A;  3WXA A;  1W26 A;  5CPV A;  1TCO B;  1XA5 A;  2JXL A;  2QPT A;  5DKN A;  5HW6 A;  2L2S A;  4D1E A;  2JRF A;  3EK7 A;  4DRO A;  2LLT A;  2F8P A;  5HKW A;  3BQ3 A;  4TW8 A;  1S26 D;  1SKT A;  1TRF A;  3OHM B;  1Q6U A;  2PV3 A;  2RUC A;  3NI6 A;  4JFI A;  3RGC A;  1QIW A;  1JFJ A;  1B4C A;  4GAO A;  2RGI A;  4JFM A;  1BR4 B;  5DKQ A;  2MHH A;  1ZAC A;  4MRY A;  3D0Y B;  3MSE B;  3VRO A;  2KE0 A;  1F4Q A;  4QJ3 B;  1PVA A;  1SY9 A;  1M31 A;  1PSB A;  1QAT A;  2XPB A;  1KSM A;  2P6B B;  1FKT A;  2KGJ A;  2WC8 A;  1LA3 A;  2ZQT A;  3LCP C;  2KQY A;  1SCM C;  2LE9 B;  1FKK A;  4UPG A;  4MEW A;  2M7L A;  5KU1 A;  4DRK A;  2HPS A;  2KFG A;  2EGD A;  2O5G A;  2KR7 A;  1Y1A A;  1K90 D;  1G8I A;  1NX1 A;  3KEV A;  4ORA B;  1IKU A;  2VCD A;  2LM5 A;  1A4P A;  4PE1 A;  5AAN A;  4ODQ A;  5GPG A;  1D7H A;  2M49 B;  1M39 A;  1DT7 B;  2H2K A;  3GK1 A;  1YVL A;  4ZCV A;  1D7I A;  2Y5I A;  2DG4 A;  3CTN A;  2FKE A;  2RQS A;  3I5G B;  2ZQS A;  3IKG A;  1FD9 A;  1FKJ A;  3WHU B;  1RRO A;  4ICB A;  4A4B A;  1XFU O;  2KNE A;  1F54 A;  1A7X A;  1OMV A;  1EXR A;  2UZ5 A; 
#chains in the Genus database with same CATH topology
 4PDZ A;  3DVM A;  1CDP A;  1ZBC A;  2L98 A;  3I5F C;  4DZ3 A;  1Z4H A;  5JOL A;  1V1F A;  5J6E A;  1QX5 B;  3ARW A;  1XFX O;  3BUX B;  1L2O B;  4QJ4 B;  4Z2I A;  4MNK A;  1YVH A;  3NHI A;  1CMF A;  2Y1N A;  4S3J A;  2PVB A;  5DEZ A;  4OV2 A;  1IRJ A;  1WNO A;  2H61 C;  4DRJ A;  2JPT A;  3C1V A;  1CDM A;  1E8A A;  1PBK A;  1Y0V H;  3D76 A;  1AJ5 A;  1E6N A;  4MRX A;  1A29 A;  3OB1 B;  1KK8 B;  2RUR A;  2LAN A;  1M63 B;  2A3E A;  3FWC A;  4P8W A;  3ARZ A;  4C0K A;  2WM0 A;  2K8M B;  1EJ3 A;  1LVC D;  4WQ2 A;  2ZFD A;  2ZRT A;  2R2I A;  2D9F A;  4ZS6 A;  4P5O E;  1AJ4 A;  5HYD A;  1UHN A;  1B9A A;  4KR0 B;  4YI9 A;  3NSO A;  1JCH B;  2CBL A;  2M1U A;  2WLY A;  4JPZ B;  4YGD B;  1HKJ A;  2RUD A;  5D69 A;  1JND A;  3TCZ A;  1ZBW A;  2P71 A;  4GBA A;  3K21 A;  4PCW A;  3CH9 A;  4MSP A;  5TNC A;  2DSV A;  1YAT A;  3EVU A;  1XRV A;  2PSR A;  3WNX B;  3FAP A;  2ITK A;  2LMT A;  4OVN F;  1NH6 A;  3A4U B;  2WCK A;  3ARY A;  5F6T A;  1FKL A;  2JNX A;  1J4H A;  3TS5 B;  4HSZ A;  3VRR A;  1SPY A;  1PRW A;  4YGB B;  1N65 A;  2QEH A;  1JC2 A;  4A4C A;  3PLF B;  2PRU A;  2NZ0 A;  3O78 A;  1QTX A;  1FF1 A;  2JT0 A;  1NSH A;  1Y6W A;  5DIT A;  1IGV A;  5GQB A;  3OP0 A;  2JT3 A;  2LJ4 A;  2K7O A;  1LL6 A;  2KO7 A;  1OZS A;  3EVR A;  3BXW A;  4ODK A;  1KK7 Z;  3TDZ A;  3RM8 A;  1TOP A;  1DJI A;  4DRW A;  4S3K A;  4M2Q A;  2LC5 A;  3DXL A;  1NCX A;  1TWO A;  3FE9 A;  1KFW A;  5AEQ A;  1NX3 A;  3CGN A;  2ZQV A;  2KLE A;  2K2F A;  2MLF C;  3FWB A;  2KI6 C;  1UHK A;  1YX8 A;  2COL B;  3KPX A;  3RLZ A;  4NQG A;  2BL0 B;  3I5I B;  2LLS A;  4GNK B;  1CLB A;  1FKF A;  2H8V A;  4BY5 A;  3F45 A;  2M8U A;  1H0G A;  1S6C A;  1OW4 A;  2KLD A;  2CNP A;  2K8I A;  1QLK A;  2F2D A;  2HF5 A;  2WOS A;  3WD3 A;  4GGF A;  4WKA A;  1W1V A;  1BU3 A;  4PHJ A;  1DGU A;  3AKB A;  4GIV A;  5HTG A;  3OA5 A;  4QZV B;  5AXI A;  2L2E A;  2B1U A;  1LS8 A;  4ODO A;  4TW7 A;  1CFC A;  3SG4 A;  1GPF A;  1ALV A;  1TUJ A;  1NMW A;  1NWU A;  4AQJ A;  3KAF A;  4R1E A;  2JU0 A;  2LCP A;  4Q04 A;  5EL2 A;  1LXF C;  3O4Y A;  1SRA A;  3ALG A;  2ZKM X;  1SMG A;  1V1G A;  2XP4 A;  3IF7 A;  1BG1 A;  4NZC A;  3KHE A;  1WRZ A;  1FKD A;  1WY9 A;  3NSK A;  4INW A;  2KGR A;  4XAK A;  4DRH A;  4JFJ A;  3DVJ A;  2KFF A;  1J6Y A;  3D77 A;  2PN0 A;  2EC6 B;  2O92 A;  2A3A A;  2PAS A;  4N5X A;  2KBI A;  1JBA A;  1EDQ A;  3A8R A;  2Q5A A;  3UNW A;  3UI6 A;  3HCM A;  1OOH A;  4LAY A;  3CYZ A;  4DRP A;  5ER5 A;  1Y1U A;  1OOJ A;  1TCO C;  4I5J A;  5B8I C;  2YBU A;  2MF9 A;  3IK8 A;  3KAH A;  3S0D A;  1TUZ A;  4N19 A;  1SR6 B;  2LP3 A;  3VRP A;  3IHZ A;  1MXE A;  4PE7 A;  3D0Y A;  1EIB A;  1WDC C;  3OX5 A;  3WD2 A;  3ICB A;  1XK4 C;  4DIR A;  1ZU8 A;  2WC6 A;  5GQQ C;  3PAT A;  1BR1 B;  1PUL A;  4E68 A;  3VAW A;  1IIO A;  2E6W A;  5I94 A;  1T11 A;  3EK8 A;  3SG6 A;  4NDC A;  5HKZ A;  1TTX A;  4YBH B;  1ROU A;  5DO2 A;  3H4S E;  1K8U A;  1QX7 A;  5AER A;  1J7P A;  2TN4 A;  1TNP A;  1OGG A;  1ZL1 A;  3SS5 A;  3O5F A;  3CR5 X;  2JT8 A;  1VF8 A;  1ZOT B;  2DSU A;  4JFL A;  4OZD A;  3ZNI A;  3CZ8 A;  2M3W A;  1KFU S;  3AS1 A;  2PMY A;  4NNR A;  1WLM A;  2GGM A;  5HBF A;  3PAL A;  1M5Y A;  2IUZ A;  2L51 A;  3KAG A;  2OFN A;  5I8N A;  5D7F A;  1XFY O;  2HET A;  1QX2 A;  1XA5 A;  5DKN A;  2JRF A;  3EK7 A;  2LLT A;  1S26 D;  1TRF A;  4NSB A;  3OHM B;  4JFI A;  1B4C A;  1DQE A;  2GTE A;  1PVA A;  1P28 A;  1HKM A;  1SCM C;  4MEW A;  2QDI A;  2M7L A;  2EUL A;  4DRK A;  3KEV A;  4ORA B;  4HBO A;  2LM5 A;  3ARR A;  3S0A A;  1YVL A;  2DG4 A;  2Y5I A;  1FKJ A;  1RRO A;  4F7F A;  1O6I A;  1EXR A;  1SW8 A;  2MNT A;  4IJ7 A;  2PBC A;  3VRN A;  4CLN A;  2L5Y A;  5KSZ A;  3RM4 A;  1ZBK A;  1JFK A;  1XFZ O;  1B7T Y;  1FW4 A;  2VN1 A;  1Q1C A;  1IG5 A;  3S0E A;  4Z2L A;  1FJD A;  1F40 A;  1CTN A;  4U86 A;  4QJ5 B;  3PR9 A;  1UHJ A;  3I6C A;  4W9O A;  4G2P A;  2H61 A;  2JPO A;  3IQO A;  1QVI Y;  4P8X A;  4W5U A;  1AHR A;  1GQM A;  4JFK A;  2P70 A;  3BYA A;  3WL1 A;  1FAP A;  3RZS A;  2XP9 A;  2L4I A;  5D3O A;  1W7I B;  4DCK A;  2FAP A;  1JSA A;  1QPF A;  3I5H C;  1X6L A;  1PIN A;  1W1Y A;  3GK2 A;  3GU0 A;  4YGE B;  3EKJ A;  3TUY C;  1SCV A;  1XO5 A;  1DF0 B;  1FI5 A;  1DJZ A;  1HJV A;  2MRD A;  4DZ2 A;  5CSF A;  1BF5 A;  4J4O A;  2M7N A;  5PAL A;  2WCH A;  1KT1 A;  3CZ0 A;  2G41 A;  1XFW O;  2OPO A;  1B8C A;  4W9Q A;  4WKH A;  2FJU B;  3QRX A;  1K94 A;  3TDI A;  1OMV A;  2K61 A;  1BL4 A;  3KAC A;  3KF9 A;  1KQM C;  1SBJ A;  1ITX A;  2ZQU A;  4PAL A;  2I18 A;  4JD9 A;  3LK0 A;  1M45 A;  4PHM A;  1SNL A;  2M2A A;  2BBM A;  3CS1 A;  2XP8 A;  1NPQ A;  1UUS A;  1AVS A;  2L2C A;  2DT0 A;  4R0X A;  2ISD A;  4DRI A;  1D2K A;  2JXC A;  4ODM A;  5DIU A;  1DF0 A;  4R5E A;  1NMV A;  3L4L A;  3SG7 A;  3D75 A;  2PAL A;  1ROT A;  1FKI A;  1XYD A;  1QJT A;  2L4H A;  2BBN A;  4UDM A;  1BMO A;  1FPW A;  2HQW A;  1KFU L;  3Q8I A;  1SL7 A;  3KAD A;  2B31 A;  1KT0 A;  3OBV A;  2M08 A;  5HW7 A;  1CDL A;  4BF8 A;  2JTT A;  2MJW B;  3CZT X;  3L47 A;  1MQ1 A;  1CFD A;  3AS0 A;  1YUU A;  3N7H A;  1S6I A;  4PHN A;  1Q6I A;  4J4N A;  3JTD C;  2MLX A;  1MWN A;  3UQI A;  4MNM A;  2PPO A;  3DF0 B;  2XP3 A;  3CR2 A;  1PSR A;  4WIW A;  2SAS A;  1UR8 A;  3PN7 C;  3GK4 X;  3M0W A;  3RME A;  2YGU A;  1OSA A;  4MVF A;  3EG5 B;  5DIC A;  3LUO A;  3SG5 A;  4F0Z B;  1L1P A;  1GUV A;  2MLZ A;  2KOT A;  1NX0 A;  4HRH A;  2G9B A;  1OOF A;  1EQ3 A;  3SG3 A;  4FAP A;  4QIB A;  1JF2 A;  1B7T Z;  1Y0O A;  1DJY A;  5HLO A;  3PFV A;  1MR8 A;  2JC2 A;  2ZND A;  5B8I B;  2KGB C;  1NYA A;  3DYE A;  4ZCU A;  1TIZ A;  2WCF A;  2A3C A;  2KQ6 A;  3WD4 A;  1KWO C;  1OMD A;  3S0G A;  4CFR A;  1F55 A;  1WDC B;  4JYS A;  3DF0 A;  5G08 A;  5I2O A;  1R2U A;  1WB0 A;  2Y4Q A;  1LL7 A;  1QVI Z;  2LGO A;  4TNS A;  3FIA A;  2EHB A;  1WAW A;  2DG3 A;  1W9Z A;  1F8H A;  4HBE A;  5DIV A;  3NXA A;  1PK0 D;  1J1D A;  2RUQ A;  2K2A A;  2LKN A;  2KAV A;  3NTP A;  2K7D A;  2LP2 A;  1PAL A;  3ART A;  3JYJ A;  1YUS A;  3JVT C;  1GRJ A;  1ZFS A;  1E6R A;  1G33 A;  1TNW A;  1LL4 A;  3QOK A;  1OWQ A;  1G4Y R;  4NDB A;  5CSI A;  5HWB A;  3PM2 A;  1JUO A;  1XK4 A;  3TZ1 A;  2JZI A;  2M1K B;  1NWD A;  1FKS A;  2DSZ A;  4CFQ A;  4JQ0 D;  1NP8 A;  3ARQ A;  2K0J A;  4MZJ A;  1HKI A;  3IKD A;  3BUM B;  1OE9 B;  2LUC A;  3AKA A;  3QME A;  2MPH A;  3ALF A;  3CAB A;  1ZK6 A;  4WK9 A;  1SCM B;  1E6Z A;  3SIB A;  1BJF A;  2CXJ A;  2KDH A;  2NCO A;  1F4O A;  1ODB A;  1NWS A;  3B87 A;  3CR4 X;  1IWQ A;  2LVV A;  3GTY X;  2PV2 A;  4M2P A;  4ZPW R;  1OGB A;  2L0P A;  2LLU A;  1GGZ A;  4ML4 A;  1P5Q A;  3WXA A;  1W26 A;  5HW6 A;  2JXL A;  4PTM A;  4DRO A;  1SKT A;  2RUC A;  3NI6 A;  4JFM A;  1BR4 B;  3VB1 A;  3B6X A;  3D0Y B;  2KE0 A;  1H0I A;  1QAT A;  1C3Z A;  1PSB A;  1FKT A;  2WC8 A;  3FE6 A;  2ZQT A;  1FKK A;  4UPG A;  2HPS A;  1ZBV A;  1K90 D;  1NX1 A;  4ODQ A;  2H2K A;  3PRA A;  3CTN A;  2FKE A;  1FD9 A;  3WHU B;  1A7X A;  4A4B A;  3B9D A;  2UZ5 A;  2QEV A;  2LPV A;  3SG2 A;  3K1E A;  4GPL B;  4DWS A;  3O5E A;  1IQ5 A;  4IT6 A;  2DPE A;  1D6O A;  3I5H B;  3O5L A;  3WIJ A;  4MNL A;  3FE8 A;  2CT9 A;  1UP5 A;  1QS7 A;  3AS3 A;  3TUY B;  4XYN A;  1J7R A;  3HX4 A;  1W1T A;  2L50 A;  3O4X A;  4TW6 A;  1LJY A;  1TCF A;  2ZR4 A;  3RM9 A;  2JUL A;  3SJS A;  3FXY A;  2KFW A;  3ARS A;  2KHN A;  2PYQ A;  1JF0 A;  4GGQ A;  1TNX A;  3BXK A;  2AUC A;  1KQM B;  2NLN A;  2WCJ A;  3UI4 A;  1IX5 A;  2XP7 A;  1B47 A;  1UWO A;  4MTV A;  4L3N A;  1AUI B;  2B5U B;  2SCP A;  1K2H A;  5DKR A;  1RTP 1;  1KFX S;  3GOF A;  3KAB A;  1M46 A;  1KCY A;  4G50 A;  1D7J A;  3DD4 A;  4DIP A;  5CSJ A;  1FFQ A;  4GFT A;  1T14 A;  3UQB A;  2KI3 A;  3BUO B;  4C0J A;  2OS8 C;  2LVK A;  3I5F B;  4JWQ A;  4LGX A;  2WND A;  1ALW A;  1CLM A;  4CPV A;  5HUA A;  2DT1 A;  3G6L A;  2KI6 D;  3W4R A;  1BOC A;  2WK2 A;  1U5I A;  5FI7 A;  1B8R A;  4HRG A;  3BFB A;  1YUT A;  3OX6 A;  3O6B A;  3I5I C;  4Q7N A;  2FDM A;  2BCA A;  1EYM A;  4MN0 A;  3EVV A;  2XP6 A;  1TN4 A;  2CTN A;  1ZB5 A;  1NSG A;  5I98 A;  3BFA A;  3RM1 A;  1A75 A;  1CNP A;  1UR9 A;  1RWY A;  4L72 B;  3WQV A;  4DWS C;  4Q22 A;  2ESC A;  3CLN A;  4HRE E;  3PRB A;  2FJY A;  4DH0 A;  2L5X B;  2QAC A;  3ARO A;  3PA7 A;  3B86 A;  1XVJ A;  3SS3 A;  2AMI A;  1W1P A;  1YUR A;  3B8S A;  1C9H A;  1SL9 A;  1NUB A;  1YRT B;  1CM4 A;  1EH2 A;  2M9G A;  2F3Y A;  5HLV A;  3VGO A;  3FS7 A;  3WQW A;  2DSW A;  3B9E A;  2WOR A;  3PN7 B;  1JNT A;  2KYF A;  2KI4 C;  3AAJ A;  1F70 A;  1ZCN A;  4MAV A;  1C7V A;  5FI6 A;  4GGN A;  1DEK A;  1UUR A;  2PI6 A;  1QLS A;  5HWC A;  2LVJ A;  4AOM A;  2G8Z A;  1BLQ A;  3UQA A;  2FCE A;  2BKH B;  1CMG A;  1LKJ A;  1H8B A;  4LAW A;  5FYX A;  3G6M A;  5BXJ A;  1CTR A;  4YGC B;  4DRN A;  2AOS A;  1KWO B;  5HL1 A;  1HJX A;  3EIP A;  1LIN A;  1QWV A;  1W7J B;  3IQQ A;  3DVE A;  1E6P A;  5GPR A;  1YW5 A;  4IT4 A;  1R9H A;  2ZR6 A;  1OQP A;  2MA2 A;  1FI6 A;  2BE4 A;  1CFP A;  2IF4 A;  3O5K A;  1KK7 Y;  2BKI B;  2KAY A;  1DEL A;  4KYN A;  2M97 A;  2F2P A;  5I2L A;  3NSI A;  3D10 A;  1JNE A;  3OB2 B;  3O5J A;  2Q91 A;  1LG1 A;  3CGM A;  3CHE A;  1BKF A;  3JVT B;  3BUN B;  4AQI A;  4MZL A;  2JWW A;  3BOW B;  1ZUZ A;  1E15 A;  3JYM A;  3SIA A;  3ZWH A;  3AS2 A;  1Y1X A;  2M1I A;  1S5G Y;  5AFP A;  3VRQ A;  3S0B A;  1IQ3 A;  3KO0 A;  2DOQ A;  2QEO A;  4ODR A;  3PRD A;  2GGZ A;  3O5O A;  4U84 A;  5JH8 A;  3O5P A;  4ETO A;  1KFX L;  1FFR A;  1K93 D;  2F21 A;  2FOT A;  5ER4 X;  3JXV A;  3ARV A;  3B7X A;  1MF8 B;  1W9U A;  2ZN8 A;  3UO9 A;  3BOW A;  3TC5 A;  1EG3 A;  1PVB A;  2KBM A;  2KFH A;  2M29 A;  2KAX A;  1ORG A;  2JOJ A;  1MXL C;  5K89 A;  2K7C A;  1KSO A;  1S1E A;  1S6J A;  1DJG A;  1Q6H A;  1F8A B;  1SYM A;  1DGV A;  4P8V A;  4QT3 A;  4N1G A;  2MAZ A;  1RD6 A;  1OOI X;  4M2O A;  4DWS D;  4PE4 A;  2G2B A;  2AAO A;  1AK8 A;  3NGV A;  4IQ2 A;  3BUW B;  1A2X A;  3TDU A;  1J1E A;  1J4I A;  4Z2H A;  5HKG A;  1E9L A;  3TDB A;  1FKG A;  4TNC A;  3ARP A;  3WH0 A;  2LVI A;  2Q4U A;  4QT2 A;  4C0L A;  4FN2 A;  3PM8 A;  4HAR A;  4IPX A;  2PPN A;  2I2R E;  1CLL A;  3NSL A;  1UHI A;  1J7Q A;  1FKH A;  3CHD A;  2BAP A;  1TCO B;  2L2S A;  4D1E A;  3BQ3 A;  1Q6U A;  3RGC A;  5DF0 A;  1JFJ A;  3AQU A;  3NHT A;  4P8U A;  5DKQ A;  1ZAC A;  4MRY A;  3MSE B;  1F4Q A;  4QJ3 B;  1M31 A;  2KGJ A;  1LA3 A;  2LE9 B;  2EGD A;  2KR7 A;  2VCD A;  1Y1A A;  1IKU A;  5GPG A;  1A4P A;  4PE1 A;  2M49 B;  1DT7 B;  1OOG A;  3FY1 A;  4ZCV A;  2ZQS A;  4ICB A;  1XFU O;  1GM0 A;  2OTG C;  1AP4 A;  2D8N A;  4DS7 A;  4KQZ A;  2JZV A;  1H4B A;  4YGA A;  3O5R A;  1C7W A;  2I7A A;  2PQL A;  2WLZ A;  1X6N A;  4TYO A;  4INX A;  4ORB B;  1NCZ A;  1FBV A;  2ZNE A;  4YRU A;  3OGN A;  1CB1 A;  2ZR5 A;  1K95 A;  1UHH A;  2XPA A;  1QV0 A;  4Z2K A;  2OS8 B;  3EKH A;  5CSN A;  3R1V A;  4I5K A;  2DT2 A;  3CZ1 A;  3LK1 A;  1FKR A;  1J7O A;  2LV7 A;  3I5G C;  3WHT B;  5FI2 A;  1NCY A;  3MDY B;  4O2T A;  5HKY A;  1B1G A;  1TNQ A;  3V2L A;  1NIW A;  1RK9 A;  1ZMZ A;  2LMU A;  2VRG A;  4U8D A;  5HW8 A;  3CDN A;  3ODK A;  3DZT A;  1A03 A;  3CZ2 A;  2NCP A;  1OMR A;  2MLE C;  2A4J A;  1L2O C;  1S3P A;  2QF8 A;  2PV1 A;  3PJI A;  1WRL A;  1S5G Z;  2JQ6 A;  3DVK A;  2N87 A;  1K9K A;  1L7Z A;  4I5N B;  4I5L B;  4CID A;  1DMO A;  4TX0 A;  1LG2 A;  1XFR A;  1EL4 A;  2E30 A;  2BEC A;  4MGV A;  4DWS B;  2LHI A;  1YTZ C;  1HQV A;  3KAI A;  4AY1 A;  3GPK A;  2LHL A;  2F4E A;  3LL8 B;  1KK8 C;  3DY9 A;  2IS9 A;  2BNX A;  1NWR A;  1K9U A;  3KCE A;  2ZN9 A;  1FKB A;  5J3X A;  1JNS A;  1LA0 A;  2LAP A;  3CWG A;  2JTZ A;  3PSR A;  1C3Y A;  5HT1 A;  3O5Q A;  2KI4 B;  4WJX A;  3O5I A;  4W9P A;  3O5G A;  2V53 A;  4DRM A;  3E3R A;  1W9P A;  2BCB A;  4PHK A;  5D75 A;  1HJW A;  3L4A A;  4ORC B;  1JVW A;  3H9R B;  3ARX A;  1DJH A;  1K9P A;  1BOD A;  4MPK A;  1QZ2 A;  1OZO A;  1Q80 A;  2OLH A;  4PT1 A;  1XHG A;  1SR0 A;  5IBW A;  2F23 A;  2XP5 A;  3B9A A;  4MZK A;  1LQ0 A;  1IJ6 A;  1SYT A;  1WRK A;  4FQT A;  2I94 A;  3AAK A;  4FQO A;  4U85 A;  4URI A;  1DJX A;  1D1O A;  2DT3 A;  4Z2G A;  4IQC A;  2HQ8 A;  3TS5 C;  1GGW A;  1DJW A;  1C07 A;  1QAS A;  4WKF A;  4IL1 A;  1N0Y A;  2WC5 A;  1U5I B;  1DVI A;  1S36 A;  1SK6 D;  2LMV A;  2DG9 A;  1K9T A;  3WD1 A;  2JNF A;  1N2D A;  2A3B A;  1CKK A;  4BY4 A;  4OR9 B;  3O5D A;  2ZRS A;  1N1A A;  4ITZ A;  3O5M A;  4P2Y B;  1EG4 A;  4GGF C;  3OOB A;  4DUQ A;  1A75 B;  2O9O A;  4GUK A;  3D78 A;  4ODP A;  3UI5 A;  1Z2C B;  1REC A;  4ZPV R;  3O2P A;  2WCB A;  2F3Z A;  2WCM A;  3LLE A;  4USL A;  3BMB A;  2WCE A;  4OKH A;  1CDN A;  1NX2 A;  1GJY A;  3CGA A;  2FCD A;  1RJV A;  2RSE A;  2O60 A;  2QEB A;  3CHF A;  3S0F A;  1B8L A;  2BL0 C;  1K96 A;  1R6P A;  2KYC A;  3WL0 A;  1B6C A;  2BCX A;  1YR5 A;  4FTG A;  3B7A A;  3UF8 A;  1QV1 A;  1MHO A;  4LAX A;  1SSE B;  4XJK B;  2BE6 A;  3KZ7 A;  1XFV O;  4LAV A;  4DRQ A;  2AWG A;  4WRI A;  1HT9 A;  1X02 A;  2PPP A;  4ZPT R;  1DTL A;  3R72 A;  1IJ5 A;  3BJH A;  2K60 A;  2Y78 A;  2YBT A;  1NWT A;  1QIV A;  1SL8 A;  3EK4 A;  2CCM A;  1QPL A;  1GOI A;  1F71 A;  4Z2J A;  1CM1 A;  2LNK A;  3JTD B;  1RFJ A;  4OCI A;  1IH0 A;  2GV5 A;  4C02 B;  3IVT A;  1J4R A;  4MBE A;  4XJK A;  1TFV A;  3CHC A;  4DT4 A;  1YX7 A;  2MBX A;  4YI8 A;  1DC1 A;  1W9V A;  1J55 A;  1U79 A;  4MLW A;  3SS4 A;  3D73 A;  2NXQ A;  2EC6 C;  2Y1M A;  5BPJ A;  3WKZ A;  2KSP A;  2M0R A;  1WLZ A;  2K7B A;  5I2Q A;  1JWD A;  1EHN A;  4N1F A;  4WQ3 A;  3NRK A;  1QXP A;  2WCL A;  1VRK A;  1HXV A;  1MUX A;  1YRU B;  1KQV A;  2F33 A;  2MLY A;  5KTY A;  3R1P A;  1E44 A;  4NDD A;  4ODN A;  3ARU A;  1SR6 C;  1BT6 A;  2ERB A;  2F2O A;  3R1O A;  1CFF A;  5JJG A;  2OTG B;  3EY6 A;  4MNJ A;  4ODL A;  4L9M A;  2LUX A;  5CPV A;  2QPT A;  2KPH A;  2F8P A;  5HKW A;  4TW8 A;  2PV3 A;  3BFH A;  2ETN A;  3WD0 A;  1QIW A;  4GAO A;  2RGI A;  2MHH A;  3VRO A;  1SY9 A;  3B88 A;  2XPB A;  1KSM A;  2P6B B;  3D74 A;  3LCP C;  2KQY A;  5KU1 A;  2KFG A;  2O5G A;  1G8I A;  5AAN A;  1D7H A;  4JKT A;  1M39 A;  3GK1 A;  1D7I A;  2RQS A;  3IKG A;  3I5G B;  3RFW A;  2P4V A;  2KNE A;  1F54 A;  1HKK A;  4PE0 A; 
#chains in the Genus database with same CATH homology
 4PDZ A;  3DVM A;  1CDP A;  1ZBC A;  2L98 A;  3I5F C;  4DZ3 A;  5JOL A;  1V1F A;  5J6E A;  1QX5 B;  3ARW A;  1XFX O;  3BUX B;  1L2O B;  4QJ4 B;  4Z2I A;  4MNK A;  1YVH A;  1CMF A;  2Y1N A;  4S3J A;  2PVB A;  5DEZ A;  4OV2 A;  1IRJ A;  1WNO A;  2H61 C;  4DRJ A;  2JPT A;  3C1V A;  1CDM A;  1E8A A;  1PBK A;  1Y0V H;  1AJ5 A;  1E6N A;  4MRX A;  1A29 A;  3OB1 B;  1KK8 B;  2RUR A;  2LAN A;  1M63 B;  2A3E A;  3FWC A;  4P8W A;  3ARZ A;  4C0K A;  2WM0 A;  2K8M B;  1EJ3 A;  1LVC D;  4WQ2 A;  2ZFD A;  2ZRT A;  2R2I A;  2D9F A;  4ZS6 A;  4P5O E;  1AJ4 A;  5HYD A;  1UHN A;  1B9A A;  4KR0 B;  4YI9 A;  3NSO A;  2CBL A;  2M1U A;  2WLY A;  4JPZ B;  4YGD B;  1HKJ A;  2RUD A;  5D69 A;  1JND A;  3TCZ A;  1ZBW A;  4GBA A;  3K21 A;  4PCW A;  3CH9 A;  4MSP A;  5TNC A;  2DSV A;  1YAT A;  3EVU A;  1XRV A;  2PSR A;  3WNX B;  3FAP A;  2ITK A;  2LMT A;  4OVN F;  1NH6 A;  3A4U B;  3ARY A;  5F6T A;  1FKL A;  2JNX A;  1J4H A;  3TS5 B;  4HSZ A;  3VRR A;  1SPY A;  1PRW A;  4YGB B;  1N65 A;  1JC2 A;  4A4C A;  3PLF B;  2PRU A;  2NZ0 A;  3O78 A;  1QTX A;  1FF1 A;  2JT0 A;  1NSH A;  1Y6W A;  5DIT A;  1IGV A;  5GQB A;  3OP0 A;  2JT3 A;  2LJ4 A;  2K7O A;  1LL6 A;  2KO7 A;  1OZS A;  3EVR A;  3BXW A;  4ODK A;  1KK7 Z;  3TDZ A;  3RM8 A;  1TOP A;  1DJI A;  4DRW A;  4S3K A;  4M2Q A;  2LC5 A;  1NCX A;  1KFW A;  5AEQ A;  1NX3 A;  3CGN A;  2ZQV A;  2K2F A;  2MLF C;  3FWB A;  2KI6 C;  1UHK A;  1YX8 A;  2COL B;  3KPX A;  3RLZ A;  4NQG A;  2BL0 B;  3I5I B;  2LLS A;  4GNK B;  1CLB A;  1FKF A;  4BY5 A;  3F45 A;  2M8U A;  1H0G A;  1S6C A;  2CNP A;  2K8I A;  1QLK A;  2F2D A;  2HF5 A;  2WOS A;  3WD3 A;  4GGF A;  4WKA A;  1W1V A;  1BU3 A;  4PHJ A;  1DGU A;  3AKB A;  4GIV A;  5HTG A;  3OA5 A;  4QZV B;  5AXI A;  2L2E A;  2B1U A;  4ODO A;  4TW7 A;  1CFC A;  3SG4 A;  1GPF A;  1ALV A;  1NMW A;  1NWU A;  4AQJ A;  3KAF A;  4R1E A;  2JU0 A;  2LCP A;  4Q04 A;  1LXF C;  3O4Y A;  1SRA A;  3ALG A;  2ZKM X;  1SMG A;  1V1G A;  2XP4 A;  3IF7 A;  1BG1 A;  4NZC A;  3KHE A;  1WRZ A;  1FKD A;  1WY9 A;  3NSK A;  2KGR A;  4XAK A;  4DRH A;  4JFJ A;  3DVJ A;  2KFF A;  1J6Y A;  2EC6 B;  2O92 A;  2A3A A;  2PAS A;  4N5X A;  2KBI A;  1JBA A;  1EDQ A;  3A8R A;  2Q5A A;  3UI6 A;  3HCM A;  4LAY A;  4DRP A;  5ER5 A;  1Y1U A;  1OOJ A;  1TCO C;  4I5J A;  5B8I C;  2YBU A;  2MF9 A;  3IK8 A;  3KAH A;  4N19 A;  1SR6 B;  2LP3 A;  3VRP A;  3IHZ A;  1MXE A;  4PE7 A;  3D0Y A;  1EIB A;  1WDC C;  3OX5 A;  3WD2 A;  3ICB A;  1XK4 C;  4DIR A;  1ZU8 A;  5GQQ C;  3PAT A;  1BR1 B;  1PUL A;  4E68 A;  3VAW A;  2E6W A;  1T11 A;  3EK8 A;  3SG6 A;  4NDC A;  5HKZ A;  1TTX A;  4YBH B;  1ROU A;  5DO2 A;  3H4S E;  1K8U A;  1QX7 A;  5AER A;  1J7P A;  2TN4 A;  1TNP A;  1OGG A;  1ZL1 A;  3O5F A;  3CR5 X;  2JT8 A;  1VF8 A;  1ZOT B;  2DSU A;  4JFL A;  3ZNI A;  3CZ8 A;  2M3W A;  1KFU S;  3AS1 A;  2PMY A;  4NNR A;  1WLM A;  2GGM A;  5HBF A;  3PAL A;  1M5Y A;  2IUZ A;  2L51 A;  3KAG A;  2OFN A;  5I8N A;  5D7F A;  1XFY O;  2HET A;  1QX2 A;  1XA5 A;  5DKN A;  2JRF A;  3EK7 A;  2LLT A;  1S26 D;  1TRF A;  4NSB A;  3OHM B;  4JFI A;  1B4C A;  1PVA A;  1HKM A;  1SCM C;  4MEW A;  2M7L A;  4DRK A;  3KEV A;  4ORA B;  4HBO A;  2LM5 A;  3ARR A;  1YVL A;  2DG4 A;  2Y5I A;  1FKJ A;  1RRO A;  1O6I A;  1EXR A;  1SW8 A;  2MNT A;  2PBC A;  3VRN A;  4CLN A;  5KSZ A;  3RM4 A;  1ZBK A;  1JFK A;  1XFZ O;  1B7T Y;  1FW4 A;  2VN1 A;  1Q1C A;  1IG5 A;  4Z2L A;  1FJD A;  1F40 A;  1CTN A;  4U86 A;  4QJ5 B;  3PR9 A;  1UHJ A;  3I6C A;  4W9O A;  4G2P A;  2H61 A;  3IQO A;  1QVI Y;  4P8X A;  4W5U A;  1AHR A;  1GQM A;  4JFK A;  3BYA A;  3WL1 A;  1FAP A;  2XP9 A;  2L4I A;  1W7I B;  4DCK A;  2FAP A;  1JSA A;  1QPF A;  3I5H C;  1X6L A;  1PIN A;  1W1Y A;  3GK2 A;  4YGE B;  3EKJ A;  3TUY C;  1SCV A;  1XO5 A;  1DF0 B;  1FI5 A;  1DJZ A;  1HJV A;  2MRD A;  4DZ2 A;  5CSF A;  1BF5 A;  4J4O A;  2M7N A;  5PAL A;  1KT1 A;  2G41 A;  1XFW O;  2OPO A;  1B8C A;  4W9Q A;  4WKH A;  2FJU B;  3QRX A;  1K94 A;  3TDI A;  1OMV A;  2K61 A;  1BL4 A;  3KAC A;  3KF9 A;  1KQM C;  1SBJ A;  1ITX A;  2ZQU A;  4PAL A;  2I18 A;  3LK0 A;  1M45 A;  4PHM A;  1SNL A;  2M2A A;  2BBM A;  3CS1 A;  2XP8 A;  1NPQ A;  1UUS A;  1AVS A;  2DT0 A;  4R0X A;  2ISD A;  4DRI A;  1D2K A;  2JXC A;  4ODM A;  5DIU A;  1DF0 A;  4R5E A;  1NMV A;  3SG7 A;  2PAL A;  1ROT A;  1FKI A;  1XYD A;  1QJT A;  2L4H A;  2BBN A;  1BMO A;  1FPW A;  2HQW A;  1KFU L;  1SL7 A;  3KAD A;  2B31 A;  1KT0 A;  2M08 A;  5HW7 A;  1CDL A;  4BF8 A;  2JTT A;  2MJW B;  3CZT X;  1MQ1 A;  1CFD A;  3AS0 A;  1YUU A;  1S6I A;  4PHN A;  1Q6I A;  4J4N A;  3JTD C;  2MLX A;  1MWN A;  3UQI A;  4MNM A;  2PPO A;  3DF0 B;  2XP3 A;  3CR2 A;  1PSR A;  4WIW A;  2SAS A;  1UR8 A;  3PN7 C;  3GK4 X;  3M0W A;  3RME A;  1OSA A;  4MVF A;  3LUO A;  3SG5 A;  4F0Z B;  1L1P A;  1GUV A;  2MLZ A;  2KOT A;  1NX0 A;  4HRH A;  2G9B A;  1EQ3 A;  3SG3 A;  4FAP A;  4QIB A;  1JF2 A;  1B7T Z;  1Y0O A;  1DJY A;  5HLO A;  3PFV A;  1MR8 A;  2JC2 A;  2ZND A;  5B8I B;  2KGB C;  1NYA A;  4ZCU A;  1TIZ A;  2WCF A;  2A3C A;  2KQ6 A;  3WD4 A;  1KWO C;  1OMD A;  4CFR A;  1F55 A;  1WDC B;  4JYS A;  3DF0 A;  5G08 A;  5I2O A;  1R2U A;  1WB0 A;  2Y4Q A;  1LL7 A;  1QVI Z;  2LGO A;  4TNS A;  3FIA A;  2EHB A;  1WAW A;  2DG3 A;  1F8H A;  4HBE A;  5DIV A;  3NXA A;  1PK0 D;  1J1D A;  2RUQ A;  2K2A A;  2LKN A;  2KAV A;  3NTP A;  2K7D A;  2LP2 A;  1PAL A;  3ART A;  3JYJ A;  1YUS A;  3JVT C;  1ZFS A;  1E6R A;  1G33 A;  1TNW A;  1LL4 A;  3QOK A;  1OWQ A;  1G4Y R;  4NDB A;  5CSI A;  5HWB A;  1JUO A;  1XK4 A;  3TZ1 A;  2JZI A;  2M1K B;  1NWD A;  1FKS A;  2DSZ A;  4CFQ A;  4JQ0 D;  1NP8 A;  3ARQ A;  2K0J A;  4MZJ A;  1HKI A;  3IKD A;  3BUM B;  1OE9 B;  2LUC A;  3AKA A;  2MPH A;  3ALF A;  1ZK6 A;  4WK9 A;  1SCM B;  1E6Z A;  3SIB A;  1BJF A;  2CXJ A;  2KDH A;  2NCO A;  1F4O A;  1ODB A;  1NWS A;  3CR4 X;  1IWQ A;  2LVV A;  2PV2 A;  4M2P A;  4ZPW R;  1OGB A;  2L0P A;  2LLU A;  1GGZ A;  4ML4 A;  1P5Q A;  3WXA A;  1W26 A;  5HW6 A;  2JXL A;  4PTM A;  4DRO A;  1SKT A;  2RUC A;  3NI6 A;  4JFM A;  1BR4 B;  3D0Y B;  2KE0 A;  1H0I A;  1QAT A;  1PSB A;  1FKT A;  2WC8 A;  2ZQT A;  1FKK A;  4UPG A;  2HPS A;  1ZBV A;  1K90 D;  1NX1 A;  4ODQ A;  3PRA A;  2H2K A;  3CTN A;  2FKE A;  1FD9 A;  3WHU B;  1A7X A;  4A4B A;  3B9D A;  2UZ5 A;  2LPV A;  3SG2 A;  4GPL B;  4DWS A;  3O5E A;  1IQ5 A;  4IT6 A;  2DPE A;  1D6O A;  3I5H B;  3O5L A;  3WIJ A;  4MNL A;  2CT9 A;  1UP5 A;  1QS7 A;  3AS3 A;  3TUY B;  4XYN A;  1J7R A;  3HX4 A;  1W1T A;  2L50 A;  4TW6 A;  1LJY A;  1TCF A;  2ZR4 A;  3RM9 A;  2JUL A;  3SJS A;  3FXY A;  2KFW A;  3ARS A;  2KHN A;  1JF0 A;  4GGQ A;  1TNX A;  3BXK A;  2AUC A;  1KQM B;  2NLN A;  3UI4 A;  1IX5 A;  2XP7 A;  1B47 A;  1UWO A;  4MTV A;  4L3N A;  1AUI B;  2SCP A;  1K2H A;  5DKR A;  1RTP 1;  1KFX S;  3GOF A;  3KAB A;  1M46 A;  1KCY A;  4G50 A;  1D7J A;  3DD4 A;  4DIP A;  5CSJ A;  1FFQ A;  4GFT A;  3UQB A;  2KI3 A;  3BUO B;  4C0J A;  2OS8 C;  2LVK A;  3I5F B;  4JWQ A;  4LGX A;  2WND A;  1ALW A;  1CLM A;  4CPV A;  5HUA A;  2DT1 A;  3G6L A;  2KI6 D;  3W4R A;  1BOC A;  2WK2 A;  1U5I A;  1B8R A;  4HRG A;  1YUT A;  3OX6 A;  3O6B A;  3I5I C;  4Q7N A;  2FDM A;  2BCA A;  1EYM A;  4MN0 A;  3EVV A;  2XP6 A;  1TN4 A;  2CTN A;  1ZB5 A;  1NSG A;  5I98 A;  3RM1 A;  1A75 A;  1CNP A;  1UR9 A;  1RWY A;  4L72 B;  3WQV A;  4DWS C;  4Q22 A;  2ESC A;  3CLN A;  4HRE E;  3PRB A;  4DH0 A;  2L5X B;  2QAC A;  3ARO A;  3PA7 A;  1XVJ A;  2AMI A;  1W1P A;  1YUR A;  3B8S A;  1C9H A;  1SL9 A;  1NUB A;  1YRT B;  1CM4 A;  1EH2 A;  2M9G A;  2F3Y A;  5HLV A;  3VGO A;  3FS7 A;  3WQW A;  2DSW A;  3B9E A;  2WOR A;  3PN7 B;  1JNT A;  2KYF A;  2KI4 C;  3AAJ A;  1F70 A;  1ZCN A;  4MAV A;  1C7V A;  4GGN A;  1UUR A;  2PI6 A;  1QLS A;  5HWC A;  2LVJ A;  4AOM A;  2G8Z A;  1BLQ A;  3UQA A;  2FCE A;  2BKH B;  1CMG A;  1LKJ A;  1H8B A;  4LAW A;  5FYX A;  3G6M A;  5BXJ A;  1CTR A;  4YGC B;  4DRN A;  2AOS A;  1KWO B;  1HJX A;  1LIN A;  3IQQ A;  1W7J B;  3DVE A;  1E6P A;  5GPR A;  1YW5 A;  4IT4 A;  1R9H A;  2ZR6 A;  1OQP A;  2MA2 A;  1FI6 A;  2BE4 A;  1CFP A;  2IF4 A;  3O5K A;  1KK7 Y;  2BKI B;  2KAY A;  2M97 A;  2F2P A;  5I2L A;  3NSI A;  3D10 A;  1JNE A;  3OB2 B;  3O5J A;  2Q91 A;  1LG1 A;  3CGM A;  3CHE A;  1BKF A;  3JVT B;  3BUN B;  4AQI A;  4MZL A;  2JWW A;  3BOW B;  1ZUZ A;  1E15 A;  3JYM A;  3SIA A;  3ZWH A;  3AS2 A;  1Y1X A;  2M1I A;  1S5G Y;  5AFP A;  3VRQ A;  1IQ3 A;  3KO0 A;  2DOQ A;  4ODR A;  3PRD A;  2GGZ A;  3O5O A;  4U84 A;  5JH8 A;  3O5P A;  4ETO A;  1KFX L;  1FFR A;  1K93 D;  2F21 A;  2FOT A;  5ER4 X;  3JXV A;  3ARV A;  3B7X A;  1MF8 B;  1W9U A;  2ZN8 A;  3BOW A;  3TC5 A;  1EG3 A;  1PVB A;  2KBM A;  2KFH A;  2M29 A;  2KAX A;  2JOJ A;  1MXL C;  5K89 A;  2K7C A;  1KSO A;  1S1E A;  1S6J A;  1DJG A;  1Q6H A;  1F8A B;  1SYM A;  1DGV A;  4P8V A;  4QT3 A;  4N1G A;  2MAZ A;  1RD6 A;  4M2O A;  4DWS D;  4PE4 A;  2G2B A;  2AAO A;  1AK8 A;  4IQ2 A;  3BUW B;  1A2X A;  3TDU A;  1J1E A;  1J4I A;  4Z2H A;  5HKG A;  1E9L A;  3TDB A;  1FKG A;  4TNC A;  3ARP A;  3WH0 A;  2LVI A;  2Q4U A;  4QT2 A;  4C0L A;  4FN2 A;  3PM8 A;  4HAR A;  4IPX A;  2PPN A;  2I2R E;  1CLL A;  3NSL A;  1UHI A;  1J7Q A;  1FKH A;  3CHD A;  1TCO B;  2L2S A;  4D1E A;  3BQ3 A;  1Q6U A;  3RGC A;  5DF0 A;  1JFJ A;  3AQU A;  4P8U A;  5DKQ A;  1ZAC A;  4MRY A;  3MSE B;  1F4Q A;  4QJ3 B;  1M31 A;  2KGJ A;  1LA3 A;  2LE9 B;  2EGD A;  2KR7 A;  2VCD A;  1Y1A A;  1IKU A;  5GPG A;  1A4P A;  4PE1 A;  2M49 B;  1DT7 B;  3FY1 A;  4ZCV A;  2ZQS A;  4ICB A;  1XFU O;  2OTG C;  1AP4 A;  2D8N A;  4DS7 A;  4KQZ A;  2JZV A;  1H4B A;  4YGA A;  3O5R A;  1C7W A;  2I7A A;  2WLZ A;  1X6N A;  4TYO A;  4ORB B;  1NCZ A;  1FBV A;  2ZNE A;  4YRU A;  1CB1 A;  2ZR5 A;  1K95 A;  1UHH A;  2XPA A;  1QV0 A;  4Z2K A;  2OS8 B;  3EKH A;  5CSN A;  4I5K A;  2DT2 A;  3LK1 A;  1FKR A;  1J7O A;  2LV7 A;  3I5G C;  3WHT B;  1NCY A;  3MDY B;  4O2T A;  5HKY A;  1B1G A;  1TNQ A;  1NIW A;  1RK9 A;  1ZMZ A;  2LMU A;  2VRG A;  4U8D A;  5HW8 A;  3ODK A;  1A03 A;  2NCP A;  1OMR A;  2MLE C;  2A4J A;  1L2O C;  1S3P A;  2QF8 A;  2PV1 A;  1WRL A;  1S5G Z;  2JQ6 A;  3DVK A;  2N87 A;  1K9K A;  1L7Z A;  4I5N B;  4I5L B;  4CID A;  1DMO A;  4TX0 A;  1LG2 A;  1EL4 A;  2E30 A;  2BEC A;  4MGV A;  4DWS B;  2LHI A;  1YTZ C;  1HQV A;  3KAI A;  4AY1 A;  3GPK A;  2LHL A;  2F4E A;  3LL8 B;  1KK8 C;  2IS9 A;  1NWR A;  1K9U A;  3KCE A;  2ZN9 A;  1FKB A;  5J3X A;  1JNS A;  1LA0 A;  2LAP A;  3CWG A;  2JTZ A;  3PSR A;  5HT1 A;  3O5Q A;  2KI4 B;  4WJX A;  3O5I A;  4W9P A;  3O5G A;  2V53 A;  4DRM A;  3E3R A;  1W9P A;  2BCB A;  4PHK A;  5D75 A;  1HJW A;  4ORC B;  1JVW A;  3H9R B;  3ARX A;  1DJH A;  1K9P A;  1BOD A;  4MPK A;  1QZ2 A;  1OZO A;  1Q80 A;  2OLH A;  1XHG A;  1SR0 A;  5IBW A;  2XP5 A;  3B9A A;  4MZK A;  1LQ0 A;  1IJ6 A;  1SYT A;  1WRK A;  2I94 A;  3AAK A;  4FQO A;  4U85 A;  4URI A;  1DJX A;  1D1O A;  2DT3 A;  4Z2G A;  4IQC A;  2HQ8 A;  3TS5 C;  1GGW A;  1DJW A;  1C07 A;  1QAS A;  4WKF A;  4IL1 A;  1N0Y A;  1U5I B;  1DVI A;  1S36 A;  1SK6 D;  2LMV A;  2DG9 A;  1K9T A;  3WD1 A;  2JNF A;  1N2D A;  2A3B A;  1CKK A;  4BY4 A;  4OR9 B;  3O5D A;  2ZRS A;  1N1A A;  4ITZ A;  3O5M A;  4P2Y B;  1EG4 A;  4GGF C;  3OOB A;  4DUQ A;  1A75 B;  2O9O A;  4GUK A;  4ODP A;  3UI5 A;  1REC A;  4ZPV R;  3O2P A;  2WCB A;  2F3Z A;  3LLE A;  4USL A;  2WCE A;  4OKH A;  1CDN A;  1NX2 A;  1GJY A;  3CGA A;  2FCD A;  1RJV A;  2RSE A;  2O60 A;  3CHF A;  1B8L A;  2BL0 C;  1K96 A;  1R6P A;  2KYC A;  3WL0 A;  1B6C A;  2BCX A;  1YR5 A;  4FTG A;  3UF8 A;  1QV1 A;  1MHO A;  4LAX A;  4XJK B;  2BE6 A;  3KZ7 A;  1XFV O;  4LAV A;  4DRQ A;  2AWG A;  4WRI A;  1HT9 A;  1X02 A;  2PPP A;  4ZPT R;  1DTL A;  1IJ5 A;  2YBT A;  2Y78 A;  1NWT A;  1QIV A;  1SL8 A;  3EK4 A;  2CCM A;  1QPL A;  1GOI A;  1F71 A;  4Z2J A;  1CM1 A;  2LNK A;  3JTD B;  1RFJ A;  4OCI A;  1IH0 A;  2GV5 A;  4C02 B;  1J4R A;  4MBE A;  4XJK A;  1TFV A;  3CHC A;  4DT4 A;  1YX7 A;  2MBX A;  4YI8 A;  1W9V A;  1J55 A;  1U79 A;  4MLW A;  2NXQ A;  2EC6 C;  2Y1M A;  5BPJ A;  3WKZ A;  2KSP A;  2M0R A;  1WLZ A;  2K7B A;  5I2Q A;  1JWD A;  1EHN A;  4N1F A;  4WQ3 A;  3NRK A;  1QXP A;  1VRK A;  1HXV A;  1MUX A;  1YRU B;  1KQV A;  2F33 A;  2MLY A;  5KTY A;  4NDD A;  4ODN A;  3ARU A;  1SR6 C;  1BT6 A;  2F2O A;  1CFF A;  5JJG A;  2OTG B;  3EY6 A;  4MNJ A;  4ODL A;  4L9M A;  2LUX A;  5CPV A;  2QPT A;  2F8P A;  5HKW A;  4TW8 A;  2PV3 A;  3WD0 A;  1QIW A;  4GAO A;  2RGI A;  2MHH A;  3VRO A;  1SY9 A;  2XPB A;  1KSM A;  2P6B B;  3LCP C;  2KQY A;  5KU1 A;  2KFG A;  2O5G A;  1G8I A;  5AAN A;  1D7H A;  1M39 A;  3GK1 A;  1D7I A;  2RQS A;  3IKG A;  3I5G B;  3RFW A;  2KNE A;  1F54 A;  1HKK A;  4PE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...