4MSPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp22 (aka fkbp14) containing two ef-hand motifs
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mspA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mspA01
1LINA 2K8MB 2KOTA 3DVEA 4C0LA 4PALA 1L2OC 1EYMA 2WORA 1U79A 4JWQA 2PPNA 4M2PA 2ZRTA 2DG3A 1FF1A 2JNFA 1XFYO 3TZ1A 4ODMA 1EG3A 1QS7A 2MHHA 2I2RE 2JPTA 2KAXA 1PVAA 4GBAA 2OTGB 1DT7B 1JSAA 1KQMC 2MF9A 1QIWA 3DVJA 2PV3A 5DKRA 4DRPA 4BY5A 4C0JA 5HWBA 2LM5A 1EH2A 1IGVA 4PHKA 1Q6UA 5I2QA 2HQ8A 3KACA 1NCZA 2BCAA 3BOWB 2EHBA 3JTDC 4O2TA 4WQ3A 3VRQA 1ZMZA 5GQQC 2FOTA 2F4EA 2ITKA 3IKDA 2F2PA 1ZCNA 4HSZA 2K8IA 1F8HA 3C1VA 4ODRA 1GGZA 2LVJA 5HYDA 2AWGA 3TDUA 4IQ2A 2WCBA 5HKZA 1KFXS 2CNPA 5ER4X 1QPLA 4C02B 1DJXA 1D6OA 2IS9A 3OB2B 3WHTB 3EVRA 5DKNA 4I5LB 1JFKA 1PINA 1KK8C 4ZCUA 5AANA 2F21A 3EVVA 1CDLA 3FS7A 2FAPA 1DF0A 4ODKA 2BCBA 1S3PA 5KTYA 3A8RA 4IQCA 4A4BA 2LNKA 3GK2A 3TUYC 3OOBA 2ZKMX 2ZQTA 1Q1CA 3LUOA 3TDBA 1WDCC 4L9MA 3VAWA 3A4UB 4GPLB 2EC6C 1YX8A 1S5GZ 1B9AA 4DIPA 3KEVA 2L2EA 1CTRA 1FW4A 2H61C 1XK4C 2OTGC 1AJ5A 2MAZA 1B47A 3I5GC 2Q91A 4N1FA 2BECA 2JRFA 5DKQA 4NQGA 5JJGA 1NX2A 4PHJA 3EK7A 1WRLA 3BUOB 1OMRA 2JXCA 2XPAA 4XYNA 1PRWA 2BE4A 1YRTB 1FKBA 4PE0A 1IKUA 2OPOA 4W9OA 5I98A 1KSOA 1J7PA 2LE9B 2FCEA 1K93D 1L7ZA 3BUXB 2M8UA 4JPZB 1S6IA 1TNPA 2KDHA 3GK1A 3KADA 1PVBA 1NP8A 1S1EA 1DGUA 3VGOA 3WXAA 4DH0A 1FKHA 4YGAA 1YTZC 2KR7A 4U86A 1FKKA 3FIAA 3KF9A 2ZQVA 2MLZA 1BMOA 2F8PA 3EK4A 2CBLA 4USLA 2RQSA 4FQOA 1S36A 4C0KA 1CDNA 1OSAA 1RFJA 2Y4QA 5I2OA 1J4RA 2Y78A 1C7WA 3AKAA 2E30A 2RSEA 1RECA 4FN2A 1SCMC 1FKGA 1OQPA 1XFUO 2LCPA 1FJDA 2PV2A 1J1DA 1J1EA 1SL8A 1L2OB 3PRBA 2AMIA 1QIVA 1KSMA 1G33A 5AFPA 4MRYA 3VRNA 1OMVA 4PCWA 2DOQA 1CDMA 2KBMA 1B1GA 4XJKB 3HX4A 4JFLA 4OCIA 2L98A 2LP2A 1A7XA 1ROUA 1BL4A 4DRJA 3O5EA 3UI4A 3PA7A 1MXLC 2QPTA 4DRHA 3BUNB 4FTGA 4HREE 4CFQA 4TX0A 1YUTA 4TW6A 3O4YA 2O5GA 4YI8A 5DIVA 1OZSA 3OB1B 1NX3A 5HKYA 3NI6A 3SJSA 2SCPA 1NMVA 1YURA 2OS8C 4M2OA 2F3ZA 2K0JA 4YGCB 3KABA 1SKTA 1FKSA 2NXQA 1JUOA 1R2UA 2SASA 2JTTA 1QZ2A 2V53A 1FKRA 1C9HA 2BKHB 5CSJA 5IBWA 4HRHA 1M39A 4HRGA 2ISDA 3CGAA 2VRGA 3JVTB 4P2YB 1SNLA 3IF7A 2MNTA 4U84A 2M7LA 1MF8B 2D8NA 2KSPA 1CB1A 1NMWA 2MPHA 4QIBA 1W7IB 1FI5A 3KAHA 2MLEC 3O5QA 4DUQA 1K94A 2KFHA 1J4HA 2VCDA 1K96A 1SRAA 1K9PA 2I18A 1C07A 2KAVA 1B4CA 3LL8B 4GFTA 1FKIA 2MRDA 4YGDB 1UUSA 1Q80A 1JWDA 2BBNA 1XFXO 1ZUZA 1IQ5A 1B7TY 2JTZA 3IQOA 3OX6A 1A03A 4QT3A 3MDYB 2ZQUA 4MLWA 1SL7A 2K7BA 2K7CA 3TC5A 1JFJA 2KI6D 1SL9A 2NCPA 4QJ3B 5BPJA 3OX5A 2MLXA 3CLNA 2EC6B 2AUCA 2KNEA 3M0WA 3DF0B 1XA5A 3VROA 2RUCA 3O5FA 1ODBA 1QV1A 3KHEA 3O2PA 1OZOA 3NSOA 1QX5B 2ZR4A 1CFCA 1HXVA 1SW8A 4CIDA 1CFDA 1RWYA 1SPYA 1YUSA 2KHNA 3CTNA 3O5MA 2LUXA 2LJ4A 2I7AA 1ALWA 3PM8A 2L51A 3VRRA 3UF8A 3CS1A 2ZNEA 2XP7A 5HUAA 1S6JA 1CFPA 2IF4A 1UHKA 2Q4UA 1NSHA 1SR6B 1UHIA 2L50A 3PSRA 4I5NB 4ITZA 1UURA 2BL0B 1BF5A 3KZ7A 1DJGA 5BXJA 4AQJA 2LHLA 1KQVA 1A75B 1F8AB 2WOSA 1H8BA 1YUUA 5GPGA 1LA0A 4AQIA 2ZR6A 5HKGA 4GGNA 1G4YR 2KBIA 1XO5A 4MBEA 2ZN8A 5B8IC 5HTGA 3I6CA 2KI4B 1Y1UA 2LVKA 3I5HB 1ZOTB 1JBAA 2OFNA 5J3XA 1HT9A 2M1KB 4FAPA 2JOJA 2M2AA 5CSFA 3PALA 5K89A 2JZVA 1DJYA 4M2QA 3KAFA 4JFMA 4TNCA 1W7JB 1NCXA 1YRUB 3CZTX 4NDBA 4PE7A 1BODA 1F70A 3B7XA 2K2FA 3H4SE 4TW7A 2PV1A 2JNXA 5HW8A 5J6EA 1WRKA 1AVSA 2F33A 1BR4B 2ZR5A 2KYCA 1MWNA 2ZN9A 1IWQA 4CFRA 1B8RA 3CWGA 1TCFA 2CCMA 4UPGA 2JQ6A 2L0PA 1FAPA 3O5RA 1L1PA 2PPOA 2MBXA 1BJFA 4DCKA 1M46A 1AUIB 2PALA 1SCVA 2BL0C 4DRWA 3TS5C 2LANA 5CSNA 3TS5B 2LP3A 4OVNF 4ODQA 1S5GY 1NPQA 1UWOA 4LAVA 4N5XA 1IJ5A 1G8IA 3DD4A 3BOWA 2M29A 1NIWA 1YATA 4TYOA 1J4IA 5KU1A 2ZQSA 4W9QA 1DJZA 1MXEA 3NXAA 4I5KA 3O5JA 1DTLA 3LCPC 3H9RB 3O5IA 3PRDA 1TOPA 4TNSA 3I5IC 2XP3A 2EGDA 3NSIA 2Q5AA 4PDZA 2JU0A 1NX1A 1H4BA 1QVIY 4GGFC 2Y1NA 2KI3A 1GQMA 2K61A 4OV2A 4YBHB 1GJYA 1B6CA 3CR5X 4IL1A 4YRUA 3O5PA 2L4IA 2L2SA 1WDCB 3JXVA 1K9KA 1FD9A 3OHMB 3FWCA 5HLOA 3PLFB 2PSRA 4G50A 1N2DA 4WRIA 1QLSA 1MR8A 2RUDA 2A4JA 2HF5A 1F54A 4DRNA 5AERA 2G9BA 2LLSA 1PSRA 5G08A 4ODOA 2TN4A 1QV0A 2LMTA 4MN0A 1M31A 1CLMA 5KSZA 1SR6C 1C7VA 2PBCA 3KAGA 3O5DA 1J7QA 2M3WA 1M45A 3LK1A 2BE6A 1NUBA 1TN4A 2JXLA 1JF0A 1ZFSA 4XJKA 1CM1A 2E6WA 3UQAA 1LVCD 1PALA 1V1FA 3K21A 1YW5A 2KQ6A 2K7DA 2N87A 3IK8A 2OS8B 1B8LA 2LKNA 3SG5A 2F2OA 3BYAA 1SMGA 5CSIA 1UHJA 1D1OA 4BF8A 1B7TZ 1SK6D 1FKFA 1Y0OA 2LAPA 1K2HA 1XK4A 1LA3A 2FJUB 2GGZA 4WQ2A 2RUQA 1EJ3A 4MSPA 1AJ4A 1DF0B 1MHOA 1QASA 2L5XB 4MZKA 1BOCA 1KFUL 2XP5A 1F55A 5HWCA 1EXRA 3RLZA 4DIRA 3HCMA 2KQYA 4JFJA 3EKHA 1DJHA 3O5LA 1D7HA 1TTXA 1JC2A 2JT0A 4JYSA 3D10A 1F4OA 1TRFA 2LLUA 1QPFA 4DZ2A 1GGWA 1RJVA 5ER5A 1QX7A 4QT2A 2RURA 1YX7A 1RROA 1TNXA 1UP5A 4U8DA 1R6PA 2COLB 1BLQA 3FAPA 3PN7B 3ODKA 4IPXA 4ICBA 4N19A 1LKJA 3CGMA 3RFWA 3O5KA 1FBVA 2HPSA 4QJ4B 1M5YA 1QATA 2ZFDA 1BG1A 4PE4A 2AAOA 1ROTA 1WY9A 3UQBA 2LMVA 3SG6A 1AHRA 2RGIA 2ZRSA 2M1IA 1IRJA 2KGBC 1SY9A 1YVHA 3SG2A 4D1EA 1OOJA 1AK8A 1P5QA 1W26A 2PPPA 2XP8A 1NX0A 1WLMA 4PE1A 1BU3A 1SBJA 3TDZA 1A29A 1ALVA 2M49B 4I5JA 1KFXL 5B8IB 2KI4C 3I5HC 2MJWB 4GNKB 2NLNA 4JQ0D 2FKEA 3KCEA 1EG4A 3ZNIA 1NCYA 4QJ5B 2DG4A 2P6BB 1PK0D 3EY6A 1NWDA 4LAXA 3PATA 1A2XA 1M63B 2LVIA 5D7FA 2BBMA 4GGQA 4DRKA 1RTP1 2D9FA 2KGRA 3EVUA 4R1EA 1DJWA 1QTXA 2GGMA 1IH0A 4CLNA 4NDCA 2XP6A 1JNSA 4A4CA 1FKDA 3KAIA 1ZK6A 1SYMA 2JULA 2VN1A 5DITA 3D0YA 1KK7Z 1KT1A 1EQ3A 4DT4A 2PVBA 3I5GB 1XFWO 1KQMB 1VRKA 2WC8A 4AOMA 4PHNA 2I94A 2LHIA 3O5GA 4MZLA 2DG9A 3AAJA 3IHZA 1CMFA 1BKFA 3CGNA 4W9PA 5FYXA 1CFFA 2Y5IA 3QRXA 3EKJA 2KAYA 1MQ1A 1N0YA 1K8UA 4ETOA 1NSGA 3D0YB 3SIAA 2WCEA 4CPVA 2PRUA 1JNTA 4BY4A 1CLBA 1XFVO 3TCZA 2LC5A 3MSEB 3KPXA 1FI6A 1J7RA 2WCFA 1XFZO 1DVIA 3GOFA 4E68A 2JT8A 2HQWA 1K90D 4DZ3A 2MA2A 1AP4A 1QVIZ 1TIZA 1NYAA 1QLKA 2BCXA 2H61A 4F0ZB 1FPWA 1CLLA 2ZNDA 3DVKA 4GUKA 5PALA 1YVLA 1UHNA 3BXKA 2JWWA 3JVTC 1N1AA 2QACA 3JYMA 4ORAB 3F45A 3RGCA 1YR5A 3EK8A 2XPBA 4R0XA 1DJIA 1TCOB 5HW7A 1OE9B 1J6YA 1BT6A 3LLEA 2KFGA 3WHUB 1TCOC 3I5FB 1WRZA 3RM1A 1JF2A 2H2KA 3AAKA 5I8NA 4LAWA 4ODNA 3WH0A 1A75A 3I5IB 2KO7A 2JZIA 3KO0A 3SG4A 3PN7C 4YI9A 1FKLA 1J7OA 3TUYB 3FWBA 1PBKA 4JFIA 2HETA 1Y0VH 5HLVA 2NCOA 4OR9B 2GV5A 3BUMB 2NZ0A 3CR2A 3DF0A 1K9UA 1U5IA 2K2AA 2M97A 1T11A 5TNCA 4TW8A 2KE0A 1QJTA 2CXJA 2R2IA 4MRXA 2L4HA 1PULA 2LMUA 4ORCB 2M1UA 2O60A 2WNDA 3TDIA 5D75A 2XP9A 4Q04A 4GAOA 3NRKA 1BR1B 2FCDA 1HQVA 5HW6A 1QX2A 1CMGA 4N1GA 3SG3A 1CNPA 2M0RA 2JC2A 3JTDB 2LPVA 2MLYA 4LAYA 1SCMB 1CKKA 4YGBB 1K95A 1KWOC 3BUWB 2CTNA 3O78A 5I2LA 3BQ3A 2KI6C 3SG7A 2G2BA 1V1GA 1WLZA 2Y1MA 2M9GA 3NSKA 1KFUS 3AKBA 4MEWA 1A4PA 3I5FC 5F6TA 1OMDA 4U85A 4DROA 1XYDA 1X02A 1S6CA 2M7NA 3ICBA 4ZCVA 4MVFA 2LUCA 2M08A 1EL4A 4GIVA 2KFWA 4PHMA 2LLTA 1DGVA 3DVMA 5JOLA 1IQ3A 2JT3A 3ZWHA 5HKWA 3IQQA 4ODPA 1RK9A 3NSLA 5AXIA 1CM4A 1IG5A 1Q6HA 3NTPA 1S26D 4P5OE 1TNQA 2F2DA 4OKHA 1TNWA 4ORBB 3VRPA 1CDPA 1KCYA 3CR4X 4G2PA 4JFKA 2KYFA 1F40A 2XP4A 1F4QA 4MGVA 1N65A 2MLFC 3SIBA 4J4NA 3O6BA 1IJ6A 1QXPA 5AEQA 1D7JA 1KT0A 4NNRA 1XVJA 3O5OA 1J55A 1Q6IA 3E3RA 1F71A 2B1UA 3GPKA 4DRQA 1ZACA 4MZJA 5CPVA 1U5IB 2CT9A 1D7IA 1FKJA 4ODLA 1PSBA 3UQIA 1Y1AA 2F3YA 2PMYA 1KWOB 3GK4X 1FKTA 1KK7Y 2LGOA 4NDDA 3UI6A 4DRMA 3PFVA 1DMOA 1LXFC 1Y1XA 3WNXB 5HT1A 3UI5A 3IKGA 1R9HA 4YGEB 2PASA 2KGJA 5DIUA 4J4OA 1MUXA 1JVWA 4DRIA 1E8AA 5D69A 2LV7A 1Y6WA 1KK8B 2BKIB 2KFFA 3LK0A 4DS7A 1B8CA 3OP0A 3JYJA 2UZ5A 4GGFA 1UHHA 2LVVA 2K7OA
chains in the Genus database with same CATH superfamily
4C0LA 1L2OC 1EYMA 2EULA 2ZRTA 3TZ1A 4ODMA 3BOWB 1ZCNA 1F8HA 3C1VA 4DRNA 1GGZA 2LVJA 2AWGA 3OBVA 4IQ2A 2WCBA 5HKZA 3CDNA 1D6OA 2IS9A 1JCHB 5DKNA 4I5LB 2A3AA 2F21A 4A4BA 4P8WA 3TDBA 3A4UB 3CZ2A 4DWSA 4DIPA 1CTRA 3QMEA 3I5GC 1NX2A 4XYNA 1YRTB 2OPOA 3ALGA 4JPZB 1OW4A 3GK1A 1S1EA 1BMOA 2F8PA 3EK4A 4USLA 4FQOA 1S36A 3NHIA 2Y4QA 4HBOA 2E30A 1FKGA 1FJDA 1XRVA 1J1EA 1L2OB 1KSMA 4MRYA 1H0IA 1CDMA 1A7XA 3D77A 1YUTA 2O5GA 1OZSA 5HKYA 3NI6A 1SKTA 1FKSA 4PT1A 1JUOA 2SASA 2BKHB 5CSJA 5IBWA 4HRHA 4HRGA 4U84A 3JVTB 1SNLA 3D75A 2M7LA 3BFAA 2D8NA 1CB1A 2MPHA 2KFHA 1SRAA 1C07A 1Q80A 1JWDA 2P71A 1ZUZA 1A03A 1B7TY 1E15A 2K7CA 3TC5A 1JFJA 5BPJA 2KLDA 3DF0B 1XA5A 3O5FA 1QV1A 1OZOA 3NSOA 2ZR4A 4P8XA 3L4AA 2WCMA 2LUXA 2LJ4A 1HKJA 2I7AA 3PSRA 1UHIA 2L50A 1HKMA 2LHLA 1A75B 2PQLA 5GPGA 1YUUA 3UO9A 4GGNA 5B8IC 1E44A 2OFNA 4FAPA 1GOIA 5CSFA 2M2AA 4S3KA 4JFMA 3CZTX 4NDBA 4KR0B 4TW7A 3PM2A 1TCFA 4Z2JA 3O5RA 2PPOA 2MBXA 1SCVA 4DRWA 3TS5C 2LANA 2LP3A 4LAVA 2QEOA 3NHTA 3PRDA 2XP3A 3NSIA 2Q5AA 1UR9A 2KI3A 4IT6A 4YBHB 1B6CA 3FE9A 3FWCA 3CZ0A 1XHGA 3FE8A 1HJWA 3ARRA 1PSRA 2LMTA 4MN0A 1RD6A 4R5EA 2DT3A 2BE6A 1NUBA 1V1FA 2KQ6A 2OS8B 2F2OA 4BF8A 3SS3A 1FKFA 2QEHA 1LA3A 3FE6A 1EJ3A 1DF0B 1MHOA 4MZKA 3CHEA 1F55A 1EXRA 2WM0A 3EKHA 1D7HA 2JT0A 1TRFA 2LLUA 4NSBA 4QT2A 2RURA 1YX7A 1RROA 3ARZA 1IX5A 3RFWA 1M5YA 2HPSA 4Z2IA 1QATA 1BG1A 4PE4A 1OOFA 1WY9A 3SG6A 1AHRA 2ZRSA 3SG2A 1AK8A 1SBJA 3I5HC 3L4LA 5FI2A 2DG4A 2WK2A 2P6BB 1NWDA 4DRKA 3EVUA 2XP6A 4NZCA 3R72A 2VN1A 1KK7Z 1DEKA 1EQ3A 1VRKA 2I94A 2LHIA 2DG9A 3IHZA 1CMFA 3SIAA 4MTVA 3EIPA 1FPWA 1UR8A 1QLKA 2H61A 3DVKA 1YVLA 3JYMA 3JVTC 2QACA 4ORAB 3RGCA 3EK8A 3S0GA 4R0XA 1TCOB 1BT6A 3WHUB 1WRZA 1JF2A 1CTNA 5I8NA 3ARXA 3WH0A 3I5IB 2JZIA 3AS0A 1W1PA 1J7OA 3FWBA 1PBKA 4JFIA 4Z2GA 4OR9B 2GV5A 1OOGA 1D2KA 2KE0A 2WNDA 3NRKA 2FCDA 2YBTA 3SG3A 2LPVA 4LAYA 1V1GA 4WKHA 5F6TA 1S6CA 4Z2KA 2WLYA 2LLTA 1DGVA 4ODPA 1RK9A 1S26D 4MGVA 1N65A 2PYQA 3O6BA 1IJ6A 3O5OA 1W9UA 1E6PA 2CT9A 3UQIA 1FKJA 1LJYA 3GK4X 1FKTA 1KK7Y 3UI6A 5HT1A 2KGJA 1MUXA 3WD0A 3NGVA 3OGNA 1B8CA 2QEVA 4GGFA 4KYNA 1U79A 2PPNA 1Z2CB 4M2PA 2H8VA 2DG3A 2JNFA 1XFYO 1QS7A 2MHHA 2B5UB 4GBAA 2JPTA 2KAXA 5HWBA 1Q6UA 1NCZA 2WCLA 3JTDC 1X6LA 4WQ3A 5GQQC 2ITKA 4ODRA 2K60A 3TDUA 1KFXS 2CNPA 1LS8A 3OB2B 3EVVA 1DF0A 4ODKA 2BCBA 5KTYA 3A8RA 4IQCA 2LNKA 3GK2A 1NWSA 2ZQTA 4L9MA 1S5GZ 2L2EA 1B47A 2BECA 3BUOB 1OMRA 2XPAA 2P4VA 1F40A 1PRWA 2BE4A 4DWSC 5I98A 4HBEA 1J7PA 3BUXB 2M8UA 1S6IA 1NP8A 4DH0A 1YTZC 1FKKA 2ZQVA 2MLZA 2WCJA 4C0KA 2PN0A 1RFJA 1HJXA 2Y78A 3AKAA 1RECA 2LCPA 2PV2A 1J1DA 1SL8A 4HARA 3VRNA 3B7AA 2DOQA 4XJKB 4JFLA 1BL4A 1EIBA 4DRJA 3O5EA 3UI4A 3BUNB 4FTGA 4TX0A 1T14A 3AS2A 2SCPA 1NMVA 4M2OA 2F3ZA 2K0JA 3KABA 2NXQA 1C9HA 3CGAA 3IF7A 1FI5A 3KAHA 1K94A 3UNWA 4P8UA 1K9PA 4P8VA 2KAVA 1B4CA 4GFTA 3CHDA 2MRDA 4YGDB 1IIOA 3IQOA 3MDYB 2K7BA 3OX5A 2RUCA 1HXVA 1QX5B 1SW8A 1RWYA 1SPYA 2KHNA 2L51A 3UF8A 3D73A 3RM4A 3B86A 1S6JA 1UHKA 2Q4UA 4TW8A 2WCKA 4I5NB 1UURA 4INWA 1BF5A 4AQJA 2A3CA 1LQ0A 1FFQA 1KQVA 1F8AB 1H8BA 2ZR6A 2KBIA 3AS1A 4Q7NA 1XO5A 2LVKA 1Y1UA 1HT9A 2M1KB 2JOJA 4S3JA 2JZVA 3D74A 1NCXA 4PE7A 2JPOA 4ZPVR 4URIA 2JNXA 1BR4B 3N7HA 1LG1A 4PTMA 2ZN9A 1IWQA 4CFRA 4UDMA 4MNJA 2CCMA 1M46A 2PALA 3B9AA 2YGUA 1S5GY 4Q22A 3BOWA 5KU1A 1DJZA 3O5JA 3O5IA 2EGDA 2JU0A 2Y1NA 2F23A 3OA5A 1GJYA 3CR5X 4IL1A 3GU0A 2L4IA 3JXVA 1K9KA 4WJXA 2PSRA 4G50A 1N2DA 1MR8A 1JNDA 1W1YA 1F54A 2TN4A 2PBCA 3BFHA 2JXLA 1JF0A 4XJKA 1PALA 2K7DA 3IK8A 1UHJA 1DELA 1XK4A 2GGZA 1E6RA 4WQ2A 4MSPA 1TUJA 3S0FA 5HWCA 4DIRA 4JYSA 3D10A 3R1VA 5ER5A 1UP5A 4U8DA 1R6PA 3FAPA 3S0EA 2ZFDA 4XAKA 3UQBA 2LMVA 3FXYA 4MAVA 1SY9A 2XP8A 2AOSA 4PE1A 4INXA 1ALVA 2M49B 2KI4C 3KCEA 1EG4A 1NCYA 1PK0D 1NWRA 2LVIA 1ZL1A 1ZBCA 4A4CA 1ZK6A 5DITA 4ZPWR 2PVBA 1KQMB 4PHNA 3O5GA 5FI7A 5FI6A 2WC6A 1MQ1A 1K8UA 1NSGA 1LL6A 1W1TA 1XFVO 3KPXA 1FI6A 3R1PA 1DVIA 2JT8A 4DZ3A 1QVIZ 1TIZA 2DSWA 1CLLA 5PALA 2G41A 1UHNA 3BXKA 5JH8A 1DJIA 4ODNA 1A75A 3SG4A 3PN7C 4YI9A 3S0DA 2HETA 2NCOA 3B88A 3CHFA 4WKAA 3DF0A 1GPFA 1U5IA 1T11A 4MPKA 2CXJA 4MRXA 4ORCB 1PULA 2O60A 5D75A 4GAOA 3W4RA 1HQVA 1QX2A 3WL1A 3JTDB 2MLYA 1SCMB 4YGBB 1KWOC 3BUWB 5I2LA 3O78A 4Z2LA 2G2BA 2Y1MA 2M9GA 3NSKA 4U85A 4MEWA 3R1OA 4DROA 1XYDA 1X02A 2M08A 1EL4A 2KFWA 5JOLA 3DVMA 1IQ3A 3NSLA 1Q6HA 4DWSB 4P5OE 1TNQA 2F2DA 3D78A 1TNWA 4ORBB 1CDPA 3CR4X 1O6IA 4G2PA 3SIBA 4J4NA 1E6ZA 2B1UA 3D76A 5CPVA 1U5IB 1D7IA 4ODLA 1KWOB 3B8SA 3IKGA 4J4OA 1Y6WA 2BKIB 3OP0A 3AAKA 1UHHA 2K7OA 1LINA 2K8MB 4IJ7A 1OGBA 4JWQA 1FF1A 5I94A 1EG3A 4FQTA 2MF9A 1W9ZA 2OTGB 4DRPA 2LM5A 1EH2A 1IGVA 5I2QA 3KACA 4JD9A 4O2TA 3VRQA 1ZMZA 2F4EA 2FOTA 3IKDA 2F2PA 1NH6A 4HSZA 5HYDA 5ER4X 1QPLA 4C02B 1DJXA 3BJHA 4ZCUA 5AANA 1CDLA 3FS7A 3OOBA 3CABA 3LUOA 1WDCC 4GPLB 2KLEA 3KEVA 2H61C 1XK4C 1X6NA 2MAZA 2OLHA 2Q91A 5EL2A 4NQGA 4PHJA 3EK7A 1WRLA 4ODQA 2JXCA 1FKBA 4L72B 4PE0A 1IKUA 1KSOA 3AS3A 1TNPA 2KDHA 3KADA 1DGUA 2DSZA 1FKHA 4YGAA 2KR7A 4U86A 2CBLA 2RSEA 1XFUO 3FY1A 3PRBA 2AMIA 1EHNA 1G33A 5AFPA 2PI6A 2KBMA 1B1GA 3G6LA 4OCIA 2L98A 1MXLC 2DT2A 4CFQA 3ARVA 4TW6A 1WNOA 2QDIA 1NX3A 5D3OA 1OOIX 1YURA 2OS8C 3WD3A 1FKRA 1M39A 4ZS6A 2VRGA 4P2YB 2MNTA 1WB0A 2MLEC 3VB1A 2WC5A 2VCDA 1K96A 2I18A 4Z2HA 3LL8B 1UUSA 1XFXO 4QT3A 1IQ5A 2DSVA 2ZQUA 4MLWA 1SL7A 2KI6D 2NCPA 4QJ3B 2MLXA 2EC6B 2AUCA 2KNEA 1ODBA 3KHEA 2QF8A 1CFCA 4CIDA 1YUSA 3O5MA 1ALWA 3PM8A 3BFBA 3CS1A 2ZNEA 2XP7A 5HUAA 1CFPA 2ERBA 1NSHA 4ITZA 5BXJA 1DJGA 2WOSA 1LA0A 2ZN8A 3I6CA 3I5HB 1E6NA 1ZOTB 5J3XA 5K89A 3KAFA 1W7JB 1YRUB 1BODA 1NWUA 2K2FA 3CH9A 3H4SE 5HW8A 5J6EA 1AVSA 2ZR5A 2KYCA 3PJIA 1B8RA 1L1PA 1LG2A 1BJFA 1P28A 1GRJA 3ARTA 3TS5B 4OVNF 1WAWA 1NPQA 1UWOA 4N5XA 1G8IA 3DD4A 2ETNA 4TYOA 2M29A 1NIWA 1FFRA 1YATA 4L3NA 4W9QA 1MXEA 3NXAA 4TNSA 3WD1A 1DTLA 3H9RB 1TOPA 3B87A 3I5IC 4PDZA 5HBFA 1QVIY 1HKKA 1GQMA 2K61A 4OV2A 4YRUA 1ZBWA 2L2SA 1WDCB 1FD9A 5HLOA 2P70A 3PLFB 3WD4A 1C3ZA 1QLSA 3WL0A 2RUDA 2A4JA 2G9BA 2LLSA 5G08A 4ODOA 2FJYA 1CLMA 5KSZA 3O5DA 1J7QA 3V2LA 5GPRA 2M3WA 1TN4A 2E6WA 3UQAA 1LVCD 3K21A 3SG5A 3BYAA 5CSIA 5DEZA 1SK6D 1Y0OA 2LAPA 1K2HA 2BNXA 1BOCA 1KFUL 3RLZA 4JFJA 2KQYA 4AY1A 1DJHA 3O5LA 1TTXA 1JC2A 1QPFA 1GGWA 2ESCA 1RJVA 4MNLA 1TNXA 2COLB 4IPXA 4MNMA 3PN7B 4N19A 1LKJA 3O5KA 4QJ4B 2RGIA 2M1IA 1IRJA 1W26A 1YVHA 4D1EA 3CZ8A 5DO2A 1WLMA 3JYJA 4I5JA 5B8IB 4OZDA 2NLNA 3ZNIA 4QJ5B 3B9EA 3EY6A 4LAXA 3PATA 1A2XA 4GGQA 5D7FA 3B6XA 2BBMA 1LL7A 1RTP1 2D9FA 4R1EA 1DJWA 1IH0A 4CLNA 2L5YA 3KAIA 2DSUA 1H0GA 1SYMA 2JULA 3K1EA 2A3EA 1KT1A 4DT4A 3DYEA 4W9PA 5FYXA 1CFFA 3QRXA 4ETOA 3D0YB 2WCEA 4CPVA 1CLBA 3TCZA 3MSEB 2WCFA 1XFZO 4E68A 3IVTA 3AQUA 1K90D 1AP4A 1NYAA 4F0ZB 2ZNDA 4GUKA 1N1AA 2JWWA 1YR5A 2IUZA 1J6YA 1OE9B 2KFGA 1TCOC 4LAWA 2G8ZA 3I5FB 2H2KA 4JKTA 3ARSA 2KO7A 3KO0A 1FKLA 1VF8A 3DY9A 3BUMB 2NZ0A 1QWVA 5TNCA 2L4HA 2LMUA 3TDIA 2M1UA 2XP9A 1BR1B 1CMGA 4N1GA 2JC2A 1E9LA 4WK9A 3BQ3A 2KI6C 3DXLA 3SG7A 4ML4A 1WLZA 1KFUS 3AKBA 3I5FC 1OMDA 4ZCVA 4MNKA 4PHMA 2JT3A 5HKWA 2DT1A 3NTPA 3VRPA 4JFKA 1F4QA 4WIWA 2MLFC 1W9PA 5AEQA 1KT0A 1J55A 1Q6IA 3E3RA 3GPKA 1ZACA 1PSBA 1Y1AA 4NDDA 4DRMA 3PFVA 3WNXB 1JVWA 1E8AA 1W1VA 1KK8B 2UZ5A 2LVVA 3WD2A 3DVEA 2KOTA 5HL1A 1NWTA 3ARYA 4PALA 2WORA 1DQEA 2I2RE 1DT7B 1PVAA 1JSAA 1KQMC 1QIWA 3DVJA 2PV3A 5DKRA 4BY5A 4C0JA 4PHKA 3ALFA 2HQ8A 2BCAA 2EHBA 2QEBA 5DIVA 2K8IA 3RMEA 4QZVB 3RZSA 3WHTB 1HKIA 3EVRA 1JFKA 1PINA 1KK8C 1TUZA 2FAPA 1S3PA 3TUYC 2ZKMX 2YBUA 1Q1CA 3RM8A 3VAWA 2EC6C 1YX8A 1B9AA 3SS4A 1OOHA 1FW4A 2OTGC 1AJ5A 1XFRA 4N1FA 2JRFA 1W9VA 5DKQA 5JJGA 4DZ2A 3EG5B 4W9OA 2LE9B 2FCEA 1K93D 1HJVA 1L7ZA 1PVBA 3VGOA 3WXAA 3FIAA 3KF9A 3WQVA 2RQSA 1K9TA 1J4RA 1CDNA 1OSAA 5I2OA 1C7WA 4FN2A 1SCMC 1OQPA 2O9OA 4W5UA 1QIVA 1OMVA 4PCWA 1KFWA 3HX4A 1SR0A 2LP2A 1ROUA 3PA7A 2QPTA 4DRHA 4HREE 1LL4A 1JNEA 3O4YA 2DPEA 4YI8A 5DICA 3OB1B 3SJSA 3DZTA 4YGCB 4IT4A 2BAPA 1R2UA 1QZ2A 2JTTA 3CHCA 2V53A 2ISDA 1MF8B 2KSPA 1NMWA 4QIBA 1W7IB 3O5QA 4DUQA 1J4HA 1FKIA 2BBNA 2JTZA 3OX6A 1SL9A 3CLNA 3M0WA 3VROA 3O2PA 1CFDA 3G6MA 3CTNA 3VRRA 2IF4A 2GTEA 1SR6B 2BL0B 3KZ7A 4AQIA 5HKGA 1G4YR 1ZBVA 4MBEA 5HTGA 2KI4B 2L2CA 1JBAA 3PALA 1DC1A 1SYTA 4F7FA 2WLZA 1DJYA 4M2QA 4TNCA 3S0AA 1F70A 3B7XA 2PV1A 1GUVA 3CZ1A 1WRKA 3ARQA 3L47A 2F33A 3SS5A 1MWNA 3CWGA 4WKFA 4UPGA 2JQ6A 2L0PA 1FAPA 3GTYX 4DCKA 1AUIB 2BL0C 5CSNA 3AROA 1IJ5A 3S0BA 1J4IA 2ZQSA 1ZBKA 4I5KA 3LCPC 3RM9A 2DT0A 1NX1A 1H4BA 4GGFC 2WCHA 3O5PA 3OHMB 1ZU8A 3B9DA 1Z4HA 4WRIA 2HF5A 1TWOA 5AERA 1TFVA 1QV0A 1M31A 3PRAA 1C7VA 1SR6C 3KAGA 3LK1A 1M45A 1ZFSA 1CM1A 1YW5A 2N87A 1B8LA 2LKNA 1D1OA 1SMGA 1B7TZ 2RUQA 2FJUB 1GM0A 3BMBA 1AJ4A 2L5XB 3QOKA 1QASA 2XP5A 3HCMA 1F4OA 3ARPA 1QX7A 1BLQA 3ODKA 4ICBA 3CGMA 2FDMA 1FBVA 2AAOA 1ROTA 2KGBC 1OOJA 1P5QA 2PPPA 1NX0A 1BU3A 3TDZA 5GQBA 1A29A 1KFXL 2MJWB 4GNKB 3Q8IA 4JQ0D 2A3BA 2FKEA 3ARWA 1M63B 4DWSD 2KGRA 1QTXA 2GGMA 1JNSA 4NDCA 1FKDA 2KPHA 4ZPTR 3D0YA 3I5GB 1XFWO 2WC8A 3O4XA 4AOMA 4MZLA 3AAJA 3CGNA 1BKFA 2Y5IA 3EKJA 1OWQA 2KAYA 1N0YA 2PRUA 1JNTA 3ARUA 4LGXA 4BY4A 2LC5A 1J7RA 3GOFA 2HQWA 2MA2A 2BCXA 3F45A 2XPBA 5HW7A 3LLEA 3RM1A 3TUYB 1Y0VH 5HLVA 3CR2A 1K9UA 2K2AA 2M97A 1EDQA 1SSEB 1QJTA 2R2IA 4Q04A 5HW6A 1CNPA 2M0RA 1ORGA 1K95A 2CTNA 2O92A 4KQZA 1A4PA 2M7NA 3ICBA 4GIVA 4MVFA 2LUCA 1ITXA 3BXWA 3ZWHA 3IQQA 5AXIA 1CM4A 1IG5A 4OKHA 3WKZA 1KCYA 2KYFA 2XP4A 1ZB5A 1QXPA 1D7JA 4NNRA 1XVJA 1F71A 4DRQA 1C3YA 2B31A 4MZJA 2F3YA 2PMYA 3WIJA 2LGOA 3PR9A 5DF0A 1DMOA 1LXFC 1Y1XA 3UI5A 1OGGA 1R9HA 4YGEB 2PASA 5DIUA 3WQWA 4DRIA 3CYZA 5D69A 2LV7A 2KFFA 3LK0A 4DS7A 1CKKA
chains in the Genus database with same CATH topology
4QZVB 3WD2A 1LINA 2K8MB 2KOTA 3DVEA 4C0LA 1NWTA 3ARYA 4PALA 1OGBA 1L2OC 1EYMA 2WORA 1U79A 4JWQA 2PPNA 4M2PA 2ZRTA 2DG3A 1FF1A 2JNFA 1XFYO 3TZ1A 4ODMA 1EG3A 1QS7A 2MHHA 2I2RE 2JPTA 2KAXA 1PVAA 4GBAA 2OTGB 1DT7B 1JSAA 1KQMC 2MF9A 1QIWA 3DVJA 2PV3A 5DKRA 4DRPA 4BY5A 4C0JA 5HWBA 2LM5A 1EH2A 1IGVA 4PHKA 1Q6UA 5I2QA 3ALFA 2HQ8A 3KACA 1NCZA 2BCAA 3BOWB 2EHBA 3JTDC 1X6LA 4O2TA 4WQ3A 3VRQA 1ZMZA 5GQQC 2FOTA 2F4EA 2ITKA 3IKDA 2F2PA 1NH6A 1ZCNA 4HSZA 2K8IA 1F8HA 3C1VA 4ODRA 1GGZA 2LVJA 5HYDA 2AWGA 3TDUA 4IQ2A 2WCBA 5HKZA 1KFXS 2CNPA 5ER4X 1QPLA 4C02B 1DJXA 1D6OA 2IS9A 3OB2B 3WHTB 1HKIA 3EVRA 5DKNA 4I5LB 1JFKA 1PINA 2A3AA 1KK8C 4ZCUA 5AANA 2F21A 3EVVA 1CDLA 3FS7A 2FAPA 1DF0A 4ODKA 2BCBA 1S3PA 5KTYA 3A8RA 4IQCA 4A4BA 2LNKA 3GK2A 3TUYC 3OOBA 4P8WA 4QT3A 1NWSA 2ZKMX 2YBUA 2ZQTA 1Q1CA 3LUOA 3RM8A 3TDBA 1WDCC 4L9MA 3VAWA 3A4UB 4GPLB 2EC6C 1YX8A 1S5GZ 1B9AA 4DWSA 4DIPA 3KEVA 2L2EA 1CTRA 1FW4A 2H61C 1XK4C 1X6NA 4DROA 2OTGC 1AJ5A 2MAZA 1B47A 3I5GC 2OLHA 2Q91A 4N1FA 2BECA 2JRFA 1W9VA 5DKQA 4NQGA 5JJGA 1NX2A 4PHJA 3EK7A 1WRLA 3BUOB 1OMRA 2JXCA 2XPAA 4XYNA 1PRWA 2BE4A 1YRTB 1FKBA 4PE0A 1IKUA 2OPOA 4HBEA 4L72B 4W9OA 4DWSC 5I98A 1KSOA 1J7PA 2LE9B 3ALGA 2FCEA 1K93D 1HJVA 1L7ZA 3AS3A 3BUXB 2M8UA 4JPZB 1S6IA 1TNPA 2KDHA 3GK1A 3KADA 1PVBA 1NP8A 1S1EA 1DGUA 3VGOA 3WXAA 2DSZA 4DH0A 1FKHA 4YGAA 1YTZC 2KR7A 4U86A 5GQBA 1FKKA 3FIAA 3KF9A 2ZQVA 2MLZA 1BMOA 2F8PA 3EK4A 2CBLA 3WQVA 4USLA 2RQSA 4FQOA 1K9TA 1S36A 4C0KA 1CDNA 1OSAA 1RFJA 2Y4QA 5I2OA 1J4RA 1HJXA 2Y78A 4HBOA 1C7WA 3AKAA 2E30A 2RSEA 1RECA 4FN2A 1SCMC 1FKGA 1OQPA 1XFUO 2LCPA 1FJDA 2PV2A 1J1DA 1XRVA 1J1EA 1SL8A 3FY1A 1L2OB 2O9OA 3PRBA 4TW8A 2AMIA 1EHNA 4HARA 1QIVA 4W5UA 1KSMA 1G33A 5AFPA 4MRYA 3VRNA 1H0IA 1OMVA 4PCWA 2PI6A 2DOQA 1CDMA 2KBMA 1B1GA 3G6LA 1KFWA 4XJKB 3HX4A 1SR0A 4OCIA 2L98A 4JFLA 2LP2A 1A7XA 1ROUA 1BL4A 1EIBA 4DRJA 3O5EA 3UI4A 3PA7A 1MXLC 2QPTA 2DT2A 4DRHA 3BUNB 4FTGA 4HREE 4CFQA 4TX0A 1LL4A 3ARVA 1YUTA 1JNEA 3O4YA 2O5GA 4TW6A 1WNOA 2DPEA 4YI8A 5DIVA 1OZSA 3OB1B 1NX3A 5HKYA 3AS2A 3NI6A 3SJSA 2SCPA 1NMVA 1ZL1A 1YURA 2OS8C 4M2OA 2F3ZA 2K0JA 4YGCB 3KABA 3WD3A 1SKTA 1FKSA 2NXQA 4IT4A 1JUOA 1R2UA 2SASA 2JTTA 1QZ2A 2V53A 3CHCA 1C9HA 1FKRA 2BKHB 5CSJA 5IBWA 4HRHA 1M39A 4HRGA 2ISDA 3CGAA 4ZS6A 2VRGA 3JVTB 4P2YB 1SNLA 3IF7A 2MNTA 4U84A 2M7LA 1MF8B 2D8NA 2KSPA 1CB1A 1NMWA 1WB0A 2MPHA 4QIBA 1W7IB 1FI5A 3KAHA 2MLEC 3O5QA 4DUQA 1K94A 2KFHA 1J4HA 2VCDA 1K96A 4P8UA 1SRAA 1K9PA 2I18A 1C07A 4P8VA 4Z2HA 2KAVA 1B4CA 3LL8B 4GFTA 1FKIA 3CHDA 2MRDA 4YGDB 1UUSA 1Q80A 1JWDA 2BBNA 1XFXO 1ZUZA 1IQ5A 1B7TY 2JTZA 3IQOA 3OX6A 1A03A 1E15A 2DSVA 3MDYB 2ZQUA 4MLWA 1SL7A 2K7BA 2K7CA 3TC5A 1JFJA 2KI6D 1SL9A 2NCPA 4QJ3B 5BPJA 3OX5A 2MLXA 3CLNA 2EC6B 2AUCA 2KNEA 3M0WA 3DF0B 1XA5A 3VROA 2RUCA 3O5FA 1ODBA 1QV1A 3KHEA 3O2PA 1OZOA 3NSOA 1QX5B 2QF8A 1CFCA 2ZR4A 1SW8A 1HXVA 4CIDA 1CFDA 1RWYA 1SPYA 1YUSA 2KHNA 3G6MA 3CTNA 4P8XA 3O5MA 2LUXA 2LJ4A 1HKJA 2I7AA 1ALWA 3PM8A 2L51A 3VRRA 3UF8A 3CS1A 2ZNEA 2XP7A 3RM4A 5HUAA 1S6JA 1CFPA 2IF4A 1UHKA 2Q4UA 4LAXA 1NSHA 1SR6B 1UHIA 2L50A 3PSRA 4I5NB 4ITZA 1UURA 2BL0B 1BF5A 1HKMA 1DJGA 3KZ7A 5BXJA 4AQJA 2A3CA 1LQ0A 2LHLA 1FFQA 1KQVA 1A75B 1F8AB 2WOSA 1H8BA 1YUUA 5GPGA 1LA0A 4AQIA 2ZR6A 5HKGA 4GGNA 1G4YR 2KBIA 3AS1A 4Q7NA 1ZBVA 1XO5A 4MBEA 2ZN8A 5B8IC 5HTGA 3I6CA 2KI4B 1Y1UA 2LVKA 3I5HB 1ZOTB 1E6NA 1JBAA 2OFNA 5J3XA 1HT9A 2M1KB 4FAPA 2JOJA 1GOIA 5CSFA 2M2AA 3PALA 4S3JA 5K89A 1SYTA 2JZVA 4S3KA 2WLZA 1DJYA 4M2QA 3KAFA 4JFMA 4TNCA 1W7JB 1NCXA 1YRUB 3CZTX 4NDBA 4PE7A 1BODA 1NWUA 1F70A 3B7XA 4ZPVR 2K2FA 4KR0B 3CH9A 3H4SE 4TW7A 2PV1A 4URIA 1GUVA 2JNXA 5HW8A 5J6EA 1WRKA 1AVSA 3ARQA 2F33A 1BR4B 1LG1A 4PTMA 2ZR5A 4LAWA 2KYCA 1MWNA 2ZN9A 1IWQA 4CFRA 1B8RA 3CWGA 1TCFA 2CCMA 4UPGA 4MNJA 4WKFA 4Z2JA 2JQ6A 2L0PA 1FAPA 3O5RA 1L1PA 1LG2A 2PPOA 2MBXA 1BJFA 4DCKA 1M46A 1AUIB 2PALA 1SCVA 2BL0C 4DRWA 3TS5C 2LANA 3B9AA 5CSNA 3ARTA 3TS5B 2LP3A 4OVNF 4ODQA 1S5GY 3AROA 1WAWA 1NPQA 1UWOA 4LAVA 4N5XA 1IJ5A 4Q22A 1G8IA 3DD4A 3BOWA 2M29A 1NIWA 1FFRA 1YATA 4TYOA 1J4IA 5KU1A 4L3NA 2ZQSA 4W9QA 1DJZA 1ZBKA 1MXEA 3NXAA 4I5KA 3O5JA 1DTLA 3LCPC 3H9RB 3O5IA 3PRDA 1TOPA 4TNSA 3I5IC 2XP3A 3RM9A 2EGDA 3NSIA 2Q5AA 1UR9A 2DT0A 4PDZA 2JU0A 1NX1A 1H4BA 5HBFA 1QVIY 4GGFC 2Y1NA 2KI3A 1HKKA 1GQMA 2K61A 4OV2A 4YBHB 1GJYA 1B6CA 3OA5A 3CR5X 4IT6A 4IL1A 4YRUA 1ZBWA 3O5PA 2L4IA 2L2SA 1WDCB 3JXVA 1K9KA 4WJXA 1FD9A 3OHMB 3FWCA 5HLOA 1ZU8A 3PLFB 3B9DA 3WD4A 2PSRA 4G50A 1XHGA 1N2DA 4WRIA 1QLSA 1MR8A 2RUDA 1JNDA 3WL0A 1W1YA 2A4JA 2HF5A 1F54A 4DRNA 5AERA 2G9BA 1HJWA 3ARRA 2LLSA 1PSRA 5G08A 1TFVA 4ODOA 2TN4A 1QV0A 2LMTA 4MN0A 1M31A 1CLMA 5KSZA 1SR6C 1C7VA 1RD6A 2PBCA 3KAGA 1J7QA 3O5DA 3PRAA 4R5EA 2DT3A 2M3WA 1M45A 3LK1A 5GPRA 2BE6A 1NUBA 1TN4A 2JXLA 1JF0A 1ZFSA 4XJKA 1CM1A 2E6WA 3UQAA 1LVCD 1PALA 1V1FA 3K21A 1YW5A 2KQ6A 2K7DA 2N87A 3IK8A 2OS8B 1B8LA 2LKNA 3SG5A 2F2OA 3BYAA 1SMGA 5CSIA 1UHJA 1D1OA 4BF8A 1B7TZ 5DEZA 1SK6D 1FKFA 1Y0OA 2LAPA 1K2HA 1XK4A 1LA3A 2FJUB 2GGZA 4WQ2A 1E6RA 2RUQA 1EJ3A 4MSPA 1AJ4A 1DF0B 1MHOA 1QASA 2L5XB 4MZKA 1BOCA 3QOKA 1KFUL 3CHEA 4MPKA 2XP5A 1F55A 5HWCA 1EXRA 3RLZA 4DIRA 3HCMA 2KQYA 2WM0A 4JFJA 3EKHA 4AY1A 1DJHA 3O5LA 1D7HA 1TTXA 1JC2A 2JT0A 4JYSA 3D10A 1F4OA 1TRFA 2LLUA 1QPFA 4DZ2A 1GGWA 2ESCA 1RJVA 4NSBA 5ER5A 1QX7A 3ARPA 4MNLA 2RURA 1YX7A 1RROA 1TNXA 1UP5A 4QT2A 4U8DA 1R6PA 2COLB 1BLQA 3FAPA 3PN7B 3ODKA 4IPXA 4MNMA 4ICBA 4N19A 3ARZA 1LKJA 1IX5A 3CGMA 2FDMA 3RFWA 3O5KA 1FBVA 2HPSA 4QJ4B 1M5YA 1QATA 2ZFDA 4Z2IA 1BG1A 4PE4A 2AAOA 1ROTA 4XAKA 1WY9A 3UQBA 2LMVA 3SG6A 1AHRA 2RGIA 2ZRSA 2M1IA 1IRJA 3FXYA 4MAVA 2KGBC 1SY9A 1YVHA 3SG2A 4D1EA 1OOJA 1AK8A 1P5QA 1W26A 2PPPA 2XP8A 2AOSA 5DO2A 1NX0A 1WLMA 4PE1A 1BU3A 1SBJA 3TDZA 1A29A 1ALVA 2M49B 4I5JA 1KFXL 5B8IB 2KI4C 3I5HC 2MJWB 4GNKB 2NLNA 4JQ0D 2A3BA 2FKEA 3KCEA 1EG4A 3ZNIA 1NCYA 4QJ5B 2DG4A 2WK2A 2P6BB 1PK0D 1NWRA 1NWDA 3ARWA 3B9EA 3PATA 1A2XA 1M63B 2LVIA 5D7FA 2BBMA 1LL7A 4GGQA 4DRKA 1RTP1 2D9FA 4DWSD 2KGRA 3EVUA 4R1EA 1DJWA 1QTXA 2GGMA 1IH0A 4CLNA 4NDCA 1ZBCA 2XP6A 4A4CA 4NZCA 1JNSA 1FKDA 3KAIA 2DSUA 1H0GA 1ZK6A 1SYMA 2JULA 2VN1A 4ZPTR 5DITA 3D0YA 1KK7Z 1KT1A 2A3EA 4ZPWR 1EQ3A 4DT4A 2PVBA 3I5GB 1XFWO 1KQMB 1VRKA 2WC8A 4AOMA 4PHNA 2I94A 2LHIA 3O5GA 4MZLA 2DG9A 3AAJA 3IHZA 1CMFA 1BKFA 3CGNA 4W9PA 3WD1A 5FYXA 1CFFA 2Y5IA 3QRXA 3EKJA 1OWQA 2KAYA 1MQ1A 1N0YA 1K8UA 4ETOA 1NSGA 3D0YB 3SIAA 2WCEA 4CPVA 1LL6A 2PRUA 1JNTA 3ARUA 4LGXA 1W1TA 4BY4A 1CLBA 4MTVA 1XFVO 3TCZA 2LC5A 3MSEB 3KPXA 1FI6A 1J7RA 2WCFA 1XFZO 1DVIA 3GOFA 4E68A 2JT8A 2HQWA 3AQUA 1K90D 4DZ3A 2MA2A 1AP4A 1QVIZ 1TIZA 1NYAA 1QLKA 2BCXA 2H61A 4F0ZB 1FPWA 1UR8A 2DSWA 1CLLA 2ZNDA 3DVKA 4GUKA 5PALA 2G41A 1YVLA 1UHNA 3BXKA 2JWWA 3JVTC 1N1AA 2QACA 3JYMA 4ORAB 3F45A 3RGCA 1YR5A 3EK8A 2IUZA 2XPBA 5JH8A 4R0XA 1DJIA 1TCOB 5HW7A 1OE9B 1J6YA 1BT6A 3LLEA 2KFGA 3WHUB 1TCOC 3I5FB 1WRZA 3RM1A 1JF2A 2H2KA 3AAKA 5I8NA 1CTNA 2G8ZA 3ARSA 3ARXA 4ODNA 1A75A 3I5IB 2KO7A 3WH0A 2JZIA 3KO0A 3AS0A 3SG4A 1W1PA 3PN7C 4YI9A 1FKLA 1J7OA 3TUYB 3FWBA 1PBKA 4JFIA 2HETA 1VF8A 1Y0VH 5HLVA 4Z2GA 2NCOA 4OR9B 2GV5A 3BUMB 3CHFA 2NZ0A 4WKAA 3CR2A 3DF0A 1K9UA 1GPFA 1U5IA 3CZ8A 2K2AA 2M97A 1EDQA 5TNCA 1D2KA 1T11A 2KE0A 1QJTA 2CXJA 2R2IA 4MRXA 2L4HA 1PULA 2LMUA 4ORCB 2M1UA 2O60A 2WNDA 3TDIA 5D75A 2XP9A 4Q04A 4GAOA 3NRKA 3W4RA 1BR1B 2FCDA 1HQVA 2YBTA 1QX2A 1CMGA 5HW6A 4N1GA 3SG3A 1CNPA 3EY6A 2M0RA 3WL1A 2JC2A 3JTDB 2LPVA 2MLYA 1E9LA 4LAYA 1SCMB 1CKKA 4YGBB 1K95A 1KWOC 3BUWB 2CTNA 3O78A 5I2LA 3BQ3A 2O92A 4WK9A 2KI6C 3SG7A 4ML4A 3RMEA 2G2BA 4Z2LA 1V1GA 1WLZA 2Y1MA 2M9GA 4KQZA 3NSKA 1KFUS 3AKBA 4MEWA 1A4PA 3I5FC 5F6TA 1OMDA 4U85A 4WKHA 1XYDA 1X02A 1S6CA 2M7NA 3ICBA 4ZCVA 4MVFA 2LUCA 2M08A 1EL4A 4GIVA 4Z2KA 2WLYA 2KFWA 4MNKA 1ITXA 4PHMA 2LLTA 1DGVA 3DVMA 5JOLA 1IQ3A 2JT3A 3BXWA 3ZWHA 5HKWA 3IQQA 4ODPA 1RK9A 3NSLA 5AXIA 1CM4A 1IG5A 1Q6HA 2DT1A 4DWSB 3NTPA 1S26D 4P5OE 1TNQA 2F2DA 4OKHA 3WKZA 1TNWA 4ORBB 3VRPA 1CDPA 1KCYA 3CR4X 1O6IA 4G2PA 4JFKA 2KYFA 1F40A 2XP4A 1F4QA 4WIWA 4MGVA 1N65A 2MLFC 1W9PA 3SIBA 4J4NA 3O6BA 1IJ6A 1ZB5A 1QXPA 5AEQA 1D7JA 1E6ZA 1KT0A 4NNRA 1XVJA 3O5OA 1J55A 1Q6IA 3E3RA 1F71A 2B1UA 1W9UA 3GPKA 4DRQA 1ZACA 1E6PA 2B31A 4MZJA 5CPVA 1U5IB 2CT9A 1D7IA 1FKJA 4ODLA 1PSBA 3UQIA 1Y1AA 2F3YA 2PMYA 1LJYA 1KWOB 3GK4X 1FKTA 3WIJA 1KK7Y 2LGOA 3PR9A 4NDDA 3B8SA 5DF0A 3UI6A 4DRMA 3PFVA 1DMOA 1LXFC 1Y1XA 3WNXB 5HT1A 3UI5A 1OGGA 1R9HA 3IKGA 4YGEB 2PASA 2KGJA 5DIUA 3WQWA 4J4OA 1MUXA 1JVWA 3WD0A 4DRIA 1E8AA 5D69A 2LV7A 1Y6WA 1W1VA 1KK8B 2BKIB 2KFFA 3LK0A 4DS7A 1B8CA 3OP0A 3JYJA 2UZ5A 4GGFA 1UHHA 2LVVA 2K7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIN A;  2K8M B;  2KOT A;  3DVE A;  4C0L A;  4PAL A;  1L2O C;  1EYM A;  2WOR A;  1U79 A;  4JWQ A;  2PPN A;  4M2P A;  2ZRT A;  2DG3 A;  1FF1 A;  2JNF A;  1XFY O;  3TZ1 A;  4ODM A;  1EG3 A;  1QS7 A;  2MHH A;  2I2R E;  2JPT A;  2KAX A;  1PVA A;  4GBA A;  2OTG B;  1DT7 B;  1JSA A;  1KQM C;  2MF9 A;  1QIW A;  3DVJ A;  2PV3 A;  5DKR A;  4DRP A;  4BY5 A;  4C0J A;  5HWB A;  2LM5 A;  1EH2 A;  1IGV A;  4PHK A;  1Q6U A;  5I2Q A;  2HQ8 A;  3KAC A;  1NCZ A;  2BCA A;  3BOW B;  2EHB A;  3JTD C;  4O2T A;  4WQ3 A;  3VRQ A;  1ZMZ A;  5GQQ C;  2FOT A;  2F4E A;  2ITK A;  3IKD A;  2F2P A;  1ZCN A;  4HSZ A;  2K8I A;  1F8H A;  3C1V A;  4ODR A;  1GGZ A;  2LVJ A;  5HYD A;  2AWG A;  3TDU A;  4IQ2 A;  2WCB A;  5HKZ A;  1KFX S;  2CNP A;  5ER4 X;  1QPL A;  4C02 B;  1DJX A;  1D6O A;  2IS9 A;  3OB2 B;  3WHT B;  3EVR A;  5DKN A;  4I5L B;  1JFK A;  1PIN A;  1KK8 C;  4ZCU A;  5AAN A;  2F21 A;  3EVV A;  1CDL A;  3FS7 A;  2FAP A;  1DF0 A;  4ODK A;  2BCB A;  1S3P A;  5KTY A;  3A8R A;  4IQC A;  4A4B A;  2LNK A;  3GK2 A;  3TUY C;  3OOB A;  2ZKM X;  2ZQT A;  1Q1C A;  3LUO A;  3TDB A;  1WDC C;  4L9M A;  3VAW A;  3A4U B;  4GPL B;  2EC6 C;  1YX8 A;  1S5G Z;  1B9A A;  4DIP A;  3KEV A;  2L2E A;  1CTR A;  1FW4 A;  2H61 C;  1XK4 C;  2OTG C;  1AJ5 A;  2MAZ A;  1B47 A;  3I5G C;  2Q91 A;  4N1F A;  2BEC A;  2JRF A;  5DKQ A;  4NQG A;  5JJG A;  1NX2 A;  4PHJ A;  3EK7 A;  1WRL A;  3BUO B;  1OMR A;  2JXC A;  2XPA A;  4XYN A;  1PRW A;  2BE4 A;  1YRT B;  1FKB A;  4PE0 A;  1IKU A;  2OPO A;  4W9O A;  5I98 A;  1KSO A;  1J7P A;  2LE9 B;  2FCE A;  1K93 D;  1L7Z A;  3BUX B;  2M8U A;  4JPZ B;  1S6I A;  1TNP A;  2KDH A;  3GK1 A;  3KAD A;  1PVB A;  1NP8 A;  1S1E A;  1DGU A;  3VGO A;  3WXA A;  4DH0 A;  1FKH A;  4YGA A;  1YTZ C;  2KR7 A;  4U86 A;  1FKK A;  3FIA A;  3KF9 A;  2ZQV A;  2MLZ A;  1BMO A;  2F8P A;  3EK4 A;  2CBL A;  4USL A;  2RQS A;  4FQO A;  1S36 A;  4C0K A;  1CDN A;  1OSA A;  1RFJ A;  2Y4Q A;  5I2O A;  1J4R A;  2Y78 A;  1C7W A;  3AKA A;  2E30 A;  2RSE A;  1REC A;  4FN2 A;  1SCM C;  1FKG A;  1OQP A;  1XFU O;  2LCP A;  1FJD A;  2PV2 A;  1J1D A;  1J1E A;  1SL8 A;  1L2O B;  3PRB A;  2AMI A;  1QIV A;  1KSM A;  1G33 A;  5AFP A;  4MRY A;  3VRN A;  1OMV A;  4PCW A;  2DOQ A;  1CDM A;  2KBM A;  1B1G A;  4XJK B;  3HX4 A;  4JFL A;  4OCI A;  2L98 A;  2LP2 A;  1A7X A;  1ROU A;  1BL4 A;  4DRJ A;  3O5E A;  3UI4 A;  3PA7 A;  1MXL C;  2QPT A;  4DRH A;  3BUN B;  4FTG A;  4HRE E;  4CFQ A;  4TX0 A;  1YUT A;  4TW6 A;  3O4Y A;  2O5G A;  4YI8 A;  5DIV A;  1OZS A;  3OB1 B;  1NX3 A;  5HKY A;  3NI6 A;  3SJS A;  2SCP A;  1NMV A;  1YUR A;  2OS8 C;  4M2O A;  2F3Z A;  2K0J A;  4YGC B;  3KAB A;  1SKT A;  1FKS A;  2NXQ A;  1JUO A;  1R2U A;  2SAS A;  2JTT A;  1QZ2 A;  2V53 A;  1FKR A;  1C9H A;  2BKH B;  5CSJ A;  5IBW A;  4HRH A;  1M39 A;  4HRG A;  2ISD A;  3CGA A;  2VRG A;  3JVT B;  4P2Y B;  1SNL A;  3IF7 A;  2MNT A;  4U84 A;  2M7L A;  1MF8 B;  2D8N A;  2KSP A;  1CB1 A;  1NMW A;  2MPH A;  4QIB A;  1W7I B;  1FI5 A;  3KAH A;  2MLE C;  3O5Q A;  4DUQ A;  1K94 A;  2KFH A;  1J4H A;  2VCD A;  1K96 A;  1SRA A;  1K9P A;  2I18 A;  1C07 A;  2KAV A;  1B4C A;  3LL8 B;  4GFT A;  1FKI A;  2MRD A;  4YGD B;  1UUS A;  1Q80 A;  1JWD A;  2BBN A;  1XFX O;  1ZUZ A;  1IQ5 A;  1B7T Y;  2JTZ A;  3IQO A;  3OX6 A;  1A03 A;  4QT3 A;  3MDY B;  2ZQU A;  4MLW A;  1SL7 A;  2K7B A;  2K7C A;  3TC5 A;  1JFJ A;  2KI6 D;  1SL9 A;  2NCP A;  4QJ3 B;  5BPJ A;  3OX5 A;  2MLX A;  3CLN A;  2EC6 B;  2AUC A;  2KNE A;  3M0W A;  3DF0 B;  1XA5 A;  3VRO A;  2RUC A;  3O5F A;  1ODB A;  1QV1 A;  3KHE A;  3O2P A;  1OZO A;  3NSO A;  1QX5 B;  2ZR4 A;  1CFC A;  1HXV A;  1SW8 A;  4CID A;  1CFD A;  1RWY A;  1SPY A;  1YUS A;  2KHN A;  3CTN A;  3O5M A;  2LUX A;  2LJ4 A;  2I7A A;  1ALW A;  3PM8 A;  2L51 A;  3VRR A;  3UF8 A;  3CS1 A;  2ZNE A;  2XP7 A;  5HUA A;  1S6J A;  1CFP A;  2IF4 A;  1UHK A;  2Q4U A;  1NSH A;  1SR6 B;  1UHI A;  2L50 A;  3PSR A;  4I5N B;  4ITZ A;  1UUR A;  2BL0 B;  1BF5 A;  3KZ7 A;  1DJG A;  5BXJ A;  4AQJ A;  2LHL A;  1KQV A;  1A75 B;  1F8A B;  2WOS A;  1H8B A;  1YUU A;  5GPG A;  1LA0 A;  4AQI A;  2ZR6 A;  5HKG A;  4GGN A;  1G4Y R;  2KBI A;  1XO5 A;  4MBE A;  2ZN8 A;  5B8I C;  5HTG A;  3I6C A;  2KI4 B;  1Y1U A;  2LVK A;  3I5H B;  1ZOT B;  1JBA A;  2OFN A;  5J3X A;  1HT9 A;  2M1K B;  4FAP A;  2JOJ A;  2M2A A;  5CSF A;  3PAL A;  5K89 A;  2JZV A;  1DJY A;  4M2Q A;  3KAF A;  4JFM A;  4TNC A;  1W7J B;  1NCX A;  1YRU B;  3CZT X;  4NDB A;  4PE7 A;  1BOD A;  1F70 A;  3B7X A;  2K2F A;  3H4S E;  4TW7 A;  2PV1 A;  2JNX A;  5HW8 A;  5J6E A;  1WRK A;  1AVS A;  2F33 A;  1BR4 B;  2ZR5 A;  2KYC A;  1MWN A;  2ZN9 A;  1IWQ A;  4CFR A;  1B8R A;  3CWG A;  1TCF A;  2CCM A;  4UPG A;  2JQ6 A;  2L0P A;  1FAP A;  3O5R A;  1L1P A;  2PPO A;  2MBX A;  1BJF A;  4DCK A;  1M46 A;  1AUI B;  2PAL A;  1SCV A;  2BL0 C;  4DRW A;  3TS5 C;  2LAN A;  5CSN A;  3TS5 B;  2LP3 A;  4OVN F;  4ODQ A;  1S5G Y;  1NPQ A;  1UWO A;  4LAV A;  4N5X A;  1IJ5 A;  1G8I A;  3DD4 A;  3BOW A;  2M29 A;  1NIW A;  1YAT A;  4TYO A;  1J4I A;  5KU1 A;  2ZQS A;  4W9Q A;  1DJZ A;  1MXE A;  3NXA A;  4I5K A;  3O5J A;  1DTL A;  3LCP C;  3H9R B;  3O5I A;  3PRD A;  1TOP A;  4TNS A;  3I5I C;  2XP3 A;  2EGD A;  3NSI A;  2Q5A A;  4PDZ A;  2JU0 A;  1NX1 A;  1H4B A;  1QVI Y;  4GGF C;  2Y1N A;  2KI3 A;  1GQM A;  2K61 A;  4OV2 A;  4YBH B;  1GJY A;  1B6C A;  3CR5 X;  4IL1 A;  4YRU A;  3O5P A;  2L4I A;  2L2S A;  1WDC B;  3JXV A;  1K9K A;  1FD9 A;  3OHM B;  3FWC A;  5HLO A;  3PLF B;  2PSR A;  4G50 A;  1N2D A;  4WRI A;  1QLS A;  1MR8 A;  2RUD A;  2A4J A;  2HF5 A;  1F54 A;  4DRN A;  5AER A;  2G9B A;  2LLS A;  1PSR A;  5G08 A;  4ODO A;  2TN4 A;  1QV0 A;  2LMT A;  4MN0 A;  1M31 A;  1CLM A;  5KSZ A;  1SR6 C;  1C7V A;  2PBC A;  3KAG A;  3O5D A;  1J7Q A;  2M3W A;  1M45 A;  3LK1 A;  2BE6 A;  1NUB A;  1TN4 A;  2JXL A;  1JF0 A;  1ZFS A;  4XJK A;  1CM1 A;  2E6W A;  3UQA A;  1LVC D;  1PAL A;  1V1F A;  3K21 A;  1YW5 A;  2KQ6 A;  2K7D A;  2N87 A;  3IK8 A;  2OS8 B;  1B8L A;  2LKN A;  3SG5 A;  2F2O A;  3BYA A;  1SMG A;  5CSI A;  1UHJ A;  1D1O A;  4BF8 A;  1B7T Z;  1SK6 D;  1FKF A;  1Y0O A;  2LAP A;  1K2H A;  1XK4 A;  1LA3 A;  2FJU B;  2GGZ A;  4WQ2 A;  2RUQ A;  1EJ3 A;  4MSP A;  1AJ4 A;  1DF0 B;  1MHO A;  1QAS A;  2L5X B;  4MZK A;  1BOC A;  1KFU L;  2XP5 A;  1F55 A;  5HWC A;  1EXR A;  3RLZ A;  4DIR A;  3HCM A;  2KQY A;  4JFJ A;  3EKH A;  1DJH A;  3O5L A;  1D7H A;  1TTX A;  1JC2 A;  2JT0 A;  4JYS A;  3D10 A;  1F4O A;  1TRF A;  2LLU A;  1QPF A;  4DZ2 A;  1GGW A;  1RJV A;  5ER5 A;  1QX7 A;  4QT2 A;  2RUR A;  1YX7 A;  1RRO A;  1TNX A;  1UP5 A;  4U8D A;  1R6P A;  2COL B;  1BLQ A;  3FAP A;  3PN7 B;  3ODK A;  4IPX A;  4ICB A;  4N19 A;  1LKJ A;  3CGM A;  3RFW A;  3O5K A;  1FBV A;  2HPS A;  4QJ4 B;  1M5Y A;  1QAT A;  2ZFD A;  1BG1 A;  4PE4 A;  2AAO A;  1ROT A;  1WY9 A;  3UQB A;  2LMV A;  3SG6 A;  1AHR A;  2RGI A;  2ZRS A;  2M1I A;  1IRJ A;  2KGB C;  1SY9 A;  1YVH A;  3SG2 A;  4D1E A;  1OOJ A;  1AK8 A;  1P5Q A;  1W26 A;  2PPP A;  2XP8 A;  1NX0 A;  1WLM A;  4PE1 A;  1BU3 A;  1SBJ A;  3TDZ A;  1A29 A;  1ALV A;  2M49 B;  4I5J A;  1KFX L;  5B8I B;  2KI4 C;  3I5H C;  2MJW B;  4GNK B;  2NLN A;  4JQ0 D;  2FKE A;  3KCE A;  1EG4 A;  3ZNI A;  1NCY A;  4QJ5 B;  2DG4 A;  2P6B B;  1PK0 D;  3EY6 A;  1NWD A;  4LAX A;  3PAT A;  1A2X A;  1M63 B;  2LVI A;  5D7F A;  2BBM A;  4GGQ A;  4DRK A;  1RTP 1;  2D9F A;  2KGR A;  3EVU A;  4R1E A;  1DJW A;  1QTX A;  2GGM A;  1IH0 A;  4CLN A;  4NDC A;  2XP6 A;  1JNS A;  4A4C A;  1FKD A;  3KAI A;  1ZK6 A;  1SYM A;  2JUL A;  2VN1 A;  5DIT A;  3D0Y A;  1KK7 Z;  1KT1 A;  1EQ3 A;  4DT4 A;  2PVB A;  3I5G B;  1XFW O;  1KQM B;  1VRK A;  2WC8 A;  4AOM A;  4PHN A;  2I94 A;  2LHI A;  3O5G A;  4MZL A;  2DG9 A;  3AAJ A;  3IHZ A;  1CMF A;  1BKF A;  3CGN A;  4W9P A;  5FYX A;  1CFF A;  2Y5I A;  3QRX A;  3EKJ A;  2KAY A;  1MQ1 A;  1N0Y A;  1K8U A;  4ETO A;  1NSG A;  3D0Y B;  3SIA A;  2WCE A;  4CPV A;  2PRU A;  1JNT A;  4BY4 A;  1CLB A;  1XFV O;  3TCZ A;  2LC5 A;  3MSE B;  3KPX A;  1FI6 A;  1J7R A;  2WCF A;  1XFZ O;  1DVI A;  3GOF A;  4E68 A;  2JT8 A;  2HQW A;  1K90 D;  4DZ3 A;  2MA2 A;  1AP4 A;  1QVI Z;  1TIZ A;  1NYA A;  1QLK A;  2BCX A;  2H61 A;  4F0Z B;  1FPW A;  1CLL A;  2ZND A;  3DVK A;  4GUK A;  5PAL A;  1YVL A;  1UHN A;  3BXK A;  2JWW A;  3JVT C;  1N1A A;  2QAC A;  3JYM A;  4ORA B;  3F45 A;  3RGC A;  1YR5 A;  3EK8 A;  2XPB A;  4R0X A;  1DJI A;  1TCO B;  5HW7 A;  1OE9 B;  1J6Y A;  1BT6 A;  3LLE A;  2KFG A;  3WHU B;  1TCO C;  3I5F B;  1WRZ A;  3RM1 A;  1JF2 A;  2H2K A;  3AAK A;  5I8N A;  4LAW A;  4ODN A;  3WH0 A;  1A75 A;  3I5I B;  2KO7 A;  2JZI A;  3KO0 A;  3SG4 A;  3PN7 C;  4YI9 A;  1FKL A;  1J7O A;  3TUY B;  3FWB A;  1PBK A;  4JFI A;  2HET A;  1Y0V H;  5HLV A;  2NCO A;  4OR9 B;  2GV5 A;  3BUM B;  2NZ0 A;  3CR2 A;  3DF0 A;  1K9U A;  1U5I A;  2K2A A;  2M97 A;  1T11 A;  5TNC A;  4TW8 A;  2KE0 A;  1QJT A;  2CXJ A;  2R2I A;  4MRX A;  2L4H A;  1PUL A;  2LMU A;  4ORC B;  2M1U A;  2O60 A;  2WND A;  3TDI A;  5D75 A;  2XP9 A;  4Q04 A;  4GAO A;  3NRK A;  1BR1 B;  2FCD A;  1HQV A;  5HW6 A;  1QX2 A;  1CMG A;  4N1G A;  3SG3 A;  1CNP A;  2M0R A;  2JC2 A;  3JTD B;  2LPV A;  2MLY A;  4LAY A;  1SCM B;  1CKK A;  4YGB B;  1K95 A;  1KWO C;  3BUW B;  2CTN A;  3O78 A;  5I2L A;  3BQ3 A;  2KI6 C;  3SG7 A;  2G2B A;  1V1G A;  1WLZ A;  2Y1M A;  2M9G A;  3NSK A;  1KFU S;  3AKB A;  4MEW A;  1A4P A;  3I5F C;  5F6T A;  1OMD A;  4U85 A;  4DRO A;  1XYD A;  1X02 A;  1S6C A;  2M7N A;  3ICB A;  4ZCV A;  4MVF A;  2LUC A;  2M08 A;  1EL4 A;  4GIV A;  2KFW A;  4PHM A;  2LLT A;  1DGV A;  3DVM A;  5JOL A;  1IQ3 A;  2JT3 A;  3ZWH A;  5HKW A;  3IQQ A;  4ODP A;  1RK9 A;  3NSL A;  5AXI A;  1CM4 A;  1IG5 A;  1Q6H A;  3NTP A;  1S26 D;  4P5O E;  1TNQ A;  2F2D A;  4OKH A;  1TNW A;  4ORB B;  3VRP A;  1CDP A;  1KCY A;  3CR4 X;  4G2P A;  4JFK A;  2KYF A;  1F40 A;  2XP4 A;  1F4Q A;  4MGV A;  1N65 A;  2MLF C;  3SIB A;  4J4N A;  3O6B A;  1IJ6 A;  1QXP A;  5AEQ A;  1D7J A;  1KT0 A;  4NNR A;  1XVJ A;  3O5O A;  1J55 A;  1Q6I A;  3E3R A;  1F71 A;  2B1U A;  3GPK A;  4DRQ A;  1ZAC A;  4MZJ A;  5CPV A;  1U5I B;  2CT9 A;  1D7I A;  1FKJ A;  4ODL A;  1PSB A;  3UQI A;  1Y1A A;  2F3Y A;  2PMY A;  1KWO B;  3GK4 X;  1FKT A;  1KK7 Y;  2LGO A;  4NDD A;  3UI6 A;  4DRM A;  3PFV A;  1DMO A;  1LXF C;  1Y1X A;  3WNX B;  5HT1 A;  3UI5 A;  3IKG A;  1R9H A;  4YGE B;  2PAS A;  2KGJ A;  5DIU A;  4J4O A;  1MUX A;  1JVW A;  4DRI A;  1E8A A;  5D69 A;  2LV7 A;  1Y6W A;  1KK8 B;  2BKI B;  2KFF A;  3LK0 A;  4DS7 A;  1B8C A;  3OP0 A;  3JYJ A;  2UZ5 A;  4GGF A;  1UHH A;  2LVV A;  2K7O A; 
#chains in the Genus database with same CATH topology
 4C0L A;  1L2O C;  1EYM A;  2EUL A;  2ZRT A;  3TZ1 A;  4ODM A;  3BOW B;  1ZCN A;  1F8H A;  3C1V A;  4DRN A;  1GGZ A;  2LVJ A;  2AWG A;  3OBV A;  4IQ2 A;  2WCB A;  5HKZ A;  3CDN A;  1D6O A;  2IS9 A;  1JCH B;  5DKN A;  4I5L B;  2A3A A;  2F21 A;  4A4B A;  4P8W A;  3TDB A;  3A4U B;  3CZ2 A;  4DWS A;  4DIP A;  1CTR A;  3QME A;  3I5G C;  1NX2 A;  4XYN A;  1YRT B;  2OPO A;  3ALG A;  4JPZ B;  1OW4 A;  3GK1 A;  1S1E A;  1BMO A;  2F8P A;  3EK4 A;  4USL A;  4FQO A;  1S36 A;  3NHI A;  2Y4Q A;  4HBO A;  2E30 A;  1FKG A;  1FJD A;  1XRV A;  1J1E A;  1L2O B;  1KSM A;  4MRY A;  1H0I A;  1CDM A;  1A7X A;  3D77 A;  1YUT A;  2O5G A;  1OZS A;  5HKY A;  3NI6 A;  1SKT A;  1FKS A;  4PT1 A;  1JUO A;  2SAS A;  2BKH B;  5CSJ A;  5IBW A;  4HRH A;  4HRG A;  4U84 A;  3JVT B;  1SNL A;  3D75 A;  2M7L A;  3BFA A;  2D8N A;  1CB1 A;  2MPH A;  2KFH A;  1SRA A;  1C07 A;  1Q80 A;  1JWD A;  2P71 A;  1ZUZ A;  1A03 A;  1B7T Y;  1E15 A;  2K7C A;  3TC5 A;  1JFJ A;  5BPJ A;  2KLD A;  3DF0 B;  1XA5 A;  3O5F A;  1QV1 A;  1OZO A;  3NSO A;  2ZR4 A;  4P8X A;  3L4A A;  2WCM A;  2LUX A;  2LJ4 A;  1HKJ A;  2I7A A;  3PSR A;  1UHI A;  2L50 A;  1HKM A;  2LHL A;  1A75 B;  2PQL A;  5GPG A;  1YUU A;  3UO9 A;  4GGN A;  5B8I C;  1E44 A;  2OFN A;  4FAP A;  1GOI A;  5CSF A;  2M2A A;  4S3K A;  4JFM A;  3CZT X;  4NDB A;  4KR0 B;  4TW7 A;  3PM2 A;  1TCF A;  4Z2J A;  3O5R A;  2PPO A;  2MBX A;  1SCV A;  4DRW A;  3TS5 C;  2LAN A;  2LP3 A;  4LAV A;  2QEO A;  3NHT A;  3PRD A;  2XP3 A;  3NSI A;  2Q5A A;  1UR9 A;  2KI3 A;  4IT6 A;  4YBH B;  1B6C A;  3FE9 A;  3FWC A;  3CZ0 A;  1XHG A;  3FE8 A;  1HJW A;  3ARR A;  1PSR A;  2LMT A;  4MN0 A;  1RD6 A;  4R5E A;  2DT3 A;  2BE6 A;  1NUB A;  1V1F A;  2KQ6 A;  2OS8 B;  2F2O A;  4BF8 A;  3SS3 A;  1FKF A;  2QEH A;  1LA3 A;  3FE6 A;  1EJ3 A;  1DF0 B;  1MHO A;  4MZK A;  3CHE A;  1F55 A;  1EXR A;  2WM0 A;  3EKH A;  1D7H A;  2JT0 A;  1TRF A;  2LLU A;  4NSB A;  4QT2 A;  2RUR A;  1YX7 A;  1RRO A;  3ARZ A;  1IX5 A;  3RFW A;  1M5Y A;  2HPS A;  4Z2I A;  1QAT A;  1BG1 A;  4PE4 A;  1OOF A;  1WY9 A;  3SG6 A;  1AHR A;  2ZRS A;  3SG2 A;  1AK8 A;  1SBJ A;  3I5H C;  3L4L A;  5FI2 A;  2DG4 A;  2WK2 A;  2P6B B;  1NWD A;  4DRK A;  3EVU A;  2XP6 A;  4NZC A;  3R72 A;  2VN1 A;  1KK7 Z;  1DEK A;  1EQ3 A;  1VRK A;  2I94 A;  2LHI A;  2DG9 A;  3IHZ A;  1CMF A;  3SIA A;  4MTV A;  3EIP A;  1FPW A;  1UR8 A;  1QLK A;  2H61 A;  3DVK A;  1YVL A;  3JYM A;  3JVT C;  2QAC A;  4ORA B;  3RGC A;  3EK8 A;  3S0G A;  4R0X A;  1TCO B;  1BT6 A;  3WHU B;  1WRZ A;  1JF2 A;  1CTN A;  5I8N A;  3ARX A;  3WH0 A;  3I5I B;  2JZI A;  3AS0 A;  1W1P A;  1J7O A;  3FWB A;  1PBK A;  4JFI A;  4Z2G A;  4OR9 B;  2GV5 A;  1OOG A;  1D2K A;  2KE0 A;  2WND A;  3NRK A;  2FCD A;  2YBT A;  3SG3 A;  2LPV A;  4LAY A;  1V1G A;  4WKH A;  5F6T A;  1S6C A;  4Z2K A;  2WLY A;  2LLT A;  1DGV A;  4ODP A;  1RK9 A;  1S26 D;  4MGV A;  1N65 A;  2PYQ A;  3O6B A;  1IJ6 A;  3O5O A;  1W9U A;  1E6P A;  2CT9 A;  3UQI A;  1FKJ A;  1LJY A;  3GK4 X;  1FKT A;  1KK7 Y;  3UI6 A;  5HT1 A;  2KGJ A;  1MUX A;  3WD0 A;  3NGV A;  3OGN A;  1B8C A;  2QEV A;  4GGF A;  4KYN A;  1U79 A;  2PPN A;  1Z2C B;  4M2P A;  2H8V A;  2DG3 A;  2JNF A;  1XFY O;  1QS7 A;  2MHH A;  2B5U B;  4GBA A;  2JPT A;  2KAX A;  5HWB A;  1Q6U A;  1NCZ A;  2WCL A;  3JTD C;  1X6L A;  4WQ3 A;  5GQQ C;  2ITK A;  4ODR A;  2K60 A;  3TDU A;  1KFX S;  2CNP A;  1LS8 A;  3OB2 B;  3EVV A;  1DF0 A;  4ODK A;  2BCB A;  5KTY A;  3A8R A;  4IQC A;  2LNK A;  3GK2 A;  1NWS A;  2ZQT A;  4L9M A;  1S5G Z;  2L2E A;  1B47 A;  2BEC A;  3BUO B;  1OMR A;  2XPA A;  2P4V A;  1F40 A;  1PRW A;  2BE4 A;  4DWS C;  5I98 A;  4HBE A;  1J7P A;  3BUX B;  2M8U A;  1S6I A;  1NP8 A;  4DH0 A;  1YTZ C;  1FKK A;  2ZQV A;  2MLZ A;  2WCJ A;  4C0K A;  2PN0 A;  1RFJ A;  1HJX A;  2Y78 A;  3AKA A;  1REC A;  2LCP A;  2PV2 A;  1J1D A;  1SL8 A;  4HAR A;  3VRN A;  3B7A A;  2DOQ A;  4XJK B;  4JFL A;  1BL4 A;  1EIB A;  4DRJ A;  3O5E A;  3UI4 A;  3BUN B;  4FTG A;  4TX0 A;  1T14 A;  3AS2 A;  2SCP A;  1NMV A;  4M2O A;  2F3Z A;  2K0J A;  3KAB A;  2NXQ A;  1C9H A;  3CGA A;  3IF7 A;  1FI5 A;  3KAH A;  1K94 A;  3UNW A;  4P8U A;  1K9P A;  4P8V A;  2KAV A;  1B4C A;  4GFT A;  3CHD A;  2MRD A;  4YGD B;  1IIO A;  3IQO A;  3MDY B;  2K7B A;  3OX5 A;  2RUC A;  1HXV A;  1QX5 B;  1SW8 A;  1RWY A;  1SPY A;  2KHN A;  2L51 A;  3UF8 A;  3D73 A;  3RM4 A;  3B86 A;  1S6J A;  1UHK A;  2Q4U A;  4TW8 A;  2WCK A;  4I5N B;  1UUR A;  4INW A;  1BF5 A;  4AQJ A;  2A3C A;  1LQ0 A;  1FFQ A;  1KQV A;  1F8A B;  1H8B A;  2ZR6 A;  2KBI A;  3AS1 A;  4Q7N A;  1XO5 A;  2LVK A;  1Y1U A;  1HT9 A;  2M1K B;  2JOJ A;  4S3J A;  2JZV A;  3D74 A;  1NCX A;  4PE7 A;  2JPO A;  4ZPV R;  4URI A;  2JNX A;  1BR4 B;  3N7H A;  1LG1 A;  4PTM A;  2ZN9 A;  1IWQ A;  4CFR A;  4UDM A;  4MNJ A;  2CCM A;  1M46 A;  2PAL A;  3B9A A;  2YGU A;  1S5G Y;  4Q22 A;  3BOW A;  5KU1 A;  1DJZ A;  3O5J A;  3O5I A;  2EGD A;  2JU0 A;  2Y1N A;  2F23 A;  3OA5 A;  1GJY A;  3CR5 X;  4IL1 A;  3GU0 A;  2L4I A;  3JXV A;  1K9K A;  4WJX A;  2PSR A;  4G50 A;  1N2D A;  1MR8 A;  1JND A;  1W1Y A;  1F54 A;  2TN4 A;  2PBC A;  3BFH A;  2JXL A;  1JF0 A;  4XJK A;  1PAL A;  2K7D A;  3IK8 A;  1UHJ A;  1DEL A;  1XK4 A;  2GGZ A;  1E6R A;  4WQ2 A;  4MSP A;  1TUJ A;  3S0F A;  5HWC A;  4DIR A;  4JYS A;  3D10 A;  3R1V A;  5ER5 A;  1UP5 A;  4U8D A;  1R6P A;  3FAP A;  3S0E A;  2ZFD A;  4XAK A;  3UQB A;  2LMV A;  3FXY A;  4MAV A;  1SY9 A;  2XP8 A;  2AOS A;  4PE1 A;  4INX A;  1ALV A;  2M49 B;  2KI4 C;  3KCE A;  1EG4 A;  1NCY A;  1PK0 D;  1NWR A;  2LVI A;  1ZL1 A;  1ZBC A;  4A4C A;  1ZK6 A;  5DIT A;  4ZPW R;  2PVB A;  1KQM B;  4PHN A;  3O5G A;  5FI7 A;  5FI6 A;  2WC6 A;  1MQ1 A;  1K8U A;  1NSG A;  1LL6 A;  1W1T A;  1XFV O;  3KPX A;  1FI6 A;  3R1P A;  1DVI A;  2JT8 A;  4DZ3 A;  1QVI Z;  1TIZ A;  2DSW A;  1CLL A;  5PAL A;  2G41 A;  1UHN A;  3BXK A;  5JH8 A;  1DJI A;  4ODN A;  1A75 A;  3SG4 A;  3PN7 C;  4YI9 A;  3S0D A;  2HET A;  2NCO A;  3B88 A;  3CHF A;  4WKA A;  3DF0 A;  1GPF A;  1U5I A;  1T11 A;  4MPK A;  2CXJ A;  4MRX A;  4ORC B;  1PUL A;  2O60 A;  5D75 A;  4GAO A;  3W4R A;  1HQV A;  1QX2 A;  3WL1 A;  3JTD B;  2MLY A;  1SCM B;  4YGB B;  1KWO C;  3BUW B;  5I2L A;  3O78 A;  4Z2L A;  2G2B A;  2Y1M A;  2M9G A;  3NSK A;  4U85 A;  4MEW A;  3R1O A;  4DRO A;  1XYD A;  1X02 A;  2M08 A;  1EL4 A;  2KFW A;  5JOL A;  3DVM A;  1IQ3 A;  3NSL A;  1Q6H A;  4DWS B;  4P5O E;  1TNQ A;  2F2D A;  3D78 A;  1TNW A;  4ORB B;  1CDP A;  3CR4 X;  1O6I A;  4G2P A;  3SIB A;  4J4N A;  1E6Z A;  2B1U A;  3D76 A;  5CPV A;  1U5I B;  1D7I A;  4ODL A;  1KWO B;  3B8S A;  3IKG A;  4J4O A;  1Y6W A;  2BKI B;  3OP0 A;  3AAK A;  1UHH A;  2K7O A;  1LIN A;  2K8M B;  4IJ7 A;  1OGB A;  4JWQ A;  1FF1 A;  5I94 A;  1EG3 A;  4FQT A;  2MF9 A;  1W9Z A;  2OTG B;  4DRP A;  2LM5 A;  1EH2 A;  1IGV A;  5I2Q A;  3KAC A;  4JD9 A;  4O2T A;  3VRQ A;  1ZMZ A;  2F4E A;  2FOT A;  3IKD A;  2F2P A;  1NH6 A;  4HSZ A;  5HYD A;  5ER4 X;  1QPL A;  4C02 B;  1DJX A;  3BJH A;  4ZCU A;  5AAN A;  1CDL A;  3FS7 A;  3OOB A;  3CAB A;  3LUO A;  1WDC C;  4GPL B;  2KLE A;  3KEV A;  2H61 C;  1XK4 C;  1X6N A;  2MAZ A;  2OLH A;  2Q91 A;  5EL2 A;  4NQG A;  4PHJ A;  3EK7 A;  1WRL A;  4ODQ A;  2JXC A;  1FKB A;  4L72 B;  4PE0 A;  1IKU A;  1KSO A;  3AS3 A;  1TNP A;  2KDH A;  3KAD A;  1DGU A;  2DSZ A;  1FKH A;  4YGA A;  2KR7 A;  4U86 A;  2CBL A;  2RSE A;  1XFU O;  3FY1 A;  3PRB A;  2AMI A;  1EHN A;  1G33 A;  5AFP A;  2PI6 A;  2KBM A;  1B1G A;  3G6L A;  4OCI A;  2L98 A;  1MXL C;  2DT2 A;  4CFQ A;  3ARV A;  4TW6 A;  1WNO A;  2QDI A;  1NX3 A;  5D3O A;  1OOI X;  1YUR A;  2OS8 C;  3WD3 A;  1FKR A;  1M39 A;  4ZS6 A;  2VRG A;  4P2Y B;  2MNT A;  1WB0 A;  2MLE C;  3VB1 A;  2WC5 A;  2VCD A;  1K96 A;  2I18 A;  4Z2H A;  3LL8 B;  1UUS A;  1XFX O;  4QT3 A;  1IQ5 A;  2DSV A;  2ZQU A;  4MLW A;  1SL7 A;  2KI6 D;  2NCP A;  4QJ3 B;  2MLX A;  2EC6 B;  2AUC A;  2KNE A;  1ODB A;  3KHE A;  2QF8 A;  1CFC A;  4CID A;  1YUS A;  3O5M A;  1ALW A;  3PM8 A;  3BFB A;  3CS1 A;  2ZNE A;  2XP7 A;  5HUA A;  1CFP A;  2ERB A;  1NSH A;  4ITZ A;  5BXJ A;  1DJG A;  2WOS A;  1LA0 A;  2ZN8 A;  3I6C A;  3I5H B;  1E6N A;  1ZOT B;  5J3X A;  5K89 A;  3KAF A;  1W7J B;  1YRU B;  1BOD A;  1NWU A;  2K2F A;  3CH9 A;  3H4S E;  5HW8 A;  5J6E A;  1AVS A;  2ZR5 A;  2KYC A;  3PJI A;  1B8R A;  1L1P A;  1LG2 A;  1BJF A;  1P28 A;  1GRJ A;  3ART A;  3TS5 B;  4OVN F;  1WAW A;  1NPQ A;  1UWO A;  4N5X A;  1G8I A;  3DD4 A;  2ETN A;  4TYO A;  2M29 A;  1NIW A;  1FFR A;  1YAT A;  4L3N A;  4W9Q A;  1MXE A;  3NXA A;  4TNS A;  3WD1 A;  1DTL A;  3H9R B;  1TOP A;  3B87 A;  3I5I C;  4PDZ A;  5HBF A;  1QVI Y;  1HKK A;  1GQM A;  2K61 A;  4OV2 A;  4YRU A;  1ZBW A;  2L2S A;  1WDC B;  1FD9 A;  5HLO A;  2P70 A;  3PLF B;  3WD4 A;  1C3Z A;  1QLS A;  3WL0 A;  2RUD A;  2A4J A;  2G9B A;  2LLS A;  5G08 A;  4ODO A;  2FJY A;  1CLM A;  5KSZ A;  3O5D A;  1J7Q A;  3V2L A;  5GPR A;  2M3W A;  1TN4 A;  2E6W A;  3UQA A;  1LVC D;  3K21 A;  3SG5 A;  3BYA A;  5CSI A;  5DEZ A;  1SK6 D;  1Y0O A;  2LAP A;  1K2H A;  2BNX A;  1BOC A;  1KFU L;  3RLZ A;  4JFJ A;  2KQY A;  4AY1 A;  1DJH A;  3O5L A;  1TTX A;  1JC2 A;  1QPF A;  1GGW A;  2ESC A;  1RJV A;  4MNL A;  1TNX A;  2COL B;  4IPX A;  4MNM A;  3PN7 B;  4N19 A;  1LKJ A;  3O5K A;  4QJ4 B;  2RGI A;  2M1I A;  1IRJ A;  1W26 A;  1YVH A;  4D1E A;  3CZ8 A;  5DO2 A;  1WLM A;  3JYJ A;  4I5J A;  5B8I B;  4OZD A;  2NLN A;  3ZNI A;  4QJ5 B;  3B9E A;  3EY6 A;  4LAX A;  3PAT A;  1A2X A;  4GGQ A;  5D7F A;  3B6X A;  2BBM A;  1LL7 A;  1RTP 1;  2D9F A;  4R1E A;  1DJW A;  1IH0 A;  4CLN A;  2L5Y A;  3KAI A;  2DSU A;  1H0G A;  1SYM A;  2JUL A;  3K1E A;  2A3E A;  1KT1 A;  4DT4 A;  3DYE A;  4W9P A;  5FYX A;  1CFF A;  3QRX A;  4ETO A;  3D0Y B;  2WCE A;  4CPV A;  1CLB A;  3TCZ A;  3MSE B;  2WCF A;  1XFZ O;  4E68 A;  3IVT A;  3AQU A;  1K90 D;  1AP4 A;  1NYA A;  4F0Z B;  2ZND A;  4GUK A;  1N1A A;  2JWW A;  1YR5 A;  2IUZ A;  1J6Y A;  1OE9 B;  2KFG A;  1TCO C;  4LAW A;  2G8Z A;  3I5F B;  2H2K A;  4JKT A;  3ARS A;  2KO7 A;  3KO0 A;  1FKL A;  1VF8 A;  3DY9 A;  3BUM B;  2NZ0 A;  1QWV A;  5TNC A;  2L4H A;  2LMU A;  3TDI A;  2M1U A;  2XP9 A;  1BR1 B;  1CMG A;  4N1G A;  2JC2 A;  1E9L A;  4WK9 A;  3BQ3 A;  2KI6 C;  3DXL A;  3SG7 A;  4ML4 A;  1WLZ A;  1KFU S;  3AKB A;  3I5F C;  1OMD A;  4ZCV A;  4MNK A;  4PHM A;  2JT3 A;  5HKW A;  2DT1 A;  3NTP A;  3VRP A;  4JFK A;  1F4Q A;  4WIW A;  2MLF C;  1W9P A;  5AEQ A;  1KT0 A;  1J55 A;  1Q6I A;  3E3R A;  3GPK A;  1ZAC A;  1PSB A;  1Y1A A;  4NDD A;  4DRM A;  3PFV A;  3WNX B;  1JVW A;  1E8A A;  1W1V A;  1KK8 B;  2UZ5 A;  2LVV A;  3WD2 A;  3DVE A;  2KOT A;  5HL1 A;  1NWT A;  3ARY A;  4PAL A;  2WOR A;  1DQE A;  2I2R E;  1DT7 B;  1PVA A;  1JSA A;  1KQM C;  1QIW A;  3DVJ A;  2PV3 A;  5DKR A;  4BY5 A;  4C0J A;  4PHK A;  3ALF A;  2HQ8 A;  2BCA A;  2EHB A;  2QEB A;  5DIV A;  2K8I A;  3RME A;  4QZV B;  3RZS A;  3WHT B;  1HKI A;  3EVR A;  1JFK A;  1PIN A;  1KK8 C;  1TUZ A;  2FAP A;  1S3P A;  3TUY C;  2ZKM X;  2YBU A;  1Q1C A;  3RM8 A;  3VAW A;  2EC6 C;  1YX8 A;  1B9A A;  3SS4 A;  1OOH A;  1FW4 A;  2OTG C;  1AJ5 A;  1XFR A;  4N1F A;  2JRF A;  1W9V A;  5DKQ A;  5JJG A;  4DZ2 A;  3EG5 B;  4W9O A;  2LE9 B;  2FCE A;  1K93 D;  1HJV A;  1L7Z A;  1PVB A;  3VGO A;  3WXA A;  3FIA A;  3KF9 A;  3WQV A;  2RQS A;  1K9T A;  1J4R A;  1CDN A;  1OSA A;  5I2O A;  1C7W A;  4FN2 A;  1SCM C;  1OQP A;  2O9O A;  4W5U A;  1QIV A;  1OMV A;  4PCW A;  1KFW A;  3HX4 A;  1SR0 A;  2LP2 A;  1ROU A;  3PA7 A;  2QPT A;  4DRH A;  4HRE E;  1LL4 A;  1JNE A;  3O4Y A;  2DPE A;  4YI8 A;  5DIC A;  3OB1 B;  3SJS A;  3DZT A;  4YGC B;  4IT4 A;  2BAP A;  1R2U A;  1QZ2 A;  2JTT A;  3CHC A;  2V53 A;  2ISD A;  1MF8 B;  2KSP A;  1NMW A;  4QIB A;  1W7I B;  3O5Q A;  4DUQ A;  1J4H A;  1FKI A;  2BBN A;  2JTZ A;  3OX6 A;  1SL9 A;  3CLN A;  3M0W A;  3VRO A;  3O2P A;  1CFD A;  3G6M A;  3CTN A;  3VRR A;  2IF4 A;  2GTE A;  1SR6 B;  2BL0 B;  3KZ7 A;  4AQI A;  5HKG A;  1G4Y R;  1ZBV A;  4MBE A;  5HTG A;  2KI4 B;  2L2C A;  1JBA A;  3PAL A;  1DC1 A;  1SYT A;  4F7F A;  2WLZ A;  1DJY A;  4M2Q A;  4TNC A;  3S0A A;  1F70 A;  3B7X A;  2PV1 A;  1GUV A;  3CZ1 A;  1WRK A;  3ARQ A;  3L47 A;  2F33 A;  3SS5 A;  1MWN A;  3CWG A;  4WKF A;  4UPG A;  2JQ6 A;  2L0P A;  1FAP A;  3GTY X;  4DCK A;  1AUI B;  2BL0 C;  5CSN A;  3ARO A;  1IJ5 A;  3S0B A;  1J4I A;  2ZQS A;  1ZBK A;  4I5K A;  3LCP C;  3RM9 A;  2DT0 A;  1NX1 A;  1H4B A;  4GGF C;  2WCH A;  3O5P A;  3OHM B;  1ZU8 A;  3B9D A;  1Z4H A;  4WRI A;  2HF5 A;  1TWO A;  5AER A;  1TFV A;  1QV0 A;  1M31 A;  3PRA A;  1C7V A;  1SR6 C;  3KAG A;  3LK1 A;  1M45 A;  1ZFS A;  1CM1 A;  1YW5 A;  2N87 A;  1B8L A;  2LKN A;  1D1O A;  1SMG A;  1B7T Z;  2RUQ A;  2FJU B;  1GM0 A;  3BMB A;  1AJ4 A;  2L5X B;  3QOK A;  1QAS A;  2XP5 A;  3HCM A;  1F4O A;  3ARP A;  1QX7 A;  1BLQ A;  3ODK A;  4ICB A;  3CGM A;  2FDM A;  1FBV A;  2AAO A;  1ROT A;  2KGB C;  1OOJ A;  1P5Q A;  2PPP A;  1NX0 A;  1BU3 A;  3TDZ A;  5GQB A;  1A29 A;  1KFX L;  2MJW B;  4GNK B;  3Q8I A;  4JQ0 D;  2A3B A;  2FKE A;  3ARW A;  1M63 B;  4DWS D;  2KGR A;  1QTX A;  2GGM A;  1JNS A;  4NDC A;  1FKD A;  2KPH A;  4ZPT R;  3D0Y A;  3I5G B;  1XFW O;  2WC8 A;  3O4X A;  4AOM A;  4MZL A;  3AAJ A;  3CGN A;  1BKF A;  2Y5I A;  3EKJ A;  1OWQ A;  2KAY A;  1N0Y A;  2PRU A;  1JNT A;  3ARU A;  4LGX A;  4BY4 A;  2LC5 A;  1J7R A;  3GOF A;  2HQW A;  2MA2 A;  2BCX A;  3F45 A;  2XPB A;  5HW7 A;  3LLE A;  3RM1 A;  3TUY B;  1Y0V H;  5HLV A;  3CR2 A;  1K9U A;  2K2A A;  2M97 A;  1EDQ A;  1SSE B;  1QJT A;  2R2I A;  4Q04 A;  5HW6 A;  1CNP A;  2M0R A;  1ORG A;  1K95 A;  2CTN A;  2O92 A;  4KQZ A;  1A4P A;  2M7N A;  3ICB A;  4GIV A;  4MVF A;  2LUC A;  1ITX A;  3BXW A;  3ZWH A;  3IQQ A;  5AXI A;  1CM4 A;  1IG5 A;  4OKH A;  3WKZ A;  1KCY A;  2KYF A;  2XP4 A;  1ZB5 A;  1QXP A;  1D7J A;  4NNR A;  1XVJ A;  1F71 A;  4DRQ A;  1C3Y A;  2B31 A;  4MZJ A;  2F3Y A;  2PMY A;  3WIJ A;  2LGO A;  3PR9 A;  5DF0 A;  1DMO A;  1LXF C;  1Y1X A;  3UI5 A;  1OGG A;  1R9H A;  4YGE B;  2PAS A;  5DIU A;  3WQW A;  4DRI A;  3CYZ A;  5D69 A;  2LV7 A;  2KFF A;  3LK0 A;  4DS7 A;  1CKK A; 
#chains in the Genus database with same CATH homology
 4QZV B;  3WD2 A;  1LIN A;  2K8M B;  2KOT A;  3DVE A;  4C0L A;  1NWT A;  3ARY A;  4PAL A;  1OGB A;  1L2O C;  1EYM A;  2WOR A;  1U79 A;  4JWQ A;  2PPN A;  4M2P A;  2ZRT A;  2DG3 A;  1FF1 A;  2JNF A;  1XFY O;  3TZ1 A;  4ODM A;  1EG3 A;  1QS7 A;  2MHH A;  2I2R E;  2JPT A;  2KAX A;  1PVA A;  4GBA A;  2OTG B;  1DT7 B;  1JSA A;  1KQM C;  2MF9 A;  1QIW A;  3DVJ A;  2PV3 A;  5DKR A;  4DRP A;  4BY5 A;  4C0J A;  5HWB A;  2LM5 A;  1EH2 A;  1IGV A;  4PHK A;  1Q6U A;  5I2Q A;  3ALF A;  2HQ8 A;  3KAC A;  1NCZ A;  2BCA A;  3BOW B;  2EHB A;  3JTD C;  1X6L A;  4O2T A;  4WQ3 A;  3VRQ A;  1ZMZ A;  5GQQ C;  2FOT A;  2F4E A;  2ITK A;  3IKD A;  2F2P A;  1NH6 A;  1ZCN A;  4HSZ A;  2K8I A;  1F8H A;  3C1V A;  4ODR A;  1GGZ A;  2LVJ A;  5HYD A;  2AWG A;  3TDU A;  4IQ2 A;  2WCB A;  5HKZ A;  1KFX S;  2CNP A;  5ER4 X;  1QPL A;  4C02 B;  1DJX A;  1D6O A;  2IS9 A;  3OB2 B;  3WHT B;  1HKI A;  3EVR A;  5DKN A;  4I5L B;  1JFK A;  1PIN A;  2A3A A;  1KK8 C;  4ZCU A;  5AAN A;  2F21 A;  3EVV A;  1CDL A;  3FS7 A;  2FAP A;  1DF0 A;  4ODK A;  2BCB A;  1S3P A;  5KTY A;  3A8R A;  4IQC A;  4A4B A;  2LNK A;  3GK2 A;  3TUY C;  3OOB A;  4P8W A;  4QT3 A;  1NWS A;  2ZKM X;  2YBU A;  2ZQT A;  1Q1C A;  3LUO A;  3RM8 A;  3TDB A;  1WDC C;  4L9M A;  3VAW A;  3A4U B;  4GPL B;  2EC6 C;  1YX8 A;  1S5G Z;  1B9A A;  4DWS A;  4DIP A;  3KEV A;  2L2E A;  1CTR A;  1FW4 A;  2H61 C;  1XK4 C;  1X6N A;  4DRO A;  2OTG C;  1AJ5 A;  2MAZ A;  1B47 A;  3I5G C;  2OLH A;  2Q91 A;  4N1F A;  2BEC A;  2JRF A;  1W9V A;  5DKQ A;  4NQG A;  5JJG A;  1NX2 A;  4PHJ A;  3EK7 A;  1WRL A;  3BUO B;  1OMR A;  2JXC A;  2XPA A;  4XYN A;  1PRW A;  2BE4 A;  1YRT B;  1FKB A;  4PE0 A;  1IKU A;  2OPO A;  4HBE A;  4L72 B;  4W9O A;  4DWS C;  5I98 A;  1KSO A;  1J7P A;  2LE9 B;  3ALG A;  2FCE A;  1K93 D;  1HJV A;  1L7Z A;  3AS3 A;  3BUX B;  2M8U A;  4JPZ B;  1S6I A;  1TNP A;  2KDH A;  3GK1 A;  3KAD A;  1PVB A;  1NP8 A;  1S1E A;  1DGU A;  3VGO A;  3WXA A;  2DSZ A;  4DH0 A;  1FKH A;  4YGA A;  1YTZ C;  2KR7 A;  4U86 A;  5GQB A;  1FKK A;  3FIA A;  3KF9 A;  2ZQV A;  2MLZ A;  1BMO A;  2F8P A;  3EK4 A;  2CBL A;  3WQV A;  4USL A;  2RQS A;  4FQO A;  1K9T A;  1S36 A;  4C0K A;  1CDN A;  1OSA A;  1RFJ A;  2Y4Q A;  5I2O A;  1J4R A;  1HJX A;  2Y78 A;  4HBO A;  1C7W A;  3AKA A;  2E30 A;  2RSE A;  1REC A;  4FN2 A;  1SCM C;  1FKG A;  1OQP A;  1XFU O;  2LCP A;  1FJD A;  2PV2 A;  1J1D A;  1XRV A;  1J1E A;  1SL8 A;  3FY1 A;  1L2O B;  2O9O A;  3PRB A;  4TW8 A;  2AMI A;  1EHN A;  4HAR A;  1QIV A;  4W5U A;  1KSM A;  1G33 A;  5AFP A;  4MRY A;  3VRN A;  1H0I A;  1OMV A;  4PCW A;  2PI6 A;  2DOQ A;  1CDM A;  2KBM A;  1B1G A;  3G6L A;  1KFW A;  4XJK B;  3HX4 A;  1SR0 A;  4OCI A;  2L98 A;  4JFL A;  2LP2 A;  1A7X A;  1ROU A;  1BL4 A;  1EIB A;  4DRJ A;  3O5E A;  3UI4 A;  3PA7 A;  1MXL C;  2QPT A;  2DT2 A;  4DRH A;  3BUN B;  4FTG A;  4HRE E;  4CFQ A;  4TX0 A;  1LL4 A;  3ARV A;  1YUT A;  1JNE A;  3O4Y A;  2O5G A;  4TW6 A;  1WNO A;  2DPE A;  4YI8 A;  5DIV A;  1OZS A;  3OB1 B;  1NX3 A;  5HKY A;  3AS2 A;  3NI6 A;  3SJS A;  2SCP A;  1NMV A;  1ZL1 A;  1YUR A;  2OS8 C;  4M2O A;  2F3Z A;  2K0J A;  4YGC B;  3KAB A;  3WD3 A;  1SKT A;  1FKS A;  2NXQ A;  4IT4 A;  1JUO A;  1R2U A;  2SAS A;  2JTT A;  1QZ2 A;  2V53 A;  3CHC A;  1C9H A;  1FKR A;  2BKH B;  5CSJ A;  5IBW A;  4HRH A;  1M39 A;  4HRG A;  2ISD A;  3CGA A;  4ZS6 A;  2VRG A;  3JVT B;  4P2Y B;  1SNL A;  3IF7 A;  2MNT A;  4U84 A;  2M7L A;  1MF8 B;  2D8N A;  2KSP A;  1CB1 A;  1NMW A;  1WB0 A;  2MPH A;  4QIB A;  1W7I B;  1FI5 A;  3KAH A;  2MLE C;  3O5Q A;  4DUQ A;  1K94 A;  2KFH A;  1J4H A;  2VCD A;  1K96 A;  4P8U A;  1SRA A;  1K9P A;  2I18 A;  1C07 A;  4P8V A;  4Z2H A;  2KAV A;  1B4C A;  3LL8 B;  4GFT A;  1FKI A;  3CHD A;  2MRD A;  4YGD B;  1UUS A;  1Q80 A;  1JWD A;  2BBN A;  1XFX O;  1ZUZ A;  1IQ5 A;  1B7T Y;  2JTZ A;  3IQO A;  3OX6 A;  1A03 A;  1E15 A;  2DSV A;  3MDY B;  2ZQU A;  4MLW A;  1SL7 A;  2K7B A;  2K7C A;  3TC5 A;  1JFJ A;  2KI6 D;  1SL9 A;  2NCP A;  4QJ3 B;  5BPJ A;  3OX5 A;  2MLX A;  3CLN A;  2EC6 B;  2AUC A;  2KNE A;  3M0W A;  3DF0 B;  1XA5 A;  3VRO A;  2RUC A;  3O5F A;  1ODB A;  1QV1 A;  3KHE A;  3O2P A;  1OZO A;  3NSO A;  1QX5 B;  2QF8 A;  1CFC A;  2ZR4 A;  1SW8 A;  1HXV A;  4CID A;  1CFD A;  1RWY A;  1SPY A;  1YUS A;  2KHN A;  3G6M A;  3CTN A;  4P8X A;  3O5M A;  2LUX A;  2LJ4 A;  1HKJ A;  2I7A A;  1ALW A;  3PM8 A;  2L51 A;  3VRR A;  3UF8 A;  3CS1 A;  2ZNE A;  2XP7 A;  3RM4 A;  5HUA A;  1S6J A;  1CFP A;  2IF4 A;  1UHK A;  2Q4U A;  4LAX A;  1NSH A;  1SR6 B;  1UHI A;  2L50 A;  3PSR A;  4I5N B;  4ITZ A;  1UUR A;  2BL0 B;  1BF5 A;  1HKM A;  1DJG A;  3KZ7 A;  5BXJ A;  4AQJ A;  2A3C A;  1LQ0 A;  2LHL A;  1FFQ A;  1KQV A;  1A75 B;  1F8A B;  2WOS A;  1H8B A;  1YUU A;  5GPG A;  1LA0 A;  4AQI A;  2ZR6 A;  5HKG A;  4GGN A;  1G4Y R;  2KBI A;  3AS1 A;  4Q7N A;  1ZBV A;  1XO5 A;  4MBE A;  2ZN8 A;  5B8I C;  5HTG A;  3I6C A;  2KI4 B;  1Y1U A;  2LVK A;  3I5H B;  1ZOT B;  1E6N A;  1JBA A;  2OFN A;  5J3X A;  1HT9 A;  2M1K B;  4FAP A;  2JOJ A;  1GOI A;  5CSF A;  2M2A A;  3PAL A;  4S3J A;  5K89 A;  1SYT A;  2JZV A;  4S3K A;  2WLZ A;  1DJY A;  4M2Q A;  3KAF A;  4JFM A;  4TNC A;  1W7J B;  1NCX A;  1YRU B;  3CZT X;  4NDB A;  4PE7 A;  1BOD A;  1NWU A;  1F70 A;  3B7X A;  4ZPV R;  2K2F A;  4KR0 B;  3CH9 A;  3H4S E;  4TW7 A;  2PV1 A;  4URI A;  1GUV A;  2JNX A;  5HW8 A;  5J6E A;  1WRK A;  1AVS A;  3ARQ A;  2F33 A;  1BR4 B;  1LG1 A;  4PTM A;  2ZR5 A;  4LAW A;  2KYC A;  1MWN A;  2ZN9 A;  1IWQ A;  4CFR A;  1B8R A;  3CWG A;  1TCF A;  2CCM A;  4UPG A;  4MNJ A;  4WKF A;  4Z2J A;  2JQ6 A;  2L0P A;  1FAP A;  3O5R A;  1L1P A;  1LG2 A;  2PPO A;  2MBX A;  1BJF A;  4DCK A;  1M46 A;  1AUI B;  2PAL A;  1SCV A;  2BL0 C;  4DRW A;  3TS5 C;  2LAN A;  3B9A A;  5CSN A;  3ART A;  3TS5 B;  2LP3 A;  4OVN F;  4ODQ A;  1S5G Y;  3ARO A;  1WAW A;  1NPQ A;  1UWO A;  4LAV A;  4N5X A;  1IJ5 A;  4Q22 A;  1G8I A;  3DD4 A;  3BOW A;  2M29 A;  1NIW A;  1FFR A;  1YAT A;  4TYO A;  1J4I A;  5KU1 A;  4L3N A;  2ZQS A;  4W9Q A;  1DJZ A;  1ZBK A;  1MXE A;  3NXA A;  4I5K A;  3O5J A;  1DTL A;  3LCP C;  3H9R B;  3O5I A;  3PRD A;  1TOP A;  4TNS A;  3I5I C;  2XP3 A;  3RM9 A;  2EGD A;  3NSI A;  2Q5A A;  1UR9 A;  2DT0 A;  4PDZ A;  2JU0 A;  1NX1 A;  1H4B A;  5HBF A;  1QVI Y;  4GGF C;  2Y1N A;  2KI3 A;  1HKK A;  1GQM A;  2K61 A;  4OV2 A;  4YBH B;  1GJY A;  1B6C A;  3OA5 A;  3CR5 X;  4IT6 A;  4IL1 A;  4YRU A;  1ZBW A;  3O5P A;  2L4I A;  2L2S A;  1WDC B;  3JXV A;  1K9K A;  4WJX A;  1FD9 A;  3OHM B;  3FWC A;  5HLO A;  1ZU8 A;  3PLF B;  3B9D A;  3WD4 A;  2PSR A;  4G50 A;  1XHG A;  1N2D A;  4WRI A;  1QLS A;  1MR8 A;  2RUD A;  1JND A;  3WL0 A;  1W1Y A;  2A4J A;  2HF5 A;  1F54 A;  4DRN A;  5AER A;  2G9B A;  1HJW A;  3ARR A;  2LLS A;  1PSR A;  5G08 A;  1TFV A;  4ODO A;  2TN4 A;  1QV0 A;  2LMT A;  4MN0 A;  1M31 A;  1CLM A;  5KSZ A;  1SR6 C;  1C7V A;  1RD6 A;  2PBC A;  3KAG A;  1J7Q A;  3O5D A;  3PRA A;  4R5E A;  2DT3 A;  2M3W A;  1M45 A;  3LK1 A;  5GPR A;  2BE6 A;  1NUB A;  1TN4 A;  2JXL A;  1JF0 A;  1ZFS A;  4XJK A;  1CM1 A;  2E6W A;  3UQA A;  1LVC D;  1PAL A;  1V1F A;  3K21 A;  1YW5 A;  2KQ6 A;  2K7D A;  2N87 A;  3IK8 A;  2OS8 B;  1B8L A;  2LKN A;  3SG5 A;  2F2O A;  3BYA A;  1SMG A;  5CSI A;  1UHJ A;  1D1O A;  4BF8 A;  1B7T Z;  5DEZ A;  1SK6 D;  1FKF A;  1Y0O A;  2LAP A;  1K2H A;  1XK4 A;  1LA3 A;  2FJU B;  2GGZ A;  4WQ2 A;  1E6R A;  2RUQ A;  1EJ3 A;  4MSP A;  1AJ4 A;  1DF0 B;  1MHO A;  1QAS A;  2L5X B;  4MZK A;  1BOC A;  3QOK A;  1KFU L;  3CHE A;  4MPK A;  2XP5 A;  1F55 A;  5HWC A;  1EXR A;  3RLZ A;  4DIR A;  3HCM A;  2KQY A;  2WM0 A;  4JFJ A;  3EKH A;  4AY1 A;  1DJH A;  3O5L A;  1D7H A;  1TTX A;  1JC2 A;  2JT0 A;  4JYS A;  3D10 A;  1F4O A;  1TRF A;  2LLU A;  1QPF A;  4DZ2 A;  1GGW A;  2ESC A;  1RJV A;  4NSB A;  5ER5 A;  1QX7 A;  3ARP A;  4MNL A;  2RUR A;  1YX7 A;  1RRO A;  1TNX A;  1UP5 A;  4QT2 A;  4U8D A;  1R6P A;  2COL B;  1BLQ A;  3FAP A;  3PN7 B;  3ODK A;  4IPX A;  4MNM A;  4ICB A;  4N19 A;  3ARZ A;  1LKJ A;  1IX5 A;  3CGM A;  2FDM A;  3RFW A;  3O5K A;  1FBV A;  2HPS A;  4QJ4 B;  1M5Y A;  1QAT A;  2ZFD A;  4Z2I A;  1BG1 A;  4PE4 A;  2AAO A;  1ROT A;  4XAK A;  1WY9 A;  3UQB A;  2LMV A;  3SG6 A;  1AHR A;  2RGI A;  2ZRS A;  2M1I A;  1IRJ A;  3FXY A;  4MAV A;  2KGB C;  1SY9 A;  1YVH A;  3SG2 A;  4D1E A;  1OOJ A;  1AK8 A;  1P5Q A;  1W26 A;  2PPP A;  2XP8 A;  2AOS A;  5DO2 A;  1NX0 A;  1WLM A;  4PE1 A;  1BU3 A;  1SBJ A;  3TDZ A;  1A29 A;  1ALV A;  2M49 B;  4I5J A;  1KFX L;  5B8I B;  2KI4 C;  3I5H C;  2MJW B;  4GNK B;  2NLN A;  4JQ0 D;  2A3B A;  2FKE A;  3KCE A;  1EG4 A;  3ZNI A;  1NCY A;  4QJ5 B;  2DG4 A;  2WK2 A;  2P6B B;  1PK0 D;  1NWR A;  1NWD A;  3ARW A;  3B9E A;  3PAT A;  1A2X A;  1M63 B;  2LVI A;  5D7F A;  2BBM A;  1LL7 A;  4GGQ A;  4DRK A;  1RTP 1;  2D9F A;  4DWS D;  2KGR A;  3EVU A;  4R1E A;  1DJW A;  1QTX A;  2GGM A;  1IH0 A;  4CLN A;  4NDC A;  1ZBC A;  2XP6 A;  4A4C A;  4NZC A;  1JNS A;  1FKD A;  3KAI A;  2DSU A;  1H0G A;  1ZK6 A;  1SYM A;  2JUL A;  2VN1 A;  4ZPT R;  5DIT A;  3D0Y A;  1KK7 Z;  1KT1 A;  2A3E A;  4ZPW R;  1EQ3 A;  4DT4 A;  2PVB A;  3I5G B;  1XFW O;  1KQM B;  1VRK A;  2WC8 A;  4AOM A;  4PHN A;  2I94 A;  2LHI A;  3O5G A;  4MZL A;  2DG9 A;  3AAJ A;  3IHZ A;  1CMF A;  1BKF A;  3CGN A;  4W9P A;  3WD1 A;  5FYX A;  1CFF A;  2Y5I A;  3QRX A;  3EKJ A;  1OWQ A;  2KAY A;  1MQ1 A;  1N0Y A;  1K8U A;  4ETO A;  1NSG A;  3D0Y B;  3SIA A;  2WCE A;  4CPV A;  1LL6 A;  2PRU A;  1JNT A;  3ARU A;  4LGX A;  1W1T A;  4BY4 A;  1CLB A;  4MTV A;  1XFV O;  3TCZ A;  2LC5 A;  3MSE B;  3KPX A;  1FI6 A;  1J7R A;  2WCF A;  1XFZ O;  1DVI A;  3GOF A;  4E68 A;  2JT8 A;  2HQW A;  3AQU A;  1K90 D;  4DZ3 A;  2MA2 A;  1AP4 A;  1QVI Z;  1TIZ A;  1NYA A;  1QLK A;  2BCX A;  2H61 A;  4F0Z B;  1FPW A;  1UR8 A;  2DSW A;  1CLL A;  2ZND A;  3DVK A;  4GUK A;  5PAL A;  2G41 A;  1YVL A;  1UHN A;  3BXK A;  2JWW A;  3JVT C;  1N1A A;  2QAC A;  3JYM A;  4ORA B;  3F45 A;  3RGC A;  1YR5 A;  3EK8 A;  2IUZ A;  2XPB A;  5JH8 A;  4R0X A;  1DJI A;  1TCO B;  5HW7 A;  1OE9 B;  1J6Y A;  1BT6 A;  3LLE A;  2KFG A;  3WHU B;  1TCO C;  3I5F B;  1WRZ A;  3RM1 A;  1JF2 A;  2H2K A;  3AAK A;  5I8N A;  1CTN A;  2G8Z A;  3ARS A;  3ARX A;  4ODN A;  1A75 A;  3I5I B;  2KO7 A;  3WH0 A;  2JZI A;  3KO0 A;  3AS0 A;  3SG4 A;  1W1P A;  3PN7 C;  4YI9 A;  1FKL A;  1J7O A;  3TUY B;  3FWB A;  1PBK A;  4JFI A;  2HET A;  1VF8 A;  1Y0V H;  5HLV A;  4Z2G A;  2NCO A;  4OR9 B;  2GV5 A;  3BUM B;  3CHF A;  2NZ0 A;  4WKA A;  3CR2 A;  3DF0 A;  1K9U A;  1GPF A;  1U5I A;  3CZ8 A;  2K2A A;  2M97 A;  1EDQ A;  5TNC A;  1D2K A;  1T11 A;  2KE0 A;  1QJT A;  2CXJ A;  2R2I A;  4MRX A;  2L4H A;  1PUL A;  2LMU A;  4ORC B;  2M1U A;  2O60 A;  2WND A;  3TDI A;  5D75 A;  2XP9 A;  4Q04 A;  4GAO A;  3NRK A;  3W4R A;  1BR1 B;  2FCD A;  1HQV A;  2YBT A;  1QX2 A;  1CMG A;  5HW6 A;  4N1G A;  3SG3 A;  1CNP A;  3EY6 A;  2M0R A;  3WL1 A;  2JC2 A;  3JTD B;  2LPV A;  2MLY A;  1E9L A;  4LAY A;  1SCM B;  1CKK A;  4YGB B;  1K95 A;  1KWO C;  3BUW B;  2CTN A;  3O78 A;  5I2L A;  3BQ3 A;  2O92 A;  4WK9 A;  2KI6 C;  3SG7 A;  4ML4 A;  3RME A;  2G2B A;  4Z2L A;  1V1G A;  1WLZ A;  2Y1M A;  2M9G A;  4KQZ A;  3NSK A;  1KFU S;  3AKB A;  4MEW A;  1A4P A;  3I5F C;  5F6T A;  1OMD A;  4U85 A;  4WKH A;  1XYD A;  1X02 A;  1S6C A;  2M7N A;  3ICB A;  4ZCV A;  4MVF A;  2LUC A;  2M08 A;  1EL4 A;  4GIV A;  4Z2K A;  2WLY A;  2KFW A;  4MNK A;  1ITX A;  4PHM A;  2LLT A;  1DGV A;  3DVM A;  5JOL A;  1IQ3 A;  2JT3 A;  3BXW A;  3ZWH A;  5HKW A;  3IQQ A;  4ODP A;  1RK9 A;  3NSL A;  5AXI A;  1CM4 A;  1IG5 A;  1Q6H A;  2DT1 A;  4DWS B;  3NTP A;  1S26 D;  4P5O E;  1TNQ A;  2F2D A;  4OKH A;  3WKZ A;  1TNW A;  4ORB B;  3VRP A;  1CDP A;  1KCY A;  3CR4 X;  1O6I A;  4G2P A;  4JFK A;  2KYF A;  1F40 A;  2XP4 A;  1F4Q A;  4WIW A;  4MGV A;  1N65 A;  2MLF C;  1W9P A;  3SIB A;  4J4N A;  3O6B A;  1IJ6 A;  1ZB5 A;  1QXP A;  5AEQ A;  1D7J A;  1E6Z A;  1KT0 A;  4NNR A;  1XVJ A;  3O5O A;  1J55 A;  1Q6I A;  3E3R A;  1F71 A;  2B1U A;  1W9U A;  3GPK A;  4DRQ A;  1ZAC A;  1E6P A;  2B31 A;  4MZJ A;  5CPV A;  1U5I B;  2CT9 A;  1D7I A;  1FKJ A;  4ODL A;  1PSB A;  3UQI A;  1Y1A A;  2F3Y A;  2PMY A;  1LJY A;  1KWO B;  3GK4 X;  1FKT A;  3WIJ A;  1KK7 Y;  2LGO A;  3PR9 A;  4NDD A;  3B8S A;  5DF0 A;  3UI6 A;  4DRM A;  3PFV A;  1DMO A;  1LXF C;  1Y1X A;  3WNX B;  5HT1 A;  3UI5 A;  1OGG A;  1R9H A;  3IKG A;  4YGE B;  2PAS A;  2KGJ A;  5DIU A;  3WQW A;  4J4O A;  1MUX A;  1JVW A;  3WD0 A;  4DRI A;  1E8A A;  5D69 A;  2LV7 A;  1Y6W A;  1W1V A;  1KK8 B;  2BKI B;  2KFF A;  3LK0 A;  4DS7 A;  1B8C A;  3OP0 A;  3JYJ A;  2UZ5 A;  4GGF A;  1UHH A;  2LVV A;  2K7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...