4MSPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp22 (aka fkbp14) containing two ef-hand motifs
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
b'LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
publication title Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mspA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mspA01
2F33A 4I5JA 3PRBA 4WQ2A 3VRQA 2I2RE 1QIVA 1EG4A 5B8IC 4MEWA 1W7IB 3TDZA 2M7LA 3MDYB 2K61A 1SBJA 1UP5A 2LAPA 2KBMA 3JXVA 2K2AA 2L0PA 3SG7A 2K7BA 3NRKA 1OZOA 2GGMA 3I5HB 2L4HA 1IRJA 1NSGA 2DG9A 1Y0VH 2IF4A 2RUDA 1BKFA 2FCDA 2BE6A 3BUMB 4J4OA 3TC5A 4XYNA 1DVIA 2KGJA 1SCVA 5CSFA 3LLEA 1KSMA 1QX2A 2CNPA 5G08A 3OHMB 2LNKA 1J4IA 4R1EA 1M63B 4C0KA 1J4RA 1QLSA 1J7OA 4ITZA 2KI6D 4ICBA 1MWNA 1C9HA 3CZTX 2LPVA 5I98A 4YGEB 2OTGB 4TNSA 3H4SE 2WCEA 3UF8A 4WRIA 3FWBA 3TDBA 5J3XA 3C1VA 4DRJA 3PALA 2K7CA 1QV1A 1GQMA 2OPOA 4YGCB 3VRRA 2F4EA 2F2OA 4PDZA 1KQMB 1CFFA 1J4HA 3CS1A 4ODKA 4DRIA 2P6BB 4UPGA 4QJ4B 1UHHA 5D69A 4GGNA 1F54A 1CKKA 4YGBB 4Q04A 2ISDA 1QLKA 1SL8A 1S6JA 4MVFA 2KAYA 2HETA 1NCYA 4GBAA 1B7TY 4ODNA 1XFYO 1NYAA 4YBHB 2K0JA 1WRZA 3SG2A 4CIDA 1CLBA 4ODOA 1FKLA 2FAPA 3CR2A 1CMFA 1S6IA 4PE7A 2HQWA 3O5DA 1DJWA 1HT9A 2JZIA 3BUOB 3LK1A 4NQGA 2G2BA 5HLVA 1EH2A 5FYXA 2PV3A 2G9BA 4G50A 2NCOA 2R2IA 1LA0A 1XFVO 3OB2B 1SRAA 2LM5A 1DJGA 2AUCA 2LJ4A 2M97A 5CSJA 2V53A 2L2SA 4PHMA 4PALA 2KO7A 2ZQSA 1IQ3A 5D75A 5HWBA 3BXKA 2KI3A 1TCFA 2MNTA 1YX7A 3PRDA 1DGVA 1EL4A 1K90D 1YR5A 2BBNA 1D7IA 2JOJA 4U86A 1K9PA 2JQ6A 1QIWA 1QATA 1BF5A 5KSZA 1H8BA 1FI6A 2ZQVA 5J6EA 3TCZA 5CPVA 1IH0A 4ORAB 1YUUA 1R2UA 3I5GC 3OP0A 3SG6A 1FKJA 1QPLA 3BQ3A 3LUOA 5DKQA 2H61A 4DRQA 1NCZA 3O5RA 2DG3A 2EGDA 1BL4A 1YTZC 3KADA 3OX5A 1GGWA 4ODPA 1B8LA 2MBXA 4W9QA 2KQ6A 2LV7A 4NDDA 3AKAA 1QASA 5TNCA 1J7PA 3O5JA 1D7JA 2M49B 5ER5A 1J55A 1AVSA 3O5EA 4W9PA 4N1FA 1DJHA 2LHIA 5HYDA 2PPOA 1FKGA 2PASA 3EKHA 4FN2A 3ICBA 1AJ4A 2JXCA 2OS8B 5AEQA 2XP9A 2ZR4A 1KQVA 4TYOA 3NXAA 4QJ5B 1BMOA 2CTNA 5CSNA 2O5GA 1KCYA 2KYCA 2LLTA 3WNXB 2LMUA 1Q6IA 1A2XA 2M2AA 1DJXA 4PE4A 5DKNA 2WCFA 3A8RA 3NTPA 2I94A 1FKIA 1N1AA 4A4BA 3TS5C 2RUCA 3O78A 1S5GY 5HLOA 4JFMA 2BE4A 1B47A 3QRXA 1YUSA 5HKYA 1Y0OA 2MLYA 2PV2A 1WY9A 2KR7A 4DT4A 4TX0A 1TIZA 1B1GA 1J7QA 5HKGA 3VRNA 1SL7A 2JWWA 2M3WA 1JFJA 4JQ0D 1IWQA 1LA3A 4GNKB 1ZACA 1SR6C 2KI4B 1CDLA 1DT7B 5GQQC 1J6YA 1BODA 1M31A 2E30A 2KI6C 2L2EA 2L5XB 2NZ0A 2ZN9A 4A4CA 4DRNA 3O6BA 1YATA 2EC6B 3O5IA 3A4UB 4GGQA 1RK9A 1SCMB 3AAJA 2Y4QA 3DD4A 3LK0A 2PVBA 2VRGA 4YI9A 3AKBA 5DITA 2BCXA 2XP4A 3JYJA 3UQBA 1U5IA 1FKTA 2Q4UA 1L1PA 2JT8A 2LCPA 4LAWA 2XP3A 5HW8A 4I5KA 1XFZO 1BU3A 1QVIY 1FKSA 4ODMA 1EQ3A 1K2HA 4ODQA 1SYMA 1LKJA 2QPTA 1K8UA 2KDHA 1WRLA 1L2OB 2L50A 3FS7A 2COLB 3I5FB 4N1GA 2MLXA 2BBMA 1Q6HA 3HX4A 1NUBA 4PHJA 1KSOA 2M9GA 3O5QA 4XJKA 1ROUA 1D6OA 2Y1NA 1B8CA 2KNEA 1PRWA 5I2LA 4DIPA 1LINA 1U5IB 1Y1UA 1QS7A 2FOTA 2UZ5A 2SASA 1DGUA 3M0WA 1A75A 3WHTB 3IHZA 2CBLA 2LUCA 3GK4X 4QJ3B 1Y1AA 1WDCB 1ZUZA 2HQ8A 1K94A 1S3PA 2F3YA 2LVVA 4LAVA 1MXEA 4LAYA 2EHBA 2LKNA 1ZK6A 1JC2A 1KWOB 1F8AB 1RFJA 3SIBA 1C7VA 4LAXA 1LVCD 1FBVA 1OE9B 2F3ZA 4XJKB 4U85A 4TW7A 4IPXA 1DTLA 4DS7A 1KFXL 1BR1B 1TRFA 1TCOB 3KAFA 1MXLC 1UWOA 1DJYA 3I5HC 1YRUB 2KBIA 1TNQA 2NLNA 2LGOA 2M8UA 1MR8A 1A75B 1PVBA 1NSHA 3NSLA 3SG4A 3CWGA 1HXVA 1BG1A 1KK8B 2L51A 4TNCA 2Q5AA 1KFUL 1M46A 4JFIA 2JTZA 2L4IA 2ZR6A 1E8AA 2WNDA 1Q1CA 1RROA 4I5NB 2Y78A 1NX2A 2PPPA 3GPKA 1AUIB 1YUTA 1QPFA 1SKTA 1BR4B 3OB1B 1AHRA 1NCXA 2LMTA 1WLZA 2LVJA 3O5FA 2OTGC 1CFPA 3UI6A 4TW8A 2LP3A 5HT1A 1M39A 1TOPA 3F45A 2XPBA 3PATA 2KGBC 2PRUA 5DKRA 3EKJA 2XPAA 4ORCB 1KQMC 5F6TA 1MHOA 3BUWB 3SG3A 1Q6UA 1BT6A 4PE0A 1IJ5A 2K7DA 1KK7Y 2MHHA 5AANA 3JTDB 1K93D 3GK1A 1UUSA 4DRKA 1XO5A 4GGFA 1JNTA 1N2DA 4JWQA 1K95A 2JC2A 3VROA 4CFQA 2KFFA 3SJSA 4DZ2A 3UQIA 3UI4A 2BL0B 3KF9A 3JVTB 2QACA 1FW4A 4DIRA 3PN7B 1B7TZ 2JPTA 2AMIA 3EVRA 2KOTA 2ZN8A 2E6WA 2KSPA 4HRHA 1FKHA 1XK4A 3TDIA 4M2PA 1U79A 1CM1A 3TUYB 1SW8A 3TZ1A 4N19A 1YX8A 3EK8A 4OCIA 1QV0A 1K9UA 1XFWO 4YGDB 3VRPA 1FPWA 1XVJA 3JTDC 3EVVA 1W7JB 1H4BA 4AQIA 2ZQTA 4JFLA 1IJ6A 2M7NA 5I2OA 5I8NA 1NPQA 3CGAA 2ITKA 2ZRTA 5AXIA 1UURA 4U84A 1KT1A 5HKZA 2OFNA 3ODKA 1B8RA 2DG4A 1K9KA 1ODBA 2ZQUA 1G8IA 4JPZB 3PFVA 1CFCA 2VCDA 1N0YA 1GGZA 3I6CA 4AOMA 2ZNEA 1D7HA 3ZWHA 1SK6D 3VAWA 3CGMA 1CDNA 1ZMZA 1EJ3A 1L7ZA 2MA2A 4ETOA 1TN4A 1B4CA 1ZCNA 1UHIA 3IQOA 1KT0A 1G33A 3I5IB 1F8HA 3PA7A 1FKDA 4JFJA 2M29A 3DF0A 4NDCA 4YI8A 2F2DA 1IGVA 4MZKA 3JYMA 2B1UA 2OS8C 4OV2A 3MSEB 4ODRA 1TNPA 4BY4A 1NWDA 2H61C 1JF0A 2CCMA 2JTTA 2MLEC 4AQJA 5K89A 1YW5A 2FCEA 1CDMA 3TDUA 1ZOTB 2K7OA 4C0JA 3KAGA 4ODLA 1YRTB 2JZVA 1FD9A 3O5LA 3UI5A 1R9HA 2XP7A 4YGAA 1EYMA 1JBAA 1J1DA 1CLLA 2F8PA 5HKWA 4DRHA 5IBWA 1JFKA 2KHNA 4BY5A 1MF8B 1D1OA 3DF0B 1NMVA 2PV1A 4ZCVA 1XFXO 3EK7A 4D1EA 1QZ2A 3KAIA 1CLMA 1B9AA 3NSIA 2ZR5A 1CFDA 1WLMA 1BJFA 5JJGA 1IKUA 1S5GZ 3DVKA 2BKHB 4DH0A 2FJUB 2HPSA 2JNXA 1ALVA 1NX1A 1QXPA 1QTXA 2KI4C 3FWCA 1OOJA 5B8IB 1FKBA 2KFWA 1ALWA 3O5PA 3IK8A 1C7WA 1QX5B 1S1EA 2EC6C 1N65A 4HREE 3KHEA 3CTNA 1FKKA 3EY6A 1SCMC 3NSKA 1FI5A 1SPYA 1YVHA 4CLNA 4ZCUA 1XA5A 2WC8A 2LC5A 1PBKA 1PSRA 2LLUA 2H2KA 2LMVA 1V1GA 2NXQA 2HF5A 3NSOA 1PSBA 4MN0A 4OVNF 3KPXA 5AFPA 3BUXB 4MBEA 2M0RA 3GK2A 1IG5A 4DZ3A 4U8DA 1J7RA 2MLZA 1EXRA 4GFTA 1PALA 3IKDA 3CR5X 3E3RA 1PK0D 2K8MB 3PSRA 3I5FC 4PHNA 1L2OC 3SG5A 1BOCA 1RWYA 1JVWA 1DJZA 2LVIA 3OOBA 1JF2A 1B6CA 1JUOA 1AJ5A 4QT2A 5HTGA 1QVIZ 2D8NA 2LP2A 3IQQA 4DRMA 2LLSA 2MAZA 1CB1A 4JFKA 1JNSA 2LVKA 2MJWB 3PLFB 1X02A 3O5MA 2ZKMX 2O60A 2LUXA 4PHKA 1FKFA 3B7XA 4BF8A 2MLFC 1WDCC 3KAHA 1CNPA 2CT9A 1A03A 4PCWA 3FIAA 2GV5A 1PINA 2DOQA 1KWOC 2A4JA 2KQYA 2PBCA 2BCAA 4NNRA 1PVAA 3VGOA 1F40A 1TTXA 5DIVA 4GAOA 4W9OA 1TCOC 3BUNB 5JOLA 3RM1A 2M1KB 2MRDA 2F21A 2TN4A 5ER4X 1BLQA 1AP4A 3ZNIA 2RUQA 1EG3A 1NX3A 2ZFDA 1YVLA 1KFXS 2KYFA 4C0LA 1A7XA 2KE0A 5AERA 1NX0A 1KK8C 4MZLA 1RJVA 3LL8B 1HQVA 2RSEA 5D7FA 1UHKA 1T11A 5CSIA 3O5OA 1LXFC 1S26D 2I18A 1R6PA 3IKGA 1XFUO 2D9FA 3O5KA 1OQPA 1KFUS 1RTP1 3LCPC 1FJDA 1A4PA 4QT3A 4JYSA 3PM8A 2VN1A 4GIVA 3AAKA 4HRGA 3UQAA 4HSZA 1CM4A 2Q91A 1S6CA 1ZFSA 4MLWA 1UHJA 3OX6A 4NDBA 1K96A 1QJTA 1G4YR 2MPHA 2BKIB 2AAOA 3I5GB 3O2PA 2N87A 3NI6A 1MUXA 1RECA 2JT0A 3KEVA 5DIUA 1DF0A 1OSAA 1AK8A 2Y5IA 1C07A 1SY9A 4DRWA 2F2PA 1NP8A 4L9MA 2KGRA 4P5OE 4YRUA 5KU1A 1W26A 4IQ2A 5HW7A 2AWGA 4C02B 1SNLA 2K8IA 3KZ7A 2KAXA 4CPVA 2PALA 3KABA 4IQCA 2M1UA 2RGIA 3D0YA 3KACA 1KK7Z 1CTRA 1MQ1A 2BL0C 2JRFA 2ZNDA 3JVTC 1ROTA 2XP5A 1V1FA 1UHNA 1TNWA 3KO0A 3SIAA 2LE9B 3PN7C 3H9RB 4E68A 3O5GA 4MZJA 1DF0B 1NMWA 1TNXA 1M45A 3CR4X 1JSAA 4N5XA 3GOFA 3TUYC 2FKEA 1OMRA 1GJYA 2LANA 2NCPA 3BOWA 1CMGA 4P2YB 4FQOA 2LHLA 4GGFC 4OKHA 1F70A 1Y6WA 2K2FA 2L98A 3TS5B 2WORA 5PALA 3WH0A 1F4QA 2I7AA 1OMVA 3D0YB 1J1EA 3DVMA 4MRYA 1Y1XA 1S36A 1XYDA 1OZSA 1A29A 5BPJA 1F4OA 3DVEA 2JU0A 1XK4C 2KAVA 2PSRA 2BECA 4PE1A 3IF7A 3RGCA 2JXLA 3WHUB 1SR6B 4MSPA 2MF9A 3BOWB 5KTYA 4DROA 2KFHA 4FTGA 4CFRA 2KFGA 3CLNA 4USLA 2PPNA 4ORBB 3CGNA 4DCKA 1F71A 1P5QA 3I5IC 2Y1MA 4F0ZB 1DMOA 2RQSA 2PMYA 1SMGA 4M2QA 4MRXA 1VRKA 2SCPA 5HWCA 2RURA 2XP6A 4J4NA 1YURA 1SL9A 3BYAA 2CXJA 1WRKA 1CDPA 4TW6A 1OMDA 1FF1A 2XP8A 2WOSA 2ZRSA 3RLZA 5BXJA 1PULA 1QX7A 1M5YA 1FAPA 4GUKA 2JULA 5HW6A 5I2QA 3FAPA 4I5LB 3O4YA 3EVUA 4M2OA 4O2TA 1DJIA 4DUQA 1F55A 4MGVA 1FKRA 3HCMA 1JWDA 3WXAA 4OR9B 2M08A 2M1IA 4WQ3A 3KCEA 3RFWA 3K21A 4GPLB 4IL1A 4R0XA 4G2PA 1IQ5A 4FAPA 2JT3A 3D10A 2BCBA 3EK4A 2JNFA 1NIWA 2GGZA 4DRPA 5HUAA 1Q80A 2IS9A 5GPGA 3DVJA 4QIBA 2WCBA
chains in the Genus database with same CATH superfamily
3B86A 4MEWA 1W7IB 3DYEA 1OZOA 3I5HB 1BKFA 2BE6A 3BUMB 1EIBA 1W1TA 4J4OA 2KGJA 1QX2A 5G08A 2LNKA 1QLSA 4ICBA 4JKTA 4NZCA 4TNSA 4WRIA 3FWBA 3TDBA 3C1VA 4MPKA 2K7CA 4YGCB 1J4HA 4ODKA 3CS1A 4QJ4B 3WD1A 4GGNA 3CH9A 3OBVA 1CKKA 2ISDA 4MVFA 2HETA 1NYAA 4CIDA 1DJWA 1HT9A 3BUOB 4NQGA 1EH2A 2PV3A 4G50A 2R2IA 2LJ4A 2A3EA 2M97A 5HWBA 4PHMA 1HKMA 3BXKA 2KI3A 2MNTA 1D7IA 1K90D 1K9PA 2JQ6A 1QIWA 5KSZA 1ITXA 1JNDA 4ORAB 1YUUA 1R2UA 3OP0A 2EGDA 1YTZC 4W9QA 2KQ6A 5ER5A 2WC6A 4MNLA 4NSBA 2PI6A 2CTNA 3A8RA 1FKIA 1N1AA 3L47A 3TS5C 3O78A 1S5GY 3AQUA 2BE4A 1B47A 3QRXA 3WL0A 4INXA 5HKGA 2JWWA 1LA3A 1ZACA 5GQQC 3S0DA 2KI6C 3O5IA 4GGQA 2Y4QA 3R1PA 3AKBA 5DITA 3IVTA 2XP4A 3JYJA 1UR9A 1ZB5A 2LCPA 1DQEA 4I5KA 1SYMA 2QPTA 1K8UA 3I5FB 1LG2A 1L2OB 4N1GA 2MLXA 2BBMA 1KSOA 1PRWA 1Y1UA 2FOTA 2SASA 3Q8IA 3M0WA 3IHZA 2CBLA 3GK4X 1Y1AA 1WDCB 1S3PA 4LAVA 5HBFA 3S0GA 2LKNA 1JC2A 1LVCD 4U85A 1C3YA 1MXLC 1DJYA 2KBIA 3O4XA 2LGOA 4L72B 1A75B 1HJXA 3SG4A 1HXVA 1BG1A 1KFUL 2L4IA 3ARRA 1Q1CA 3GPKA 4I5NB 2PPPA 3B9AA 1YUTA 2LMTA 2LVJA 3ARSA 2OTGC 4TW8A 5DKRA 1KQMC 1MHOA 1Q6UA 4Z2LA 2K7DA 2MHHA 5AANA 4DRKA 1JNTA 4CFQA 3UQIA 3UI4A 1OOGA 2QACA 3DXLA 1FW4A 2WM0A 3PN7B 2JPTA 3EVRA 2AMIA 2DSVA 1FKHA 4M2PA 4DZ3A 3EK8A 1QV0A 1XFWO 3EVVA 4JFLA 5I2OA 2M7NA 1H0IA 1E9LA 1NPQA 5AXIA 2P4VA 1OGBA 1B8RA 1ODBA 3PFVA 1GGZA 2ZNEA 1D7HA 1W1YA 3ZWHA 1SK6D 2AOSA 2G8ZA 1ZMZA 4ETOA 1TN4A 1FKDA 5GQBA 2B1UA 2OS8C 1TNPA 2CCMA 2FCEA 1CDMA 3KAGA 3UI5A 1R9HA 2F8PA 4DRHA 2KHNA 3N7HA 4BY5A 1MF8B 1D1OA 1NMVA 3CZ2A 5JJGA 1BJFA 2BKHB 2FJUB 1S1EA 2EULA 2EC6C 1N65A 1PSRA 2LLUA 4MTVA 1J7RA 1PALA 3CR5X 2QEBA 4PHNA 3PSRA 1JVWA 2LVIA 1QVIZ 2LP2A 4DRMA 1X02A 1TFVA 2O60A 1FKFA 3OGNA 1CNPA 4PCWA 3FIAA 2DOQA 2BCAA 1F40A 1TTXA 3RMEA 4W9OA 3BUNB 5JOLA 5ER4X 1YVLA 1W9ZA 2L2CA 4C0LA 2KE0A 1KK8C 4WKAA 1RJVA 3FE8A 1HQVA 5CSIA 2I18A 1R6PA 1XFUO 1KFUS 1A4PA 5FI6A 4HRGA 3ARTA 1CM4A 3B6XA 3NHTA 2MPHA 2DT1A 2N87A 1RECA 5DIUA 4P5OE 5HW7A 1SNLA 2BNXA 2KAXA 2RGIA 3WD4A 2ZNDA 1V1FA 1DEKA 2LE9B 4E68A 4MZJA 1JSAA 4N5XA 3BOWA 4P2YB 2WORA 2I7AA 4IJ7A 3D0YB 3DVMA 1Y1XA 3GTYX 3RM8A 1F4OA 3B7AA 2WLZA 2JU0A 4PE1A 3IF7A 3RGCA 2JXLA 1SR6B 4MSPA 2MF9A 4DROA 4CFRA 4DCKA 3WQVA 4F0ZB 2RQSA 4Z2GA 2PMYA 4MRXA 3QMEA 3BFAA 1GUVA 1ZL1A 1CDPA 1M5YA 1FAPA 3FAPA 4M2OA 4Z2IA 3WXAA 2M1IA 3K21A 4IL1A 2JT3A 3SS4A 2WCBA 3GU0A 3PRBA 3VRQA 2WCLA 1UP5A 2K2AA 3SG7A 3NRKA 1IRJA 2FCDA 3TC5A 4XYNA 4WKHA 2CNPA 3OHMB 1M63B 1J4RA 1J7OA 1W9VA 1MWNA 3ARVA 1TWOA 4YGEB 4DWSA 5EL2A 5J3XA 3PALA 1QV1A 2F4EA 1CFFA 4DRIA 2P6BB 4UPGA 5D69A 1F54A 1SL8A 2KAYA 1NCYA 4GBAA 2K0JA 1OWQA 4ODOA 3O5DA 2G2BA 5FYXA 2G9BA 1LA0A 1XFVO 1SRAA 1DJGA 2L2SA 1TCFA 1YX7A 3PRDA 3WL1A 1EL4A 2BBNA 1DC1A 4UDMA 1QATA 2KPHA 1QPLA 3LUOA 3V2LA 1GM0A 1FKJA 1GPFA 1NCZA 1BL4A 1B8LA 2LV7A 1J7PA 2QEVA 2M49B 2IUZA 3O5EA 4N1FA 1ZU8A 1DJHA 2LHIA 1XHGA 2PASA 3EKHA 4FN2A 2JXCA 3PR9A 2ZR4A 3CHCA 4TYOA 4QJ5B 1BMOA 5CSNA 1KCYA 2LLTA 3WNXB 2M2AA 4PE4A 2WCFA 3NTPA 3R1OA 5HLOA 4P8UA 1YUSA 5HKYA 1Y0OA 1TIZA 1SL7A 1JFJA 1JNEA 4JQ0D 2PQLA 2KI4B 1DT7B 1M31A 2L2EA 2L5XB 2NZ0A 4LGXA 1SCMB 3AAJA 2VRGA 1U5IA 2Q4UA 5HW8A 1FKSA 1EQ3A 1K2HA 2A3BA 1LKJA 5DEZA 2KDHA 2L50A 3FS7A 1Q6HA 1HJVA 2M9GA 3O5QA 1ROUA 1D6OA 4DIPA 1LINA 1QS7A 1DGUA 4KYNA 3WHTB 3G6MA 4R5EA 1ZUZA 1K94A 3OA5A 2F3YA 4LAYA 5JH8A 1ZK6A 1KWOB 3SIBA 4LAXA 2F3ZA 4XJKB 4TW7A 1DTLA 4ZPWR 1X6NA 3CYZA 1TNQA 2KLDA 2NLNA 5DICA 2YBTA 1MR8A 3CWGA 2L51A 1M46A 2ZR6A 1RROA 4Q7NA 1WLZA 1TOPA 2XPBA 3PATA 2KGBC 3EKJA 2XPAA 5F6TA 3BUWB 3SG3A 1BT6A 1E6ZA 4PE0A 4P8WA 1KK7Y 4GGFA 4DWSC 2WCKA 2KFFA 1SR0A 2ERBA 3JVTB 1B7TZ 3CABA 1W9PA 1XK4A 3TDIA 5FI2A 1CM1A 1GOIA 3TUYB 3TZ1A 1YX8A 1FPWA 1W7JB 2ZQTA 1IJ6A 1W1VA 3CGAA 2ITKA 2DG4A 2ZQUA 3NGVA 1N0YA 3RZSA 1EJ3A 1B4CA 1ZCNA 1G33A 3I5IB 4YI8A 3UNWA 4MZKA 3JYMA 4ODRA 1NWDA 4AQJA 1JF0A 2WC5A 5K89A 4C0JA 1YRTB 2JZVA 1FD9A 4P8VA 1JBAA 1J1DA 1JFKA 3DF0B 3S0BA 4Z2JA 1B9AA 2YGUA 1ZBCA 1ALVA 1QXPA 2KFWA 1HKKA 1C7WA 1QX5B 4HREE 1UR8A 3RM4A 1PBKA 2LC5A 2LMVA 2H2KA 3NSOA 1PSBA 3KPXA 3L4LA 2MLZA 1KFWA 3E3RA 1BOCA 1RWYA 3OOBA 1JF2A 3ARXA 4ML4A 2D8NA 2LLSA 2MAZA 4JFKA 1JNSA 3PLFB 3O5MA 2LUXA 4PHKA 4F7FA 1NWUA 1SYTA 1PINA 3CHEA 2PBCA 5DIVA 3ARZA 1TCOC 2FDMA 2MRDA 2F21A 3BXWA 1QWVA 5D7FA 1T11A 1S26D 3IKGA 1NWRA 4MAVA 4HSZA 3AROA 3R1VA 2Q91A 1K96A 3NI6A 1MUXA 5HL1A 3KEVA 1DF0A 1AK8A 1C07A 1SY9A 4L9MA 3KZ7A 3G6LA 2BL0C 2JRFA 3O5GA 1OMRA 1LQ0A 1E6NA 4GGFC 2L98A 3TS5B 5PALA 3WH0A 3NHIA 1P28A 1XYDA 3D73A 1OZSA 3SS5A 5BPJA 1VF8A 3WD2A 3B8SA 1XK4C 2B31A 2KFHA 2KFGA 3CGNA 1P5QA 1DMOA 1NWSA 1SMGA 1VRKA 5HWCA 4TW6A 1OMDA 2ZRSA 1PULA 1QX7A 3RM9A 4GUKA 1FKRA 1JWDA 2M08A 4OR9B 3KCEA 4G2PA 3D10A 4KR0B 4WQ2A 1QIVA 1EG4A 5B8IC 3TDZA 4URIA 2M7LA 1NWTA 2LAPA 3FE9A 2L0PA 4OZDA 4FQTA 2L4HA 4S3JA 1Y0VH 1DVIA 1SCVA 5CSFA 1OOHA 4R1EA 4C0KA 4ITZA 2KI6D 3B9EA 1OOIX 1C9HA 3CZTX 2OTGB 1W9UA 3H4SE 3UF8A 4S3KA 1GQMA 2OPOA 3VRRA 2F2OA 1KQMB 1ZBWA 1UHHA 3WD3A 4YGBB 1QLKA 1S6JA 3WQWA 1XFYO 4ZPVR 1WRZA 1CLBA 1CMFA 1S6IA 2HQWA 5HLVA 3OB2B 1XRVA 2LM5A 2AUCA 5CSJA 3K1EA 2KO7A 1IQ3A 1DGVA 4U86A 1YR5A 1BF5A 2DSUA 2ZQVA 5J6EA 3I5GC 3SG6A 5DKQA 4DRQA 2DG3A 3KADA 4ODPA 2WCJA 2MBXA 3W4RA 1QASA 4QZVB 1J55A 3PRAA 3ALGA 5HYDA 1FKGA 3ICBA 2OS8B 5AEQA 2XP9A 2P70A 1KQVA 3NXAA 1LL7A 1A2XA 5DKNA 2I94A 3CHDA 1NH6A 4TX0A 1B1GA 1J7QA 2M3WA 1IWQA 3EIPA 1CDLA 2ZN9A 3ARUA 3O6BA 2EC6B 3A4UB 2BAPA 3DD4A 2PVBA 3D77A 2JT8A 4LAWA 2WCMA 1BU3A 2DT0A 1QVIY 3BMBA 1HJWA 1WRLA 5D3OA 3HX4A 1NUBA 4PHJA 2Y1NA 5I2LA 3S0AA 3D76A 1FFQA 1E44A 1A75A 2LUCA 4QJ3B 2HQ8A 2LVVA 1MXEA 1OOFA 2EHBA 1RFJA 1C7VA 4WKFA 1FBVA 3D75A 3KAFA 1UWOA 3I5HC 1NSHA 1KK8B 4JFIA 2JTZA 1E8AA 1EDQA 1NX2A 3BFHA 1AUIB 1E15A 1BR4B 1AHRA 1NCXA 3UI6A 2LP3A 5HT1A 3F45A 2PRUA 1TUZA 4ORCB 1IJ5A 3JTDB 1UUSA 1N2DA 2JC2A 3VROA 2OLHA 2QDIA 2ZN8A 2E6WA 4HRHA 4OCIA 1K9UA 4YGDB 1H4BA 4L3NA 5I8NA 1LL4A 2PN0A 3AS3A 1KT1A 5HKZA 2OFNA 3ODKA 1K9KA 2VCDA 3FY1A 3CGMA 1CDNA 5DF0A 2MA2A 1L7ZA 3IQOA 4MNMA 3WD0A 2B5UB 1GRJA 1Z4HA 1LJYA 2F2DA 1IGVA 4OV2A 1YW5A 3TDUA 1ZOTB 2K7OA 4ODLA 3O5LA 2XP7A 4YGAA 1EYMA 5I94A 1CLLA 5HKWA 2DSWA 3ALFA 2PV1A 1XFXO 4D1EA 3KAIA 2O92A 1ZBVA 3NSIA 1CFDA 1WLMA 1S5GZ 3DVKA 3PJIA 2JNXA 1NX1A 3FWCA 3O5PA 3CZ1A 3EY6A 3NSKA 1SPYA 4CLNA 2WC8A 4MN0A 5AFPA 2M0RA 3GK2A 4WJXA 4U8DA 3IKDA 1T14A 1PK0D 3I5FC 3SG5A 1L2OC 1DJZA 1AJ5A 4QT2A 2FJYA 5HTGA 3IQQA 1CB1A 2LVKA 2MJWB 2QEHA 3B7XA 4BF8A 1WDCC 3KAHA 2CT9A 1A03A 2GV5A 3DY9A 2A4JA 2KQYA 1PVAA 4GAOA 2WCHA 1BLQA 1AP4A 1EG3A 1NX3A 2ZFDA 1NX0A 3LL8B 1UHKA 3O5OA 2D9FA 3O5KA 1OQPA 2ETNA 1FJDA 2WK2A 3PM8A 2VN1A 3UQAA 3AAKA 1S6CA 1ZFSA 1UHJA 3OX6A 4NDBA 1QJTA 1G4YR 2BKIB 2JT0A 4DRWA 1NP8A 3DZTA 5KU1A 1W26A 4IQ2A 4C02B 2K8IA 4CPVA 2PALA 3KABA 1SSEB 3D0YA 1CTRA 1UHNA 5GPRA 3PN7C 1WAWA 1NMWA 1M45A 2FKEA 4Q22A 1LG1A 1GJYA 1K9TA 2JPOA 4OKHA 1Y6WA 1EHNA 1J1EA 1S36A 3VB1A 3AS0A 1IX5A 1A29A 1D2KA 3DVEA 2KAVA 1TUJA 2BECA 4Z2HA 3WHUB 3BOWB 3UO9A 4HBOA 4FTGA 4USLA 2PPNA 1F71A 4M2QA 2XP6A 4J4NA 2PYQA 1WRKA 1ZBKA 2WOSA 2DPEA 2JULA 5I2QA 3AS2A 1DJIA 4DUQA 2K60A 4WQ3A 2QF8A 1IQ5A 3FE6A 3ARPA 3B88A 3CZ8A 1E6RA 4FAPA 2BCBA 2JNFA 4DRPA 4IT6A 5HUAA 2IS9A 5GPGA 3DVJA 4QIBA 3CHFA 4BY4A 2F33A 4I5JA 2I2RE 3MDYB 2K61A 1SBJA 1W1PA 2KBMA 3JXVA 2K7BA 1ORGA 2GGMA 2DG9A 1NSGA 2IF4A 2RUDA 2A3CA 3LLEA 3L4AA 1KSMA 2G41A 1J4IA 4WIWA 1HKIA 2LPVA 5I98A 2WCEA 4DRJA 4PDZA 1Z2CB 1FFRA 2H8VA 4HARA 4Q04A 4ODNA 1B7TY 1H0GA 4YBHB 4DWSB 3SG2A 1FKLA 2FAPA 3CR2A 4PE7A 2JZIA 3LK1A 4PTMA 4W5UA 2NCOA 5D75A 2V53A 2ZQSA 4PALA 3WKZA 2JOJA 1H8BA 1FI6A 1XFRA 3TCZA 5CPVA 1IH0A 3BQ3A 2H61A 3O5RA 3OX5A 1GGWA 4NDDA 3AKAA 5TNCA 3ARWA 3O5JA 1D7JA 1AVSA 4W9PA 2PPOA 3D74A 1AJ4A 2O5GA 2KYCA 1Q6IA 2LMUA 1DJXA 1LL6A 2DT3A 4A4BA 2RUCA 3CZ0A 4JFMA 2WLYA 2MLYA 2PV2A 1WY9A 2KR7A 4DT4A 4DWSD 4MNKA 3VRNA 1E6PA 4GNKB 1SR6C 1J6YA 1BODA 2E30A 4A4CA 4DRNA 1YATA 1RK9A 3LK0A 4YI9A 2BCXA 3UQBA 1L1PA 1FKTA 2XP3A 1XFZO 4ODMA 2F23A 1DELA 4ODQA 2COLB 2DT2A 4XJKA 1B8CA 2KNEA 3SS3A 1U5IB 2UZ5A 1RD6A 3ARYA 1F8AB 1OE9B 4ZPTR 4IPXA 4DS7A 1TRFA 1BR1B 1KFXL 1TCOB 1YRUB 3B87A 4ZS6A 2M8UA 1PVBA 3NSLA 3ARQA 4TNCA 2Q5AA 2GTEA 1JCHB 1WB0A 2ESCA 2WNDA 2Y78A 1QPFA 1SKTA 3OB1B 3O5FA 1CFPA 1M39A 2QEOA 1K93D 3GK1A 1XO5A 4JWQA 1K95A 3R72A 3SJSA 4DZ2A 2BL0B 3KF9A 4JD9A 4DIRA 4IT4A 2KOTA 2KSPA 3CDNA 3B9DA 1U79A 4N19A 1SW8A 3VRPA 1XVJA 3JTDC 4INWA 4AQIA 4HBEA 4P8XA 2ZRTA 4U84A 1UURA 1G8IA 4JPZB 1CFCA 3I6CA 4AOMA 3VAWA 2P71A 1UHIA 1KT0A 5FI7A 1F8HA 2O9OA 3PA7A 4JFJA 2M29A 3DF0A 4NDCA 3FXYA 1C3ZA 4XAKA 3MSEB 1O6IA 2H61C 2JTTA 2MLEC 5DO2A 3D78A 5IBWA 2L5YA 4ZCVA 3EK7A 1QZ2A 1CLMA 2ZR5A 1IKUA 4DH0A 2HPSA 1LS8A 1OGGA 3EG5B 1QTXA 2KI4C 1OOJA 5B8IB 1FKBA 1ALWA 3S0EA 3IK8A 3KHEA 3CTNA 1FKKA 4KQZA 1SCMC 1FI5A 1YVHA 4ZCUA 1XA5A 3BFBA 1V1GA 2NXQA 2HF5A 4OVNF 3RFWA 3BUXB 4MBEA 1IG5A 1EXRA 4Z2KA 4GFTA 2K8MB 3BJHA 1B6CA 1JUOA 3S0FA 1HKJA 2ZKMX 2MLFC 1CTNA 1KWOC 1OW4A 4NNRA 3VGOA 1X6LA 3RM1A 2M1KB 2TN4A 2RUQA 3ZNIA 4AY1A 1KFXS 2KYFA 1A7XA 5AERA 4MZLA 2RSEA 1LXFC 3AS1A 1RTP1 3LCPC 4QT3A 4JYSA 4GIVA 1WNOA 4MLWA 2AAOA 3I5GB 3O2PA 1OSAA 2DSZA 2Y5IA 2F2PA 4YRUA 2KGRA 2AWGA 4IQCA 2M1UA 2YBUA 1KK7Z 3KACA 1MQ1A 3JVTC 1ROTA 2XP5A 1TNWA 3KO0A 3SIAA 3H9RB 1DF0B 1TNXA 3CR4X 3GOFA 3TUYC 1IIOA 2LANA 2NCPA 1CMGA 4FQOA 2LHLA 1F70A 2K2FA 4PT1A 1F4QA 1OMVA 4MRYA 2A3AA 2KLEA 2PSRA 5KTYA 3PM2A 3CLNA 4ORBB 3I5IC 2Y1MA 2SCPA 2RURA 1YURA 1SL9A 3BYAA 2CXJA 3WIJA 1FF1A 2XP8A 3QOKA 3RLZA 5BXJA 5HW6A 4I5LB 3O4YA 3EVUA 4MNJA 4O2TA 1F55A 4MGVA 3HCMA 4GPLB 4R0XA 4WK9A 3EK4A 1NIWA 2GGZA 1Q80A
chains in the Genus database with same CATH topology
4MEWA 1W7IB 1OZOA 3I5HB 1BKFA 2BE6A 3BUMB 1EIBA 1W1TA 4J4OA 2KGJA 1QX2A 5G08A 2LNKA 1QLSA 4ICBA 4NZCA 4TNSA 4WRIA 3FWBA 3TDBA 3C1VA 4MPKA 2K7CA 4YGCB 1J4HA 4ODKA 3CS1A 4QJ4B 3WD1A 4GGNA 3CH9A 1CKKA 2ISDA 4MVFA 2HETA 1NYAA 4CIDA 1DJWA 1HT9A 3BUOB 4NQGA 1EH2A 2PV3A 4G50A 2R2IA 2LJ4A 2A3EA 2M97A 5HWBA 4PHMA 1HKMA 3BXKA 2KI3A 2MNTA 1D7IA 1K90D 1K9PA 2JQ6A 1QIWA 5KSZA 1ITXA 1JNDA 4ORAB 1YUUA 1R2UA 3OP0A 2EGDA 1YTZC 4W9QA 2KQ6A 5ER5A 4MNLA 4NSBA 2PI6A 2CTNA 3A8RA 1FKIA 1N1AA 3TS5C 3O78A 1S5GY 3AQUA 2BE4A 1B47A 3QRXA 3WL0A 5HKGA 2JWWA 1LA3A 1ZACA 5GQQC 2KI6C 3O5IA 4GGQA 2Y4QA 3AKBA 5DITA 2XP4A 3JYJA 1UR9A 1ZB5A 2LCPA 4I5KA 1SYMA 2QPTA 1K8UA 3I5FB 1LG2A 1L2OB 4N1GA 2MLXA 2BBMA 1KSOA 1PRWA 1Y1UA 2FOTA 2SASA 3M0WA 3IHZA 2CBLA 3GK4X 1Y1AA 1WDCB 1S3PA 4LAVA 5HBFA 2LKNA 1JC2A 1LVCD 4U85A 1MXLC 1DJYA 2KBIA 2LGOA 4L72B 1A75B 1HJXA 3SG4A 1HXVA 1BG1A 1KFUL 2L4IA 3ARRA 1Q1CA 3GPKA 4I5NB 2PPPA 3B9AA 1YUTA 2LMTA 2LVJA 3ARSA 2OTGC 4TW8A 5DKRA 1KQMC 1MHOA 1Q6UA 4Z2LA 2K7DA 2MHHA 5AANA 4DRKA 1JNTA 4CFQA 3UQIA 3UI4A 2QACA 2WM0A 1FW4A 3PN7B 2JPTA 3EVRA 2AMIA 2DSVA 1FKHA 4M2PA 4DZ3A 3EK8A 1QV0A 1XFWO 3EVVA 4JFLA 5I2OA 2M7NA 1H0IA 1E9LA 1NPQA 5AXIA 1OGBA 1B8RA 1ODBA 3PFVA 1GGZA 2ZNEA 1D7HA 1W1YA 3ZWHA 1SK6D 2AOSA 2G8ZA 1ZMZA 4ETOA 1TN4A 1FKDA 5GQBA 2B1UA 2OS8C 1TNPA 2CCMA 2FCEA 1CDMA 3KAGA 3UI5A 1R9HA 2F8PA 4DRHA 2KHNA 4BY5A 1MF8B 1D1OA 1NMVA 5JJGA 1BJFA 2BKHB 2FJUB 1S1EA 2EC6C 1N65A 4MTVA 1PSRA 2LLUA 1J7RA 1PALA 3CR5X 4PHNA 3PSRA 1JVWA 2LVIA 1QVIZ 2LP2A 4DRMA 1X02A 1TFVA 2O60A 1FKFA 1CNPA 4PCWA 3FIAA 2DOQA 2BCAA 1F40A 1TTXA 3RMEA 4W9OA 3BUNB 5JOLA 5ER4X 1YVLA 4C0LA 2KE0A 1KK8C 4WKAA 1RJVA 1HQVA 5CSIA 2I18A 1R6PA 1XFUO 1KFUS 1A4PA 4HRGA 3ARTA 1CM4A 2MPHA 2DT1A 2N87A 1RECA 5DIUA 4P5OE 5HW7A 1SNLA 2KAXA 2RGIA 3WD4A 2ZNDA 1V1FA 2LE9B 4E68A 4MZJA 1JSAA 4N5XA 3BOWA 4P2YB 2WORA 2I7AA 3D0YB 3DVMA 1Y1XA 3RM8A 1F4OA 2WLZA 2JU0A 4PE1A 3IF7A 3RGCA 2JXLA 1SR6B 4MSPA 2MF9A 4DROA 4CFRA 4DCKA 3WQVA 4F0ZB 2RQSA 4Z2GA 2PMYA 4MRXA 1GUVA 1ZL1A 1CDPA 1M5YA 1FAPA 3FAPA 4M2OA 4Z2IA 3WXAA 2M1IA 3K21A 4IL1A 2JT3A 2WCBA 3PRBA 3VRQA 1UP5A 2K2AA 3SG7A 3NRKA 1IRJA 2FCDA 3TC5A 4XYNA 4WKHA 2CNPA 3OHMB 1M63B 1J4RA 1J7OA 1W9VA 1MWNA 3ARVA 4YGEB 4DWSA 5J3XA 3PALA 1QV1A 2F4EA 1CFFA 4DRIA 2P6BB 4UPGA 5D69A 1F54A 1SL8A 2KAYA 1NCYA 4GBAA 2K0JA 1OWQA 4ODOA 3O5DA 2G2BA 5FYXA 2G9BA 1LA0A 1XFVO 1SRAA 1DJGA 2L2SA 1TCFA 1YX7A 3PRDA 3WL1A 1EL4A 2BBNA 1QATA 1QPLA 3LUOA 1GPFA 1FKJA 1NCZA 1BL4A 1B8LA 2LV7A 1J7PA 2M49B 2IUZA 3O5EA 4N1FA 1ZU8A 1DJHA 2LHIA 1XHGA 2PASA 3EKHA 4FN2A 2JXCA 3PR9A 2ZR4A 3CHCA 4TYOA 4QJ5B 1BMOA 5CSNA 1KCYA 2LLTA 3WNXB 2M2AA 4PE4A 2WCFA 3NTPA 5HLOA 4P8UA 1YUSA 5HKYA 1Y0OA 1TIZA 1SL7A 1JFJA 1JNEA 4JQ0D 2KI4B 1DT7B 1M31A 2L2EA 2L5XB 2NZ0A 4LGXA 1SCMB 3AAJA 2VRGA 1U5IA 2Q4UA 5HW8A 1FKSA 1EQ3A 1K2HA 2A3BA 1LKJA 5DEZA 2KDHA 2L50A 3FS7A 1Q6HA 1HJVA 2M9GA 3O5QA 1ROUA 1D6OA 4DIPA 1LINA 1QS7A 1DGUA 3WHTB 3G6MA 4R5EA 1ZUZA 1K94A 3OA5A 2F3YA 4LAYA 5JH8A 1ZK6A 1KWOB 3SIBA 4LAXA 2F3ZA 4XJKB 4TW7A 1DTLA 4ZPWR 1X6NA 1TNQA 2NLNA 2YBTA 1MR8A 3CWGA 2L51A 1M46A 2ZR6A 1RROA 4Q7NA 1WLZA 1TOPA 2XPBA 3PATA 2KGBC 3EKJA 2XPAA 5F6TA 3BUWB 3SG3A 1BT6A 1E6ZA 4PE0A 4P8WA 1KK7Y 4GGFA 4DWSC 2KFFA 1SR0A 3JVTB 1B7TZ 1W9PA 1XK4A 3TDIA 1CM1A 1GOIA 3TUYB 3TZ1A 1YX8A 1FPWA 1W7JB 2ZQTA 1IJ6A 1W1VA 3CGAA 2ITKA 2DG4A 2ZQUA 1N0YA 1EJ3A 1B4CA 1ZCNA 1G33A 3I5IB 4YI8A 4MZKA 3JYMA 4ODRA 1NWDA 4AQJA 1JF0A 5K89A 4C0JA 1YRTB 2JZVA 1FD9A 4P8VA 1JBAA 1J1DA 1JFKA 3DF0B 4Z2JA 1B9AA 1ZBCA 1ALVA 1QXPA 2KFWA 1HKKA 1C7WA 1QX5B 4HREE 1UR8A 3RM4A 1PBKA 2LC5A 2LMVA 2H2KA 3NSOA 1PSBA 3KPXA 2MLZA 1KFWA 3E3RA 1BOCA 1RWYA 3OOBA 1JF2A 3ARXA 4ML4A 2D8NA 2LLSA 2MAZA 4JFKA 1JNSA 3PLFB 3O5MA 2LUXA 4PHKA 1NWUA 1SYTA 1PINA 3CHEA 2PBCA 5DIVA 3ARZA 1TCOC 2FDMA 2MRDA 2F21A 3BXWA 5D7FA 1T11A 1S26D 3IKGA 1NWRA 4MAVA 4HSZA 3AROA 2Q91A 1K96A 3NI6A 1MUXA 3KEVA 1DF0A 1AK8A 1C07A 1SY9A 4L9MA 3KZ7A 3G6LA 2BL0C 2JRFA 3O5GA 1OMRA 1LQ0A 1E6NA 4GGFC 2L98A 3TS5B 5PALA 3WH0A 1XYDA 1OZSA 5BPJA 1VF8A 3WD2A 3B8SA 1XK4C 2B31A 2KFHA 2KFGA 3CGNA 1P5QA 1DMOA 1NWSA 1SMGA 1VRKA 5HWCA 4TW6A 1OMDA 2ZRSA 1PULA 1QX7A 3RM9A 4GUKA 1FKRA 1JWDA 2M08A 4OR9B 3KCEA 4G2PA 3D10A 4KR0B 4WQ2A 1QIVA 1EG4A 5B8IC 3TDZA 4URIA 2M7LA 1NWTA 2LAPA 2L0PA 2L4HA 4S3JA 1Y0VH 1DVIA 1SCVA 5CSFA 4R1EA 4C0KA 4ITZA 2KI6D 3B9EA 1C9HA 3CZTX 2OTGB 1W9UA 3H4SE 3UF8A 4S3KA 1GQMA 2OPOA 3VRRA 2F2OA 1KQMB 1ZBWA 1UHHA 3WD3A 4YGBB 1QLKA 1S6JA 3WQWA 1XFYO 4ZPVR 1WRZA 1CLBA 1CMFA 1S6IA 2HQWA 5HLVA 3OB2B 1XRVA 2LM5A 2AUCA 5CSJA 2KO7A 1IQ3A 1DGVA 4U86A 1YR5A 1BF5A 2DSUA 2ZQVA 5J6EA 3I5GC 3SG6A 5DKQA 4DRQA 2DG3A 3KADA 4ODPA 2MBXA 3W4RA 1QASA 4QZVB 1J55A 3PRAA 3ALGA 5HYDA 1FKGA 3ICBA 2OS8B 5AEQA 2XP9A 1KQVA 3NXAA 1LL7A 1A2XA 5DKNA 2I94A 3CHDA 1NH6A 4TX0A 1B1GA 1J7QA 2M3WA 1IWQA 1CDLA 2ZN9A 3ARUA 3O6BA 2EC6B 3A4UB 3DD4A 2PVBA 2JT8A 4LAWA 1BU3A 2DT0A 1QVIY 1HJWA 1WRLA 3HX4A 1NUBA 4PHJA 2Y1NA 5I2LA 1FFQA 1A75A 2LUCA 4QJ3B 2HQ8A 2LVVA 1MXEA 2EHBA 1RFJA 1C7VA 4WKFA 1FBVA 3KAFA 1UWOA 3I5HC 1NSHA 1KK8B 4JFIA 2JTZA 1E8AA 1EDQA 1NX2A 1AUIB 1E15A 1BR4B 1AHRA 1NCXA 3UI6A 2LP3A 5HT1A 3F45A 2PRUA 4ORCB 1IJ5A 3JTDB 1UUSA 1N2DA 2JC2A 3VROA 2OLHA 2ZN8A 2E6WA 4HRHA 4OCIA 1K9UA 4YGDB 1H4BA 4L3NA 5I8NA 1LL4A 3AS3A 1KT1A 5HKZA 2OFNA 3ODKA 1K9KA 2VCDA 3FY1A 3CGMA 1CDNA 5DF0A 2MA2A 1L7ZA 3IQOA 4MNMA 3WD0A 1LJYA 2F2DA 1IGVA 4OV2A 1YW5A 3TDUA 1ZOTB 2K7OA 4ODLA 3O5LA 2XP7A 4YGAA 1EYMA 1CLLA 5HKWA 2DSWA 3ALFA 2PV1A 1XFXO 4D1EA 3KAIA 2O92A 1ZBVA 3NSIA 1CFDA 1WLMA 1S5GZ 3DVKA 2JNXA 1NX1A 3FWCA 3O5PA 3EY6A 3NSKA 1SPYA 4CLNA 2WC8A 4MN0A 5AFPA 2M0RA 3GK2A 4WJXA 4U8DA 3IKDA 1PK0D 3I5FC 3SG5A 1L2OC 1DJZA 1AJ5A 4QT2A 5HTGA 3IQQA 1CB1A 2LVKA 2MJWB 3B7XA 4BF8A 1WDCC 3KAHA 2CT9A 1A03A 2GV5A 2A4JA 2KQYA 1PVAA 4GAOA 1BLQA 1AP4A 1EG3A 1NX3A 2ZFDA 1NX0A 3LL8B 1UHKA 3O5OA 2D9FA 3O5KA 1OQPA 1FJDA 2WK2A 3PM8A 2VN1A 3UQAA 3AAKA 1S6CA 1ZFSA 1UHJA 3OX6A 4NDBA 1QJTA 1G4YR 2BKIB 2JT0A 4DRWA 1NP8A 5KU1A 1W26A 4IQ2A 4C02B 2K8IA 4CPVA 2PALA 3KABA 3D0YA 1CTRA 1UHNA 5GPRA 3PN7C 1WAWA 1NMWA 1M45A 2FKEA 4Q22A 1LG1A 1GJYA 1K9TA 4OKHA 1Y6WA 1EHNA 1J1EA 1S36A 3AS0A 1IX5A 1A29A 1D2KA 3DVEA 2KAVA 2BECA 4Z2HA 3WHUB 3BOWB 4HBOA 4FTGA 4USLA 2PPNA 1F71A 4M2QA 2XP6A 4J4NA 1WRKA 1ZBKA 2WOSA 2DPEA 2JULA 5I2QA 3AS2A 1DJIA 4DUQA 4WQ3A 2QF8A 1IQ5A 3ARPA 4FAPA 3CZ8A 1E6RA 2BCBA 2JNFA 4DRPA 4IT6A 5HUAA 2IS9A 5GPGA 3DVJA 4QIBA 3CHFA 4BY4A 2F33A 4I5JA 2I2RE 3MDYB 2K61A 1SBJA 1W1PA 2KBMA 3JXVA 2K7BA 2GGMA 2DG9A 1NSGA 2IF4A 2RUDA 2A3CA 3LLEA 1KSMA 2G41A 1J4IA 4WIWA 1HKIA 2LPVA 5I98A 2WCEA 4DRJA 4PDZA 1FFRA 4HARA 4Q04A 4ODNA 1B7TY 1H0GA 4YBHB 4DWSB 3SG2A 1FKLA 2FAPA 3CR2A 4PE7A 2JZIA 3LK1A 4PTMA 4W5UA 2NCOA 5D75A 2V53A 2ZQSA 4PALA 3WKZA 2JOJA 1H8BA 1FI6A 3TCZA 5CPVA 1IH0A 3BQ3A 2H61A 3O5RA 3OX5A 1GGWA 4NDDA 3AKAA 5TNCA 3ARWA 3O5JA 1D7JA 1AVSA 4W9PA 2PPOA 1AJ4A 2O5GA 2KYCA 1Q6IA 2LMUA 1DJXA 1LL6A 2DT3A 4A4BA 2RUCA 4JFMA 2WLYA 2MLYA 2PV2A 1WY9A 2KR7A 4DT4A 4DWSD 4MNKA 3VRNA 1E6PA 4GNKB 1SR6C 1J6YA 1BODA 2E30A 4A4CA 4DRNA 1YATA 1RK9A 3LK0A 4YI9A 2BCXA 3UQBA 1L1PA 1FKTA 2XP3A 1XFZO 4ODMA 4ODQA 2COLB 2DT2A 4XJKA 1B8CA 2KNEA 1U5IB 2UZ5A 1RD6A 3ARYA 1F8AB 1OE9B 4ZPTR 4IPXA 4DS7A 1KFXL 1BR1B 1TRFA 1TCOB 1YRUB 4ZS6A 2M8UA 1PVBA 3NSLA 3ARQA 4TNCA 2Q5AA 1WB0A 2ESCA 2WNDA 2Y78A 1QPFA 1SKTA 3OB1B 3O5FA 1CFPA 1M39A 1K93D 3GK1A 1XO5A 4JWQA 1K95A 3SJSA 4DZ2A 2BL0B 3KF9A 4DIRA 4IT4A 2KOTA 2KSPA 3B9DA 1U79A 4N19A 1SW8A 3VRPA 1XVJA 3JTDC 4AQIA 4HBEA 4P8XA 2ZRTA 4U84A 1UURA 1G8IA 4JPZB 1CFCA 3I6CA 4AOMA 3VAWA 1UHIA 1KT0A 1F8HA 2O9OA 3PA7A 4JFJA 2M29A 3DF0A 4NDCA 3FXYA 4XAKA 3MSEB 1O6IA 2H61C 2JTTA 2MLEC 5DO2A 5IBWA 4ZCVA 3EK7A 1QZ2A 1CLMA 2ZR5A 1IKUA 4DH0A 2HPSA 1OGGA 1QTXA 2KI4C 1OOJA 5B8IB 1FKBA 1ALWA 3IK8A 3KHEA 3CTNA 1FKKA 4KQZA 1SCMC 1FI5A 1YVHA 4ZCUA 1XA5A 1V1GA 2NXQA 2HF5A 4OVNF 3RFWA 3BUXB 4MBEA 1IG5A 1EXRA 4Z2KA 4GFTA 2K8MB 1B6CA 1JUOA 1HKJA 2ZKMX 2MLFC 1CTNA 1KWOC 4NNRA 3VGOA 1X6LA 3RM1A 2M1KB 2TN4A 2RUQA 3ZNIA 4AY1A 1KFXS 2KYFA 1A7XA 5AERA 4MZLA 2RSEA 1LXFC 3AS1A 1RTP1 3LCPC 4QT3A 4JYSA 4GIVA 1WNOA 4MLWA 2AAOA 3I5GB 3O2PA 1OSAA 2DSZA 2Y5IA 2F2PA 4YRUA 2KGRA 2AWGA 4IQCA 2M1UA 2YBUA 1KK7Z 3KACA 1MQ1A 3JVTC 1ROTA 2XP5A 1TNWA 3KO0A 3SIAA 3H9RB 1DF0B 1TNXA 3CR4X 3GOFA 3TUYC 2LANA 2NCPA 1CMGA 4FQOA 2LHLA 1F70A 2K2FA 1F4QA 1OMVA 4MRYA 2A3AA 2PSRA 5KTYA 3CLNA 4ORBB 3I5IC 2Y1MA 2SCPA 2RURA 1YURA 1SL9A 3BYAA 2CXJA 3WIJA 1FF1A 2XP8A 3QOKA 3RLZA 5BXJA 5HW6A 4I5LB 3O4YA 3EVUA 4MNJA 4O2TA 1F55A 4MGVA 3HCMA 4GPLB 4R0XA 4WK9A 3EK4A 1NIWA 2GGZA 1Q80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F33 A;  4I5J A;  3PRB A;  4WQ2 A;  3VRQ A;  2I2R E;  1QIV A;  1EG4 A;  5B8I C;  4MEW A;  1W7I B;  3TDZ A;  2M7L A;  3MDY B;  2K61 A;  1SBJ A;  1UP5 A;  2LAP A;  2KBM A;  3JXV A;  2K2A A;  2L0P A;  3SG7 A;  2K7B A;  3NRK A;  1OZO A;  2GGM A;  3I5H B;  2L4H A;  1IRJ A;  1NSG A;  2DG9 A;  1Y0V H;  2IF4 A;  2RUD A;  1BKF A;  2FCD A;  2BE6 A;  3BUM B;  4J4O A;  3TC5 A;  4XYN A;  1DVI A;  2KGJ A;  1SCV A;  5CSF A;  3LLE A;  1KSM A;  1QX2 A;  2CNP A;  5G08 A;  3OHM B;  2LNK A;  1J4I A;  4R1E A;  1M63 B;  4C0K A;  1J4R A;  1QLS A;  1J7O A;  4ITZ A;  2KI6 D;  4ICB A;  1MWN A;  1C9H A;  3CZT X;  2LPV A;  5I98 A;  4YGE B;  2OTG B;  4TNS A;  3H4S E;  2WCE A;  3UF8 A;  4WRI A;  3FWB A;  3TDB A;  5J3X A;  3C1V A;  4DRJ A;  3PAL A;  2K7C A;  1QV1 A;  1GQM A;  2OPO A;  4YGC B;  3VRR A;  2F4E A;  2F2O A;  4PDZ A;  1KQM B;  1CFF A;  1J4H A;  3CS1 A;  4ODK A;  4DRI A;  2P6B B;  4UPG A;  4QJ4 B;  1UHH A;  5D69 A;  4GGN A;  1F54 A;  1CKK A;  4YGB B;  4Q04 A;  2ISD A;  1QLK A;  1SL8 A;  1S6J A;  4MVF A;  2KAY A;  2HET A;  1NCY A;  4GBA A;  1B7T Y;  4ODN A;  1XFY O;  1NYA A;  4YBH B;  2K0J A;  1WRZ A;  3SG2 A;  4CID A;  1CLB A;  4ODO A;  1FKL A;  2FAP A;  3CR2 A;  1CMF A;  1S6I A;  4PE7 A;  2HQW A;  3O5D A;  1DJW A;  1HT9 A;  2JZI A;  3BUO B;  3LK1 A;  4NQG A;  2G2B A;  5HLV A;  1EH2 A;  5FYX A;  2PV3 A;  2G9B A;  4G50 A;  2NCO A;  2R2I A;  1LA0 A;  1XFV O;  3OB2 B;  1SRA A;  2LM5 A;  1DJG A;  2AUC A;  2LJ4 A;  2M97 A;  5CSJ A;  2V53 A;  2L2S A;  4PHM A;  4PAL A;  2KO7 A;  2ZQS A;  1IQ3 A;  5D75 A;  5HWB A;  3BXK A;  2KI3 A;  1TCF A;  2MNT A;  1YX7 A;  3PRD A;  1DGV A;  1EL4 A;  1K90 D;  1YR5 A;  2BBN A;  1D7I A;  2JOJ A;  4U86 A;  1K9P A;  2JQ6 A;  1QIW A;  1QAT A;  1BF5 A;  5KSZ A;  1H8B A;  1FI6 A;  2ZQV A;  5J6E A;  3TCZ A;  5CPV A;  1IH0 A;  4ORA B;  1YUU A;  1R2U A;  3I5G C;  3OP0 A;  3SG6 A;  1FKJ A;  1QPL A;  3BQ3 A;  3LUO A;  5DKQ A;  2H61 A;  4DRQ A;  1NCZ A;  3O5R A;  2DG3 A;  2EGD A;  1BL4 A;  1YTZ C;  3KAD A;  3OX5 A;  1GGW A;  4ODP A;  1B8L A;  2MBX A;  4W9Q A;  2KQ6 A;  2LV7 A;  4NDD A;  3AKA A;  1QAS A;  5TNC A;  1J7P A;  3O5J A;  1D7J A;  2M49 B;  5ER5 A;  1J55 A;  1AVS A;  3O5E A;  4W9P A;  4N1F A;  1DJH A;  2LHI A;  5HYD A;  2PPO A;  1FKG A;  2PAS A;  3EKH A;  4FN2 A;  3ICB A;  1AJ4 A;  2JXC A;  2OS8 B;  5AEQ A;  2XP9 A;  2ZR4 A;  1KQV A;  4TYO A;  3NXA A;  4QJ5 B;  1BMO A;  2CTN A;  5CSN A;  2O5G A;  1KCY A;  2KYC A;  2LLT A;  3WNX B;  2LMU A;  1Q6I A;  1A2X A;  2M2A A;  1DJX A;  4PE4 A;  5DKN A;  2WCF A;  3A8R A;  3NTP A;  2I94 A;  1FKI A;  1N1A A;  4A4B A;  3TS5 C;  2RUC A;  3O78 A;  1S5G Y;  5HLO A;  4JFM A;  2BE4 A;  1B47 A;  3QRX A;  1YUS A;  5HKY A;  1Y0O A;  2MLY A;  2PV2 A;  1WY9 A;  2KR7 A;  4DT4 A;  4TX0 A;  1TIZ A;  1B1G A;  1J7Q A;  5HKG A;  3VRN A;  1SL7 A;  2JWW A;  2M3W A;  1JFJ A;  4JQ0 D;  1IWQ A;  1LA3 A;  4GNK B;  1ZAC A;  1SR6 C;  2KI4 B;  1CDL A;  1DT7 B;  5GQQ C;  1J6Y A;  1BOD A;  1M31 A;  2E30 A;  2KI6 C;  2L2E A;  2L5X B;  2NZ0 A;  2ZN9 A;  4A4C A;  4DRN A;  3O6B A;  1YAT A;  2EC6 B;  3O5I A;  3A4U B;  4GGQ A;  1RK9 A;  1SCM B;  3AAJ A;  2Y4Q A;  3DD4 A;  3LK0 A;  2PVB A;  2VRG A;  4YI9 A;  3AKB A;  5DIT A;  2BCX A;  2XP4 A;  3JYJ A;  3UQB A;  1U5I A;  1FKT A;  2Q4U A;  1L1P A;  2JT8 A;  2LCP A;  4LAW A;  2XP3 A;  5HW8 A;  4I5K A;  1XFZ O;  1BU3 A;  1QVI Y;  1FKS A;  4ODM A;  1EQ3 A;  1K2H A;  4ODQ A;  1SYM A;  1LKJ A;  2QPT A;  1K8U A;  2KDH A;  1WRL A;  1L2O B;  2L50 A;  3FS7 A;  2COL B;  3I5F B;  4N1G A;  2MLX A;  2BBM A;  1Q6H A;  3HX4 A;  1NUB A;  4PHJ A;  1KSO A;  2M9G A;  3O5Q A;  4XJK A;  1ROU A;  1D6O A;  2Y1N A;  1B8C A;  2KNE A;  1PRW A;  5I2L A;  4DIP A;  1LIN A;  1U5I B;  1Y1U A;  1QS7 A;  2FOT A;  2UZ5 A;  2SAS A;  1DGU A;  3M0W A;  1A75 A;  3WHT B;  3IHZ A;  2CBL A;  2LUC A;  3GK4 X;  4QJ3 B;  1Y1A A;  1WDC B;  1ZUZ A;  2HQ8 A;  1K94 A;  1S3P A;  2F3Y A;  2LVV A;  4LAV A;  1MXE A;  4LAY A;  2EHB A;  2LKN A;  1ZK6 A;  1JC2 A;  1KWO B;  1F8A B;  1RFJ A;  3SIB A;  1C7V A;  4LAX A;  1LVC D;  1FBV A;  1OE9 B;  2F3Z A;  4XJK B;  4U85 A;  4TW7 A;  4IPX A;  1DTL A;  4DS7 A;  1KFX L;  1BR1 B;  1TRF A;  1TCO B;  3KAF A;  1MXL C;  1UWO A;  1DJY A;  3I5H C;  1YRU B;  2KBI A;  1TNQ A;  2NLN A;  2LGO A;  2M8U A;  1MR8 A;  1A75 B;  1PVB A;  1NSH A;  3NSL A;  3SG4 A;  3CWG A;  1HXV A;  1BG1 A;  1KK8 B;  2L51 A;  4TNC A;  2Q5A A;  1KFU L;  1M46 A;  4JFI A;  2JTZ A;  2L4I A;  2ZR6 A;  1E8A A;  2WND A;  1Q1C A;  1RRO A;  4I5N B;  2Y78 A;  1NX2 A;  2PPP A;  3GPK A;  1AUI B;  1YUT A;  1QPF A;  1SKT A;  1BR4 B;  3OB1 B;  1AHR A;  1NCX A;  2LMT A;  1WLZ A;  2LVJ A;  3O5F A;  2OTG C;  1CFP A;  3UI6 A;  4TW8 A;  2LP3 A;  5HT1 A;  1M39 A;  1TOP A;  3F45 A;  2XPB A;  3PAT A;  2KGB C;  2PRU A;  5DKR A;  3EKJ A;  2XPA A;  4ORC B;  1KQM C;  5F6T A;  1MHO A;  3BUW B;  3SG3 A;  1Q6U A;  1BT6 A;  4PE0 A;  1IJ5 A;  2K7D A;  1KK7 Y;  2MHH A;  5AAN A;  3JTD B;  1K93 D;  3GK1 A;  1UUS A;  4DRK A;  1XO5 A;  4GGF A;  1JNT A;  1N2D A;  4JWQ A;  1K95 A;  2JC2 A;  3VRO A;  4CFQ A;  2KFF A;  3SJS A;  4DZ2 A;  3UQI A;  3UI4 A;  2BL0 B;  3KF9 A;  3JVT B;  2QAC A;  1FW4 A;  4DIR A;  3PN7 B;  1B7T Z;  2JPT A;  2AMI A;  3EVR A;  2KOT A;  2ZN8 A;  2E6W A;  2KSP A;  4HRH A;  1FKH A;  1XK4 A;  3TDI A;  4M2P A;  1U79 A;  1CM1 A;  3TUY B;  1SW8 A;  3TZ1 A;  4N19 A;  1YX8 A;  3EK8 A;  4OCI A;  1QV0 A;  1K9U A;  1XFW O;  4YGD B;  3VRP A;  1FPW A;  1XVJ A;  3JTD C;  3EVV A;  1W7J B;  1H4B A;  4AQI A;  2ZQT A;  4JFL A;  1IJ6 A;  2M7N A;  5I2O A;  5I8N A;  1NPQ A;  3CGA A;  2ITK A;  2ZRT A;  5AXI A;  1UUR A;  4U84 A;  1KT1 A;  5HKZ A;  2OFN A;  3ODK A;  1B8R A;  2DG4 A;  1K9K A;  1ODB A;  2ZQU A;  1G8I A;  4JPZ B;  3PFV A;  1CFC A;  2VCD A;  1N0Y A;  1GGZ A;  3I6C A;  4AOM A;  2ZNE A;  1D7H A;  3ZWH A;  1SK6 D;  3VAW A;  3CGM A;  1CDN A;  1ZMZ A;  1EJ3 A;  1L7Z A;  2MA2 A;  4ETO A;  1TN4 A;  1B4C A;  1ZCN A;  1UHI A;  3IQO A;  1KT0 A;  1G33 A;  3I5I B;  1F8H A;  3PA7 A;  1FKD A;  4JFJ A;  2M29 A;  3DF0 A;  4NDC A;  4YI8 A;  2F2D A;  1IGV A;  4MZK A;  3JYM A;  2B1U A;  2OS8 C;  4OV2 A;  3MSE B;  4ODR A;  1TNP A;  4BY4 A;  1NWD A;  2H61 C;  1JF0 A;  2CCM A;  2JTT A;  2MLE C;  4AQJ A;  5K89 A;  1YW5 A;  2FCE A;  1CDM A;  3TDU A;  1ZOT B;  2K7O A;  4C0J A;  3KAG A;  4ODL A;  1YRT B;  2JZV A;  1FD9 A;  3O5L A;  3UI5 A;  1R9H A;  2XP7 A;  4YGA A;  1EYM A;  1JBA A;  1J1D A;  1CLL A;  2F8P A;  5HKW A;  4DRH A;  5IBW A;  1JFK A;  2KHN A;  4BY5 A;  1MF8 B;  1D1O A;  3DF0 B;  1NMV A;  2PV1 A;  4ZCV A;  1XFX O;  3EK7 A;  4D1E A;  1QZ2 A;  3KAI A;  1CLM A;  1B9A A;  3NSI A;  2ZR5 A;  1CFD A;  1WLM A;  1BJF A;  5JJG A;  1IKU A;  1S5G Z;  3DVK A;  2BKH B;  4DH0 A;  2FJU B;  2HPS A;  2JNX A;  1ALV A;  1NX1 A;  1QXP A;  1QTX A;  2KI4 C;  3FWC A;  1OOJ A;  5B8I B;  1FKB A;  2KFW A;  1ALW A;  3O5P A;  3IK8 A;  1C7W A;  1QX5 B;  1S1E A;  2EC6 C;  1N65 A;  4HRE E;  3KHE A;  3CTN A;  1FKK A;  3EY6 A;  1SCM C;  3NSK A;  1FI5 A;  1SPY A;  1YVH A;  4CLN A;  4ZCU A;  1XA5 A;  2WC8 A;  2LC5 A;  1PBK A;  1PSR A;  2LLU A;  2H2K A;  2LMV A;  1V1G A;  2NXQ A;  2HF5 A;  3NSO A;  1PSB A;  4MN0 A;  4OVN F;  3KPX A;  5AFP A;  3BUX B;  4MBE A;  2M0R A;  3GK2 A;  1IG5 A;  4DZ3 A;  4U8D A;  1J7R A;  2MLZ A;  1EXR A;  4GFT A;  1PAL A;  3IKD A;  3CR5 X;  3E3R A;  1PK0 D;  2K8M B;  3PSR A;  3I5F C;  4PHN A;  1L2O C;  3SG5 A;  1BOC A;  1RWY A;  1JVW A;  1DJZ A;  2LVI A;  3OOB A;  1JF2 A;  1B6C A;  1JUO A;  1AJ5 A;  4QT2 A;  5HTG A;  1QVI Z;  2D8N A;  2LP2 A;  3IQQ A;  4DRM A;  2LLS A;  2MAZ A;  1CB1 A;  4JFK A;  1JNS A;  2LVK A;  2MJW B;  3PLF B;  1X02 A;  3O5M A;  2ZKM X;  2O60 A;  2LUX A;  4PHK A;  1FKF A;  3B7X A;  4BF8 A;  2MLF C;  1WDC C;  3KAH A;  1CNP A;  2CT9 A;  1A03 A;  4PCW A;  3FIA A;  2GV5 A;  1PIN A;  2DOQ A;  1KWO C;  2A4J A;  2KQY A;  2PBC A;  2BCA A;  4NNR A;  1PVA A;  3VGO A;  1F40 A;  1TTX A;  5DIV A;  4GAO A;  4W9O A;  1TCO C;  3BUN B;  5JOL A;  3RM1 A;  2M1K B;  2MRD A;  2F21 A;  2TN4 A;  5ER4 X;  1BLQ A;  1AP4 A;  3ZNI A;  2RUQ A;  1EG3 A;  1NX3 A;  2ZFD A;  1YVL A;  1KFX S;  2KYF A;  4C0L A;  1A7X A;  2KE0 A;  5AER A;  1NX0 A;  1KK8 C;  4MZL A;  1RJV A;  3LL8 B;  1HQV A;  2RSE A;  5D7F A;  1UHK A;  1T11 A;  5CSI A;  3O5O A;  1LXF C;  1S26 D;  2I18 A;  1R6P A;  3IKG A;  1XFU O;  2D9F A;  3O5K A;  1OQP A;  1KFU S;  1RTP 1;  3LCP C;  1FJD A;  1A4P A;  4QT3 A;  4JYS A;  3PM8 A;  2VN1 A;  4GIV A;  3AAK A;  4HRG A;  3UQA A;  4HSZ A;  1CM4 A;  2Q91 A;  1S6C A;  1ZFS A;  4MLW A;  1UHJ A;  3OX6 A;  4NDB A;  1K96 A;  1QJT A;  1G4Y R;  2MPH A;  2BKI B;  2AAO A;  3I5G B;  3O2P A;  2N87 A;  3NI6 A;  1MUX A;  1REC A;  2JT0 A;  3KEV A;  5DIU A;  1DF0 A;  1OSA A;  1AK8 A;  2Y5I A;  1C07 A;  1SY9 A;  4DRW A;  2F2P A;  1NP8 A;  4L9M A;  2KGR A;  4P5O E;  4YRU A;  5KU1 A;  1W26 A;  4IQ2 A;  5HW7 A;  2AWG A;  4C02 B;  1SNL A;  2K8I A;  3KZ7 A;  2KAX A;  4CPV A;  2PAL A;  3KAB A;  4IQC A;  2M1U A;  2RGI A;  3D0Y A;  3KAC A;  1KK7 Z;  1CTR A;  1MQ1 A;  2BL0 C;  2JRF A;  2ZND A;  3JVT C;  1ROT A;  2XP5 A;  1V1F A;  1UHN A;  1TNW A;  3KO0 A;  3SIA A;  2LE9 B;  3PN7 C;  3H9R B;  4E68 A;  3O5G A;  4MZJ A;  1DF0 B;  1NMW A;  1TNX A;  1M45 A;  3CR4 X;  1JSA A;  4N5X A;  3GOF A;  3TUY C;  2FKE A;  1OMR A;  1GJY A;  2LAN A;  2NCP A;  3BOW A;  1CMG A;  4P2Y B;  4FQO A;  2LHL A;  4GGF C;  4OKH A;  1F70 A;  1Y6W A;  2K2F A;  2L98 A;  3TS5 B;  2WOR A;  5PAL A;  3WH0 A;  1F4Q A;  2I7A A;  1OMV A;  3D0Y B;  1J1E A;  3DVM A;  4MRY A;  1Y1X A;  1S36 A;  1XYD A;  1OZS A;  1A29 A;  5BPJ A;  1F4O A;  3DVE A;  2JU0 A;  1XK4 C;  2KAV A;  2PSR A;  2BEC A;  4PE1 A;  3IF7 A;  3RGC A;  2JXL A;  3WHU B;  1SR6 B;  4MSP A;  2MF9 A;  3BOW B;  5KTY A;  4DRO A;  2KFH A;  4FTG A;  4CFR A;  2KFG A;  3CLN A;  4USL A;  2PPN A;  4ORB B;  3CGN A;  4DCK A;  1F71 A;  1P5Q A;  3I5I C;  2Y1M A;  4F0Z B;  1DMO A;  2RQS A;  2PMY A;  1SMG A;  4M2Q A;  4MRX A;  1VRK A;  2SCP A;  5HWC A;  2RUR A;  2XP6 A;  4J4N A;  1YUR A;  1SL9 A;  3BYA A;  2CXJ A;  1WRK A;  1CDP A;  4TW6 A;  1OMD A;  1FF1 A;  2XP8 A;  2WOS A;  2ZRS A;  3RLZ A;  5BXJ A;  1PUL A;  1QX7 A;  1M5Y A;  1FAP A;  4GUK A;  2JUL A;  5HW6 A;  5I2Q A;  3FAP A;  4I5L B;  3O4Y A;  3EVU A;  4M2O A;  4O2T A;  1DJI A;  4DUQ A;  1F55 A;  4MGV A;  1FKR A;  3HCM A;  1JWD A;  3WXA A;  4OR9 B;  2M08 A;  2M1I A;  4WQ3 A;  3KCE A;  3RFW A;  3K21 A;  4GPL B;  4IL1 A;  4R0X A;  4G2P A;  1IQ5 A;  4FAP A;  2JT3 A;  3D10 A;  2BCB A;  3EK4 A;  2JNF A;  1NIW A;  2GGZ A;  4DRP A;  5HUA A;  1Q80 A;  2IS9 A;  5GPG A;  3DVJ A;  4QIB A;  2WCB A; 
#chains in the Genus database with same CATH topology
 3B86 A;  4MEW A;  1W7I B;  3DYE A;  1OZO A;  3I5H B;  1BKF A;  2BE6 A;  3BUM B;  1EIB A;  1W1T A;  4J4O A;  2KGJ A;  1QX2 A;  5G08 A;  2LNK A;  1QLS A;  4ICB A;  4JKT A;  4NZC A;  4TNS A;  4WRI A;  3FWB A;  3TDB A;  3C1V A;  4MPK A;  2K7C A;  4YGC B;  1J4H A;  4ODK A;  3CS1 A;  4QJ4 B;  3WD1 A;  4GGN A;  3CH9 A;  3OBV A;  1CKK A;  2ISD A;  4MVF A;  2HET A;  1NYA A;  4CID A;  1DJW A;  1HT9 A;  3BUO B;  4NQG A;  1EH2 A;  2PV3 A;  4G50 A;  2R2I A;  2LJ4 A;  2A3E A;  2M97 A;  5HWB A;  4PHM A;  1HKM A;  3BXK A;  2KI3 A;  2MNT A;  1D7I A;  1K90 D;  1K9P A;  2JQ6 A;  1QIW A;  5KSZ A;  1ITX A;  1JND A;  4ORA B;  1YUU A;  1R2U A;  3OP0 A;  2EGD A;  1YTZ C;  4W9Q A;  2KQ6 A;  5ER5 A;  2WC6 A;  4MNL A;  4NSB A;  2PI6 A;  2CTN A;  3A8R A;  1FKI A;  1N1A A;  3L47 A;  3TS5 C;  3O78 A;  1S5G Y;  3AQU A;  2BE4 A;  1B47 A;  3QRX A;  3WL0 A;  4INX A;  5HKG A;  2JWW A;  1LA3 A;  1ZAC A;  5GQQ C;  3S0D A;  2KI6 C;  3O5I A;  4GGQ A;  2Y4Q A;  3R1P A;  3AKB A;  5DIT A;  3IVT A;  2XP4 A;  3JYJ A;  1UR9 A;  1ZB5 A;  2LCP A;  1DQE A;  4I5K A;  1SYM A;  2QPT A;  1K8U A;  3I5F B;  1LG2 A;  1L2O B;  4N1G A;  2MLX A;  2BBM A;  1KSO A;  1PRW A;  1Y1U A;  2FOT A;  2SAS A;  3Q8I A;  3M0W A;  3IHZ A;  2CBL A;  3GK4 X;  1Y1A A;  1WDC B;  1S3P A;  4LAV A;  5HBF A;  3S0G A;  2LKN A;  1JC2 A;  1LVC D;  4U85 A;  1C3Y A;  1MXL C;  1DJY A;  2KBI A;  3O4X A;  2LGO A;  4L72 B;  1A75 B;  1HJX A;  3SG4 A;  1HXV A;  1BG1 A;  1KFU L;  2L4I A;  3ARR A;  1Q1C A;  3GPK A;  4I5N B;  2PPP A;  3B9A A;  1YUT A;  2LMT A;  2LVJ A;  3ARS A;  2OTG C;  4TW8 A;  5DKR A;  1KQM C;  1MHO A;  1Q6U A;  4Z2L A;  2K7D A;  2MHH A;  5AAN A;  4DRK A;  1JNT A;  4CFQ A;  3UQI A;  3UI4 A;  1OOG A;  2QAC A;  3DXL A;  1FW4 A;  2WM0 A;  3PN7 B;  2JPT A;  3EVR A;  2AMI A;  2DSV A;  1FKH A;  4M2P A;  4DZ3 A;  3EK8 A;  1QV0 A;  1XFW O;  3EVV A;  4JFL A;  5I2O A;  2M7N A;  1H0I A;  1E9L A;  1NPQ A;  5AXI A;  2P4V A;  1OGB A;  1B8R A;  1ODB A;  3PFV A;  1GGZ A;  2ZNE A;  1D7H A;  1W1Y A;  3ZWH A;  1SK6 D;  2AOS A;  2G8Z A;  1ZMZ A;  4ETO A;  1TN4 A;  1FKD A;  5GQB A;  2B1U A;  2OS8 C;  1TNP A;  2CCM A;  2FCE A;  1CDM A;  3KAG A;  3UI5 A;  1R9H A;  2F8P A;  4DRH A;  2KHN A;  3N7H A;  4BY5 A;  1MF8 B;  1D1O A;  1NMV A;  3CZ2 A;  5JJG A;  1BJF A;  2BKH B;  2FJU B;  1S1E A;  2EUL A;  2EC6 C;  1N65 A;  1PSR A;  2LLU A;  4MTV A;  1J7R A;  1PAL A;  3CR5 X;  2QEB A;  4PHN A;  3PSR A;  1JVW A;  2LVI A;  1QVI Z;  2LP2 A;  4DRM A;  1X02 A;  1TFV A;  2O60 A;  1FKF A;  3OGN A;  1CNP A;  4PCW A;  3FIA A;  2DOQ A;  2BCA A;  1F40 A;  1TTX A;  3RME A;  4W9O A;  3BUN B;  5JOL A;  5ER4 X;  1YVL A;  1W9Z A;  2L2C A;  4C0L A;  2KE0 A;  1KK8 C;  4WKA A;  1RJV A;  3FE8 A;  1HQV A;  5CSI A;  2I18 A;  1R6P A;  1XFU O;  1KFU S;  1A4P A;  5FI6 A;  4HRG A;  3ART A;  1CM4 A;  3B6X A;  3NHT A;  2MPH A;  2DT1 A;  2N87 A;  1REC A;  5DIU A;  4P5O E;  5HW7 A;  1SNL A;  2BNX A;  2KAX A;  2RGI A;  3WD4 A;  2ZND A;  1V1F A;  1DEK A;  2LE9 B;  4E68 A;  4MZJ A;  1JSA A;  4N5X A;  3BOW A;  4P2Y B;  2WOR A;  2I7A A;  4IJ7 A;  3D0Y B;  3DVM A;  1Y1X A;  3GTY X;  3RM8 A;  1F4O A;  3B7A A;  2WLZ A;  2JU0 A;  4PE1 A;  3IF7 A;  3RGC A;  2JXL A;  1SR6 B;  4MSP A;  2MF9 A;  4DRO A;  4CFR A;  4DCK A;  3WQV A;  4F0Z B;  2RQS A;  4Z2G A;  2PMY A;  4MRX A;  3QME A;  3BFA A;  1GUV A;  1ZL1 A;  1CDP A;  1M5Y A;  1FAP A;  3FAP A;  4M2O A;  4Z2I A;  3WXA A;  2M1I A;  3K21 A;  4IL1 A;  2JT3 A;  3SS4 A;  2WCB A;  3GU0 A;  3PRB A;  3VRQ A;  2WCL A;  1UP5 A;  2K2A A;  3SG7 A;  3NRK A;  1IRJ A;  2FCD A;  3TC5 A;  4XYN A;  4WKH A;  2CNP A;  3OHM B;  1M63 B;  1J4R A;  1J7O A;  1W9V A;  1MWN A;  3ARV A;  1TWO A;  4YGE B;  4DWS A;  5EL2 A;  5J3X A;  3PAL A;  1QV1 A;  2F4E A;  1CFF A;  4DRI A;  2P6B B;  4UPG A;  5D69 A;  1F54 A;  1SL8 A;  2KAY A;  1NCY A;  4GBA A;  2K0J A;  1OWQ A;  4ODO A;  3O5D A;  2G2B A;  5FYX A;  2G9B A;  1LA0 A;  1XFV O;  1SRA A;  1DJG A;  2L2S A;  1TCF A;  1YX7 A;  3PRD A;  3WL1 A;  1EL4 A;  2BBN A;  1DC1 A;  4UDM A;  1QAT A;  2KPH A;  1QPL A;  3LUO A;  3V2L A;  1GM0 A;  1FKJ A;  1GPF A;  1NCZ A;  1BL4 A;  1B8L A;  2LV7 A;  1J7P A;  2QEV A;  2M49 B;  2IUZ A;  3O5E A;  4N1F A;  1ZU8 A;  1DJH A;  2LHI A;  1XHG A;  2PAS A;  3EKH A;  4FN2 A;  2JXC A;  3PR9 A;  2ZR4 A;  3CHC A;  4TYO A;  4QJ5 B;  1BMO A;  5CSN A;  1KCY A;  2LLT A;  3WNX B;  2M2A A;  4PE4 A;  2WCF A;  3NTP A;  3R1O A;  5HLO A;  4P8U A;  1YUS A;  5HKY A;  1Y0O A;  1TIZ A;  1SL7 A;  1JFJ A;  1JNE A;  4JQ0 D;  2PQL A;  2KI4 B;  1DT7 B;  1M31 A;  2L2E A;  2L5X B;  2NZ0 A;  4LGX A;  1SCM B;  3AAJ A;  2VRG A;  1U5I A;  2Q4U A;  5HW8 A;  1FKS A;  1EQ3 A;  1K2H A;  2A3B A;  1LKJ A;  5DEZ A;  2KDH A;  2L50 A;  3FS7 A;  1Q6H A;  1HJV A;  2M9G A;  3O5Q A;  1ROU A;  1D6O A;  4DIP A;  1LIN A;  1QS7 A;  1DGU A;  4KYN A;  3WHT B;  3G6M A;  4R5E A;  1ZUZ A;  1K94 A;  3OA5 A;  2F3Y A;  4LAY A;  5JH8 A;  1ZK6 A;  1KWO B;  3SIB A;  4LAX A;  2F3Z A;  4XJK B;  4TW7 A;  1DTL A;  4ZPW R;  1X6N A;  3CYZ A;  1TNQ A;  2KLD A;  2NLN A;  5DIC A;  2YBT A;  1MR8 A;  3CWG A;  2L51 A;  1M46 A;  2ZR6 A;  1RRO A;  4Q7N A;  1WLZ A;  1TOP A;  2XPB A;  3PAT A;  2KGB C;  3EKJ A;  2XPA A;  5F6T A;  3BUW B;  3SG3 A;  1BT6 A;  1E6Z A;  4PE0 A;  4P8W A;  1KK7 Y;  4GGF A;  4DWS C;  2WCK A;  2KFF A;  1SR0 A;  2ERB A;  3JVT B;  1B7T Z;  3CAB A;  1W9P A;  1XK4 A;  3TDI A;  5FI2 A;  1CM1 A;  1GOI A;  3TUY B;  3TZ1 A;  1YX8 A;  1FPW A;  1W7J B;  2ZQT A;  1IJ6 A;  1W1V A;  3CGA A;  2ITK A;  2DG4 A;  2ZQU A;  3NGV A;  1N0Y A;  3RZS A;  1EJ3 A;  1B4C A;  1ZCN A;  1G33 A;  3I5I B;  4YI8 A;  3UNW A;  4MZK A;  3JYM A;  4ODR A;  1NWD A;  4AQJ A;  1JF0 A;  2WC5 A;  5K89 A;  4C0J A;  1YRT B;  2JZV A;  1FD9 A;  4P8V A;  1JBA A;  1J1D A;  1JFK A;  3DF0 B;  3S0B A;  4Z2J A;  1B9A A;  2YGU A;  1ZBC A;  1ALV A;  1QXP A;  2KFW A;  1HKK A;  1C7W A;  1QX5 B;  4HRE E;  1UR8 A;  3RM4 A;  1PBK A;  2LC5 A;  2LMV A;  2H2K A;  3NSO A;  1PSB A;  3KPX A;  3L4L A;  2MLZ A;  1KFW A;  3E3R A;  1BOC A;  1RWY A;  3OOB A;  1JF2 A;  3ARX A;  4ML4 A;  2D8N A;  2LLS A;  2MAZ A;  4JFK A;  1JNS A;  3PLF B;  3O5M A;  2LUX A;  4PHK A;  4F7F A;  1NWU A;  1SYT A;  1PIN A;  3CHE A;  2PBC A;  5DIV A;  3ARZ A;  1TCO C;  2FDM A;  2MRD A;  2F21 A;  3BXW A;  1QWV A;  5D7F A;  1T11 A;  1S26 D;  3IKG A;  1NWR A;  4MAV A;  4HSZ A;  3ARO A;  3R1V A;  2Q91 A;  1K96 A;  3NI6 A;  1MUX A;  5HL1 A;  3KEV A;  1DF0 A;  1AK8 A;  1C07 A;  1SY9 A;  4L9M A;  3KZ7 A;  3G6L A;  2BL0 C;  2JRF A;  3O5G A;  1OMR A;  1LQ0 A;  1E6N A;  4GGF C;  2L98 A;  3TS5 B;  5PAL A;  3WH0 A;  3NHI A;  1P28 A;  1XYD A;  3D73 A;  1OZS A;  3SS5 A;  5BPJ A;  1VF8 A;  3WD2 A;  3B8S A;  1XK4 C;  2B31 A;  2KFH A;  2KFG A;  3CGN A;  1P5Q A;  1DMO A;  1NWS A;  1SMG A;  1VRK A;  5HWC A;  4TW6 A;  1OMD A;  2ZRS A;  1PUL A;  1QX7 A;  3RM9 A;  4GUK A;  1FKR A;  1JWD A;  2M08 A;  4OR9 B;  3KCE A;  4G2P A;  3D10 A;  4KR0 B;  4WQ2 A;  1QIV A;  1EG4 A;  5B8I C;  3TDZ A;  4URI A;  2M7L A;  1NWT A;  2LAP A;  3FE9 A;  2L0P A;  4OZD A;  4FQT A;  2L4H A;  4S3J A;  1Y0V H;  1DVI A;  1SCV A;  5CSF A;  1OOH A;  4R1E A;  4C0K A;  4ITZ A;  2KI6 D;  3B9E A;  1OOI X;  1C9H A;  3CZT X;  2OTG B;  1W9U A;  3H4S E;  3UF8 A;  4S3K A;  1GQM A;  2OPO A;  3VRR A;  2F2O A;  1KQM B;  1ZBW A;  1UHH A;  3WD3 A;  4YGB B;  1QLK A;  1S6J A;  3WQW A;  1XFY O;  4ZPV R;  1WRZ A;  1CLB A;  1CMF A;  1S6I A;  2HQW A;  5HLV A;  3OB2 B;  1XRV A;  2LM5 A;  2AUC A;  5CSJ A;  3K1E A;  2KO7 A;  1IQ3 A;  1DGV A;  4U86 A;  1YR5 A;  1BF5 A;  2DSU A;  2ZQV A;  5J6E A;  3I5G C;  3SG6 A;  5DKQ A;  4DRQ A;  2DG3 A;  3KAD A;  4ODP A;  2WCJ A;  2MBX A;  3W4R A;  1QAS A;  4QZV B;  1J55 A;  3PRA A;  3ALG A;  5HYD A;  1FKG A;  3ICB A;  2OS8 B;  5AEQ A;  2XP9 A;  2P70 A;  1KQV A;  3NXA A;  1LL7 A;  1A2X A;  5DKN A;  2I94 A;  3CHD A;  1NH6 A;  4TX0 A;  1B1G A;  1J7Q A;  2M3W A;  1IWQ A;  3EIP A;  1CDL A;  2ZN9 A;  3ARU A;  3O6B A;  2EC6 B;  3A4U B;  2BAP A;  3DD4 A;  2PVB A;  3D77 A;  2JT8 A;  4LAW A;  2WCM A;  1BU3 A;  2DT0 A;  1QVI Y;  3BMB A;  1HJW A;  1WRL A;  5D3O A;  3HX4 A;  1NUB A;  4PHJ A;  2Y1N A;  5I2L A;  3S0A A;  3D76 A;  1FFQ A;  1E44 A;  1A75 A;  2LUC A;  4QJ3 B;  2HQ8 A;  2LVV A;  1MXE A;  1OOF A;  2EHB A;  1RFJ A;  1C7V A;  4WKF A;  1FBV A;  3D75 A;  3KAF A;  1UWO A;  3I5H C;  1NSH A;  1KK8 B;  4JFI A;  2JTZ A;  1E8A A;  1EDQ A;  1NX2 A;  3BFH A;  1AUI B;  1E15 A;  1BR4 B;  1AHR A;  1NCX A;  3UI6 A;  2LP3 A;  5HT1 A;  3F45 A;  2PRU A;  1TUZ A;  4ORC B;  1IJ5 A;  3JTD B;  1UUS A;  1N2D A;  2JC2 A;  3VRO A;  2OLH A;  2QDI A;  2ZN8 A;  2E6W A;  4HRH A;  4OCI A;  1K9U A;  4YGD B;  1H4B A;  4L3N A;  5I8N A;  1LL4 A;  2PN0 A;  3AS3 A;  1KT1 A;  5HKZ A;  2OFN A;  3ODK A;  1K9K A;  2VCD A;  3FY1 A;  3CGM A;  1CDN A;  5DF0 A;  2MA2 A;  1L7Z A;  3IQO A;  4MNM A;  3WD0 A;  2B5U B;  1GRJ A;  1Z4H A;  1LJY A;  2F2D A;  1IGV A;  4OV2 A;  1YW5 A;  3TDU A;  1ZOT B;  2K7O A;  4ODL A;  3O5L A;  2XP7 A;  4YGA A;  1EYM A;  5I94 A;  1CLL A;  5HKW A;  2DSW A;  3ALF A;  2PV1 A;  1XFX O;  4D1E A;  3KAI A;  2O92 A;  1ZBV A;  3NSI A;  1CFD A;  1WLM A;  1S5G Z;  3DVK A;  3PJI A;  2JNX A;  1NX1 A;  3FWC A;  3O5P A;  3CZ1 A;  3EY6 A;  3NSK A;  1SPY A;  4CLN A;  2WC8 A;  4MN0 A;  5AFP A;  2M0R A;  3GK2 A;  4WJX A;  4U8D A;  3IKD A;  1T14 A;  1PK0 D;  3I5F C;  3SG5 A;  1L2O C;  1DJZ A;  1AJ5 A;  4QT2 A;  2FJY A;  5HTG A;  3IQQ A;  1CB1 A;  2LVK A;  2MJW B;  2QEH A;  3B7X A;  4BF8 A;  1WDC C;  3KAH A;  2CT9 A;  1A03 A;  2GV5 A;  3DY9 A;  2A4J A;  2KQY A;  1PVA A;  4GAO A;  2WCH A;  1BLQ A;  1AP4 A;  1EG3 A;  1NX3 A;  2ZFD A;  1NX0 A;  3LL8 B;  1UHK A;  3O5O A;  2D9F A;  3O5K A;  1OQP A;  2ETN A;  1FJD A;  2WK2 A;  3PM8 A;  2VN1 A;  3UQA A;  3AAK A;  1S6C A;  1ZFS A;  1UHJ A;  3OX6 A;  4NDB A;  1QJT A;  1G4Y R;  2BKI B;  2JT0 A;  4DRW A;  1NP8 A;  3DZT A;  5KU1 A;  1W26 A;  4IQ2 A;  4C02 B;  2K8I A;  4CPV A;  2PAL A;  3KAB A;  1SSE B;  3D0Y A;  1CTR A;  1UHN A;  5GPR A;  3PN7 C;  1WAW A;  1NMW A;  1M45 A;  2FKE A;  4Q22 A;  1LG1 A;  1GJY A;  1K9T A;  2JPO A;  4OKH A;  1Y6W A;  1EHN A;  1J1E A;  1S36 A;  3VB1 A;  3AS0 A;  1IX5 A;  1A29 A;  1D2K A;  3DVE A;  2KAV A;  1TUJ A;  2BEC A;  4Z2H A;  3WHU B;  3BOW B;  3UO9 A;  4HBO A;  4FTG A;  4USL A;  2PPN A;  1F71 A;  4M2Q A;  2XP6 A;  4J4N A;  2PYQ A;  1WRK A;  1ZBK A;  2WOS A;  2DPE A;  2JUL A;  5I2Q A;  3AS2 A;  1DJI A;  4DUQ A;  2K60 A;  4WQ3 A;  2QF8 A;  1IQ5 A;  3FE6 A;  3ARP A;  3B88 A;  3CZ8 A;  1E6R A;  4FAP A;  2BCB A;  2JNF A;  4DRP A;  4IT6 A;  5HUA A;  2IS9 A;  5GPG A;  3DVJ A;  4QIB A;  3CHF A;  4BY4 A;  2F33 A;  4I5J A;  2I2R E;  3MDY B;  2K61 A;  1SBJ A;  1W1P A;  2KBM A;  3JXV A;  2K7B A;  1ORG A;  2GGM A;  2DG9 A;  1NSG A;  2IF4 A;  2RUD A;  2A3C A;  3LLE A;  3L4A A;  1KSM A;  2G41 A;  1J4I A;  4WIW A;  1HKI A;  2LPV A;  5I98 A;  2WCE A;  4DRJ A;  4PDZ A;  1Z2C B;  1FFR A;  2H8V A;  4HAR A;  4Q04 A;  4ODN A;  1B7T Y;  1H0G A;  4YBH B;  4DWS B;  3SG2 A;  1FKL A;  2FAP A;  3CR2 A;  4PE7 A;  2JZI A;  3LK1 A;  4PTM A;  4W5U A;  2NCO A;  5D75 A;  2V53 A;  2ZQS A;  4PAL A;  3WKZ A;  2JOJ A;  1H8B A;  1FI6 A;  1XFR A;  3TCZ A;  5CPV A;  1IH0 A;  3BQ3 A;  2H61 A;  3O5R A;  3OX5 A;  1GGW A;  4NDD A;  3AKA A;  5TNC A;  3ARW A;  3O5J A;  1D7J A;  1AVS A;  4W9P A;  2PPO A;  3D74 A;  1AJ4 A;  2O5G A;  2KYC A;  1Q6I A;  2LMU A;  1DJX A;  1LL6 A;  2DT3 A;  4A4B A;  2RUC A;  3CZ0 A;  4JFM A;  2WLY A;  2MLY A;  2PV2 A;  1WY9 A;  2KR7 A;  4DT4 A;  4DWS D;  4MNK A;  3VRN A;  1E6P A;  4GNK B;  1SR6 C;  1J6Y A;  1BOD A;  2E30 A;  4A4C A;  4DRN A;  1YAT A;  1RK9 A;  3LK0 A;  4YI9 A;  2BCX A;  3UQB A;  1L1P A;  1FKT A;  2XP3 A;  1XFZ O;  4ODM A;  2F23 A;  1DEL A;  4ODQ A;  2COL B;  2DT2 A;  4XJK A;  1B8C A;  2KNE A;  3SS3 A;  1U5I B;  2UZ5 A;  1RD6 A;  3ARY A;  1F8A B;  1OE9 B;  4ZPT R;  4IPX A;  4DS7 A;  1TRF A;  1BR1 B;  1KFX L;  1TCO B;  1YRU B;  3B87 A;  4ZS6 A;  2M8U A;  1PVB A;  3NSL A;  3ARQ A;  4TNC A;  2Q5A A;  2GTE A;  1JCH B;  1WB0 A;  2ESC A;  2WND A;  2Y78 A;  1QPF A;  1SKT A;  3OB1 B;  3O5F A;  1CFP A;  1M39 A;  2QEO A;  1K93 D;  3GK1 A;  1XO5 A;  4JWQ A;  1K95 A;  3R72 A;  3SJS A;  4DZ2 A;  2BL0 B;  3KF9 A;  4JD9 A;  4DIR A;  4IT4 A;  2KOT A;  2KSP A;  3CDN A;  3B9D A;  1U79 A;  4N19 A;  1SW8 A;  3VRP A;  1XVJ A;  3JTD C;  4INW A;  4AQI A;  4HBE A;  4P8X A;  2ZRT A;  4U84 A;  1UUR A;  1G8I A;  4JPZ B;  1CFC A;  3I6C A;  4AOM A;  3VAW A;  2P71 A;  1UHI A;  1KT0 A;  5FI7 A;  1F8H A;  2O9O A;  3PA7 A;  4JFJ A;  2M29 A;  3DF0 A;  4NDC A;  3FXY A;  1C3Z A;  4XAK A;  3MSE B;  1O6I A;  2H61 C;  2JTT A;  2MLE C;  5DO2 A;  3D78 A;  5IBW A;  2L5Y A;  4ZCV A;  3EK7 A;  1QZ2 A;  1CLM A;  2ZR5 A;  1IKU A;  4DH0 A;  2HPS A;  1LS8 A;  1OGG A;  3EG5 B;  1QTX A;  2KI4 C;  1OOJ A;  5B8I B;  1FKB A;  1ALW A;  3S0E A;  3IK8 A;  3KHE A;  3CTN A;  1FKK A;  4KQZ A;  1SCM C;  1FI5 A;  1YVH A;  4ZCU A;  1XA5 A;  3BFB A;  1V1G A;  2NXQ A;  2HF5 A;  4OVN F;  3RFW A;  3BUX B;  4MBE A;  1IG5 A;  1EXR A;  4Z2K A;  4GFT A;  2K8M B;  3BJH A;  1B6C A;  1JUO A;  3S0F A;  1HKJ A;  2ZKM X;  2MLF C;  1CTN A;  1KWO C;  1OW4 A;  4NNR A;  3VGO A;  1X6L A;  3RM1 A;  2M1K B;  2TN4 A;  2RUQ A;  3ZNI A;  4AY1 A;  1KFX S;  2KYF A;  1A7X A;  5AER A;  4MZL A;  2RSE A;  1LXF C;  3AS1 A;  1RTP 1;  3LCP C;  4QT3 A;  4JYS A;  4GIV A;  1WNO A;  4MLW A;  2AAO A;  3I5G B;  3O2P A;  1OSA A;  2DSZ A;  2Y5I A;  2F2P A;  4YRU A;  2KGR A;  2AWG A;  4IQC A;  2M1U A;  2YBU A;  1KK7 Z;  3KAC A;  1MQ1 A;  3JVT C;  1ROT A;  2XP5 A;  1TNW A;  3KO0 A;  3SIA A;  3H9R B;  1DF0 B;  1TNX A;  3CR4 X;  3GOF A;  3TUY C;  1IIO A;  2LAN A;  2NCP A;  1CMG A;  4FQO A;  2LHL A;  1F70 A;  2K2F A;  4PT1 A;  1F4Q A;  1OMV A;  4MRY A;  2A3A A;  2KLE A;  2PSR A;  5KTY A;  3PM2 A;  3CLN A;  4ORB B;  3I5I C;  2Y1M A;  2SCP A;  2RUR A;  1YUR A;  1SL9 A;  3BYA A;  2CXJ A;  3WIJ A;  1FF1 A;  2XP8 A;  3QOK A;  3RLZ A;  5BXJ A;  5HW6 A;  4I5L B;  3O4Y A;  3EVU A;  4MNJ A;  4O2T A;  1F55 A;  4MGV A;  3HCM A;  4GPL B;  4R0X A;  4WK9 A;  3EK4 A;  1NIW A;  2GGZ A;  1Q80 A; 
#chains in the Genus database with same CATH homology
 4MEW A;  1W7I B;  1OZO A;  3I5H B;  1BKF A;  2BE6 A;  3BUM B;  1EIB A;  1W1T A;  4J4O A;  2KGJ A;  1QX2 A;  5G08 A;  2LNK A;  1QLS A;  4ICB A;  4NZC A;  4TNS A;  4WRI A;  3FWB A;  3TDB A;  3C1V A;  4MPK A;  2K7C A;  4YGC B;  1J4H A;  4ODK A;  3CS1 A;  4QJ4 B;  3WD1 A;  4GGN A;  3CH9 A;  1CKK A;  2ISD A;  4MVF A;  2HET A;  1NYA A;  4CID A;  1DJW A;  1HT9 A;  3BUO B;  4NQG A;  1EH2 A;  2PV3 A;  4G50 A;  2R2I A;  2LJ4 A;  2A3E A;  2M97 A;  5HWB A;  4PHM A;  1HKM A;  3BXK A;  2KI3 A;  2MNT A;  1D7I A;  1K90 D;  1K9P A;  2JQ6 A;  1QIW A;  5KSZ A;  1ITX A;  1JND A;  4ORA B;  1YUU A;  1R2U A;  3OP0 A;  2EGD A;  1YTZ C;  4W9Q A;  2KQ6 A;  5ER5 A;  4MNL A;  4NSB A;  2PI6 A;  2CTN A;  3A8R A;  1FKI A;  1N1A A;  3TS5 C;  3O78 A;  1S5G Y;  3AQU A;  2BE4 A;  1B47 A;  3QRX A;  3WL0 A;  5HKG A;  2JWW A;  1LA3 A;  1ZAC A;  5GQQ C;  2KI6 C;  3O5I A;  4GGQ A;  2Y4Q A;  3AKB A;  5DIT A;  2XP4 A;  3JYJ A;  1UR9 A;  1ZB5 A;  2LCP A;  4I5K A;  1SYM A;  2QPT A;  1K8U A;  3I5F B;  1LG2 A;  1L2O B;  4N1G A;  2MLX A;  2BBM A;  1KSO A;  1PRW A;  1Y1U A;  2FOT A;  2SAS A;  3M0W A;  3IHZ A;  2CBL A;  3GK4 X;  1Y1A A;  1WDC B;  1S3P A;  4LAV A;  5HBF A;  2LKN A;  1JC2 A;  1LVC D;  4U85 A;  1MXL C;  1DJY A;  2KBI A;  2LGO A;  4L72 B;  1A75 B;  1HJX A;  3SG4 A;  1HXV A;  1BG1 A;  1KFU L;  2L4I A;  3ARR A;  1Q1C A;  3GPK A;  4I5N B;  2PPP A;  3B9A A;  1YUT A;  2LMT A;  2LVJ A;  3ARS A;  2OTG C;  4TW8 A;  5DKR A;  1KQM C;  1MHO A;  1Q6U A;  4Z2L A;  2K7D A;  2MHH A;  5AAN A;  4DRK A;  1JNT A;  4CFQ A;  3UQI A;  3UI4 A;  2QAC A;  2WM0 A;  1FW4 A;  3PN7 B;  2JPT A;  3EVR A;  2AMI A;  2DSV A;  1FKH A;  4M2P A;  4DZ3 A;  3EK8 A;  1QV0 A;  1XFW O;  3EVV A;  4JFL A;  5I2O A;  2M7N A;  1H0I A;  1E9L A;  1NPQ A;  5AXI A;  1OGB A;  1B8R A;  1ODB A;  3PFV A;  1GGZ A;  2ZNE A;  1D7H A;  1W1Y A;  3ZWH A;  1SK6 D;  2AOS A;  2G8Z A;  1ZMZ A;  4ETO A;  1TN4 A;  1FKD A;  5GQB A;  2B1U A;  2OS8 C;  1TNP A;  2CCM A;  2FCE A;  1CDM A;  3KAG A;  3UI5 A;  1R9H A;  2F8P A;  4DRH A;  2KHN A;  4BY5 A;  1MF8 B;  1D1O A;  1NMV A;  5JJG A;  1BJF A;  2BKH B;  2FJU B;  1S1E A;  2EC6 C;  1N65 A;  4MTV A;  1PSR A;  2LLU A;  1J7R A;  1PAL A;  3CR5 X;  4PHN A;  3PSR A;  1JVW A;  2LVI A;  1QVI Z;  2LP2 A;  4DRM A;  1X02 A;  1TFV A;  2O60 A;  1FKF A;  1CNP A;  4PCW A;  3FIA A;  2DOQ A;  2BCA A;  1F40 A;  1TTX A;  3RME A;  4W9O A;  3BUN B;  5JOL A;  5ER4 X;  1YVL A;  4C0L A;  2KE0 A;  1KK8 C;  4WKA A;  1RJV A;  1HQV A;  5CSI A;  2I18 A;  1R6P A;  1XFU O;  1KFU S;  1A4P A;  4HRG A;  3ART A;  1CM4 A;  2MPH A;  2DT1 A;  2N87 A;  1REC A;  5DIU A;  4P5O E;  5HW7 A;  1SNL A;  2KAX A;  2RGI A;  3WD4 A;  2ZND A;  1V1F A;  2LE9 B;  4E68 A;  4MZJ A;  1JSA A;  4N5X A;  3BOW A;  4P2Y B;  2WOR A;  2I7A A;  3D0Y B;  3DVM A;  1Y1X A;  3RM8 A;  1F4O A;  2WLZ A;  2JU0 A;  4PE1 A;  3IF7 A;  3RGC A;  2JXL A;  1SR6 B;  4MSP A;  2MF9 A;  4DRO A;  4CFR A;  4DCK A;  3WQV A;  4F0Z B;  2RQS A;  4Z2G A;  2PMY A;  4MRX A;  1GUV A;  1ZL1 A;  1CDP A;  1M5Y A;  1FAP A;  3FAP A;  4M2O A;  4Z2I A;  3WXA A;  2M1I A;  3K21 A;  4IL1 A;  2JT3 A;  2WCB A;  3PRB A;  3VRQ A;  1UP5 A;  2K2A A;  3SG7 A;  3NRK A;  1IRJ A;  2FCD A;  3TC5 A;  4XYN A;  4WKH A;  2CNP A;  3OHM B;  1M63 B;  1J4R A;  1J7O A;  1W9V A;  1MWN A;  3ARV A;  4YGE B;  4DWS A;  5J3X A;  3PAL A;  1QV1 A;  2F4E A;  1CFF A;  4DRI A;  2P6B B;  4UPG A;  5D69 A;  1F54 A;  1SL8 A;  2KAY A;  1NCY A;  4GBA A;  2K0J A;  1OWQ A;  4ODO A;  3O5D A;  2G2B A;  5FYX A;  2G9B A;  1LA0 A;  1XFV O;  1SRA A;  1DJG A;  2L2S A;  1TCF A;  1YX7 A;  3PRD A;  3WL1 A;  1EL4 A;  2BBN A;  1QAT A;  1QPL A;  3LUO A;  1GPF A;  1FKJ A;  1NCZ A;  1BL4 A;  1B8L A;  2LV7 A;  1J7P A;  2M49 B;  2IUZ A;  3O5E A;  4N1F A;  1ZU8 A;  1DJH A;  2LHI A;  1XHG A;  2PAS A;  3EKH A;  4FN2 A;  2JXC A;  3PR9 A;  2ZR4 A;  3CHC A;  4TYO A;  4QJ5 B;  1BMO A;  5CSN A;  1KCY A;  2LLT A;  3WNX B;  2M2A A;  4PE4 A;  2WCF A;  3NTP A;  5HLO A;  4P8U A;  1YUS A;  5HKY A;  1Y0O A;  1TIZ A;  1SL7 A;  1JFJ A;  1JNE A;  4JQ0 D;  2KI4 B;  1DT7 B;  1M31 A;  2L2E A;  2L5X B;  2NZ0 A;  4LGX A;  1SCM B;  3AAJ A;  2VRG A;  1U5I A;  2Q4U A;  5HW8 A;  1FKS A;  1EQ3 A;  1K2H A;  2A3B A;  1LKJ A;  5DEZ A;  2KDH A;  2L50 A;  3FS7 A;  1Q6H A;  1HJV A;  2M9G A;  3O5Q A;  1ROU A;  1D6O A;  4DIP A;  1LIN A;  1QS7 A;  1DGU A;  3WHT B;  3G6M A;  4R5E A;  1ZUZ A;  1K94 A;  3OA5 A;  2F3Y A;  4LAY A;  5JH8 A;  1ZK6 A;  1KWO B;  3SIB A;  4LAX A;  2F3Z A;  4XJK B;  4TW7 A;  1DTL A;  4ZPW R;  1X6N A;  1TNQ A;  2NLN A;  2YBT A;  1MR8 A;  3CWG A;  2L51 A;  1M46 A;  2ZR6 A;  1RRO A;  4Q7N A;  1WLZ A;  1TOP A;  2XPB A;  3PAT A;  2KGB C;  3EKJ A;  2XPA A;  5F6T A;  3BUW B;  3SG3 A;  1BT6 A;  1E6Z A;  4PE0 A;  4P8W A;  1KK7 Y;  4GGF A;  4DWS C;  2KFF A;  1SR0 A;  3JVT B;  1B7T Z;  1W9P A;  1XK4 A;  3TDI A;  1CM1 A;  1GOI A;  3TUY B;  3TZ1 A;  1YX8 A;  1FPW A;  1W7J B;  2ZQT A;  1IJ6 A;  1W1V A;  3CGA A;  2ITK A;  2DG4 A;  2ZQU A;  1N0Y A;  1EJ3 A;  1B4C A;  1ZCN A;  1G33 A;  3I5I B;  4YI8 A;  4MZK A;  3JYM A;  4ODR A;  1NWD A;  4AQJ A;  1JF0 A;  5K89 A;  4C0J A;  1YRT B;  2JZV A;  1FD9 A;  4P8V A;  1JBA A;  1J1D A;  1JFK A;  3DF0 B;  4Z2J A;  1B9A A;  1ZBC A;  1ALV A;  1QXP A;  2KFW A;  1HKK A;  1C7W A;  1QX5 B;  4HRE E;  1UR8 A;  3RM4 A;  1PBK A;  2LC5 A;  2LMV A;  2H2K A;  3NSO A;  1PSB A;  3KPX A;  2MLZ A;  1KFW A;  3E3R A;  1BOC A;  1RWY A;  3OOB A;  1JF2 A;  3ARX A;  4ML4 A;  2D8N A;  2LLS A;  2MAZ A;  4JFK A;  1JNS A;  3PLF B;  3O5M A;  2LUX A;  4PHK A;  1NWU A;  1SYT A;  1PIN A;  3CHE A;  2PBC A;  5DIV A;  3ARZ A;  1TCO C;  2FDM A;  2MRD A;  2F21 A;  3BXW A;  5D7F A;  1T11 A;  1S26 D;  3IKG A;  1NWR A;  4MAV A;  4HSZ A;  3ARO A;  2Q91 A;  1K96 A;  3NI6 A;  1MUX A;  3KEV A;  1DF0 A;  1AK8 A;  1C07 A;  1SY9 A;  4L9M A;  3KZ7 A;  3G6L A;  2BL0 C;  2JRF A;  3O5G A;  1OMR A;  1LQ0 A;  1E6N A;  4GGF C;  2L98 A;  3TS5 B;  5PAL A;  3WH0 A;  1XYD A;  1OZS A;  5BPJ A;  1VF8 A;  3WD2 A;  3B8S A;  1XK4 C;  2B31 A;  2KFH A;  2KFG A;  3CGN A;  1P5Q A;  1DMO A;  1NWS A;  1SMG A;  1VRK A;  5HWC A;  4TW6 A;  1OMD A;  2ZRS A;  1PUL A;  1QX7 A;  3RM9 A;  4GUK A;  1FKR A;  1JWD A;  2M08 A;  4OR9 B;  3KCE A;  4G2P A;  3D10 A;  4KR0 B;  4WQ2 A;  1QIV A;  1EG4 A;  5B8I C;  3TDZ A;  4URI A;  2M7L A;  1NWT A;  2LAP A;  2L0P A;  2L4H A;  4S3J A;  1Y0V H;  1DVI A;  1SCV A;  5CSF A;  4R1E A;  4C0K A;  4ITZ A;  2KI6 D;  3B9E A;  1C9H A;  3CZT X;  2OTG B;  1W9U A;  3H4S E;  3UF8 A;  4S3K A;  1GQM A;  2OPO A;  3VRR A;  2F2O A;  1KQM B;  1ZBW A;  1UHH A;  3WD3 A;  4YGB B;  1QLK A;  1S6J A;  3WQW A;  1XFY O;  4ZPV R;  1WRZ A;  1CLB A;  1CMF A;  1S6I A;  2HQW A;  5HLV A;  3OB2 B;  1XRV A;  2LM5 A;  2AUC A;  5CSJ A;  2KO7 A;  1IQ3 A;  1DGV A;  4U86 A;  1YR5 A;  1BF5 A;  2DSU A;  2ZQV A;  5J6E A;  3I5G C;  3SG6 A;  5DKQ A;  4DRQ A;  2DG3 A;  3KAD A;  4ODP A;  2MBX A;  3W4R A;  1QAS A;  4QZV B;  1J55 A;  3PRA A;  3ALG A;  5HYD A;  1FKG A;  3ICB A;  2OS8 B;  5AEQ A;  2XP9 A;  1KQV A;  3NXA A;  1LL7 A;  1A2X A;  5DKN A;  2I94 A;  3CHD A;  1NH6 A;  4TX0 A;  1B1G A;  1J7Q A;  2M3W A;  1IWQ A;  1CDL A;  2ZN9 A;  3ARU A;  3O6B A;  2EC6 B;  3A4U B;  3DD4 A;  2PVB A;  2JT8 A;  4LAW A;  1BU3 A;  2DT0 A;  1QVI Y;  1HJW A;  1WRL A;  3HX4 A;  1NUB A;  4PHJ A;  2Y1N A;  5I2L A;  1FFQ A;  1A75 A;  2LUC A;  4QJ3 B;  2HQ8 A;  2LVV A;  1MXE A;  2EHB A;  1RFJ A;  1C7V A;  4WKF A;  1FBV A;  3KAF A;  1UWO A;  3I5H C;  1NSH A;  1KK8 B;  4JFI A;  2JTZ A;  1E8A A;  1EDQ A;  1NX2 A;  1AUI B;  1E15 A;  1BR4 B;  1AHR A;  1NCX A;  3UI6 A;  2LP3 A;  5HT1 A;  3F45 A;  2PRU A;  4ORC B;  1IJ5 A;  3JTD B;  1UUS A;  1N2D A;  2JC2 A;  3VRO A;  2OLH A;  2ZN8 A;  2E6W A;  4HRH A;  4OCI A;  1K9U A;  4YGD B;  1H4B A;  4L3N A;  5I8N A;  1LL4 A;  3AS3 A;  1KT1 A;  5HKZ A;  2OFN A;  3ODK A;  1K9K A;  2VCD A;  3FY1 A;  3CGM A;  1CDN A;  5DF0 A;  2MA2 A;  1L7Z A;  3IQO A;  4MNM A;  3WD0 A;  1LJY A;  2F2D A;  1IGV A;  4OV2 A;  1YW5 A;  3TDU A;  1ZOT B;  2K7O A;  4ODL A;  3O5L A;  2XP7 A;  4YGA A;  1EYM A;  1CLL A;  5HKW A;  2DSW A;  3ALF A;  2PV1 A;  1XFX O;  4D1E A;  3KAI A;  2O92 A;  1ZBV A;  3NSI A;  1CFD A;  1WLM A;  1S5G Z;  3DVK A;  2JNX A;  1NX1 A;  3FWC A;  3O5P A;  3EY6 A;  3NSK A;  1SPY A;  4CLN A;  2WC8 A;  4MN0 A;  5AFP A;  2M0R A;  3GK2 A;  4WJX A;  4U8D A;  3IKD A;  1PK0 D;  3I5F C;  3SG5 A;  1L2O C;  1DJZ A;  1AJ5 A;  4QT2 A;  5HTG A;  3IQQ A;  1CB1 A;  2LVK A;  2MJW B;  3B7X A;  4BF8 A;  1WDC C;  3KAH A;  2CT9 A;  1A03 A;  2GV5 A;  2A4J A;  2KQY A;  1PVA A;  4GAO A;  1BLQ A;  1AP4 A;  1EG3 A;  1NX3 A;  2ZFD A;  1NX0 A;  3LL8 B;  1UHK A;  3O5O A;  2D9F A;  3O5K A;  1OQP A;  1FJD A;  2WK2 A;  3PM8 A;  2VN1 A;  3UQA A;  3AAK A;  1S6C A;  1ZFS A;  1UHJ A;  3OX6 A;  4NDB A;  1QJT A;  1G4Y R;  2BKI B;  2JT0 A;  4DRW A;  1NP8 A;  5KU1 A;  1W26 A;  4IQ2 A;  4C02 B;  2K8I A;  4CPV A;  2PAL A;  3KAB A;  3D0Y A;  1CTR A;  1UHN A;  5GPR A;  3PN7 C;  1WAW A;  1NMW A;  1M45 A;  2FKE A;  4Q22 A;  1LG1 A;  1GJY A;  1K9T A;  4OKH A;  1Y6W A;  1EHN A;  1J1E A;  1S36 A;  3AS0 A;  1IX5 A;  1A29 A;  1D2K A;  3DVE A;  2KAV A;  2BEC A;  4Z2H A;  3WHU B;  3BOW B;  4HBO A;  4FTG A;  4USL A;  2PPN A;  1F71 A;  4M2Q A;  2XP6 A;  4J4N A;  1WRK A;  1ZBK A;  2WOS A;  2DPE A;  2JUL A;  5I2Q A;  3AS2 A;  1DJI A;  4DUQ A;  4WQ3 A;  2QF8 A;  1IQ5 A;  3ARP A;  4FAP A;  3CZ8 A;  1E6R A;  2BCB A;  2JNF A;  4DRP A;  4IT6 A;  5HUA A;  2IS9 A;  5GPG A;  3DVJ A;  4QIB A;  3CHF A;  4BY4 A;  2F33 A;  4I5J A;  2I2R E;  3MDY B;  2K61 A;  1SBJ A;  1W1P A;  2KBM A;  3JXV A;  2K7B A;  2GGM A;  2DG9 A;  1NSG A;  2IF4 A;  2RUD A;  2A3C A;  3LLE A;  1KSM A;  2G41 A;  1J4I A;  4WIW A;  1HKI A;  2LPV A;  5I98 A;  2WCE A;  4DRJ A;  4PDZ A;  1FFR A;  4HAR A;  4Q04 A;  4ODN A;  1B7T Y;  1H0G A;  4YBH B;  4DWS B;  3SG2 A;  1FKL A;  2FAP A;  3CR2 A;  4PE7 A;  2JZI A;  3LK1 A;  4PTM A;  4W5U A;  2NCO A;  5D75 A;  2V53 A;  2ZQS A;  4PAL A;  3WKZ A;  2JOJ A;  1H8B A;  1FI6 A;  3TCZ A;  5CPV A;  1IH0 A;  3BQ3 A;  2H61 A;  3O5R A;  3OX5 A;  1GGW A;  4NDD A;  3AKA A;  5TNC A;  3ARW A;  3O5J A;  1D7J A;  1AVS A;  4W9P A;  2PPO A;  1AJ4 A;  2O5G A;  2KYC A;  1Q6I A;  2LMU A;  1DJX A;  1LL6 A;  2DT3 A;  4A4B A;  2RUC A;  4JFM A;  2WLY A;  2MLY A;  2PV2 A;  1WY9 A;  2KR7 A;  4DT4 A;  4DWS D;  4MNK A;  3VRN A;  1E6P A;  4GNK B;  1SR6 C;  1J6Y A;  1BOD A;  2E30 A;  4A4C A;  4DRN A;  1YAT A;  1RK9 A;  3LK0 A;  4YI9 A;  2BCX A;  3UQB A;  1L1P A;  1FKT A;  2XP3 A;  1XFZ O;  4ODM A;  4ODQ A;  2COL B;  2DT2 A;  4XJK A;  1B8C A;  2KNE A;  1U5I B;  2UZ5 A;  1RD6 A;  3ARY A;  1F8A B;  1OE9 B;  4ZPT R;  4IPX A;  4DS7 A;  1KFX L;  1BR1 B;  1TRF A;  1TCO B;  1YRU B;  4ZS6 A;  2M8U A;  1PVB A;  3NSL A;  3ARQ A;  4TNC A;  2Q5A A;  1WB0 A;  2ESC A;  2WND A;  2Y78 A;  1QPF A;  1SKT A;  3OB1 B;  3O5F A;  1CFP A;  1M39 A;  1K93 D;  3GK1 A;  1XO5 A;  4JWQ A;  1K95 A;  3SJS A;  4DZ2 A;  2BL0 B;  3KF9 A;  4DIR A;  4IT4 A;  2KOT A;  2KSP A;  3B9D A;  1U79 A;  4N19 A;  1SW8 A;  3VRP A;  1XVJ A;  3JTD C;  4AQI A;  4HBE A;  4P8X A;  2ZRT A;  4U84 A;  1UUR A;  1G8I A;  4JPZ B;  1CFC A;  3I6C A;  4AOM A;  3VAW A;  1UHI A;  1KT0 A;  1F8H A;  2O9O A;  3PA7 A;  4JFJ A;  2M29 A;  3DF0 A;  4NDC A;  3FXY A;  4XAK A;  3MSE B;  1O6I A;  2H61 C;  2JTT A;  2MLE C;  5DO2 A;  5IBW A;  4ZCV A;  3EK7 A;  1QZ2 A;  1CLM A;  2ZR5 A;  1IKU A;  4DH0 A;  2HPS A;  1OGG A;  1QTX A;  2KI4 C;  1OOJ A;  5B8I B;  1FKB A;  1ALW A;  3IK8 A;  3KHE A;  3CTN A;  1FKK A;  4KQZ A;  1SCM C;  1FI5 A;  1YVH A;  4ZCU A;  1XA5 A;  1V1G A;  2NXQ A;  2HF5 A;  4OVN F;  3RFW A;  3BUX B;  4MBE A;  1IG5 A;  1EXR A;  4Z2K A;  4GFT A;  2K8M B;  1B6C A;  1JUO A;  1HKJ A;  2ZKM X;  2MLF C;  1CTN A;  1KWO C;  4NNR A;  3VGO A;  1X6L A;  3RM1 A;  2M1K B;  2TN4 A;  2RUQ A;  3ZNI A;  4AY1 A;  1KFX S;  2KYF A;  1A7X A;  5AER A;  4MZL A;  2RSE A;  1LXF C;  3AS1 A;  1RTP 1;  3LCP C;  4QT3 A;  4JYS A;  4GIV A;  1WNO A;  4MLW A;  2AAO A;  3I5G B;  3O2P A;  1OSA A;  2DSZ A;  2Y5I A;  2F2P A;  4YRU A;  2KGR A;  2AWG A;  4IQC A;  2M1U A;  2YBU A;  1KK7 Z;  3KAC A;  1MQ1 A;  3JVT C;  1ROT A;  2XP5 A;  1TNW A;  3KO0 A;  3SIA A;  3H9R B;  1DF0 B;  1TNX A;  3CR4 X;  3GOF A;  3TUY C;  2LAN A;  2NCP A;  1CMG A;  4FQO A;  2LHL A;  1F70 A;  2K2F A;  1F4Q A;  1OMV A;  4MRY A;  2A3A A;  2PSR A;  5KTY A;  3CLN A;  4ORB B;  3I5I C;  2Y1M A;  2SCP A;  2RUR A;  1YUR A;  1SL9 A;  3BYA A;  2CXJ A;  3WIJ A;  1FF1 A;  2XP8 A;  3QOK A;  3RLZ A;  5BXJ A;  5HW6 A;  4I5L B;  3O4Y A;  3EVU A;  4MNJ A;  4O2T A;  1F55 A;  4MGV A;  3HCM A;  4GPL B;  4R0X A;  4WK9 A;  3EK4 A;  1NIW A;  2GGZ A;  1Q80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...