4MSPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp22 (aka fkbp14) containing two ef-hand motifs
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mspA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mspA01
3CLNA 3VRPA 2F33A 3OOBA 1ZFSA 3TDUA 1L2OB 1B47A 1QVIZ 1XVJA 1FKKA 2KAYA 2F4EA 4A4BA 1FJDA 1W26A 1QV0A 2ZQUA 4GGNA 2I2RE 2OS8C 2SCPA 4HRGA 3I5GC 1NSHA 4PE4A 1F8HA 1Q80A 4JFLA 4C0JA 4QJ4B 2KQYA 3EK8A 2I7AA 1KQMC 2VRGA 3F45A 2D9FA 1NSGA 5D75A 1KK7Z 2XP7A 1QATA 1MQ1A 4PE7A 1WLZA 1NX1A 3PRBA 1SYMA 4DRKA 1YX7A 1SL7A 3M0WA 2H61A 1J7RA 4O2TA 1QPLA 3O5PA 3BUOB 3I5IC 2KSPA 2JRFA 5D7FA 3BYAA 1G8IA 5HUAA 3DF0B 2KBMA 1HQVA 2LMUA 1RK9A 3EKHA 2JPTA 2KE0A 2N87A 2KNEA 3NTPA 2CCMA 2K7OA 2KYCA 4IL1A 2K7CA 3A8RA 1IGVA 4QT2A 5DKRA 2MBXA 4I5KA 4C0KA 1J7QA 1NX0A 1AVSA 2F2DA 5I8NA 1IQ3A 1XFXO 4LAVA 4ODPA 3NRKA 1U5IB 2JXLA 1TNPA 5HYDA 4GIVA 2MHHA 1FKRA 3CGNA 1BF5A 1N1AA 5IBWA 1K94A 2HPSA 4ORBB 1DJIA 1FI5A 3CWGA 2LMVA 2LM5A 1CFDA 4MVFA 4WQ2A 1IH0A 2NCPA 4ITZA 1S3PA 1ZMZA 2GV5A 1B9AA 2KR7A 4NDBA 5TNCA 1C9HA 2M08A 3O5EA 2F2PA 3GPKA 3CGMA 1AK8A 2MJWB 1YW5A 4LAXA 2IF4A 3FIAA 1SRAA 1PVBA 2IS9A 2LKNA 3KHEA 3JYMA 3KCEA 1SR6B 1YVHA 1BT6A 2PPOA 2PMYA 2ZKMX 1BJFA 1UUSA 5AXIA 1D7IA 1DJHA 2L2SA 5HKWA 2MPHA 3TUYB 4PHNA 4QT3A 2L51A 2JOJA 2OPOA 3UI5A 4HREE 1FAPA 2PPPA 2ISDA 3PA7A 5BPJA 1XA5A 5HKYA 1F4QA 2BE6A 1CDLA 4ORAB 3VGOA 2MLXA 1TNQA 3MSEB 3NSIA 4M2PA 1B7TY 2PBCA 1D1OA 1K96A 2BBMA 3SIAA 2RUQA 1QIVA 1NMWA 1VRKA 2AAOA 4CFRA 2Q5AA 3CR5X 1IWQA 1UWOA 4G2PA 5BXJA 5HKGA 2F3ZA 1OQPA 4N19A 1CB1A 1ZCNA 2LE9B 2O5GA 1MR8A 2M7LA 2LLUA 3PN7B 1CDPA 2KYFA 4FN2A 3RM1A 4U86A 3UQIA 1WY9A 2JXCA 1AHRA 3O2PA 1YURA 2K8MB 4DS7A 2KAXA 3DVJA 3LL8B 2ZR5A 4DRIA 2JT8A 4MGVA 1F71A 4YI9A 2K61A 1XK4A 2M3WA 3DVMA 4N1GA 2KGBC 3KAFA 3KEVA 1SR6C 2AWGA 2MNTA 2JNFA 2LP3A 1QX5B 1F4OA 1SW8A 2M7NA 3I6CA 2EC6B 1KT0A 1YUTA 3RFWA 1LXFC 3FS7A 2ZNDA 3CR4X 3I5FB 1T11A 2JNXA 2BBNA 1PSRA 5CSNA 2DG3A 2LHIA 3D0YB 1BKFA 3CS1A 1IG5A 1XYDA 2BCAA 1QJTA 3LK1A 1CLMA 4HSZA 5PALA 3RLZA 3SJSA 1FKSA 3PN7C 3IKDA 2KQ6A 4PALA 5AERA 1A75B 1SL8A 1M63B 2JULA 3PALA 3WHTB 1NYAA 1BR1B 1A4PA 2JQ6A 4GGQA 5HT1A 1M45A 5KU1A 3ICBA 3KF9A 1Y1AA 1DF0B 1MF8B 1NUBA 2JZIA 3JVTB 4YGDB 2MLEC 5CSJA 1CDNA 1SMGA 4IQ2A 1S26D 3DD4A 2VCDA 2L5XB 5AANA 1Y1XA 2SASA 1GGWA 1LVCD 2WC8A 3IQQA 4W9QA 3OP0A 3O5KA 1IQ5A 1CDMA 2LANA 2RSEA 2EC6C 4ODRA 4GNKB 1TOPA 1N65A 1ROUA 4MZJA 3LLEA 1RFJA 2EHBA 3CZTX 1SK6D 2PALA 4NDCA 3MDYB 4E68A 4DRNA 1BR4B 2JU0A 3TS5C 2MF9A 1DJYA 2JZVA 2K7BA 4CLNA 4LAWA 1J1EA 1F8AB 3PRDA 2WORA 3IQOA 4CIDA 1KFXL 1J55A 1L7ZA 1BL4A 4TW6A 5CSFA 2CXJA 3D10A 1SCMB 2ZQTA 2MLFC 1KQMB 1J4IA 1M31A 3VRQA 4ODLA 3UI6A 4Q04A 1B7TZ 1NCZA 2B1UA 3I5HC 1J4RA 1XO5A 2MA2A 4GAOA 1C7VA 1H4BA 3O5DA 1S1EA 2Y1MA 3SG7A 1XFVO 2ZNEA 1MUXA 4PCWA 1FKTA 2H2KA 3D0YA 3DF0A 1XFUO 3EKJA 4ETOA 1UURA 1A7XA 1BU3A 1UHHA 2LLSA 1EJ3A 1QPFA 1A75A 3TDIA 3NI6A 4DROA 2KBIA 1OOJA 1BOCA 1FKJA 3RGCA 2BE4A 1DJZA 1K93D 2M0RA 5J3XA 3H9RB 1LA3A 2LCPA 5DKQA 2F21A 2OFNA 1QX2A 2COLB 5ER4X 4A4CA 1CLLA 3WNXB 2XPAA 3FWCA 2JT0A 2KGRA 1C7WA 1R6PA 2L0PA 3BUMB 3GK4X 3IF7A 4ICBA 2KI6C 4PHKA 4TNSA 2HQ8A 2OTGC 4MN0A 2I94A 1K90D 4MZKA 1TTXA 2CBLA 3CGAA 3O78A 4YGBB 1CFFA 3EK4A 2R2IA 4GFTA 4MRXA 1DJXA 1FKDA 1H8BA 2L4IA 2Y5IA 1CMFA 1OZSA 2PSRA 1EL4A 5JJGA 2H61C 1DMOA 4W9PA 3JXVA 1XFWO 1CM1A 4N5XA 3KAGA 3UQBA 4JFJA 5KTYA 1QZ2A 3OHMB 1FW4A 4MRYA 2RUCA 4ODQA 1IJ5A 1WRLA 2FJUB 4PHMA 1DGUA 1MHOA 2K2FA 1E8AA 3IHZA 1W7JB 2F3YA 1KT1A 1PINA 1SL9A 4DRMA 4I5NB 2KHNA 2M49B 1SY9A 4ODMA 4JFKA 2WCBA 2KI3A 1L2OC 1M46A 4U8DA 1B6CA 3OB1B 1FI6A 2M1IA 5I2LA 1ALVA 3I5HB 3GK2A 5HTGA 4L9MA 4QJ3B 5JOLA 1KCYA 2O60A 2LVIA 4W9OA 1JNSA 3KAIA 1PRWA 1Y0VH 2LP2A 3UF8A 2BCBA 2FCDA 1F54A 1ZACA 3VAWA 3CR2A 1PK0D 2ZRTA 3SIBA 1BLQA 4JFMA 2PV3A 5DKNA 4OKHA 2F8PA 1Y6WA 1NPQA 1TNWA 3AKBA 5KSZA 2M97A 1NMVA 1J7OA 2MLYA 5DIUA 3LCPC 1ODBA 1SNLA 2FKEA 1KFUL 1QLKA 3O5RA 4JFIA 4PHJA 3IK8A 2Q91A 2NCOA 1K9PA 3SG6A 1AUIB 2A4JA 2VN1A 3KAHA 4JYSA 5CSIA 1CFPA 4NNRA 1DJGA 3DVEA 3IKGA 1UHKA 2JC2A 4GPLB 1S5GY 3KZ7A 3WH0A 1S6JA 1S6CA 1KWOC 1JWDA 3I5GB 2XP5A 4J4OA 1D6OA 2HQWA 3A4UB 4XJKA 2OS8B 2LVKA 3BOWA 1EG4A 4ZCVA 1J7PA 1FKIA 2ZR4A 2ZQSA 4C02B 1NWDA 1Y1UA 1CLBA 3ODKA 3HX4A 3C1VA 1UHIA 3KO0A 1SPYA 2F2OA 1JNTA 1A29A 2XP6A 1D7JA 4ODNA 3BQ3A 4TW8A 2M29A 2KGJA 1DT7B 4DRHA 5B8IC 1SCMC 1AP4A 1EYMA 3VRNA 1FKLA 1DTLA 4NQGA 1YUSA 1EH2A 1HT9A 2LV7A 1Q6IA 2GGZA 4BY5A 3TDBA 3LUOA 2BKIB 1BMOA 3EK7A 1QTXA 1TRFA 4OV2A 3CTNA 3K21A 1Y0OA 1IJ6A 1EQ3A 2OTGB 1LINA 1IRJA 1JF0A 2ZR6A 1B4CA 1OE9B 2L4HA 4C0LA 1QS7A 3NSLA 3OB2B 2MLZA 1MWNA 1S5GZ 2RQSA 4J4NA 1WDCB 1XFZO 3BUXB 3PLFB 5K89A 1GQMA 1ZOTB 1F55A 4TYOA 1B8RA 1YX8A 2AUCA 1QXPA 2LMTA 1FPWA 1OMDA 2WCFA 1KK8B 2BKHB 4YGAA 1A03A 3PFVA 2XPBA 1YATA 2Y78A 4IPXA 4HRHA 1PULA 2LHLA 3JVTC 1U79A 2QPTA 1R2UA 4DRPA 2BECA 1SKTA 1DJWA 2P6BB 3FWBA 2FOTA 2ZN8A 1ALWA 1FBVA 1V1FA 4CFQA 1A2XA 1YUUA 2AMIA 2K7DA 3JYJA 2K8IA 3JTDB 3KPXA 5GPGA 3EVVA 4XJKB 1GGZA 1IKUA 1FKFA 3B7XA 4AQJA 3SG5A 1PVAA 1TCOB 5ER5A 3KABA 1B1GA 3ZWHA 2LUCA 4ODKA 2JTTA 3I5FC 1DGVA 1M5YA 2LJ4A 4GGFA 4QJ5B 2CTNA 1TCFA 1RJVA 4QIBA 4OR9B 4M2QA 1G33A 4F0ZB 3O4YA 4FTGA 2HF5A 3TUYC 3H4SE 4P2YB 2K0JA 2BL0B 2KDHA 2JTZA 1QIWA 1NX2A 1B8CA 1M39A 1PSBA 2KFGA 2M9GA 2QACA 4ORCB 3TDZA 3ZNIA 1FF1A 4USLA 1QLSA 2LVVA 1RWYA 1NP8A 1U5IA 1YRUB 3LK0A 3O5GA 2NLNA 1K8UA 4DIPA 2PVBA 4G50A 4JQ0D 3UQAA 3O5JA 4FQOA 3VRRA 5HW7A 5HW8A 3BUNB 1L1PA 1J1DA 2KI4B 1TNXA 1UHNA 3NXAA 3HCMA 5F6TA 3O5IA 2ZFDA 2FCEA 1AJ5A 1CNPA 3FAPA 4U84A 4DZ2A 1FKHA 1JUOA 2MAZA 1NCXA 4PE1A 1JVWA 3TC5A 1F40A 1KWOB 4TX0A 1B8LA 1K9KA 4NDDA 1KK7Y 1CTRA 1OSAA 4I5LB 1XK4C 4ODOA 1KK8C 4UPGA 2ZN9A 4AQIA 2V53A 5FYXA 4JWQA 1JC2A 1JBAA 5AFPA 3AAJA 4BY4A 1TN4A 1OMRA 2WOSA 4YRUA 1YVLA 2KI6D 2PV1A 1QVIY 3WXAA 5B8IB 1V1GA 1JF2A 2KFFA 2LC5A 1RROA 1QASA 2E6WA 4XYNA 2CNPA 3E3RA 1MXLC 2Y1NA 1ROTA 4DRQA 1SBJA 3PSRA 2RUDA 3SG4A 1KSOA 4AOMA 4IQCA 2LLTA 2LPVA 4GGFC 4DZ3A 5J6EA 3O5QA 3BUWB 4DRJA 5I98A 1N0YA 2G2BA 2K2AA 2WCEA 2PV2A 1RECA 4N1FA 2WNDA 3JTDC 4MZLA 4MSPA 1J4HA 5HW6A 1QV1A 3NSOA 1UP5A 3OX5A 2LGOA 5AEQA 1EG3A 1QX7A 2PRUA 2Y4QA 3VROA 1C07A 1YR5A 2L2EA 2KO7A 2L98A 3KACA 2DOQA 1LA0A 1DVIA 3EVUA 1K9UA 1JFJA 2KOTA 2RGIA 2M2AA 1S36A 4PE0A 4PDZA 5HWCA 2DG9A 3AKAA 2DG4A 1GJYA 1SCVA 2KI4C 4JPZB 1W7IB 1YTZC 2GGMA 4U85A 1KSMA 4BF8A 1OZOA 1WRZA 5G08A 3KADA 5DITA 2XP9A 5HKZA 1RTP1 1WDCC 4MEWA 5HLVA 2ZQVA 5I2OA 5GQQC 4OCIA 5D69A 1ZK6A 1NCYA 3GOFA 3O5OA 3O5LA 1Q6UA 2CT9A 3O6BA 3OX6A 1K2HA 3BXKA 2LNKA 3EVRA 4WQ3A 1G4YR 3QRXA 4DT4A 2RURA 2BL0C 4OVNF 1EXRA 1YRTB 3AAKA 2JT3A 4CPVA 4MBEA 1BODA 1WRKA 1D7HA 3O5FA 2G9BA 1NIWA 1FD9A 1P5QA 2KFWA 3NSKA 3UI4A 2D8NA 1HXVA 2UZ5A 3PM8A 4P5OE 2EGDA 1PBKA 1J6YA 5I2QA 1CMGA 1CM4A 1WLMA 1TCOC 2XP3A 1UHJA 2HETA 2TN4A 3SG2A 4M2OA 1JFKA 4DRWA 2E30A 1KFUS 1PALA 4LAYA 1FKGA 1ZUZA 3GK1A 1F70A 2BCXA 1XFYO 4DIRA 2NXQA 4GUKA 4WRIA 4YGEB 1FKBA 5HWBA 1S6IA 4DUQA 1K95A 2Q4UA 1NX3A 1Q6HA 5DIVA 3DVKA 2XP4A 1KFXS 1X02A 5HLOA 2KFHA 1TIZA 1CKKA 2KAVA 1R9HA 5CPVA 2I18A 4D1EA 2ITKA 3TCZA 4DH0A 1N2DA 2LUXA 3TS5B 4ZCUA 4I5JA 4YBHB 2L50A 2M1UA 3WHUB 1JSAA 4YGCB 3TZ1A 4YI8A 1LKJA 3I5IB 4GBAA 3BOWB 1KQVA 4FAPA 2M8UA 1AJ4A 2ZRSA 3O5MA 2MRDA 2JWWA 2LVJA 2PASA 4R1EA 4TW7A 1BG1A 2FAPA 1Q1CA 2M1KB 4R0XA 2NZ0A 4DCKA 2XP8A 3EY6A 1OMVA 2LAPA 1MXEA 1CFCA 3SG3A 1DF0A 4TNCA 3PATA 2PPNA 4MLWA
chains in the Genus database with same CATH superfamily
1ZFSA 1FJDA 2ZQUA 2SCPA 4HRGA 3I5GC 1NSHA 2D9FA 3F45A 5D75A 1KQMC 1KK7Z 1NX1A 3O5PA 1OGBA 1HQVA 2KE0A 2JPTA 2N87A 2CCMA 1C3YA 3A8RA 1IGVA 5DKRA 2MBXA 1J7QA 1AVSA 5GQBA 4LAVA 4ODPA 1FKRA 4GIVA 3ARQA 1BF5A 2DSWA 1K94A 4MTVA 2LMVA 4MVFA 2NCPA 1S3PA 1ZMZA 1H0IA 1KFWA 1AK8A 2IF4A 2LKNA 1BT6A 1BJFA 5AXIA 1D7IA 2L2SA 1OOGA 2MPHA 5DF0A 3WD2A 3TUYB 1HKMA 1FAPA 2ISDA 5HKYA 1XA5A 1F4QA 3MSEB 4M2PA 2PBCA 1D1OA 2BBMA 1VRKA 1W9ZA 3CR5X 5HKGA 4N19A 1CB1A 2M7LA 2DSZA 4FN2A 4U86A 4P8XA 4YI9A 1WNOA 3RM8A 1K9TA 1C3ZA 2EC6B 1KT0A 4HARA 2O92A 1PSRA 3D75A 3CS1A 4HSZA 1XYDA 1QJTA 2KLDA 1FKSA 1GPFA 1SL8A 2JULA 3GTYX 3D73A 5KU1A 3ICBA 2WCMA 3JVTB 1NUBA 1CDNA 1DQEA 2SASA 4W9QA 3OP0A 1CDMA 2EC6C 1RD6A 3WD1A 4MZJA 1BR4B 2MF9A 2JZVA 4CIDA 1KFXL 1J55A 1BL4A 4TW6A 2CXJA 1D2KA 4Q04A 1B7TZ 1NCZA 3I5HC 1J4RA 1XO5A 2MA2A 5EL2A 1XFVO 3EKJA 1XFUO 1W1PA 1UURA 1A7XA 2KBIA 1OOJA 3OBVA 3RGCA 1DJZA 1K93D 3H9RB 1HJWA 4NZCA 3G6MA 4A4CA 3S0FA 2XPAA 1SSEB 3BUMB 1C7WA 4R5EA 4PHKA 4MZKA 3CGAA 3EK4A 1FKDA 2H61C 1XFWO 3KAGA 4N5XA 1E6ZA 1QZ2A 3D74A 1FW4A 3QOKA 1TWOA 4I5NB 4ZPWR 2WCBA 2KI3A 3ARVA 4ZPVR 1CTNA 1JNSA 1PRWA 4DWSC 3UF8A 2FCDA 1ZACA 2ZRTA 4JFMA 5DKNA 1NPQA 1TNWA 5KSZA 1SNLA 1QLKA 4JFIA 4PHJA 3IK8A 1AUIB 1OWQA 4NNRA 4DWSD 3DVEA 3KZ7A 4J4OA 1HJXA 1Y1UA 2WLYA 3HX4A 1GUVA 3C1VA 1SPYA 1A29A 1D7JA 4DRHA 1SCMC 3CTNA 1NWTA 4DIPA 1OE9B 5B8IC 3NSLA 2DSUA 3VB1A 1XFZO 3PLFB 3FE6A 5K89A 1GQMA 1F55A 1YX8A 2AUCA 4YGAA 1A03A 3PFVA 4IPXA 4HRHA 1PULA 2QPTA 3FWBA 2ZN8A 1FBVA 3NHTA 2AMIA 3RMEA 5GPGA 3JTDB 3ZWHA 2JTTA 1TCFA 4QIBA 1G33A 4FTGA 2HF5A 1QIWA 3TDZA 4U85A 3L4LA 1RWYA 3O5GA 1U5IA 1X6NA 3DXLA 2PVBA 4L72B 4JQ0D 1J1DA 1TNXA 1LL4A 5F6TA 1CNPA 4PE1A 1F40A 3TC5A 1KWOB 2FDMA 1OSAA 4ODOA 1KK8C 4AQIA 5FYXA 4JWQA 1JC2A 1OMRA 4YRUA 5B8IB 1JF2A 2KFFA 1QASA 4W5UA 2E6WA 4XYNA 3PRAA 1MXLC 2WCLA 1ROTA 1GOIA 3CHEA 3SG4A 3B86A 1W1YA 4GGFC 5I98A 4INXA 1N0YA 3L47A 3JTDC 1UP5A 1QX7A 3KACA 2L98A 2DOQA 1DVIA 2DG9A 2KI4C 4JPZB 1YTZC 1RTP1 1WDCC 4KQZA 5I2OA 5GQQC 3GOFA 1Q6UA 2CT9A 3O6BA 3BXKA 1G4YR 2BL0C 4OVNF 1EXRA 3O5FA 4P8VA 3NSKA 3UI4A 1HXVA 2UZ5A 1CM4A 2XP3A 1UHJA 3SG2A 4DRWA 2E30A 3ALGA 1KFUS 1PALA 4LAYA 1ZUZA 2IUZA 1LL7A 5HWBA 1FKBA 1KFXS 1X02A 2KFHA 1TIZA 1ZBKA 3TCZA 2LUXA 2QEBA 2L50A 2M1UA 1JSAA 4GBAA 4FAPA 2M8UA 1AJ4A 2MRDA 1Q1CA 2LAPA 4TNCA 3AS0A 3CLNA 2F33A 3O4XA 1LG2A 1W26A 4GGNA 2I2RE 3S0EA 4PE4A 3OA5A 1Q80A 4C0JA 4QJ4B 3ARPA 1QATA 4PE7A 1SL7A 2QEHA 3CZ2A 3I5IC 2JRFA 5D7FA 1G8IA 5HUAA 2LMUA 2K7OA 2KYCA 2ERBA 1U5IB 2JXLA 1TNPA 3D78A 5HYDA 5IBWA 4ORBB 1FI5A 1OOHA 1IH0A 1E6RA 3V2LA 3GPKA 4LAXA 3FIAA 1PVBA 2IS9A 3KHEA 3S0BA 3KCEA 2PI6A 2PMYA 1UUSA 1DJHA 1DEKA 2L51A 2OPOA 4HREE 5BPJA 2BE6A 1CDLA 3VGOA 1TNQA 1B7TY 1HJVA 4ML4A 3RM9A 1K96A 2G8ZA 2RUQA 1UWOA 1XHGA 5FI7A 1ZCNA 3B88A 2LLUA 4Q7NA 1CDPA 1LQ0A 4MPKA 3DVJA 1NWRA 1UR9A 2M3WA 1XK4A 4PT1A 2LP3A 3AS2A 1QX5B 2M7NA 3I6CA 3CR4X 3I5FB 3BXWA 1IG5A 2BCAA 3LK1A 5PALA 3IKDA 1ZB5A 5AERA 1M63B 3WHTB 1A4PA 1Z2CB 1DF0B 4YGDB 1SMGA 4IQ2A 2JPOA 3DD4A 1LVCD 1LJYA 2EULA 2LANA 3K1EA 4WIWA 4ODRA 4GNKB 1N65A 1RFJA 4CLNA 4LAWA 3PRDA 3IQOA 5CSFA 2ZQTA 1KQMB 1J4IA 1M31A 3VRQA 2B1UA 1E6NA 1H4BA 1C7VA 4PCWA 2H2KA 3CABA 1UHHA 3NHIA 3ARYA 3BJHA 4DROA 1FKJA 5J3XA 5HBFA 2O9OA 5DKQA 2F21A 2COLB 3FWCA 2JT0A 1R6PA 3S0AA 4TNSA 2I94A 4MRXA 3DZTA 2PSRA 1EL4A 5JJGA 3JXVA 4P8UA 1CM1A 1OOFA 3OHMB 1IJ5A 3R1OA 1WRLA 2K2FA 1E8AA 3IHZA 1W7JB 2F3YA 1PINA 1SY9A 4ODMA 4F7FA 4U8DA 2M1IA 2QEOA 2K60A 2WCHA 1KCYA 2LVIA 4W9OA 4MNKA 2LP2A 1Y6WA 2F8PA 1NMVA 2MLYA 3AKBA 5DIUA 2M97A 3LCPC 2DT2A 1KFUL 3WD4A 2Q91A 2NCOA 1DJGA 3B87A 3WH0A 1KWOC 2XP5A 1EHNA 2LVKA 1EG4A 2ZR4A 5DICA 1ZBVA 3KO0A 1JNTA 2F2OA 2XP6A 2M29A 2KGJA 3AROA 1EH2A 3LUOA 2BKIB 1E44A 4OV2A 1IJ6A 4ZS6A 1EQ3A 4L3NA 1B4CA 4C0LA 1QS7A 4J4NA 1TUZA 1B8RA 2LMTA 1FPWA 1OMDA 1KK8B 2XPBA 2Y78A 2KPHA 4DRPA 2A3EA 2FOTA 1V1FA 1YUUA 3R72A 3JYJA 1IX5A 4OZDA 1FKFA 4AQJA 1PVAA 3KABA 5FI2A 1DGVA 2LJ4A 4GGFA 4QJ5B 3CYZA 3H4SE 2KDHA 2JTZA 1GRJA 2M9GA 1FF1A 3O5JA 2LVVA 3LK0A 2NLNA 1K8UA 2YGUA 3BUNB 3NXAA 2ZFDA 4U84A 1FKHA 1JUOA 2MAZA 1NCXA 4TX0A 1B8LA 2P71A 2BAPA 4NDDA 2WCKA 2V53A 1E15A 5AFPA 3AAJA 2B5UB 1TN4A 2KI6D 2PV1A 3PR9A 5D3OA 3S0DA 3E3RA 1SBJA 3PSRA 2RUDA 4AOMA 3D76A 2LPVA 3O5QA 2PV2A 4N1FA 4MZLA 4MSPA 3NSOA 3OX5A 5AEQA 1EG3A 2PRUA 3VROA 2L2EA 2KO7A 1JFJA 1E9LA 2KOTA 2RGIA 2M2AA 5HWCA 2DG4A 1Z4HA 1GJYA 1W7IB 4BF8A 1OZOA 1WB0A 5G08A 2ZQVA 4MEWA 3BFAA 3O5OA 1UR8A 3EVRA 2RURA 3AAKA 2OLHA 4P5OE 1PBKA 1J6YA 5I2QA 1WLMA 1TCOC 2PQLA 4Z2LA 4AY1A 1LG1A 1F70A 2BCXA 1XFYO 4GUKA 3WD0A 4WRIA 4Z2GA 1Q6HA 2KAVA 2ITKA 4D1EA 1N2DA 1OW4A 4YI8A 4JKTA 3I5IB 1P28A 3DY9A 2NZ0A 1W1VA 2XP8A 3EY6A 1OMVA 1MXEA 1CFCA 3PATA 3VRPA 3OOBA 1EDQA 1L2OB 1QVIZ 1XVJA 1FKKA 2KAYA 3ARTA 4A4BA 1ZL1A 1QV0A 2OS8C 3R1VA 2KLEA 4JFLA 3EK8A 2VRGA 4Z2HA 1MQ1A 3PRBA 1SYMA 1YX7A 3M0WA 2H61A 1QPLA 2KSPA 2B31A 3DF0B 2YBTA 3EKHA 2K7CA 3PJIA 4QT2A 4C0KA 1QWVA 1X6LA 2F2DA 3CGNA 1N1AA 2HPSA 2WC5A 1DJIA 3CWGA 2LM5A 4ITZA 4WKFA 2GV5A 1B9AA 1HKIA 2KR7A 4NDBA 5TNCA 1C9HA 3O5EA 2F2PA 3CHCA 1SRAA 1YVHA 1TUJA 2QDIA 2ZKMX 4PHNA 4P8WA 4QT3A 2JOJA 4LGXA 3PA7A 4ORAB 3CZ0A 3SIAA 1NMWA 4CFRA 1IWQA 3S0GA 5BXJA 2F3ZA 2PN0A 1MR8A 3PN7B 3UQIA 1OOIX 3O2PA 2KAXA 4DRIA 1F71A 2DT0A 2K61A 3DVMA 4N1GA 3KAFA 2P70A 2JNFA 4MAVA 3RFWA 1YUTA 3FS7A 2ZNDA 1T11A 2JNXA 5CSNA 2DG3A 2LHIA 3SJSA 1CLMA 3RLZA 3PN7C 3FE8A 4PALA 1A75B 1NYAA 2JQ6A 1M45A 3KF9A 2JZIA 2ESCA 2MLEC 2VCDA 5AANA 1Y1XA 1GGWA 2RSEA 1TOPA 1ROUA 3LLEA 1FFRA 3CZTX 1SK6D 2PALA 3PM2A 4NDCA 4E68A 4DRNA 2JU0A 4Q22A 2K7BA 1OGGA 2WORA 1L7ZA 1SCMB 2MLFC 4ODLA 3UI6A 3WD3A 3FY1A 3O5DA 4GAOA 1S1EA 2Y1MA 3SG7A 1W9UA 1FKTA 1EJ3A 1A75A 3TDIA 3SS4A 1GM0A 3UO9A 2BE4A 4MNLA 2OFNA 1CLLA 2ETNA 3WNXB 2L0PA 3GK4X 4ICBA 3IF7A 4Z2JA 2KI6C 4MN0A 2CBLA 4YGBB 4DWSB 1H8BA 2Y5IA 4W9PA 4JFJA 5KTYA 3B7AA 4ODQA 3R1PA 1T14A 2FJUB 1DGUA 1SL9A 4JFKA 1L2OC 2YBUA 3OB1B 1FI6A 3GK2A 3CDNA 2O60A 3B8SA 1Y0VH 2BCBA 2PV3A 1ODBA 2FKEA 3SG6A 2L2CA 2VN1A 3KAHA 1CFPA 1UHKA 4GPLB 1S5GY 1ZU8A 1S6JA 1S6CA 1JWDA 1D6OA 2HQWA 4XJKA 2OS8B 4ZCVA 1J7PA 1LL6A 3WQWA 1NWDA 1CLBA 2QF8A 2DT1A 4ODNA 2P4VA 1AP4A 1FKLA 4NQGA 1YUSA 1Q6IA 2LV7A 2GGZA 3TDBA 2OTGB 1LINA 1JF0A 2L4HA 2RQSA 1S5GZ 1ZOTB 3CHFA 2PYQA 2WCFA 2FJYA 1YATA 2A3BA 3G6LA 2LHLA 1U79A 2BECA 1SKTA 1DJWA 5DEZA 4CFQA 5DO2A 1A2XA 3AQUA 3KPXA 1GGZA 1IKUA 3ARSA 1TCOB 1VF8A 1B1GA 3I5FC 1RJVA 4S3JA 1W9VA 5FI6A 3RM4A 1B8CA 1PSBA 2QACA 4NSBA 4USLA 1QLSA 1NP8A 3UQAA 3VRRA 4IT4A 1UHNA 3O5IA 3AS3A 4WJXA 4HBEA 1AJ5A 3FAPA 4FQTA 1WAWA 1JVWA 1K9KA 1CTRA 4I5LB 2ZN9A 3ARZA 4BY4A 3B9DA 5I94A 2WOSA 1DELA 1QVIY 3WXAA 1V1GA 2WCJA 1RROA 2Y1NA 2G41A 4DRQA 1KSOA 3CH9A 4IQCA 2LLTA 3BUWB 2G2BA 2K2AA 2WCEA 1RECA 1J4HA 1QV1A 1XFRA 2Y4QA 1YR5A 3EVUA 1K9UA 3D77A 1NH6A 4PDZA 3AKAA 2GGMA 1KSMA 1WRZA 3KADA 5DITA 5HLVA 4OCIA 1ZK6A 3O5LA 1NCYA 4UDMA 3OX6A 1K2HA 4WQ3A 4HBOA 4DT4A 1YRTB 1BODA 4MBEA 1NIWA 1FD9A 1P5QA 2KFWA 3FE9A 3PM8A 3ARXA 2EGDA 3B9EA 2HETA 2TN4A 3GK1A 2NXQA 1ORGA 1S6IA 4DUQA 2Q4UA 5DIVA 2ZR6A 1R9HA 1CKKA 3TS5B 4ZCUA 4I5JA 4YBHB 1LKJA 3CHDA 3O5MA 2JWWA 2LVJA 2PASA 2FAPA 2M1KB 4DCKA 3SG3A 1DF0A 2PPNA 3FXYA 3TDUA 1B47A 1ZBCA 2F4EA 5HL1A 1F8HA 2KQYA 2I7AA 1NSGA 2XP7A 1WLZA 4DRKA 4IT6A 1J7RA 4O2TA 3BUOB 3BYAA 1ITXA 2AOSA 2KBMA 1RK9A 2KNEA 3NTPA 1XRVA 4IL1A 4WKHA 4Z2KA 4I5KA 2WK2A 1NX0A 3WKZA 5I8NA 1IQ3A 1XFXO 3NRKA 1LS8A 2MHHA 1DC1A 4ZPTR 4WQ2A 1CFDA 2M08A 3CGMA 3EIPA 2MJWB 1YW5A 3JYMA 1SR6B 3CZ1A 2PPOA 5HKWA 3IVTA 3UI5A 2PPPA 4WK9A 1JCHB 4KYNA 2MLXA 3EG5B 3NSIA 1QIVA 2Q5AA 2AAOA 4G2PA 1OQPA 2LE9B 2O5GA 2KYFA 3RM1A 1WY9A 2JXCA 1AHRA 1YURA 2K8MB 4DS7A 2ZR5A 3LL8B 4MGVA 1SR0A 2KGBC 3KEVA 1SR6C 2AWGA 4QZVB 2MNTA 1F4OA 1SW8A 1LXFC 2BBNA 3D0YB 1BKFA 1TFVA 2KQ6A 2DT3A 3PALA 1BR1B 5HT1A 4GGQA 1Y1AA 1MF8B 5CSJA 1S26D 2L5XB 2WC8A 3IQQA 3QMEA 3O5KA 1IQ5A 2EHBA 3MDYB 3TS5C 1DJYA 1J1EA 1F8AB 1JNEA 3D10A 3GU0A 2ZNEA 1MUXA 3D0YA 3DF0A 4ETOA 1BU3A 3WQVA 2LLSA 3NI6A 1QPFA 5JH8A 1BOCA 3WL0A 2M0RA 2WC6A 3N7HA 3AS1A 2GTEA 1LA3A 2LCPA 1QX2A 5ER4X 2KGRA 1DT7B 2HQ8A 2OTGC 1K90D 2L5YA 1TTXA 3O78A 1CFFA 2R2IA 4GFTA 1DJXA 2L4IA 1CMFA 1OZSA 1DMOA 3UQBA 2WLZA 2RUCA 4MRYA 4PHMA 1MHOA 2A3AA 1W1TA 1KT1A 4DRMA 2KHNA 2M49B 1M46A 1B6CA 5I2LA 1ALVA 3I5HB 5HTGA 4L9MA 4QJ3B 5JOLA 3KAIA 4MNMA 3VAWA 1F54A 3CR2A 1PK0D 3SIBA 1BLQA 4OKHA 1NWUA 2DSVA 1J7OA 4S3KA 3O5RA 1K9PA 2A4JA 4WKAA 4JYSA 5CSIA 3IKGA 2JC2A 1ZBWA 2QEVA 1EIBA 3I5GB 1FKIA 3A4UB 3BOWA 4KR0B 3SS5A 2ZQSA 4C02B 3ODKA 1SYTA 1UHIA 4Z2IA 3BQ3A 4PTMA 3SS3A 1EYMA 3VRNA 1DTLA 1HT9A 4BY5A 1BMOA 3EK7A 1QTXA 1TRFA 3K21A 1Y0OA 1IRJA 2F23A 2MLZA 3W4RA 3OB2B 1MWNA 1WDCB 3BUXB 4TYOA 1QXPA 2BKHB 3BMBA 2DPEA 3CZ8A 3JVTC 1R2UA 2P6BB 1ALWA 2K7DA 2K8IA 4URIA 3EVVA 3B9AA 4XJKB 3B7XA 3SG5A 5ER5A 3BFHA 2LUCA 4ODKA 3OGNA 2BNXA 2A3CA 3WL1A 1M5YA 2CTNA 4OR9B 4M2QA 4F0ZB 3O4YA 3TUYC 4JD9A 4P2YB 1O6IA 2K0JA 2BL0B 1NX2A 1M39A 2KFGA 4ORCB 3ZNIA 1HKKA 4IJ7A 1YRUB 2H8VA 3UNWA 4G50A 4FQOA 5HW7A 5HW8A 1L1PA 2KI4B 3HCMA 3ARWA 2FCEA 1FFQA 4DZ2A 3ARRA 1KK7Y 1XK4C 4UPGA 1IIOA 1JBAA 1YVLA 2LC5A 3RZSA 2CNPA 1W9PA 1E6PA 4MNJA 3B6XA 4DZ3A 5J6EA 4DRJA 2WNDA 5HW6A 4DWSA 2LGOA 1C07A 4TW8A 1LA0A 4INWA 1S36A 4PE0A 3WIJA 1SCVA 1H0GA 2XP9A 5HKZA 1NWSA 3Q8IA 5D69A 3L4AA 5GPRA 2LNKA 3QRXA 1HKJA 4CPVA 2JT3A 1D7HA 1WRKA 2G9BA 3NGVA 2D8NA 1CMGA 4XAKA 4M2OA 1JFKA 3ARUA 1FKGA 4DIRA 2WM0A 3ALFA 4YGEB 1K95A 1NX3A 3DVKA 2XP4A 5HLOA 4DH0A 5CPVA 2I18A 3BFBA 1JNDA 3WHUB 4YGCB 3TZ1A 3BOWB 1KQVA 2ZRSA 4R1EA 4TW7A 3DYEA 1BG1A 4R0XA 2JT8A 4MLWA
chains in the Genus database with same CATH topology
3FXYA 3CLNA 3VRPA 2F33A 3OOBA 1ZFSA 1EDQA 3TDUA 1L2OB 1B47A 1QVIZ 1XVJA 1FKKA 2KAYA 1LG2A 1ZBCA 2F4EA 4A4BA 3ARTA 1ZL1A 1FJDA 1W26A 1QV0A 2ZQUA 4GGNA 2I2RE 2OS8C 2SCPA 4HRGA 3I5GC 1NSHA 4PE4A 1F8HA 3OA5A 1Q80A 4JFLA 4C0JA 4QJ4B 2KQYA 3EK8A 2I7AA 1KQMC 2VRGA 3F45A 2D9FA 1NSGA 3ARPA 5D75A 1KK7Z 2XP7A 1QATA 4Z2HA 1MQ1A 4PE7A 1WLZA 1NX1A 3PRBA 1SYMA 4DRKA 1YX7A 1SL7A 3M0WA 4IT6A 2H61A 1J7RA 4O2TA 1QPLA 3O5PA 3BUOB 1OGBA 3I5IC 2KSPA 2JRFA 5D7FA 3BYAA 1G8IA 1ITXA 2AOSA 2B31A 5HUAA 3DF0B 2KBMA 1HQVA 2LMUA 2YBTA 4AY1A 1RK9A 3EKHA 2JPTA 2KE0A 2N87A 2KNEA 3NTPA 4DWSD 1XRVA 2CCMA 2K7OA 2KYCA 4IL1A 2K7CA 3A8RA 1IGVA 4QT2A 5DKRA 2MBXA 4I5KA 4C0KA 1J7QA 2WK2A 4WKHA 1X6LA 4Z2KA 1NX0A 1AVSA 2F2DA 5GQBA 5I8NA 3WKZA 1IQ3A 1XFXO 4LAVA 4ODPA 3NRKA 1U5IB 2JXLA 1TNPA 5HYDA 4GIVA 2MHHA 1FKRA 3CGNA 3ARQA 1BF5A 1N1AA 2DSWA 5IBWA 1K94A 2HPSA 4ORBB 1DJIA 1FI5A 4MTVA 3CWGA 2LMVA 4ZPTR 2LM5A 1CFDA 4MVFA 4WQ2A 1IH0A 1E6RA 2NCPA 4ITZA 4WKFA 1S3PA 1ZMZA 2GV5A 1H0IA 1B9AA 1HKIA 2KR7A 4NDBA 5TNCA 1C9HA 1KFWA 2M08A 3O5EA 2F2PA 3GPKA 3CGMA 1AK8A 2MJWB 1YW5A 4LAXA 2IF4A 3FIAA 3CHCA 1SRAA 1PVBA 2IS9A 2LKNA 3KHEA 3JYMA 3KCEA 2PI6A 1SR6B 1YVHA 1BT6A 2PPOA 2PMYA 2ZKMX 1BJFA 1UUSA 5AXIA 1D7IA 1DJHA 2L2SA 5HKWA 2MPHA 5DF0A 3WD2A 3TUYB 4PHNA 4P8WA 2L51A 4QT3A 2JOJA 2OPOA 1HKMA 4HREE 1FAPA 2PPPA 2ISDA 3PA7A 4LGXA 4WK9A 3UI5A 5BPJA 1XA5A 5HKYA 1F4QA 2BE6A 1CDLA 4ORAB 3VGOA 2MLXA 1TNQA 3MSEB 3NSIA 4M2PA 1B7TY 2PBCA 1HJVA 1D1OA 4ML4A 3RM9A 1K96A 2MLZA 2BBMA 3SIAA 2G8ZA 2RUQA 1QIVA 1NMWA 1VRKA 2AAOA 4CFRA 2Q5AA 3CR5X 1IWQA 1UWOA 4G2PA 5BXJA 1XHGA 2F3ZA 5HKGA 1OQPA 5GPGA 4N19A 1CB1A 1ZCNA 2LE9B 2O5GA 1MR8A 2M7LA 2LLUA 2DSZA 4Q7NA 3PN7B 1CDPA 2KYFA 1LQ0A 4FN2A 3RM1A 4MPKA 4U86A 3UQIA 1WY9A 2JXCA 1AHRA 3O2PA 1YURA 2K8MB 4DS7A 2KAXA 3DVJA 3LL8B 2ZR5A 1IX5A 1NWRA 4DRIA 2JT8A 4MGVA 1SR0A 1F71A 2DT0A 4P8XA 1UR9A 4YI9A 2K61A 1XK4A 2M3WA 3DVMA 4N1GA 2KGBC 1WNOA 3KAFA 3KEVA 1SR6C 2AWGA 3RM8A 1K9TA 2MNTA 4QZVB 2JNFA 2LP3A 4MAVA 4NSBA 3AS2A 1QX5B 1F4OA 1SW8A 2M7NA 3I6CA 2EC6B 1KT0A 1YUTA 3RFWA 4HARA 1LXFC 3FS7A 2ZNDA 3CR4X 3I5FB 1T11A 2O92A 2JNXA 2BBNA 1PSRA 3BXWA 5CSNA 2DG3A 2LHIA 3D0YB 1BKFA 3CS1A 1IG5A 1XYDA 2BCAA 1QJTA 3LK1A 1CLMA 4HSZA 5PALA 3RLZA 3SJSA 1FKSA 3PN7C 1GPFA 1TFVA 3IKDA 2KQ6A 2DT3A 1ZB5A 4PALA 5AERA 1A75B 1SL8A 1M63B 2JULA 3PALA 3WHTB 1NYAA 1BR1B 1A4PA 2JQ6A 4GGQA 5HT1A 1M45A 5KU1A 3ICBA 3KF9A 1Y1AA 1DF0B 1MF8B 1NUBA 2JZIA 3JVTB 4YGDB 2MLEC 5CSJA 1CDNA 1SMGA 2ESCA 4IQ2A 4WKAA 1S26D 3DD4A 2VCDA 2L5XB 5AANA 3W4RA 1Y1XA 2SASA 1GGWA 1LVCD 2WC8A 3IQQA 1LJYA 3OP0A 4W9QA 3O5KA 1IQ5A 1CDMA 2LANA 2RSEA 2EC6C 1RD6A 4GNKB 1TOPA 4ODRA 4WIWA 1N65A 1ROUA 3WD1A 4MZJA 3LLEA 1FFRA 1RFJA 2EHBA 3CZTX 1SK6D 2PALA 4NDCA 3MDYB 4E68A 4DRNA 1BR4B 2JU0A 3TS5C 2MF9A 1DJYA 2JZVA 4Q22A 2K7BA 4CLNA 1OGGA 4LAWA 1J1EA 1F8AB 3PRDA 2WORA 3IQOA 4CIDA 1JNEA 1KFXL 1J55A 1L7ZA 1BL4A 4TW6A 5CSFA 2CXJA 3D10A 1SCMB 2ZQTA 2MLFC 1KQMB 1J4IA 1M31A 3VRQA 1D2KA 4ODLA 4Q04A 1B7TZ 3FY1A 3UI6A 1NCZA 2B1UA 3I5HC 3WD3A 1J4RA 1E6NA 1XO5A 2MA2A 4GAOA 1C7VA 1H4BA 3O5DA 1S1EA 2Y1MA 3SG7A 1W9UA 1XFVO 2ZNEA 1MUXA 4PCWA 1FKTA 2H2KA 3D0YA 3DF0A 1XFUO 3EKJA 1W1PA 4ETOA 1UURA 1A7XA 1BU3A 3WQVA 1UHHA 2LLSA 1EJ3A 1QPFA 1A75A 3TDIA 3ARYA 3NI6A 4DROA 5JH8A 2KBIA 1OOJA 1BOCA 1FKJA 3RGCA 3WL0A 2BE4A 1DJZA 1K93D 2M0RA 5J3XA 3H9RB 1HJWA 5HBFA 3AS1A 2O9OA 4MNLA 1LA3A 2LCPA 5DKQA 2F21A 2OFNA 1QX2A 3G6MA 2COLB 5ER4X 4A4CA 4NZCA 1CLLA 3WNXB 2XPAA 3FWCA 2JT0A 2KGRA 1C7WA 1R6PA 2L0PA 3BUMB 3GK4X 3IF7A 4ICBA 2KI6C 4PHKA 4R5EA 2HQ8A 2OTGC 4MN0A 4TNSA 2I94A 1K90D 4MZKA 1TTXA 2CBLA 3CGAA 3O78A 4YGBB 1CFFA 3EK4A 2R2IA 4GFTA 4MRXA 1DJXA 1FKDA 1H8BA 2L4IA 2Y5IA 1CMFA 1OZSA 2PSRA 1EL4A 5JJGA 2H61C 1DMOA 4W9PA 3JXVA 1XFWO 4P8UA 1CM1A 4N5XA 3KAGA 3UQBA 4JFJA 5KTYA 1E6ZA 1QZ2A 2WLZA 3OHMB 1FW4A 4MRYA 2RUCA 3QOKA 1IJ5A 4ODQA 1WRLA 2FJUB 4PHMA 1DGUA 1MHOA 2K2FA 1E8AA 3IHZA 2A3AA 1W7JB 1W1TA 2F3YA 1KT1A 1PINA 1SL9A 4DRMA 4I5NB 2KHNA 2M49B 1SY9A 4ODMA 4JFKA 4ZPWR 2WCBA 2KI3A 1L2OC 2YBUA 1M46A 4U8DA 1B6CA 3OB1B 1FI6A 2M1IA 5I2LA 1ALVA 3I5HB 3GK2A 3ARVA 4L9MA 4ZPVR 4QJ3B 5HTGA 5JOLA 1CTNA 1KCYA 2O60A 2LVIA 4W9OA 3B8SA 1JNSA 3KAIA 4MNKA 1PRWA 4DWSC 1Y0VH 4MNMA 2LP2A 3UF8A 2BCBA 2FCDA 1F54A 1ZACA 3VAWA 3CR2A 1PK0D 2ZRTA 3SIBA 1BLQA 4JFMA 4DWSB 2PV3A 5DKNA 4OKHA 1NWUA 2F8PA 1Y6WA 1NPQA 1TNWA 3AKBA 5KSZA 2M97A 1NMVA 1J7OA 2DSVA 2MLYA 3LCPC 1ODBA 4S3KA 1SNLA 2DT2A 2FKEA 1KFUL 1QLKA 3O5RA 4JFIA 4PHJA 3IK8A 2Q91A 2NCOA 1K9PA 3SG6A 1AUIB 2A4JA 1OWQA 2VN1A 3KAHA 5CSIA 1CFPA 4JYSA 1DJGA 3DVEA 3IKGA 1UHKA 2JC2A 4GPLB 1S5GY 3KZ7A 1ZBWA 1ZU8A 3WH0A 1S6JA 1S6CA 1KWOC 1JWDA 1EIBA 3I5GB 2XP5A 4J4OA 1EHNA 1D6OA 2HQWA 3A4UB 4XJKA 2OS8B 2LVKA 3BOWA 1EG4A 4ZCVA 1J7PA 1FKIA 1LL6A 4KR0B 3WQWA 2ZR4A 2ZQSA 4C02B 1NWDA 1HJXA 1Y1UA 1CLBA 2WLYA 3HX4A 1GUVA 3ODKA 3RMEA 1SYTA 3C1VA 1ZBVA 2QF8A 2DT1A 1UHIA 3KO0A 4Z2IA 1SPYA 2F2OA 1JNTA 1A29A 2XP6A 1D7JA 4ODNA 3BQ3A 4TW8A 2M29A 2KGJA 1DT7B 4PTMA 4DRHA 4NNRA 5B8IC 1SCMC 1AP4A 1EYMA 3AROA 3VRNA 1FKLA 1DTLA 4NQGA 1YUSA 1EH2A 1HT9A 2LV7A 1Q6IA 2GGZA 4BY5A 3TDBA 3LUOA 2BKIB 1BMOA 3EK7A 1QTXA 1TRFA 4OV2A 3CTNA 3K21A 1Y0OA 1IJ6A 4ZS6A 2OTGB 1LINA 1IRJA 1JF0A 1NWTA 2ZR6A 4L3NA 1EQ3A 1B4CA 1OE9B 2L4HA 4C0LA 1QS7A 3NSLA 3OB2B 2DSUA 1MWNA 1S5GZ 2RQSA 4J4NA 1WDCB 1XFZO 3BUXB 3PLFB 5K89A 1GQMA 1ZOTB 1F55A 3CHFA 4TYOA 1B8RA 1YX8A 2AUCA 1QXPA 2LMTA 1FPWA 1OMDA 2WCFA 1KK8B 2BKHB 4YGAA 1A03A 3PFVA 2DPEA 1YATA 2A3BA 2XPBA 2Y78A 4IPXA 4HRHA 1PULA 3CZ8A 3G6LA 2LHLA 3JVTC 1U79A 2QPTA 1R2UA 2A3EA 2BECA 1SKTA 1DJWA 2P6BB 3FWBA 5DEZA 2FOTA 2ZN8A 1ALWA 1FBVA 1V1FA 4CFQA 5DO2A 1A2XA 1YUUA 2AMIA 2K7DA 3AQUA 3JYJA 2K8IA 3JTDB 3KPXA 4URIA 3EVVA 3B9AA 4XJKB 1GGZA 1IKUA 1FKFA 3B7XA 3ARSA 4AQJA 3SG5A 1PVAA 1TCOB 5ER5A 1VF8A 1B1GA 3KABA 3ZWHA 2LUCA 4ODKA 2JTTA 2A3CA 3WL1A 3I5FC 1DGVA 1M5YA 2LJ4A 4GGFA 4QJ5B 2CTNA 1TCFA 1RJVA 4QIBA 4OR9B 4M2QA 1G33A 4F0ZB 3O4YA 4FTGA 2HF5A 3TUYC 4S3JA 3H4SE 4P2YB 1O6IA 2K0JA 1W9VA 2BL0B 2KDHA 2JTZA 1QIWA 1NX2A 3RM4A 1B8CA 1M39A 1PSBA 2KFGA 2M9GA 2QACA 4ORCB 3TDZA 3ZNIA 1FF1A 4USLA 1QLSA 2LVVA 1RWYA 1NP8A 1U5IA 1YRUB 3LK0A 1HKKA 2NLNA 1K8UA 1X6NA 3O5GA 2PVBA 4G50A 4L72B 4DIPA 4JQ0D 3UQAA 3O5JA 4FQOA 3VRRA 5HW7A 5HW8A 4IT4A 3BUNB 3WD4A 1J1DA 2KI4B 1TNXA 1UHNA 1LL4A 1L1PA 3NXAA 3HCMA 5F6TA 3O5IA 2ZFDA 3AS3A 3ARWA 4WJXA 2FCEA 1AJ5A 1CNPA 3FAPA 4HBEA 1FFQA 4U84A 1FKHA 1WAWA 1JUOA 2MAZA 1NCXA 4PE1A 1JVWA 3TC5A 4DZ2A 3ARRA 1F40A 1KWOB 4TX0A 1B8LA 1K9KA 2FDMA 4NDDA 1KK7Y 1CTRA 1OSAA 4I5LB 1XK4C 4ODOA 1KK8C 4UPGA 2ZN9A 4AQIA 2V53A 5FYXA 4JWQA 1JC2A 3ARZA 1E15A 1JBAA 5AFPA 3AAJA 4BY4A 1TN4A 3B9DA 1OMRA 2WOSA 4YRUA 1YVLA 2KI6D 2PV1A 1QVIY 3WXAA 5B8IB 3PR9A 1V1GA 1JF2A 2KFFA 2LC5A 1RROA 1QASA 4W5UA 2E6WA 4XYNA 3PRAA 2CNPA 3E3RA 1MXLC 2Y1NA 2G41A 1ROTA 4DRQA 1GOIA 1W9PA 1SBJA 3PSRA 3CHEA 1E6PA 2RUDA 4MNJA 3SG4A 1KSOA 3CH9A 4AOMA 4IQCA 2LLTA 1W1YA 2LPVA 4GGFC 4DZ3A 5J6EA 3O5QA 3BUWB 4DRJA 5I98A 1N0YA 2G2BA 2K2AA 2WCEA 2PV2A 1RECA 4N1FA 2WNDA 3JTDC 4MZLA 4MSPA 1J4HA 5HW6A 1QV1A 3NSOA 1UP5A 3OX5A 4DWSA 2LGOA 5AEQA 1EG3A 1QX7A 2PRUA 2Y4QA 3VROA 1C07A 1YR5A 2L2EA 2KO7A 2L98A 3KACA 2DOQA 1LA0A 1DVIA 3EVUA 1K9UA 1JFJA 2KOTA 2RGIA 1E9LA 1NH6A 2M2AA 1S36A 4PE0A 4PDZA 5HWCA 2DG9A 3AKAA 2DG4A 3WIJA 1GJYA 1SCVA 2KI4C 4JPZB 1W7IB 1YTZC 2GGMA 4U85A 1KSMA 4BF8A 1OZOA 1WRZA 5G08A 1H0GA 1WB0A 3KADA 2XP9A 5DITA 5HKZA 1RTP1 1WDCC 4MEWA 5HLVA 2ZQVA 5I2OA 4KQZA 1NWSA 5GQQC 4OCIA 5D69A 1ZK6A 1NCYA 3GOFA 3O5OA 3O5LA 1Q6UA 2CT9A 5GPRA 3O6BA 3OX6A 1K2HA 1UR8A 3BXKA 2LNKA 3EVRA 4WQ3A 4HBOA 1G4YR 3QRXA 4DT4A 2RURA 2BL0C 1HKJA 4OVNF 1EXRA 1YRTB 3AAKA 2JT3A 4CPVA 4MBEA 1BODA 1WRKA 1D7HA 3O5FA 2G9BA 1NIWA 1FD9A 1P5QA 2KFWA 2OLHA 4P8VA 3NSKA 3UI4A 2D8NA 1HXVA 2UZ5A 3PM8A 4P5OE 2EGDA 1PBKA 3ARXA 1J6YA 3B9EA 5I2QA 1CMGA 1CM4A 1WLMA 1TCOC 2XP3A 1UHJA 2HETA 2TN4A 3SG2A 4XAKA 4Z2LA 4M2OA 1JFKA 4DRWA 3ARUA 2E30A 3ALGA 1KFUS 1PALA 4LAYA 1FKGA 1ZUZA 3GK1A 1LG1A 1F70A 2IUZA 2BCXA 1XFYO 4DIRA 1LL7A 2NXQA 5DIUA 2WM0A 4GUKA 3WD0A 3ALFA 4WRIA 4YGEB 1FKBA 5HWBA 4Z2GA 1S6IA 4DRPA 4Z2JA 4DUQA 1K95A 2Q4UA 1NX3A 1Q6HA 5DIVA 3DVKA 2XP4A 1KFXS 1X02A 5HLOA 2KFHA 1TIZA 1CKKA 2KAVA 1R9HA 5CPVA 2I18A 4D1EA 1ZBKA 2ITKA 3TCZA 4DH0A 1N2DA 2LUXA 3TS5B 1JNDA 4ZCUA 4I5JA 4YBHB 2L50A 2M1UA 3WHUB 1JSAA 4YGCB 3TZ1A 4YI8A 1LKJA 3I5IB 3CHDA 4GBAA 3BOWB 1KQVA 4FAPA 2M8UA 1AJ4A 2ZRSA 3O5MA 2MRDA 2JWWA 2LVJA 2PASA 4R1EA 4TW7A 1BG1A 2FAPA 1Q1CA 2M1KB 4R0XA 2NZ0A 4DCKA 1W1VA 2XP8A 1OMVA 2LAPA 1MXEA 3EY6A 1CFCA 3SG3A 1DF0A 4TNCA 3PATA 2PPNA 4MLWA 3AS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLN A;  3VRP A;  2F33 A;  3OOB A;  1ZFS A;  3TDU A;  1L2O B;  1B47 A;  1QVI Z;  1XVJ A;  1FKK A;  2KAY A;  2F4E A;  4A4B A;  1FJD A;  1W26 A;  1QV0 A;  2ZQU A;  4GGN A;  2I2R E;  2OS8 C;  2SCP A;  4HRG A;  3I5G C;  1NSH A;  4PE4 A;  1F8H A;  1Q80 A;  4JFL A;  4C0J A;  4QJ4 B;  2KQY A;  3EK8 A;  2I7A A;  1KQM C;  2VRG A;  3F45 A;  2D9F A;  1NSG A;  5D75 A;  1KK7 Z;  2XP7 A;  1QAT A;  1MQ1 A;  4PE7 A;  1WLZ A;  1NX1 A;  3PRB A;  1SYM A;  4DRK A;  1YX7 A;  1SL7 A;  3M0W A;  2H61 A;  1J7R A;  4O2T A;  1QPL A;  3O5P A;  3BUO B;  3I5I C;  2KSP A;  2JRF A;  5D7F A;  3BYA A;  1G8I A;  5HUA A;  3DF0 B;  2KBM A;  1HQV A;  2LMU A;  1RK9 A;  3EKH A;  2JPT A;  2KE0 A;  2N87 A;  2KNE A;  3NTP A;  2CCM A;  2K7O A;  2KYC A;  4IL1 A;  2K7C A;  3A8R A;  1IGV A;  4QT2 A;  5DKR A;  2MBX A;  4I5K A;  4C0K A;  1J7Q A;  1NX0 A;  1AVS A;  2F2D A;  5I8N A;  1IQ3 A;  1XFX O;  4LAV A;  4ODP A;  3NRK A;  1U5I B;  2JXL A;  1TNP A;  5HYD A;  4GIV A;  2MHH A;  1FKR A;  3CGN A;  1BF5 A;  1N1A A;  5IBW A;  1K94 A;  2HPS A;  4ORB B;  1DJI A;  1FI5 A;  3CWG A;  2LMV A;  2LM5 A;  1CFD A;  4MVF A;  4WQ2 A;  1IH0 A;  2NCP A;  4ITZ A;  1S3P A;  1ZMZ A;  2GV5 A;  1B9A A;  2KR7 A;  4NDB A;  5TNC A;  1C9H A;  2M08 A;  3O5E A;  2F2P A;  3GPK A;  3CGM A;  1AK8 A;  2MJW B;  1YW5 A;  4LAX A;  2IF4 A;  3FIA A;  1SRA A;  1PVB A;  2IS9 A;  2LKN A;  3KHE A;  3JYM A;  3KCE A;  1SR6 B;  1YVH A;  1BT6 A;  2PPO A;  2PMY A;  2ZKM X;  1BJF A;  1UUS A;  5AXI A;  1D7I A;  1DJH A;  2L2S A;  5HKW A;  2MPH A;  3TUY B;  4PHN A;  4QT3 A;  2L51 A;  2JOJ A;  2OPO A;  3UI5 A;  4HRE E;  1FAP A;  2PPP A;  2ISD A;  3PA7 A;  5BPJ A;  1XA5 A;  5HKY A;  1F4Q A;  2BE6 A;  1CDL A;  4ORA B;  3VGO A;  2MLX A;  1TNQ A;  3MSE B;  3NSI A;  4M2P A;  1B7T Y;  2PBC A;  1D1O A;  1K96 A;  2BBM A;  3SIA A;  2RUQ A;  1QIV A;  1NMW A;  1VRK A;  2AAO A;  4CFR A;  2Q5A A;  3CR5 X;  1IWQ A;  1UWO A;  4G2P A;  5BXJ A;  5HKG A;  2F3Z A;  1OQP A;  4N19 A;  1CB1 A;  1ZCN A;  2LE9 B;  2O5G A;  1MR8 A;  2M7L A;  2LLU A;  3PN7 B;  1CDP A;  2KYF A;  4FN2 A;  3RM1 A;  4U86 A;  3UQI A;  1WY9 A;  2JXC A;  1AHR A;  3O2P A;  1YUR A;  2K8M B;  4DS7 A;  2KAX A;  3DVJ A;  3LL8 B;  2ZR5 A;  4DRI A;  2JT8 A;  4MGV A;  1F71 A;  4YI9 A;  2K61 A;  1XK4 A;  2M3W A;  3DVM A;  4N1G A;  2KGB C;  3KAF A;  3KEV A;  1SR6 C;  2AWG A;  2MNT A;  2JNF A;  2LP3 A;  1QX5 B;  1F4O A;  1SW8 A;  2M7N A;  3I6C A;  2EC6 B;  1KT0 A;  1YUT A;  3RFW A;  1LXF C;  3FS7 A;  2ZND A;  3CR4 X;  3I5F B;  1T11 A;  2JNX A;  2BBN A;  1PSR A;  5CSN A;  2DG3 A;  2LHI A;  3D0Y B;  1BKF A;  3CS1 A;  1IG5 A;  1XYD A;  2BCA A;  1QJT A;  3LK1 A;  1CLM A;  4HSZ A;  5PAL A;  3RLZ A;  3SJS A;  1FKS A;  3PN7 C;  3IKD A;  2KQ6 A;  4PAL A;  5AER A;  1A75 B;  1SL8 A;  1M63 B;  2JUL A;  3PAL A;  3WHT B;  1NYA A;  1BR1 B;  1A4P A;  2JQ6 A;  4GGQ A;  5HT1 A;  1M45 A;  5KU1 A;  3ICB A;  3KF9 A;  1Y1A A;  1DF0 B;  1MF8 B;  1NUB A;  2JZI A;  3JVT B;  4YGD B;  2MLE C;  5CSJ A;  1CDN A;  1SMG A;  4IQ2 A;  1S26 D;  3DD4 A;  2VCD A;  2L5X B;  5AAN A;  1Y1X A;  2SAS A;  1GGW A;  1LVC D;  2WC8 A;  3IQQ A;  4W9Q A;  3OP0 A;  3O5K A;  1IQ5 A;  1CDM A;  2LAN A;  2RSE A;  2EC6 C;  4ODR A;  4GNK B;  1TOP A;  1N65 A;  1ROU A;  4MZJ A;  3LLE A;  1RFJ A;  2EHB A;  3CZT X;  1SK6 D;  2PAL A;  4NDC A;  3MDY B;  4E68 A;  4DRN A;  1BR4 B;  2JU0 A;  3TS5 C;  2MF9 A;  1DJY A;  2JZV A;  2K7B A;  4CLN A;  4LAW A;  1J1E A;  1F8A B;  3PRD A;  2WOR A;  3IQO A;  4CID A;  1KFX L;  1J55 A;  1L7Z A;  1BL4 A;  4TW6 A;  5CSF A;  2CXJ A;  3D10 A;  1SCM B;  2ZQT A;  2MLF C;  1KQM B;  1J4I A;  1M31 A;  3VRQ A;  4ODL A;  3UI6 A;  4Q04 A;  1B7T Z;  1NCZ A;  2B1U A;  3I5H C;  1J4R A;  1XO5 A;  2MA2 A;  4GAO A;  1C7V A;  1H4B A;  3O5D A;  1S1E A;  2Y1M A;  3SG7 A;  1XFV O;  2ZNE A;  1MUX A;  4PCW A;  1FKT A;  2H2K A;  3D0Y A;  3DF0 A;  1XFU O;  3EKJ A;  4ETO A;  1UUR A;  1A7X A;  1BU3 A;  1UHH A;  2LLS A;  1EJ3 A;  1QPF A;  1A75 A;  3TDI A;  3NI6 A;  4DRO A;  2KBI A;  1OOJ A;  1BOC A;  1FKJ A;  3RGC A;  2BE4 A;  1DJZ A;  1K93 D;  2M0R A;  5J3X A;  3H9R B;  1LA3 A;  2LCP A;  5DKQ A;  2F21 A;  2OFN A;  1QX2 A;  2COL B;  5ER4 X;  4A4C A;  1CLL A;  3WNX B;  2XPA A;  3FWC A;  2JT0 A;  2KGR A;  1C7W A;  1R6P A;  2L0P A;  3BUM B;  3GK4 X;  3IF7 A;  4ICB A;  2KI6 C;  4PHK A;  4TNS A;  2HQ8 A;  2OTG C;  4MN0 A;  2I94 A;  1K90 D;  4MZK A;  1TTX A;  2CBL A;  3CGA A;  3O78 A;  4YGB B;  1CFF A;  3EK4 A;  2R2I A;  4GFT A;  4MRX A;  1DJX A;  1FKD A;  1H8B A;  2L4I A;  2Y5I A;  1CMF A;  1OZS A;  2PSR A;  1EL4 A;  5JJG A;  2H61 C;  1DMO A;  4W9P A;  3JXV A;  1XFW O;  1CM1 A;  4N5X A;  3KAG A;  3UQB A;  4JFJ A;  5KTY A;  1QZ2 A;  3OHM B;  1FW4 A;  4MRY A;  2RUC A;  4ODQ A;  1IJ5 A;  1WRL A;  2FJU B;  4PHM A;  1DGU A;  1MHO A;  2K2F A;  1E8A A;  3IHZ A;  1W7J B;  2F3Y A;  1KT1 A;  1PIN A;  1SL9 A;  4DRM A;  4I5N B;  2KHN A;  2M49 B;  1SY9 A;  4ODM A;  4JFK A;  2WCB A;  2KI3 A;  1L2O C;  1M46 A;  4U8D A;  1B6C A;  3OB1 B;  1FI6 A;  2M1I A;  5I2L A;  1ALV A;  3I5H B;  3GK2 A;  5HTG A;  4L9M A;  4QJ3 B;  5JOL A;  1KCY A;  2O60 A;  2LVI A;  4W9O A;  1JNS A;  3KAI A;  1PRW A;  1Y0V H;  2LP2 A;  3UF8 A;  2BCB A;  2FCD A;  1F54 A;  1ZAC A;  3VAW A;  3CR2 A;  1PK0 D;  2ZRT A;  3SIB A;  1BLQ A;  4JFM A;  2PV3 A;  5DKN A;  4OKH A;  2F8P A;  1Y6W A;  1NPQ A;  1TNW A;  3AKB A;  5KSZ A;  2M97 A;  1NMV A;  1J7O A;  2MLY A;  5DIU A;  3LCP C;  1ODB A;  1SNL A;  2FKE A;  1KFU L;  1QLK A;  3O5R A;  4JFI A;  4PHJ A;  3IK8 A;  2Q91 A;  2NCO A;  1K9P A;  3SG6 A;  1AUI B;  2A4J A;  2VN1 A;  3KAH A;  4JYS A;  5CSI A;  1CFP A;  4NNR A;  1DJG A;  3DVE A;  3IKG A;  1UHK A;  2JC2 A;  4GPL B;  1S5G Y;  3KZ7 A;  3WH0 A;  1S6J A;  1S6C A;  1KWO C;  1JWD A;  3I5G B;  2XP5 A;  4J4O A;  1D6O A;  2HQW A;  3A4U B;  4XJK A;  2OS8 B;  2LVK A;  3BOW A;  1EG4 A;  4ZCV A;  1J7P A;  1FKI A;  2ZR4 A;  2ZQS A;  4C02 B;  1NWD A;  1Y1U A;  1CLB A;  3ODK A;  3HX4 A;  3C1V A;  1UHI A;  3KO0 A;  1SPY A;  2F2O A;  1JNT A;  1A29 A;  2XP6 A;  1D7J A;  4ODN A;  3BQ3 A;  4TW8 A;  2M29 A;  2KGJ A;  1DT7 B;  4DRH A;  5B8I C;  1SCM C;  1AP4 A;  1EYM A;  3VRN A;  1FKL A;  1DTL A;  4NQG A;  1YUS A;  1EH2 A;  1HT9 A;  2LV7 A;  1Q6I A;  2GGZ A;  4BY5 A;  3TDB A;  3LUO A;  2BKI B;  1BMO A;  3EK7 A;  1QTX A;  1TRF A;  4OV2 A;  3CTN A;  3K21 A;  1Y0O A;  1IJ6 A;  1EQ3 A;  2OTG B;  1LIN A;  1IRJ A;  1JF0 A;  2ZR6 A;  1B4C A;  1OE9 B;  2L4H A;  4C0L A;  1QS7 A;  3NSL A;  3OB2 B;  2MLZ A;  1MWN A;  1S5G Z;  2RQS A;  4J4N A;  1WDC B;  1XFZ O;  3BUX B;  3PLF B;  5K89 A;  1GQM A;  1ZOT B;  1F55 A;  4TYO A;  1B8R A;  1YX8 A;  2AUC A;  1QXP A;  2LMT A;  1FPW A;  1OMD A;  2WCF A;  1KK8 B;  2BKH B;  4YGA A;  1A03 A;  3PFV A;  2XPB A;  1YAT A;  2Y78 A;  4IPX A;  4HRH A;  1PUL A;  2LHL A;  3JVT C;  1U79 A;  2QPT A;  1R2U A;  4DRP A;  2BEC A;  1SKT A;  1DJW A;  2P6B B;  3FWB A;  2FOT A;  2ZN8 A;  1ALW A;  1FBV A;  1V1F A;  4CFQ A;  1A2X A;  1YUU A;  2AMI A;  2K7D A;  3JYJ A;  2K8I A;  3JTD B;  3KPX A;  5GPG A;  3EVV A;  4XJK B;  1GGZ A;  1IKU A;  1FKF A;  3B7X A;  4AQJ A;  3SG5 A;  1PVA A;  1TCO B;  5ER5 A;  3KAB A;  1B1G A;  3ZWH A;  2LUC A;  4ODK A;  2JTT A;  3I5F C;  1DGV A;  1M5Y A;  2LJ4 A;  4GGF A;  4QJ5 B;  2CTN A;  1TCF A;  1RJV A;  4QIB A;  4OR9 B;  4M2Q A;  1G33 A;  4F0Z B;  3O4Y A;  4FTG A;  2HF5 A;  3TUY C;  3H4S E;  4P2Y B;  2K0J A;  2BL0 B;  2KDH A;  2JTZ A;  1QIW A;  1NX2 A;  1B8C A;  1M39 A;  1PSB A;  2KFG A;  2M9G A;  2QAC A;  4ORC B;  3TDZ A;  3ZNI A;  1FF1 A;  4USL A;  1QLS A;  2LVV A;  1RWY A;  1NP8 A;  1U5I A;  1YRU B;  3LK0 A;  3O5G A;  2NLN A;  1K8U A;  4DIP A;  2PVB A;  4G50 A;  4JQ0 D;  3UQA A;  3O5J A;  4FQO A;  3VRR A;  5HW7 A;  5HW8 A;  3BUN B;  1L1P A;  1J1D A;  2KI4 B;  1TNX A;  1UHN A;  3NXA A;  3HCM A;  5F6T A;  3O5I A;  2ZFD A;  2FCE A;  1AJ5 A;  1CNP A;  3FAP A;  4U84 A;  4DZ2 A;  1FKH A;  1JUO A;  2MAZ A;  1NCX A;  4PE1 A;  1JVW A;  3TC5 A;  1F40 A;  1KWO B;  4TX0 A;  1B8L A;  1K9K A;  4NDD A;  1KK7 Y;  1CTR A;  1OSA A;  4I5L B;  1XK4 C;  4ODO A;  1KK8 C;  4UPG A;  2ZN9 A;  4AQI A;  2V53 A;  5FYX A;  4JWQ A;  1JC2 A;  1JBA A;  5AFP A;  3AAJ A;  4BY4 A;  1TN4 A;  1OMR A;  2WOS A;  4YRU A;  1YVL A;  2KI6 D;  2PV1 A;  1QVI Y;  3WXA A;  5B8I B;  1V1G A;  1JF2 A;  2KFF A;  2LC5 A;  1RRO A;  1QAS A;  2E6W A;  4XYN A;  2CNP A;  3E3R A;  1MXL C;  2Y1N A;  1ROT A;  4DRQ A;  1SBJ A;  3PSR A;  2RUD A;  3SG4 A;  1KSO A;  4AOM A;  4IQC A;  2LLT A;  2LPV A;  4GGF C;  4DZ3 A;  5J6E A;  3O5Q A;  3BUW B;  4DRJ A;  5I98 A;  1N0Y A;  2G2B A;  2K2A A;  2WCE A;  2PV2 A;  1REC A;  4N1F A;  2WND A;  3JTD C;  4MZL A;  4MSP A;  1J4H A;  5HW6 A;  1QV1 A;  3NSO A;  1UP5 A;  3OX5 A;  2LGO A;  5AEQ A;  1EG3 A;  1QX7 A;  2PRU A;  2Y4Q A;  3VRO A;  1C07 A;  1YR5 A;  2L2E A;  2KO7 A;  2L98 A;  3KAC A;  2DOQ A;  1LA0 A;  1DVI A;  3EVU A;  1K9U A;  1JFJ A;  2KOT A;  2RGI A;  2M2A A;  1S36 A;  4PE0 A;  4PDZ A;  5HWC A;  2DG9 A;  3AKA A;  2DG4 A;  1GJY A;  1SCV A;  2KI4 C;  4JPZ B;  1W7I B;  1YTZ C;  2GGM A;  4U85 A;  1KSM A;  4BF8 A;  1OZO A;  1WRZ A;  5G08 A;  3KAD A;  5DIT A;  2XP9 A;  5HKZ A;  1RTP 1;  1WDC C;  4MEW A;  5HLV A;  2ZQV A;  5I2O A;  5GQQ C;  4OCI A;  5D69 A;  1ZK6 A;  1NCY A;  3GOF A;  3O5O A;  3O5L A;  1Q6U A;  2CT9 A;  3O6B A;  3OX6 A;  1K2H A;  3BXK A;  2LNK A;  3EVR A;  4WQ3 A;  1G4Y R;  3QRX A;  4DT4 A;  2RUR A;  2BL0 C;  4OVN F;  1EXR A;  1YRT B;  3AAK A;  2JT3 A;  4CPV A;  4MBE A;  1BOD A;  1WRK A;  1D7H A;  3O5F A;  2G9B A;  1NIW A;  1FD9 A;  1P5Q A;  2KFW A;  3NSK A;  3UI4 A;  2D8N A;  1HXV A;  2UZ5 A;  3PM8 A;  4P5O E;  2EGD A;  1PBK A;  1J6Y A;  5I2Q A;  1CMG A;  1CM4 A;  1WLM A;  1TCO C;  2XP3 A;  1UHJ A;  2HET A;  2TN4 A;  3SG2 A;  4M2O A;  1JFK A;  4DRW A;  2E30 A;  1KFU S;  1PAL A;  4LAY A;  1FKG A;  1ZUZ A;  3GK1 A;  1F70 A;  2BCX A;  1XFY O;  4DIR A;  2NXQ A;  4GUK A;  4WRI A;  4YGE B;  1FKB A;  5HWB A;  1S6I A;  4DUQ A;  1K95 A;  2Q4U A;  1NX3 A;  1Q6H A;  5DIV A;  3DVK A;  2XP4 A;  1KFX S;  1X02 A;  5HLO A;  2KFH A;  1TIZ A;  1CKK A;  2KAV A;  1R9H A;  5CPV A;  2I18 A;  4D1E A;  2ITK A;  3TCZ A;  4DH0 A;  1N2D A;  2LUX A;  3TS5 B;  4ZCU A;  4I5J A;  4YBH B;  2L50 A;  2M1U A;  3WHU B;  1JSA A;  4YGC B;  3TZ1 A;  4YI8 A;  1LKJ A;  3I5I B;  4GBA A;  3BOW B;  1KQV A;  4FAP A;  2M8U A;  1AJ4 A;  2ZRS A;  3O5M A;  2MRD A;  2JWW A;  2LVJ A;  2PAS A;  4R1E A;  4TW7 A;  1BG1 A;  2FAP A;  1Q1C A;  2M1K B;  4R0X A;  2NZ0 A;  4DCK A;  2XP8 A;  3EY6 A;  1OMV A;  2LAP A;  1MXE A;  1CFC A;  3SG3 A;  1DF0 A;  4TNC A;  3PAT A;  2PPN A;  4MLW A; 
#chains in the Genus database with same CATH topology
 1ZFS A;  1FJD A;  2ZQU A;  2SCP A;  4HRG A;  3I5G C;  1NSH A;  2D9F A;  3F45 A;  5D75 A;  1KQM C;  1KK7 Z;  1NX1 A;  3O5P A;  1OGB A;  1HQV A;  2KE0 A;  2JPT A;  2N87 A;  2CCM A;  1C3Y A;  3A8R A;  1IGV A;  5DKR A;  2MBX A;  1J7Q A;  1AVS A;  5GQB A;  4LAV A;  4ODP A;  1FKR A;  4GIV A;  3ARQ A;  1BF5 A;  2DSW A;  1K94 A;  4MTV A;  2LMV A;  4MVF A;  2NCP A;  1S3P A;  1ZMZ A;  1H0I A;  1KFW A;  1AK8 A;  2IF4 A;  2LKN A;  1BT6 A;  1BJF A;  5AXI A;  1D7I A;  2L2S A;  1OOG A;  2MPH A;  5DF0 A;  3WD2 A;  3TUY B;  1HKM A;  1FAP A;  2ISD A;  5HKY A;  1XA5 A;  1F4Q A;  3MSE B;  4M2P A;  2PBC A;  1D1O A;  2BBM A;  1VRK A;  1W9Z A;  3CR5 X;  5HKG A;  4N19 A;  1CB1 A;  2M7L A;  2DSZ A;  4FN2 A;  4U86 A;  4P8X A;  4YI9 A;  1WNO A;  3RM8 A;  1K9T A;  1C3Z A;  2EC6 B;  1KT0 A;  4HAR A;  2O92 A;  1PSR A;  3D75 A;  3CS1 A;  4HSZ A;  1XYD A;  1QJT A;  2KLD A;  1FKS A;  1GPF A;  1SL8 A;  2JUL A;  3GTY X;  3D73 A;  5KU1 A;  3ICB A;  2WCM A;  3JVT B;  1NUB A;  1CDN A;  1DQE A;  2SAS A;  4W9Q A;  3OP0 A;  1CDM A;  2EC6 C;  1RD6 A;  3WD1 A;  4MZJ A;  1BR4 B;  2MF9 A;  2JZV A;  4CID A;  1KFX L;  1J55 A;  1BL4 A;  4TW6 A;  2CXJ A;  1D2K A;  4Q04 A;  1B7T Z;  1NCZ A;  3I5H C;  1J4R A;  1XO5 A;  2MA2 A;  5EL2 A;  1XFV O;  3EKJ A;  1XFU O;  1W1P A;  1UUR A;  1A7X A;  2KBI A;  1OOJ A;  3OBV A;  3RGC A;  1DJZ A;  1K93 D;  3H9R B;  1HJW A;  4NZC A;  3G6M A;  4A4C A;  3S0F A;  2XPA A;  1SSE B;  3BUM B;  1C7W A;  4R5E A;  4PHK A;  4MZK A;  3CGA A;  3EK4 A;  1FKD A;  2H61 C;  1XFW O;  3KAG A;  4N5X A;  1E6Z A;  1QZ2 A;  3D74 A;  1FW4 A;  3QOK A;  1TWO A;  4I5N B;  4ZPW R;  2WCB A;  2KI3 A;  3ARV A;  4ZPV R;  1CTN A;  1JNS A;  1PRW A;  4DWS C;  3UF8 A;  2FCD A;  1ZAC A;  2ZRT A;  4JFM A;  5DKN A;  1NPQ A;  1TNW A;  5KSZ A;  1SNL A;  1QLK A;  4JFI A;  4PHJ A;  3IK8 A;  1AUI B;  1OWQ A;  4NNR A;  4DWS D;  3DVE A;  3KZ7 A;  4J4O A;  1HJX A;  1Y1U A;  2WLY A;  3HX4 A;  1GUV A;  3C1V A;  1SPY A;  1A29 A;  1D7J A;  4DRH A;  1SCM C;  3CTN A;  1NWT A;  4DIP A;  1OE9 B;  5B8I C;  3NSL A;  2DSU A;  3VB1 A;  1XFZ O;  3PLF B;  3FE6 A;  5K89 A;  1GQM A;  1F55 A;  1YX8 A;  2AUC A;  4YGA A;  1A03 A;  3PFV A;  4IPX A;  4HRH A;  1PUL A;  2QPT A;  3FWB A;  2ZN8 A;  1FBV A;  3NHT A;  2AMI A;  3RME A;  5GPG A;  3JTD B;  3ZWH A;  2JTT A;  1TCF A;  4QIB A;  1G33 A;  4FTG A;  2HF5 A;  1QIW A;  3TDZ A;  4U85 A;  3L4L A;  1RWY A;  3O5G A;  1U5I A;  1X6N A;  3DXL A;  2PVB A;  4L72 B;  4JQ0 D;  1J1D A;  1TNX A;  1LL4 A;  5F6T A;  1CNP A;  4PE1 A;  1F40 A;  3TC5 A;  1KWO B;  2FDM A;  1OSA A;  4ODO A;  1KK8 C;  4AQI A;  5FYX A;  4JWQ A;  1JC2 A;  1OMR A;  4YRU A;  5B8I B;  1JF2 A;  2KFF A;  1QAS A;  4W5U A;  2E6W A;  4XYN A;  3PRA A;  1MXL C;  2WCL A;  1ROT A;  1GOI A;  3CHE A;  3SG4 A;  3B86 A;  1W1Y A;  4GGF C;  5I98 A;  4INX A;  1N0Y A;  3L47 A;  3JTD C;  1UP5 A;  1QX7 A;  3KAC A;  2L98 A;  2DOQ A;  1DVI A;  2DG9 A;  2KI4 C;  4JPZ B;  1YTZ C;  1RTP 1;  1WDC C;  4KQZ A;  5I2O A;  5GQQ C;  3GOF A;  1Q6U A;  2CT9 A;  3O6B A;  3BXK A;  1G4Y R;  2BL0 C;  4OVN F;  1EXR A;  3O5F A;  4P8V A;  3NSK A;  3UI4 A;  1HXV A;  2UZ5 A;  1CM4 A;  2XP3 A;  1UHJ A;  3SG2 A;  4DRW A;  2E30 A;  3ALG A;  1KFU S;  1PAL A;  4LAY A;  1ZUZ A;  2IUZ A;  1LL7 A;  5HWB A;  1FKB A;  1KFX S;  1X02 A;  2KFH A;  1TIZ A;  1ZBK A;  3TCZ A;  2LUX A;  2QEB A;  2L50 A;  2M1U A;  1JSA A;  4GBA A;  4FAP A;  2M8U A;  1AJ4 A;  2MRD A;  1Q1C A;  2LAP A;  4TNC A;  3AS0 A;  3CLN A;  2F33 A;  3O4X A;  1LG2 A;  1W26 A;  4GGN A;  2I2R E;  3S0E A;  4PE4 A;  3OA5 A;  1Q80 A;  4C0J A;  4QJ4 B;  3ARP A;  1QAT A;  4PE7 A;  1SL7 A;  2QEH A;  3CZ2 A;  3I5I C;  2JRF A;  5D7F A;  1G8I A;  5HUA A;  2LMU A;  2K7O A;  2KYC A;  2ERB A;  1U5I B;  2JXL A;  1TNP A;  3D78 A;  5HYD A;  5IBW A;  4ORB B;  1FI5 A;  1OOH A;  1IH0 A;  1E6R A;  3V2L A;  3GPK A;  4LAX A;  3FIA A;  1PVB A;  2IS9 A;  3KHE A;  3S0B A;  3KCE A;  2PI6 A;  2PMY A;  1UUS A;  1DJH A;  1DEK A;  2L51 A;  2OPO A;  4HRE E;  5BPJ A;  2BE6 A;  1CDL A;  3VGO A;  1TNQ A;  1B7T Y;  1HJV A;  4ML4 A;  3RM9 A;  1K96 A;  2G8Z A;  2RUQ A;  1UWO A;  1XHG A;  5FI7 A;  1ZCN A;  3B88 A;  2LLU A;  4Q7N A;  1CDP A;  1LQ0 A;  4MPK A;  3DVJ A;  1NWR A;  1UR9 A;  2M3W A;  1XK4 A;  4PT1 A;  2LP3 A;  3AS2 A;  1QX5 B;  2M7N A;  3I6C A;  3CR4 X;  3I5F B;  3BXW A;  1IG5 A;  2BCA A;  3LK1 A;  5PAL A;  3IKD A;  1ZB5 A;  5AER A;  1M63 B;  3WHT B;  1A4P A;  1Z2C B;  1DF0 B;  4YGD B;  1SMG A;  4IQ2 A;  2JPO A;  3DD4 A;  1LVC D;  1LJY A;  2EUL A;  2LAN A;  3K1E A;  4WIW A;  4ODR A;  4GNK B;  1N65 A;  1RFJ A;  4CLN A;  4LAW A;  3PRD A;  3IQO A;  5CSF A;  2ZQT A;  1KQM B;  1J4I A;  1M31 A;  3VRQ A;  2B1U A;  1E6N A;  1H4B A;  1C7V A;  4PCW A;  2H2K A;  3CAB A;  1UHH A;  3NHI A;  3ARY A;  3BJH A;  4DRO A;  1FKJ A;  5J3X A;  5HBF A;  2O9O A;  5DKQ A;  2F21 A;  2COL B;  3FWC A;  2JT0 A;  1R6P A;  3S0A A;  4TNS A;  2I94 A;  4MRX A;  3DZT A;  2PSR A;  1EL4 A;  5JJG A;  3JXV A;  4P8U A;  1CM1 A;  1OOF A;  3OHM B;  1IJ5 A;  3R1O A;  1WRL A;  2K2F A;  1E8A A;  3IHZ A;  1W7J B;  2F3Y A;  1PIN A;  1SY9 A;  4ODM A;  4F7F A;  4U8D A;  2M1I A;  2QEO A;  2K60 A;  2WCH A;  1KCY A;  2LVI A;  4W9O A;  4MNK A;  2LP2 A;  1Y6W A;  2F8P A;  1NMV A;  2MLY A;  3AKB A;  5DIU A;  2M97 A;  3LCP C;  2DT2 A;  1KFU L;  3WD4 A;  2Q91 A;  2NCO A;  1DJG A;  3B87 A;  3WH0 A;  1KWO C;  2XP5 A;  1EHN A;  2LVK A;  1EG4 A;  2ZR4 A;  5DIC A;  1ZBV A;  3KO0 A;  1JNT A;  2F2O A;  2XP6 A;  2M29 A;  2KGJ A;  3ARO A;  1EH2 A;  3LUO A;  2BKI B;  1E44 A;  4OV2 A;  1IJ6 A;  4ZS6 A;  1EQ3 A;  4L3N A;  1B4C A;  4C0L A;  1QS7 A;  4J4N A;  1TUZ A;  1B8R A;  2LMT A;  1FPW A;  1OMD A;  1KK8 B;  2XPB A;  2Y78 A;  2KPH A;  4DRP A;  2A3E A;  2FOT A;  1V1F A;  1YUU A;  3R72 A;  3JYJ A;  1IX5 A;  4OZD A;  1FKF A;  4AQJ A;  1PVA A;  3KAB A;  5FI2 A;  1DGV A;  2LJ4 A;  4GGF A;  4QJ5 B;  3CYZ A;  3H4S E;  2KDH A;  2JTZ A;  1GRJ A;  2M9G A;  1FF1 A;  3O5J A;  2LVV A;  3LK0 A;  2NLN A;  1K8U A;  2YGU A;  3BUN B;  3NXA A;  2ZFD A;  4U84 A;  1FKH A;  1JUO A;  2MAZ A;  1NCX A;  4TX0 A;  1B8L A;  2P71 A;  2BAP A;  4NDD A;  2WCK A;  2V53 A;  1E15 A;  5AFP A;  3AAJ A;  2B5U B;  1TN4 A;  2KI6 D;  2PV1 A;  3PR9 A;  5D3O A;  3S0D A;  3E3R A;  1SBJ A;  3PSR A;  2RUD A;  4AOM A;  3D76 A;  2LPV A;  3O5Q A;  2PV2 A;  4N1F A;  4MZL A;  4MSP A;  3NSO A;  3OX5 A;  5AEQ A;  1EG3 A;  2PRU A;  3VRO A;  2L2E A;  2KO7 A;  1JFJ A;  1E9L A;  2KOT A;  2RGI A;  2M2A A;  5HWC A;  2DG4 A;  1Z4H A;  1GJY A;  1W7I B;  4BF8 A;  1OZO A;  1WB0 A;  5G08 A;  2ZQV A;  4MEW A;  3BFA A;  3O5O A;  1UR8 A;  3EVR A;  2RUR A;  3AAK A;  2OLH A;  4P5O E;  1PBK A;  1J6Y A;  5I2Q A;  1WLM A;  1TCO C;  2PQL A;  4Z2L A;  4AY1 A;  1LG1 A;  1F70 A;  2BCX A;  1XFY O;  4GUK A;  3WD0 A;  4WRI A;  4Z2G A;  1Q6H A;  2KAV A;  2ITK A;  4D1E A;  1N2D A;  1OW4 A;  4YI8 A;  4JKT A;  3I5I B;  1P28 A;  3DY9 A;  2NZ0 A;  1W1V A;  2XP8 A;  3EY6 A;  1OMV A;  1MXE A;  1CFC A;  3PAT A;  3VRP A;  3OOB A;  1EDQ A;  1L2O B;  1QVI Z;  1XVJ A;  1FKK A;  2KAY A;  3ART A;  4A4B A;  1ZL1 A;  1QV0 A;  2OS8 C;  3R1V A;  2KLE A;  4JFL A;  3EK8 A;  2VRG A;  4Z2H A;  1MQ1 A;  3PRB A;  1SYM A;  1YX7 A;  3M0W A;  2H61 A;  1QPL A;  2KSP A;  2B31 A;  3DF0 B;  2YBT A;  3EKH A;  2K7C A;  3PJI A;  4QT2 A;  4C0K A;  1QWV A;  1X6L A;  2F2D A;  3CGN A;  1N1A A;  2HPS A;  2WC5 A;  1DJI A;  3CWG A;  2LM5 A;  4ITZ A;  4WKF A;  2GV5 A;  1B9A A;  1HKI A;  2KR7 A;  4NDB A;  5TNC A;  1C9H A;  3O5E A;  2F2P A;  3CHC A;  1SRA A;  1YVH A;  1TUJ A;  2QDI A;  2ZKM X;  4PHN A;  4P8W A;  4QT3 A;  2JOJ A;  4LGX A;  3PA7 A;  4ORA B;  3CZ0 A;  3SIA A;  1NMW A;  4CFR A;  1IWQ A;  3S0G A;  5BXJ A;  2F3Z A;  2PN0 A;  1MR8 A;  3PN7 B;  3UQI A;  1OOI X;  3O2P A;  2KAX A;  4DRI A;  1F71 A;  2DT0 A;  2K61 A;  3DVM A;  4N1G A;  3KAF A;  2P70 A;  2JNF A;  4MAV A;  3RFW A;  1YUT A;  3FS7 A;  2ZND A;  1T11 A;  2JNX A;  5CSN A;  2DG3 A;  2LHI A;  3SJS A;  1CLM A;  3RLZ A;  3PN7 C;  3FE8 A;  4PAL A;  1A75 B;  1NYA A;  2JQ6 A;  1M45 A;  3KF9 A;  2JZI A;  2ESC A;  2MLE C;  2VCD A;  5AAN A;  1Y1X A;  1GGW A;  2RSE A;  1TOP A;  1ROU A;  3LLE A;  1FFR A;  3CZT X;  1SK6 D;  2PAL A;  3PM2 A;  4NDC A;  4E68 A;  4DRN A;  2JU0 A;  4Q22 A;  2K7B A;  1OGG A;  2WOR A;  1L7Z A;  1SCM B;  2MLF C;  4ODL A;  3UI6 A;  3WD3 A;  3FY1 A;  3O5D A;  4GAO A;  1S1E A;  2Y1M A;  3SG7 A;  1W9U A;  1FKT A;  1EJ3 A;  1A75 A;  3TDI A;  3SS4 A;  1GM0 A;  3UO9 A;  2BE4 A;  4MNL A;  2OFN A;  1CLL A;  2ETN A;  3WNX B;  2L0P A;  3GK4 X;  4ICB A;  3IF7 A;  4Z2J A;  2KI6 C;  4MN0 A;  2CBL A;  4YGB B;  4DWS B;  1H8B A;  2Y5I A;  4W9P A;  4JFJ A;  5KTY A;  3B7A A;  4ODQ A;  3R1P A;  1T14 A;  2FJU B;  1DGU A;  1SL9 A;  4JFK A;  1L2O C;  2YBU A;  3OB1 B;  1FI6 A;  3GK2 A;  3CDN A;  2O60 A;  3B8S A;  1Y0V H;  2BCB A;  2PV3 A;  1ODB A;  2FKE A;  3SG6 A;  2L2C A;  2VN1 A;  3KAH A;  1CFP A;  1UHK A;  4GPL B;  1S5G Y;  1ZU8 A;  1S6J A;  1S6C A;  1JWD A;  1D6O A;  2HQW A;  4XJK A;  2OS8 B;  4ZCV A;  1J7P A;  1LL6 A;  3WQW A;  1NWD A;  1CLB A;  2QF8 A;  2DT1 A;  4ODN A;  2P4V A;  1AP4 A;  1FKL A;  4NQG A;  1YUS A;  1Q6I A;  2LV7 A;  2GGZ A;  3TDB A;  2OTG B;  1LIN A;  1JF0 A;  2L4H A;  2RQS A;  1S5G Z;  1ZOT B;  3CHF A;  2PYQ A;  2WCF A;  2FJY A;  1YAT A;  2A3B A;  3G6L A;  2LHL A;  1U79 A;  2BEC A;  1SKT A;  1DJW A;  5DEZ A;  4CFQ A;  5DO2 A;  1A2X A;  3AQU A;  3KPX A;  1GGZ A;  1IKU A;  3ARS A;  1TCO B;  1VF8 A;  1B1G A;  3I5F C;  1RJV A;  4S3J A;  1W9V A;  5FI6 A;  3RM4 A;  1B8C A;  1PSB A;  2QAC A;  4NSB A;  4USL A;  1QLS A;  1NP8 A;  3UQA A;  3VRR A;  4IT4 A;  1UHN A;  3O5I A;  3AS3 A;  4WJX A;  4HBE A;  1AJ5 A;  3FAP A;  4FQT A;  1WAW A;  1JVW A;  1K9K A;  1CTR A;  4I5L B;  2ZN9 A;  3ARZ A;  4BY4 A;  3B9D A;  5I94 A;  2WOS A;  1DEL A;  1QVI Y;  3WXA A;  1V1G A;  2WCJ A;  1RRO A;  2Y1N A;  2G41 A;  4DRQ A;  1KSO A;  3CH9 A;  4IQC A;  2LLT A;  3BUW B;  2G2B A;  2K2A A;  2WCE A;  1REC A;  1J4H A;  1QV1 A;  1XFR A;  2Y4Q A;  1YR5 A;  3EVU A;  1K9U A;  3D77 A;  1NH6 A;  4PDZ A;  3AKA A;  2GGM A;  1KSM A;  1WRZ A;  3KAD A;  5DIT A;  5HLV A;  4OCI A;  1ZK6 A;  3O5L A;  1NCY A;  4UDM A;  3OX6 A;  1K2H A;  4WQ3 A;  4HBO A;  4DT4 A;  1YRT B;  1BOD A;  4MBE A;  1NIW A;  1FD9 A;  1P5Q A;  2KFW A;  3FE9 A;  3PM8 A;  3ARX A;  2EGD A;  3B9E A;  2HET A;  2TN4 A;  3GK1 A;  2NXQ A;  1ORG A;  1S6I A;  4DUQ A;  2Q4U A;  5DIV A;  2ZR6 A;  1R9H A;  1CKK A;  3TS5 B;  4ZCU A;  4I5J A;  4YBH B;  1LKJ A;  3CHD A;  3O5M A;  2JWW A;  2LVJ A;  2PAS A;  2FAP A;  2M1K B;  4DCK A;  3SG3 A;  1DF0 A;  2PPN A;  3FXY A;  3TDU A;  1B47 A;  1ZBC A;  2F4E A;  5HL1 A;  1F8H A;  2KQY A;  2I7A A;  1NSG A;  2XP7 A;  1WLZ A;  4DRK A;  4IT6 A;  1J7R A;  4O2T A;  3BUO B;  3BYA A;  1ITX A;  2AOS A;  2KBM A;  1RK9 A;  2KNE A;  3NTP A;  1XRV A;  4IL1 A;  4WKH A;  4Z2K A;  4I5K A;  2WK2 A;  1NX0 A;  3WKZ A;  5I8N A;  1IQ3 A;  1XFX O;  3NRK A;  1LS8 A;  2MHH A;  1DC1 A;  4ZPT R;  4WQ2 A;  1CFD A;  2M08 A;  3CGM A;  3EIP A;  2MJW B;  1YW5 A;  3JYM A;  1SR6 B;  3CZ1 A;  2PPO A;  5HKW A;  3IVT A;  3UI5 A;  2PPP A;  4WK9 A;  1JCH B;  4KYN A;  2MLX A;  3EG5 B;  3NSI A;  1QIV A;  2Q5A A;  2AAO A;  4G2P A;  1OQP A;  2LE9 B;  2O5G A;  2KYF A;  3RM1 A;  1WY9 A;  2JXC A;  1AHR A;  1YUR A;  2K8M B;  4DS7 A;  2ZR5 A;  3LL8 B;  4MGV A;  1SR0 A;  2KGB C;  3KEV A;  1SR6 C;  2AWG A;  4QZV B;  2MNT A;  1F4O A;  1SW8 A;  1LXF C;  2BBN A;  3D0Y B;  1BKF A;  1TFV A;  2KQ6 A;  2DT3 A;  3PAL A;  1BR1 B;  5HT1 A;  4GGQ A;  1Y1A A;  1MF8 B;  5CSJ A;  1S26 D;  2L5X B;  2WC8 A;  3IQQ A;  3QME A;  3O5K A;  1IQ5 A;  2EHB A;  3MDY B;  3TS5 C;  1DJY A;  1J1E A;  1F8A B;  1JNE A;  3D10 A;  3GU0 A;  2ZNE A;  1MUX A;  3D0Y A;  3DF0 A;  4ETO A;  1BU3 A;  3WQV A;  2LLS A;  3NI6 A;  1QPF A;  5JH8 A;  1BOC A;  3WL0 A;  2M0R A;  2WC6 A;  3N7H A;  3AS1 A;  2GTE A;  1LA3 A;  2LCP A;  1QX2 A;  5ER4 X;  2KGR A;  1DT7 B;  2HQ8 A;  2OTG C;  1K90 D;  2L5Y A;  1TTX A;  3O78 A;  1CFF A;  2R2I A;  4GFT A;  1DJX A;  2L4I A;  1CMF A;  1OZS A;  1DMO A;  3UQB A;  2WLZ A;  2RUC A;  4MRY A;  4PHM A;  1MHO A;  2A3A A;  1W1T A;  1KT1 A;  4DRM A;  2KHN A;  2M49 B;  1M46 A;  1B6C A;  5I2L A;  1ALV A;  3I5H B;  5HTG A;  4L9M A;  4QJ3 B;  5JOL A;  3KAI A;  4MNM A;  3VAW A;  1F54 A;  3CR2 A;  1PK0 D;  3SIB A;  1BLQ A;  4OKH A;  1NWU A;  2DSV A;  1J7O A;  4S3K A;  3O5R A;  1K9P A;  2A4J A;  4WKA A;  4JYS A;  5CSI A;  3IKG A;  2JC2 A;  1ZBW A;  2QEV A;  1EIB A;  3I5G B;  1FKI A;  3A4U B;  3BOW A;  4KR0 B;  3SS5 A;  2ZQS A;  4C02 B;  3ODK A;  1SYT A;  1UHI A;  4Z2I A;  3BQ3 A;  4PTM A;  3SS3 A;  1EYM A;  3VRN A;  1DTL A;  1HT9 A;  4BY5 A;  1BMO A;  3EK7 A;  1QTX A;  1TRF A;  3K21 A;  1Y0O A;  1IRJ A;  2F23 A;  2MLZ A;  3W4R A;  3OB2 B;  1MWN A;  1WDC B;  3BUX B;  4TYO A;  1QXP A;  2BKH B;  3BMB A;  2DPE A;  3CZ8 A;  3JVT C;  1R2U A;  2P6B B;  1ALW A;  2K7D A;  2K8I A;  4URI A;  3EVV A;  3B9A A;  4XJK B;  3B7X A;  3SG5 A;  5ER5 A;  3BFH A;  2LUC A;  4ODK A;  3OGN A;  2BNX A;  2A3C A;  3WL1 A;  1M5Y A;  2CTN A;  4OR9 B;  4M2Q A;  4F0Z B;  3O4Y A;  3TUY C;  4JD9 A;  4P2Y B;  1O6I A;  2K0J A;  2BL0 B;  1NX2 A;  1M39 A;  2KFG A;  4ORC B;  3ZNI A;  1HKK A;  4IJ7 A;  1YRU B;  2H8V A;  3UNW A;  4G50 A;  4FQO A;  5HW7 A;  5HW8 A;  1L1P A;  2KI4 B;  3HCM A;  3ARW A;  2FCE A;  1FFQ A;  4DZ2 A;  3ARR A;  1KK7 Y;  1XK4 C;  4UPG A;  1IIO A;  1JBA A;  1YVL A;  2LC5 A;  3RZS A;  2CNP A;  1W9P A;  1E6P A;  4MNJ A;  3B6X A;  4DZ3 A;  5J6E A;  4DRJ A;  2WND A;  5HW6 A;  4DWS A;  2LGO A;  1C07 A;  4TW8 A;  1LA0 A;  4INW A;  1S36 A;  4PE0 A;  3WIJ A;  1SCV A;  1H0G A;  2XP9 A;  5HKZ A;  1NWS A;  3Q8I A;  5D69 A;  3L4A A;  5GPR A;  2LNK A;  3QRX A;  1HKJ A;  4CPV A;  2JT3 A;  1D7H A;  1WRK A;  2G9B A;  3NGV A;  2D8N A;  1CMG A;  4XAK A;  4M2O A;  1JFK A;  3ARU A;  1FKG A;  4DIR A;  2WM0 A;  3ALF A;  4YGE B;  1K95 A;  1NX3 A;  3DVK A;  2XP4 A;  5HLO A;  4DH0 A;  5CPV A;  2I18 A;  3BFB A;  1JND A;  3WHU B;  4YGC B;  3TZ1 A;  3BOW B;  1KQV A;  2ZRS A;  4R1E A;  4TW7 A;  3DYE A;  1BG1 A;  4R0X A;  2JT8 A;  4MLW A; 
#chains in the Genus database with same CATH homology
 3FXY A;  3CLN A;  3VRP A;  2F33 A;  3OOB A;  1ZFS A;  1EDQ A;  3TDU A;  1L2O B;  1B47 A;  1QVI Z;  1XVJ A;  1FKK A;  2KAY A;  1LG2 A;  1ZBC A;  2F4E A;  4A4B A;  3ART A;  1ZL1 A;  1FJD A;  1W26 A;  1QV0 A;  2ZQU A;  4GGN A;  2I2R E;  2OS8 C;  2SCP A;  4HRG A;  3I5G C;  1NSH A;  4PE4 A;  1F8H A;  3OA5 A;  1Q80 A;  4JFL A;  4C0J A;  4QJ4 B;  2KQY A;  3EK8 A;  2I7A A;  1KQM C;  2VRG A;  3F45 A;  2D9F A;  1NSG A;  3ARP A;  5D75 A;  1KK7 Z;  2XP7 A;  1QAT A;  4Z2H A;  1MQ1 A;  4PE7 A;  1WLZ A;  1NX1 A;  3PRB A;  1SYM A;  4DRK A;  1YX7 A;  1SL7 A;  3M0W A;  4IT6 A;  2H61 A;  1J7R A;  4O2T A;  1QPL A;  3O5P A;  3BUO B;  1OGB A;  3I5I C;  2KSP A;  2JRF A;  5D7F A;  3BYA A;  1G8I A;  1ITX A;  2AOS A;  2B31 A;  5HUA A;  3DF0 B;  2KBM A;  1HQV A;  2LMU A;  2YBT A;  4AY1 A;  1RK9 A;  3EKH A;  2JPT A;  2KE0 A;  2N87 A;  2KNE A;  3NTP A;  4DWS D;  1XRV A;  2CCM A;  2K7O A;  2KYC A;  4IL1 A;  2K7C A;  3A8R A;  1IGV A;  4QT2 A;  5DKR A;  2MBX A;  4I5K A;  4C0K A;  1J7Q A;  2WK2 A;  4WKH A;  1X6L A;  4Z2K A;  1NX0 A;  1AVS A;  2F2D A;  5GQB A;  5I8N A;  3WKZ A;  1IQ3 A;  1XFX O;  4LAV A;  4ODP A;  3NRK A;  1U5I B;  2JXL A;  1TNP A;  5HYD A;  4GIV A;  2MHH A;  1FKR A;  3CGN A;  3ARQ A;  1BF5 A;  1N1A A;  2DSW A;  5IBW A;  1K94 A;  2HPS A;  4ORB B;  1DJI A;  1FI5 A;  4MTV A;  3CWG A;  2LMV A;  4ZPT R;  2LM5 A;  1CFD A;  4MVF A;  4WQ2 A;  1IH0 A;  1E6R A;  2NCP A;  4ITZ A;  4WKF A;  1S3P A;  1ZMZ A;  2GV5 A;  1H0I A;  1B9A A;  1HKI A;  2KR7 A;  4NDB A;  5TNC A;  1C9H A;  1KFW A;  2M08 A;  3O5E A;  2F2P A;  3GPK A;  3CGM A;  1AK8 A;  2MJW B;  1YW5 A;  4LAX A;  2IF4 A;  3FIA A;  3CHC A;  1SRA A;  1PVB A;  2IS9 A;  2LKN A;  3KHE A;  3JYM A;  3KCE A;  2PI6 A;  1SR6 B;  1YVH A;  1BT6 A;  2PPO A;  2PMY A;  2ZKM X;  1BJF A;  1UUS A;  5AXI A;  1D7I A;  1DJH A;  2L2S A;  5HKW A;  2MPH A;  5DF0 A;  3WD2 A;  3TUY B;  4PHN A;  4P8W A;  2L51 A;  4QT3 A;  2JOJ A;  2OPO A;  1HKM A;  4HRE E;  1FAP A;  2PPP A;  2ISD A;  3PA7 A;  4LGX A;  4WK9 A;  3UI5 A;  5BPJ A;  1XA5 A;  5HKY A;  1F4Q A;  2BE6 A;  1CDL A;  4ORA B;  3VGO A;  2MLX A;  1TNQ A;  3MSE B;  3NSI A;  4M2P A;  1B7T Y;  2PBC A;  1HJV A;  1D1O A;  4ML4 A;  3RM9 A;  1K96 A;  2MLZ A;  2BBM A;  3SIA A;  2G8Z A;  2RUQ A;  1QIV A;  1NMW A;  1VRK A;  2AAO A;  4CFR A;  2Q5A A;  3CR5 X;  1IWQ A;  1UWO A;  4G2P A;  5BXJ A;  1XHG A;  2F3Z A;  5HKG A;  1OQP A;  5GPG A;  4N19 A;  1CB1 A;  1ZCN A;  2LE9 B;  2O5G A;  1MR8 A;  2M7L A;  2LLU A;  2DSZ A;  4Q7N A;  3PN7 B;  1CDP A;  2KYF A;  1LQ0 A;  4FN2 A;  3RM1 A;  4MPK A;  4U86 A;  3UQI A;  1WY9 A;  2JXC A;  1AHR A;  3O2P A;  1YUR A;  2K8M B;  4DS7 A;  2KAX A;  3DVJ A;  3LL8 B;  2ZR5 A;  1IX5 A;  1NWR A;  4DRI A;  2JT8 A;  4MGV A;  1SR0 A;  1F71 A;  2DT0 A;  4P8X A;  1UR9 A;  4YI9 A;  2K61 A;  1XK4 A;  2M3W A;  3DVM A;  4N1G A;  2KGB C;  1WNO A;  3KAF A;  3KEV A;  1SR6 C;  2AWG A;  3RM8 A;  1K9T A;  2MNT A;  4QZV B;  2JNF A;  2LP3 A;  4MAV A;  4NSB A;  3AS2 A;  1QX5 B;  1F4O A;  1SW8 A;  2M7N A;  3I6C A;  2EC6 B;  1KT0 A;  1YUT A;  3RFW A;  4HAR A;  1LXF C;  3FS7 A;  2ZND A;  3CR4 X;  3I5F B;  1T11 A;  2O92 A;  2JNX A;  2BBN A;  1PSR A;  3BXW A;  5CSN A;  2DG3 A;  2LHI A;  3D0Y B;  1BKF A;  3CS1 A;  1IG5 A;  1XYD A;  2BCA A;  1QJT A;  3LK1 A;  1CLM A;  4HSZ A;  5PAL A;  3RLZ A;  3SJS A;  1FKS A;  3PN7 C;  1GPF A;  1TFV A;  3IKD A;  2KQ6 A;  2DT3 A;  1ZB5 A;  4PAL A;  5AER A;  1A75 B;  1SL8 A;  1M63 B;  2JUL A;  3PAL A;  3WHT B;  1NYA A;  1BR1 B;  1A4P A;  2JQ6 A;  4GGQ A;  5HT1 A;  1M45 A;  5KU1 A;  3ICB A;  3KF9 A;  1Y1A A;  1DF0 B;  1MF8 B;  1NUB A;  2JZI A;  3JVT B;  4YGD B;  2MLE C;  5CSJ A;  1CDN A;  1SMG A;  2ESC A;  4IQ2 A;  4WKA A;  1S26 D;  3DD4 A;  2VCD A;  2L5X B;  5AAN A;  3W4R A;  1Y1X A;  2SAS A;  1GGW A;  1LVC D;  2WC8 A;  3IQQ A;  1LJY A;  3OP0 A;  4W9Q A;  3O5K A;  1IQ5 A;  1CDM A;  2LAN A;  2RSE A;  2EC6 C;  1RD6 A;  4GNK B;  1TOP A;  4ODR A;  4WIW A;  1N65 A;  1ROU A;  3WD1 A;  4MZJ A;  3LLE A;  1FFR A;  1RFJ A;  2EHB A;  3CZT X;  1SK6 D;  2PAL A;  4NDC A;  3MDY B;  4E68 A;  4DRN A;  1BR4 B;  2JU0 A;  3TS5 C;  2MF9 A;  1DJY A;  2JZV A;  4Q22 A;  2K7B A;  4CLN A;  1OGG A;  4LAW A;  1J1E A;  1F8A B;  3PRD A;  2WOR A;  3IQO A;  4CID A;  1JNE A;  1KFX L;  1J55 A;  1L7Z A;  1BL4 A;  4TW6 A;  5CSF A;  2CXJ A;  3D10 A;  1SCM B;  2ZQT A;  2MLF C;  1KQM B;  1J4I A;  1M31 A;  3VRQ A;  1D2K A;  4ODL A;  4Q04 A;  1B7T Z;  3FY1 A;  3UI6 A;  1NCZ A;  2B1U A;  3I5H C;  3WD3 A;  1J4R A;  1E6N A;  1XO5 A;  2MA2 A;  4GAO A;  1C7V A;  1H4B A;  3O5D A;  1S1E A;  2Y1M A;  3SG7 A;  1W9U A;  1XFV O;  2ZNE A;  1MUX A;  4PCW A;  1FKT A;  2H2K A;  3D0Y A;  3DF0 A;  1XFU O;  3EKJ A;  1W1P A;  4ETO A;  1UUR A;  1A7X A;  1BU3 A;  3WQV A;  1UHH A;  2LLS A;  1EJ3 A;  1QPF A;  1A75 A;  3TDI A;  3ARY A;  3NI6 A;  4DRO A;  5JH8 A;  2KBI A;  1OOJ A;  1BOC A;  1FKJ A;  3RGC A;  3WL0 A;  2BE4 A;  1DJZ A;  1K93 D;  2M0R A;  5J3X A;  3H9R B;  1HJW A;  5HBF A;  3AS1 A;  2O9O A;  4MNL A;  1LA3 A;  2LCP A;  5DKQ A;  2F21 A;  2OFN A;  1QX2 A;  3G6M A;  2COL B;  5ER4 X;  4A4C A;  4NZC A;  1CLL A;  3WNX B;  2XPA A;  3FWC A;  2JT0 A;  2KGR A;  1C7W A;  1R6P A;  2L0P A;  3BUM B;  3GK4 X;  3IF7 A;  4ICB A;  2KI6 C;  4PHK A;  4R5E A;  2HQ8 A;  2OTG C;  4MN0 A;  4TNS A;  2I94 A;  1K90 D;  4MZK A;  1TTX A;  2CBL A;  3CGA A;  3O78 A;  4YGB B;  1CFF A;  3EK4 A;  2R2I A;  4GFT A;  4MRX A;  1DJX A;  1FKD A;  1H8B A;  2L4I A;  2Y5I A;  1CMF A;  1OZS A;  2PSR A;  1EL4 A;  5JJG A;  2H61 C;  1DMO A;  4W9P A;  3JXV A;  1XFW O;  4P8U A;  1CM1 A;  4N5X A;  3KAG A;  3UQB A;  4JFJ A;  5KTY A;  1E6Z A;  1QZ2 A;  2WLZ A;  3OHM B;  1FW4 A;  4MRY A;  2RUC A;  3QOK A;  1IJ5 A;  4ODQ A;  1WRL A;  2FJU B;  4PHM A;  1DGU A;  1MHO A;  2K2F A;  1E8A A;  3IHZ A;  2A3A A;  1W7J B;  1W1T A;  2F3Y A;  1KT1 A;  1PIN A;  1SL9 A;  4DRM A;  4I5N B;  2KHN A;  2M49 B;  1SY9 A;  4ODM A;  4JFK A;  4ZPW R;  2WCB A;  2KI3 A;  1L2O C;  2YBU A;  1M46 A;  4U8D A;  1B6C A;  3OB1 B;  1FI6 A;  2M1I A;  5I2L A;  1ALV A;  3I5H B;  3GK2 A;  3ARV A;  4L9M A;  4ZPV R;  4QJ3 B;  5HTG A;  5JOL A;  1CTN A;  1KCY A;  2O60 A;  2LVI A;  4W9O A;  3B8S A;  1JNS A;  3KAI A;  4MNK A;  1PRW A;  4DWS C;  1Y0V H;  4MNM A;  2LP2 A;  3UF8 A;  2BCB A;  2FCD A;  1F54 A;  1ZAC A;  3VAW A;  3CR2 A;  1PK0 D;  2ZRT A;  3SIB A;  1BLQ A;  4JFM A;  4DWS B;  2PV3 A;  5DKN A;  4OKH A;  1NWU A;  2F8P A;  1Y6W A;  1NPQ A;  1TNW A;  3AKB A;  5KSZ A;  2M97 A;  1NMV A;  1J7O A;  2DSV A;  2MLY A;  3LCP C;  1ODB A;  4S3K A;  1SNL A;  2DT2 A;  2FKE A;  1KFU L;  1QLK A;  3O5R A;  4JFI A;  4PHJ A;  3IK8 A;  2Q91 A;  2NCO A;  1K9P A;  3SG6 A;  1AUI B;  2A4J A;  1OWQ A;  2VN1 A;  3KAH A;  5CSI A;  1CFP A;  4JYS A;  1DJG A;  3DVE A;  3IKG A;  1UHK A;  2JC2 A;  4GPL B;  1S5G Y;  3KZ7 A;  1ZBW A;  1ZU8 A;  3WH0 A;  1S6J A;  1S6C A;  1KWO C;  1JWD A;  1EIB A;  3I5G B;  2XP5 A;  4J4O A;  1EHN A;  1D6O A;  2HQW A;  3A4U B;  4XJK A;  2OS8 B;  2LVK A;  3BOW A;  1EG4 A;  4ZCV A;  1J7P A;  1FKI A;  1LL6 A;  4KR0 B;  3WQW A;  2ZR4 A;  2ZQS A;  4C02 B;  1NWD A;  1HJX A;  1Y1U A;  1CLB A;  2WLY A;  3HX4 A;  1GUV A;  3ODK A;  3RME A;  1SYT A;  3C1V A;  1ZBV A;  2QF8 A;  2DT1 A;  1UHI A;  3KO0 A;  4Z2I A;  1SPY A;  2F2O A;  1JNT A;  1A29 A;  2XP6 A;  1D7J A;  4ODN A;  3BQ3 A;  4TW8 A;  2M29 A;  2KGJ A;  1DT7 B;  4PTM A;  4DRH A;  4NNR A;  5B8I C;  1SCM C;  1AP4 A;  1EYM A;  3ARO A;  3VRN A;  1FKL A;  1DTL A;  4NQG A;  1YUS A;  1EH2 A;  1HT9 A;  2LV7 A;  1Q6I A;  2GGZ A;  4BY5 A;  3TDB A;  3LUO A;  2BKI B;  1BMO A;  3EK7 A;  1QTX A;  1TRF A;  4OV2 A;  3CTN A;  3K21 A;  1Y0O A;  1IJ6 A;  4ZS6 A;  2OTG B;  1LIN A;  1IRJ A;  1JF0 A;  1NWT A;  2ZR6 A;  4L3N A;  1EQ3 A;  1B4C A;  1OE9 B;  2L4H A;  4C0L A;  1QS7 A;  3NSL A;  3OB2 B;  2DSU A;  1MWN A;  1S5G Z;  2RQS A;  4J4N A;  1WDC B;  1XFZ O;  3BUX B;  3PLF B;  5K89 A;  1GQM A;  1ZOT B;  1F55 A;  3CHF A;  4TYO A;  1B8R A;  1YX8 A;  2AUC A;  1QXP A;  2LMT A;  1FPW A;  1OMD A;  2WCF A;  1KK8 B;  2BKH B;  4YGA A;  1A03 A;  3PFV A;  2DPE A;  1YAT A;  2A3B A;  2XPB A;  2Y78 A;  4IPX A;  4HRH A;  1PUL A;  3CZ8 A;  3G6L A;  2LHL A;  3JVT C;  1U79 A;  2QPT A;  1R2U A;  2A3E A;  2BEC A;  1SKT A;  1DJW A;  2P6B B;  3FWB A;  5DEZ A;  2FOT A;  2ZN8 A;  1ALW A;  1FBV A;  1V1F A;  4CFQ A;  5DO2 A;  1A2X A;  1YUU A;  2AMI A;  2K7D A;  3AQU A;  3JYJ A;  2K8I A;  3JTD B;  3KPX A;  4URI A;  3EVV A;  3B9A A;  4XJK B;  1GGZ A;  1IKU A;  1FKF A;  3B7X A;  3ARS A;  4AQJ A;  3SG5 A;  1PVA A;  1TCO B;  5ER5 A;  1VF8 A;  1B1G A;  3KAB A;  3ZWH A;  2LUC A;  4ODK A;  2JTT A;  2A3C A;  3WL1 A;  3I5F C;  1DGV A;  1M5Y A;  2LJ4 A;  4GGF A;  4QJ5 B;  2CTN A;  1TCF A;  1RJV A;  4QIB A;  4OR9 B;  4M2Q A;  1G33 A;  4F0Z B;  3O4Y A;  4FTG A;  2HF5 A;  3TUY C;  4S3J A;  3H4S E;  4P2Y B;  1O6I A;  2K0J A;  1W9V A;  2BL0 B;  2KDH A;  2JTZ A;  1QIW A;  1NX2 A;  3RM4 A;  1B8C A;  1M39 A;  1PSB A;  2KFG A;  2M9G A;  2QAC A;  4ORC B;  3TDZ A;  3ZNI A;  1FF1 A;  4USL A;  1QLS A;  2LVV A;  1RWY A;  1NP8 A;  1U5I A;  1YRU B;  3LK0 A;  1HKK A;  2NLN A;  1K8U A;  1X6N A;  3O5G A;  2PVB A;  4G50 A;  4L72 B;  4DIP A;  4JQ0 D;  3UQA A;  3O5J A;  4FQO A;  3VRR A;  5HW7 A;  5HW8 A;  4IT4 A;  3BUN B;  3WD4 A;  1J1D A;  2KI4 B;  1TNX A;  1UHN A;  1LL4 A;  1L1P A;  3NXA A;  3HCM A;  5F6T A;  3O5I A;  2ZFD A;  3AS3 A;  3ARW A;  4WJX A;  2FCE A;  1AJ5 A;  1CNP A;  3FAP A;  4HBE A;  1FFQ A;  4U84 A;  1FKH A;  1WAW A;  1JUO A;  2MAZ A;  1NCX A;  4PE1 A;  1JVW A;  3TC5 A;  4DZ2 A;  3ARR A;  1F40 A;  1KWO B;  4TX0 A;  1B8L A;  1K9K A;  2FDM A;  4NDD A;  1KK7 Y;  1CTR A;  1OSA A;  4I5L B;  1XK4 C;  4ODO A;  1KK8 C;  4UPG A;  2ZN9 A;  4AQI A;  2V53 A;  5FYX A;  4JWQ A;  1JC2 A;  3ARZ A;  1E15 A;  1JBA A;  5AFP A;  3AAJ A;  4BY4 A;  1TN4 A;  3B9D A;  1OMR A;  2WOS A;  4YRU A;  1YVL A;  2KI6 D;  2PV1 A;  1QVI Y;  3WXA A;  5B8I B;  3PR9 A;  1V1G A;  1JF2 A;  2KFF A;  2LC5 A;  1RRO A;  1QAS A;  4W5U A;  2E6W A;  4XYN A;  3PRA A;  2CNP A;  3E3R A;  1MXL C;  2Y1N A;  2G41 A;  1ROT A;  4DRQ A;  1GOI A;  1W9P A;  1SBJ A;  3PSR A;  3CHE A;  1E6P A;  2RUD A;  4MNJ A;  3SG4 A;  1KSO A;  3CH9 A;  4AOM A;  4IQC A;  2LLT A;  1W1Y A;  2LPV A;  4GGF C;  4DZ3 A;  5J6E A;  3O5Q A;  3BUW B;  4DRJ A;  5I98 A;  1N0Y A;  2G2B A;  2K2A A;  2WCE A;  2PV2 A;  1REC A;  4N1F A;  2WND A;  3JTD C;  4MZL A;  4MSP A;  1J4H A;  5HW6 A;  1QV1 A;  3NSO A;  1UP5 A;  3OX5 A;  4DWS A;  2LGO A;  5AEQ A;  1EG3 A;  1QX7 A;  2PRU A;  2Y4Q A;  3VRO A;  1C07 A;  1YR5 A;  2L2E A;  2KO7 A;  2L98 A;  3KAC A;  2DOQ A;  1LA0 A;  1DVI A;  3EVU A;  1K9U A;  1JFJ A;  2KOT A;  2RGI A;  1E9L A;  1NH6 A;  2M2A A;  1S36 A;  4PE0 A;  4PDZ A;  5HWC A;  2DG9 A;  3AKA A;  2DG4 A;  3WIJ A;  1GJY A;  1SCV A;  2KI4 C;  4JPZ B;  1W7I B;  1YTZ C;  2GGM A;  4U85 A;  1KSM A;  4BF8 A;  1OZO A;  1WRZ A;  5G08 A;  1H0G A;  1WB0 A;  3KAD A;  2XP9 A;  5DIT A;  5HKZ A;  1RTP 1;  1WDC C;  4MEW A;  5HLV A;  2ZQV A;  5I2O A;  4KQZ A;  1NWS A;  5GQQ C;  4OCI A;  5D69 A;  1ZK6 A;  1NCY A;  3GOF A;  3O5O A;  3O5L A;  1Q6U A;  2CT9 A;  5GPR A;  3O6B A;  3OX6 A;  1K2H A;  1UR8 A;  3BXK A;  2LNK A;  3EVR A;  4WQ3 A;  4HBO A;  1G4Y R;  3QRX A;  4DT4 A;  2RUR A;  2BL0 C;  1HKJ A;  4OVN F;  1EXR A;  1YRT B;  3AAK A;  2JT3 A;  4CPV A;  4MBE A;  1BOD A;  1WRK A;  1D7H A;  3O5F A;  2G9B A;  1NIW A;  1FD9 A;  1P5Q A;  2KFW A;  2OLH A;  4P8V A;  3NSK A;  3UI4 A;  2D8N A;  1HXV A;  2UZ5 A;  3PM8 A;  4P5O E;  2EGD A;  1PBK A;  3ARX A;  1J6Y A;  3B9E A;  5I2Q A;  1CMG A;  1CM4 A;  1WLM A;  1TCO C;  2XP3 A;  1UHJ A;  2HET A;  2TN4 A;  3SG2 A;  4XAK A;  4Z2L A;  4M2O A;  1JFK A;  4DRW A;  3ARU A;  2E30 A;  3ALG A;  1KFU S;  1PAL A;  4LAY A;  1FKG A;  1ZUZ A;  3GK1 A;  1LG1 A;  1F70 A;  2IUZ A;  2BCX A;  1XFY O;  4DIR A;  1LL7 A;  2NXQ A;  5DIU A;  2WM0 A;  4GUK A;  3WD0 A;  3ALF A;  4WRI A;  4YGE B;  1FKB A;  5HWB A;  4Z2G A;  1S6I A;  4DRP A;  4Z2J A;  4DUQ A;  1K95 A;  2Q4U A;  1NX3 A;  1Q6H A;  5DIV A;  3DVK A;  2XP4 A;  1KFX S;  1X02 A;  5HLO A;  2KFH A;  1TIZ A;  1CKK A;  2KAV A;  1R9H A;  5CPV A;  2I18 A;  4D1E A;  1ZBK A;  2ITK A;  3TCZ A;  4DH0 A;  1N2D A;  2LUX A;  3TS5 B;  1JND A;  4ZCU A;  4I5J A;  4YBH B;  2L50 A;  2M1U A;  3WHU B;  1JSA A;  4YGC B;  3TZ1 A;  4YI8 A;  1LKJ A;  3I5I B;  3CHD A;  4GBA A;  3BOW B;  1KQV A;  4FAP A;  2M8U A;  1AJ4 A;  2ZRS A;  3O5M A;  2MRD A;  2JWW A;  2LVJ A;  2PAS A;  4R1E A;  4TW7 A;  1BG1 A;  2FAP A;  1Q1C A;  2M1K B;  4R0X A;  2NZ0 A;  4DCK A;  1W1V A;  2XP8 A;  1OMV A;  2LAP A;  1MXE A;  3EY6 A;  1CFC A;  3SG3 A;  1DF0 A;  4TNC A;  3PAT A;  2PPN A;  4MLW A;  3AS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...