4MSPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp22 (aka fkbp14) containing two ef-hand motifs
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
publication title Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 52
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4mspA02
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4mspA01
1YVLA 1EYMA 4AQJA 2NCOA 5TNCA 2LPVA 2PSRA 2Q5AA 1FKDA 5KU1A 1F40A 2LKNA 1V1FA 4WRIA 4IPXA 3MSEB 4N5XA 4MBEA 1DT7B 1BMOA 1NYAA 1ZOTB 3NSLA 5IBWA 3KPXA 5HWBA 1EQ3A 3OP0A 1NP8A 1VRKA 1YRTB 2FJUB 5HKYA 2CTNA 4I5LB 5HYDA 1A75A 1DMOA 3OHMB 1Y6WA 1GGWA 2LC5A 3OB2B 2CCMA 1ZMZA 1A75B 3NSIA 4AQIA 3PA7A 3FAPA 1J6YA 3JVTB 2MNTA 4LAYA 4L9MA 5CSJA 3JTDB 2N87A 1PBKA 1XFZO 2KFWA 4G2PA 1SPYA 1JNTA 3KADA 1A29A 3TC5A 1D7JA 1S5GY 4M2QA 1YUSA 2LUCA 2Y78A 4ODPA 1DJXA 1OMVA 2LM5A 5BPJA 1FKIA 3A4UB 4OV2A 3BOWA 2JT3A 3TDIA 4F0ZB 3VRNA 3KF9A 5KTYA 3RLZA 1N0YA 1JSAA 1KT1A 1NWDA 1TCOB 1CMFA 4DIPA 1UP5A 1C9HA 3WHUB 2MF9A 3IHZA 2M2AA 4YGDB 2HF5A 3JVTC 3PALA 1K90D 1FKBA 3WH0A 5DKQA 4GGFC 1M63B 2MPHA 2RUDA 3PM8A 3JTDC 1OE9B 4I5JA 5DKNA 2I2RE 5KSZA 1SCVA 2H61C 4LAVA 3CGAA 2KFGA 2LCPA 1FKSA 2BBNA 2LJ4A 2M0RA 2VCDA 1D6OA 1JFKA 1BOCA 2FKEA 5I8NA 3PLFB 1CDMA 4JYSA 4FAPA 1QX7A 2ZQSA 1TCOC 2KGJA 3CTNA 3HCMA 1FD9A 3UQAA 2JZIA 2L4IA 1QXPA 1JNSA 1FKLA 4ODQA 1YX8A 3SG4A 2ZRTA 1JFJA 2KNEA 3O78A 1TNPA 1KFXL 1R6PA 1TOPA 1HQVA 2LAPA 4ODKA 1LKJA 1Y1XA 2SCPA 3DF0A 1R9HA 3EK8A 1XFXO 1CLMA 2F33A 2KBIA 2OS8B 2F4EA 5AANA 2PV2A 3UQIA 2PALA 2DOQA 5HLVA 3O5GA 1RJVA 3EKHA 1MUXA 4YGAA 1X02A 3DVEA 4A4CA 5AFPA 2BKHB 2WC8A 2RQSA 2PPOA 1DGVA 2ZQUA 2BECA 4PE1A 4WQ2A 4GAOA 3VROA 1JVWA 4MSPA 2DG3A 3NSKA 1G8IA 4LAWA 1L1PA 2KSPA 1WRZA 2K8IA 2OS8C 2RSEA 1M31A 2K0JA 2PPPA 4ODOA 1UUSA 4DRMA 2EHBA 3RM1A 1S6IA 3DVKA 1F70A 1L2OB 1F71A 1IQ5A 2LLUA 3FWCA 2XP8A 1B47A 3SIAA 4G50A 2LLTA 2XPAA 1KSMA 2LANA 5DKRA 4DZ2A 2L50A 3TCZA 3KAGA 2KHNA 2KGRA 4PCWA 2M1IA 2I18A 1LXFC 1IJ6A 3I5FB 2KO7A 3O5LA 5HT1A 2O5GA 4IQ2A 4ORAB 5J3XA 2ZQTA 1P5QA 2DG9A 4MLWA 1K94A 3VRQA 4CFQA 3O5JA 1AP4A 4MRXA 1TTXA 4M2OA 1L2OC 3CR4X 1NX1A 4N19A 1LA0A 1QIWA 1CMGA 1QPLA 1UHKA 1YVHA 3IF7A 2NXQA 5CSNA 1XFYO 2G2BA 4HRGA 5PALA 4BF8A 1BJFA 1H8BA 1KK7Y 1S3PA 2GV5A 2O60A 3UI5A 1CFPA 1KK8B 3KAHA 1UHHA 1AHRA 3E3RA 3I5FC 3ODKA 2L2EA 3ICBA 4DS7A 2HQWA 1CLLA 3PRDA 5CPVA 2FCEA 4JQ0D 1CB1A 1K95A 4HREE 1SRAA 2BCBA 1WRLA 2CBLA 3OX5A 1ODBA 1LVCD 1XFUO 4HRHA 4YBHB 4FN2A 2LGOA 2NLNA 2M7LA 2WCFA 2FCDA 2KAYA 3KCEA 1FKFA 1KFUS 1FKRA 1BT6A 2ZR5A 1BR4B 5GPGA 4C0LA 1XFVO 2L98A 5G08A 4DRNA 1K96A 1KK8C 1NX2A 3M0WA 2F21A 2MAZA 3C1VA 3ZNIA 3MDYB 2H2KA 5J6EA 1S6JA 3IQQA 2Y1NA 5D75A 2L4HA 3AKBA 2L0PA 1E8AA 1FPWA 2LLSA 3O5KA 2Q91A 4QJ5B 4P5OE 3DVJA 1ROTA 1UWOA 2CNPA 1RK9A 1XK4A 2L51A 2KFHA 2MLYA 1GQMA 1F55A 1OOJA 1SCMB 1BL4A 4NDCA 2XP9A 4AOMA 2ZNEA 1DJZA 2UZ5A 2MHHA 2MBXA 3BUMB 1H4BA 4GFTA 2KI4B 4DRQA 1KCYA 3SIBA 3GPKA 4XJKA 1CFCA 1YATA 3PN7B 2NZ0A 1QVIZ 2KQYA 5AEQA 1DJGA 4XJKB 3SG3A 1YRUB 1CFFA 2E6WA 1IQ3A 4NDBA 1YUUA 1SNLA 2KBMA 3TDZA 3O5IA 1AUIB 1S26D 1WY9A 1OSAA 2LP2A 1YUTA 5I2OA 4DRPA 3UI6A 2AUCA 5CSFA 3CGNA 1DJWA 1QLKA 3O5OA 2OTGB 1SCMC 3OX6A 4YRUA 2XP7A 2GGZA 1QX2A 2HPSA 2K7DA 3DVMA 1MWNA 2KI4C 3BOWB 1ZFSA 1TNWA 1J4RA 4R1EA 1EH2A 3EY6A 4R0XA 3KEVA 3LL8B 3PATA 3PN7C 2CXJA 1K9PA 2LVJA 4QJ3B 3SG5A 2LV7A 1B7TZ 1SL9A 3O5DA 1B6CA 2L2SA 3SG6A 1PSBA 4C0JA 1NSGA 5I2LA 4DIRA 1FKGA 1PALA 3SG2A 5ER4X 3JYJA 4MZJA 4U86A 4GPLB 4USLA 4FTGA 1DJHA 4MN0A 2OTGC 1K2HA 3CGMA 3GK4X 2LVKA 2KE0A 1CTRA 2BCXA 1UURA 1B4CA 1TN4A 1S5GZ 2V53A 1CDPA 4N1GA 1U5IA 2COLB 3O6BA 1LA3A 1DVIA 1BR1B 2JRFA 5HKZA 1CDLA 2JNXA 2GGMA 3IQOA 2ZNDA 1PVAA 2ZN9A 4MVFA 4CFRA 3DF0B 4QJ4B 1NMWA 4ORCB 1ZCNA 4TNCA 1BF5A 1Y1UA 1TNQA 3OB1B 2HQ8A 5ER5A 3EKJA 3H4SE 1K93D 1DF0A 1NSHA 4W9OA 3A8RA 3UF8A 4N1FA 2K8MB 2QACA 2F3ZA 5CSIA 1KWOB 4DH0A 4QT3A 3LCPC 1QJTA 4W9QA 4O2TA 1M39A 1RECA 1Q6UA 4GIVA 1SBJA 3GK1A 2JOJA 1TRFA 2K2FA 4MRYA 3KAIA 2KR7A 3FWBA 2AAOA 1WRKA 4PHJA 4A4BA 4TYOA 1UHJA 1FKHA 1WLMA 2EGDA 1D7HA 2E30A 4TX0A 2M49B 4M2PA 2M9GA 2WCEA 1D7IA 4CPVA 3D10A 2M3WA 1NX0A 2KQ6A 2KGBC 3CR5X 2MLZA 2JXLA 1KWOC 3NXAA 3PFVA 3GOFA 4ORBB 1IGVA 3O2PA 1XVJA 4PE0A 5AERA 1AVSA 1JBAA 2KI3A 3NSOA 1PK0D 1PRWA 2FOTA 2JU0A 2WORA 1CNPA 2VN1A 3IKDA 3BQ3A 3CLNA 4HSZA 1Q1CA 3K21A 3KHEA 4YI9A 1SL8A 1RFJA 4LAXA 1LINA 3CS1A 2PPNA 2AMIA 1FKJA 4QT2A 4DZ3A 1J7PA 2KOTA 2G9BA 4PE4A 1SYMA 5HLOA 2BE4A 4ICBA 1PSRA 2D9FA 3UQBA 1B8RA 2KYFA 1S6CA 2LE9B 1J7OA 1YW5A 3LUOA 5DIUA 2PBCA 3EK7A 4DRHA 3FS7A 1EXRA 3FIAA 5I2QA 2ITKA 1IKUA 1QX5B 2KFFA 3ZWHA 1MQ1A 3OOBA 1F8AB 4PDZA 4JFLA 3D0YA 5HW7A 3EVRA 2EC6B 2XPBA 2BE6A 1QTXA 2F2OA 2JTZA 1JC2A 4DRIA 4ETOA 1DTLA 3SJSA 1J7QA 2XP4A 4TNSA 2Y5IA 2LVIA 2ZR4A 4DRJA 3RFWA 4PHMA 5D69A 4DCKA 4YGEB 3B7XA 1HXVA 3IK8A 3QRXA 5K89A 1SW8A 2KDHA 1B9AA 3WNXB 1A03A 2JZVA 1A7XA 2TN4A 1SL7A 2ZKMX 3KACA 3F45A 1EJ3A 1R2UA 1TNXA 3LLEA 5HUAA 1Y0VH 3O4YA 4OVNF 2K2AA 4NDDA 3I5GB 1PULA 2R2IA 1KQMB 1CKKA 1ZK6A 5HKWA 1NIWA 2EC6C 2KAXA 5GQQC 1J7RA 1NCYA 4JWQA 3HX4A 1AJ4A 4E68A 1ALWA 1OZSA 1SMGA 3TS5B 3TDBA 1T11A 2MRDA 3O5PA 4D1EA 3KABA 1WDCB 1J55A 1IH0A 1C7WA 2RUCA 3KAFA 4TW8A 1QVIY 2HETA 2ZN8A 4JFKA 1S1EA 2JC2A 2LVVA 4U85A 1KFUL 3CZTX 2PRUA 3KZ7A 1M46A 3I5GC 1K9UA 4ODMA 2BCAA 1KQMC 5JJGA 1QIVA 1FF1A 3CWGA 1MR8A 1OZOA 2LMVA 1ZACA 4ODRA 2ISDA 3BUWB 3TS5C 2JT0A 2JPTA 2M1UA 2K7OA 2PMYA 4ITZA 4MGVA 1L7ZA 2KYCA 1WDCC 1XK4C 1OQPA 4W9PA 1OMDA 1SK6D 2MJWB 4OKHA 4NNRA 4DRWA 1B7TY 2F2PA 1QS7A 4Q04A 4IL1A 1B1GA 4QIBA 4TW7A 5HW8A 4GGFA 4CIDA 2A4JA 3BXKA 2B1UA 1K8UA 1HT9A 2H61A 2LUXA 4ZCVA 1FI5A 2K61A 3WXAA 1W26A 1V1GA 4GGQA 1BODA 1CM4A 1MHOA 2JT8A 1JF2A 1Y1AA 4BY4A 1NUBA 2JQ6A 4JPZB 1ZUZA 4JFIA 1W7IB 2LNKA 1Q6HA 1FW4A 4MZLA 3I6CA 1K9KA 3TUYB 3PRBA 2KI6D 4BY5A 5AXIA 2WNDA 1EG3A 2I94A 4OR9B 3JXVA 1KFXS 1MF8B 1BLQA 4ODLA 1JUOA 1Q6IA 4ZCUA 1BKFA 1QLSA 1U5IB 1GGZA 3BUOB 4CLNA 1YX7A 2PV1A 3VGOA 1FJDA 3BUXB 1IRJA 1OMRA 2PV3A 2ZRSA 4GUKA 4JFJA 1XFWO 1G33A 2F3YA 2MLXA 1N2DA 4J4NA 3O5MA 5HWCA 1F8HA 1A2XA 1CFDA 4IQCA 1RTP1 5I98A 1IJ5A 4DRKA 2RGIA 1J1EA 3TUYC 1IWQA 3NI6A 3I5IB 4MEWA 3AAJA 1QPFA 1PVBA 2JNFA 1C7VA 3UI4A 3O5FA 1SR6B 2ZR6A 2ZFDA 1DF0B 5D7FA 5DIVA 1XA5A 2Q4UA 1M45A 1WLZA 2LHIA 1S36A 4OCIA 1IG5A 2LP3A 4GNKB 2JTTA 1F54A 2Y1MA 1YURA 2JULA 2M08A 2I7AA 2K7CA 4WQ3A 5F6TA 2BBMA 3CR2A 2ZQVA 3VRPA 2IS9A 3GK2A 4DROA 2AWGA 4XYNA 1CLBA 1JWDA 1ROUA 1SY9A 3I5IC 2K7BA 2DG4A 2OFNA 1C07A 3I5HB 1D1OA 2IF4A 1DJYA 4PE7A 1SR6C 1CM1A 1TCFA 3EK4A 4TW6A 2M1KB 4I5KA 1J1DA 1W7JB 1UHIA 4GGNA 2KAVA 1N65A 2M29A 1DJIA 3VAWA 1AJ5A 4GBAA 1CDNA 1Y0OA 1NCXA 1B8LA 1QATA 3NRKA 2RUQA 4U84A 1XYDA 2WOSA 5BXJA 1ALVA 1QV0A 4ODNA 1QASA 2XP3A 1J4HA 1G4YR 2D8NA 1GJYA 1EL4A 2KI6C 4DUQA 3I5HC 3IKGA 4YGBB 3O5RA 5HKGA 1N1AA 1NMVA 4YI8A 3H9RB 3NTPA 3O5QA 2JXCA 3PSRA 4FQOA 4J4OA 1EG4A 3WHTB 1RWYA 1FAPA 1BU3A 2BL0B 1AK8A 1M5YA 1FBVA 1MXEA 1MXLC 4MZKA 1QZ2A 1KQVA 1F4OA 5JOLA 1TIZA 2NCPA 2OPOA 3DD4A 2XP6A 2BKIB 2MLFC 1NX3A 1YR5A 3TZ1A 3D0YB 3VRRA 1UHNA 1FI6A 4PHNA 2JWWA 2SASA 3EVUA 3AAKA 1JF0A 2P6BB 3EVVA 2FAPA 1PINA 2VRGA 3RGCA 3BYAA 2M7NA 3SG7A 5B8IB 4JFMA 4U8DA 2F2DA 4UPGA 4NQGA 1SKTA 1Q80A 4I5NB 2BL0C 4PALA 1BG1A 1YTZC 2LMUA 2Y4QA 3TDUA 2XP5A 1KK7Z 2LMTA 3LK1A 3JYMA 1DGUA 1U79A 1XO5A 1J4IA 1A4PA 2L5XB 2M97A 3LK0A 2CT9A 3BUNB 1B8CA 4YGCB 2LHLA 4DT4A 5HW6A 1KSOA 4C02B 2M8UA 1QV1A 5FYXA 2QPTA 1F4QA 1NPQA 2MLEC 5HTGA 1NCZA 2PASA 3O5EA 1FKTA 1KT0A 5B8IC 2PVBA 3AKAA 3KO0A 2RURA 1RROA 4PHKA 1FKKA 4C0KA 2MA2A 2WCBA 5DITA 2F8PA 4P2YB
chains in the Genus database with same CATH superfamily
4JKTA 1YVLA 3Q8IA 2LPVA 2Q5AA 5KU1A 2LKNA 3ARPA 3MSEB 1DT7B 3NSLA 4JD9A 3FY1A 1NP8A 1VRKA 1YRTB 2CTNA 4I5LB 1A75A 2A3BA 2LC5A 3OB2B 3PA7A 1XFZO 2KFWA 3KADA 3TC5A 2Y78A 4INXA 1FKIA 4F0ZB 3KF9A 5KTYA 3RLZA 1KT1A 1CMFA 4DIPA 1C9HA 4YGDB 2HF5A 5DKQA 2RUDA 2MPHA 1SCVA 3CGAA 1FKSA 2LJ4A 2B31A 1CDMA 5GPRA 2ZQSA 1FD9A 3UQAA 1JNSA 1YX8A 1JFJA 1TNPA 1KFXL 1HKMA 3UQIA 2PALA 4A4CA 5AFPA 2WC8A 2RQSA 4WQ2A 3CABA 5DEZA 1L1PA 1WRZA 2K8IA 4PTMA 2RSEA 1M31A 5I94A 2PPPA 4ODOA 2ERBA 1S6IA 3B9DA 2LLUA 3FWCA 2XPAA 1KSMA 5DKRA 4DZ2A 3DY9A 1LXFC 2KO7A 1NWRA 1SR0A 2DG9A 1NX1A 3OGNA 1T14A 1YVHA 3DYEA 4ZS6A 1UR9A 3KAHA 2QEBA 2HQWA 3PRDA 1WRLA 1LVCD 2LGOA 2WC6A 1GOIA 2M7LA 5GPGA 1ZBWA 1LS8A 1K96A 3C1VA 3SS4A 4Q22A 2Y1NA 2AOSA 1HJWA 2L0PA 3O5KA 4QJ5B 3DVJA 1XK4A 1GQMA 2XP9A 1SCMB 3WQVA 2ZNEA 1DJZA 2UZ5A 4DRQA 4XJKA 2A3AA 1QVIZ 1DJGA 1IQ3A 1SNLA 4DRPA 3O5OA 1OOIX 1SCMC 3OX6A 1J4RA 5DO2A 3EY6A 3SG5A 3LL8B 1B6CA 3SG6A 4C0JA 5I2LA 4DIRA 1FKGA 5ER4X 3JYJA 4GPLB 3WL1A 1ZB5A 3GK4X 2BCXA 3RM9A 2QEHA 1BR1B 2EULA 2JNXA 4CFRA 2ZN9A 1NMWA 1BF5A 1Y1UA 2HQ8A 3H4SE 1DF0A 4W9OA 4N1FA 2QACA 3LCPC 4O2TA 1LL4A 1IIOA 2JOJA 3KAIA 3FWBA 2E30A 3UO9A 2M3WA 2JPOA 2JXLA 4F7FA 3GOFA 1IGVA 1XVJA 4WKFA 2O9OA 2JU0A 2VN1A 4HSZA 3KHEA 2PPNA 4DZ3A 2G9BA 2D9FA 3BFHA 1B8RA 1W1VA 4DRHA 2PBCA 3FIAA 3ZWHA 1F8AB 5GQBA 4PDZA 4JFLA 2WLZA 2WLYA 4DRIA 2F2OA 2Y5IA 2ZR4A 4DRJA 1ZL1A 5D69A 2TN4A 1SL7A 1R2UA 4OVNF 2K2AA 3WL0A 1ZK6A 5FI7A 1NCYA 2YBTA 1IH0A 1C7WA 1QVIY 1OGGA 2ZN8A 1S1EA 3R1OA 1KFUL 3KZ7A 1ZACA 4ODRA 1ZBCA 4P8WA 2K60A 2PMYA 2K7OA 4QZVB 2MJWB 2F2PA 1X6LA 1K8UA 4ZCVA 3WXAA 4GGQA 2JQ6A 2LNKA 3I6CA 1K9KA 3TUYB 4ODLA 4OR9B 1EG3A 1KFXS 1MF8B 1Q6IA 1BKFA 1O6IA 1U5IB 1GGZA 4CLNA 1DC1A 1ZU8A 4HBOA 4IQCA 2RGIA 1J1EA 3TUYC 3PJIA 4MEWA 3AAJA 1QPFA 1PVBA 3UI4A 5D7FA 1S36A 1IG5A 4KQZA 1F54A 1SYTA 2M08A 4DROA 1JWDA 4DWSA 1SY9A 2DG4A 2K7BA 2IF4A 3RM8A 4PE7A 1TCFA 1JNDA 3B9EA 1UHIA 4GGNA 1N65A 1Y0OA 4MNMA 2RUQA 1XYDA 4DUQA 4YGBB 3O5RA 1N1AA 4YI8A 3PSRA 4FQOA 1EDQA 1AK8A 1M5YA 1MXEA 2BKIB 3PR9A 1OOGA 3VRRA 4Q7NA 3AAKA 2WCLA 5B8IB 4JFMA 4URIA 1SKTA 1Q80A 4PALA 5D3OA 2XP5A 2L5XB 2CT9A 4PT1A 1B8CA 5FI2A 1RD6A 2LHLA 5FYXA 2PASA 1KT0A 5B8IC 2PVBA 2MA2A 3L4LA 4IT4A 2WCJA 1EYMA 2NCOA 3NHTA 1FKDA 1V1FA 4WRIA 4N5XA 1ZOTB 1EQ3A 5IBWA 3OP0A 1DMOA 5HKYA 3FE9A 2BNXA 4W5UA 1A75B 1W1TA 3FAPA 3JVTB 4LAYA 3JTDB 1X6NA 1JNTA 1UR8A 1A29A 1S5GY 4M2QA 2LUCA 1HKIA 2LM5A 1JSAA 1N0YA 1JNEA 1TCOB 2DT0A 1UP5A 3JVTC 3PALA 1FKBA 3WH0A 3JTDC 5DKNA 4LAVA 2KFGA 2BBNA 2M0RA 2VCDA 2FKEA 3CHEA 3PLFB 1TCOC 2KGJA 2G41A 4INWA 1FKLA 2ZRTA 3O78A 1LL7A 1TOPA 3DF0A 1R9HA 5AANA 3O5GA 1NWSA 2QEVA 1DGVA 4MAVA 1JVWA 4HBEA 2DG3A 2YBUA 1G8IA 2K0JA 1UUSA 3DVKA 4MTVA 4G50A 2LLTA 4ZPTR 3KAGA 2KGRA 3I5FB 3OA5A 3VRQA 4CFQA 4M2OA 2KPHA 3B87A 3IF7A 2NXQA 4WKAA 4BF8A 1H8BA 2GV5A 2O60A 1OW4A 1UHHA 1AHRA 3I5FC 2L2EA 4DS7A 1CLLA 5CPVA 1CB1A 4HREE 3OX5A 1ODBA 1XFUO 4FN2A 2NLNA 3S0AA 2KAYA 3KCEA 3AQUA 1KFUS 1BT6A 2L98A 1OGBA 2F21A 2H2KA 5J6EA 5D75A 2L4HA 3AKBA 1E8AA 4P5OE 1RK9A 2KFHA 4AOMA 3BUMB 2KI4B 1E6NA 3PN7B 2NZ0A 2PN0A 5AEQA 2QEOA 4XJKB 3SG3A 4L3NA 2E6WA 1S26D 3W4RA 1QLKA 4NSBA 2L2CA 3DVMA 1QX2A 2KI4C 3BOWB 2QDIA 1TNWA 1EH2A 3KEVA 3PN7C 2LVJA 2LV7A 3O5DA 1WAWA 1E9LA 1NSGA 1NH6A 1E6RA 3ALFA 4MZJA 4U86A 1TUJA 4FTGA 2YGUA 2LVKA 1CTRA 1TN4A 2V53A 1CDPA 3R72A 2G8ZA 4MNLA 4MVFA 3IQOA 1P28A 2ZNDA 4WIWA 1NWUA 1ZCNA 4TNCA 4Z2GA 1TNQA 3EKJA 1SSEB 2O92A 4DH0A 1KWOB 2WM0A 1TFVA 4PHJA 3VB1A 1UHJA 1FKHA 1WLMA 2M49B 3RZSA 2M9GA 4P8VA 3D10A 2WC5A 2KGBC 1KWOC 4ORBB 3O2PA 5AERA 4ZPVR 2KI3A 3B86A 1PRWA 2FOTA 3NSOA 2WORA 3CLNA 3NGVA 4YI9A 1SL8A 1LINA 1OWQA 2AMIA 1FKJA 4Z2IA 5HLOA 1CTNA 5DIUA 3QOKA 2ITKA 3D0YA 3EVRA 2BE6A 2JTZA 3SJSA 4PHMA 3ARWA 4YGEB 1HXVA 3IK8A 1A7XA 3KACA 3ARXA 1EJ3A 5HUAA 1Y0VH 4NDDA 1HJXA 3I5GB 2ETNA 1KQMB 5HKWA 3HX4A 1AJ4A 4E68A 4P8UA 1T11A 2MRDA 4D1EA 1WDCB 2HETA 3K1EA 2JC2A 2LVVA 2PRUA 3PRAA 3I5GC 1K9UA 2BCAA 1KQMC 5JJGA 3ARRA 3CWGA 3L47A 3OBVA 2LMVA 2JT0A 1WDCC 1LL6A 1XRVA 1OQPA 1OMDA 1SK6D 1VF8A 4DRWA 4Q04A 4QIBA 5HW8A 4CIDA 2FJYA 2K61A 1V1GA 1MHOA 1NUBA 4JPZB 1ZUZA 1Q6HA 3PRBA 2KI6D 1XFRA 4FQTA 5AXIA 2WNDA 1ZBKA 4DWSD 3JXVA 1QWVA 3DZTA 2PV1A 4KR0B 3RM4A 3VGOA 1FJDA 2PV3A 4UDMA 1G33A 2F3YA 1E44A 5I98A 1LJYA 3NI6A 5DIVA 1XA5A 2Q4UA 2LHIA 4Z2HA 2K7CA 2BBMA 3CR2A 2IS9A 2AWGA 2P70A 1ROUA 2OFNA 3I5HB 2PQLA 3EK4A 4I5KA 2M29A 3VAWA 1C3YA 1LQ0A 2WOSA 1QV0A 2XP3A 4Z2LA 2KI6C 3AS1A 3I5HC 3IKGA 1NMVA 3H9RB 2DSWA 1FAPA 1FBVA 1MXLC 3SS3A 1F4OA 2XP6A 2NCPA 1FI6A 1YR5A 1UHNA 2SASA 2VRGA 3BFAA 4UPGA 4NQGA 3CDNA 1BG1A 1YTZC 1KK7Z 2IUZA 1DGUA 3JYMA 2OLHA 1A4PA 5DF0A 2QPTA 3QMEA 2MLEC 1NCZA 3O5EA 1FKTA 1TWOA 3KO0A 1FKKA 4C0KA 5DITA 4P2YB 4ODMA 3WD0A 5TNCA 2PSRA 1F40A 3R1PA 4MBEA 5HWBA 3KPXA 3S0GA 2FJUB 5HYDA 2P4VA 3OHMB 1GGWA 2CCMA 1J6YA 2A3CA 2N87A 1PBKA 4G2PA 1SPYA 1YUSA 4ODPA 1DJXA 5BPJA 3A4UB 4OV2A 3VRNA 1NWDA 1K90D 3O4XA 4GGFC 3PM8A 4I5JA 5KSZA 2H61C 1W1PA 2LCPA 3GTYX 5EL2A 5I8NA 4FAPA 1QX7A 3CTNA 2L4IA 1HQVA 2SCPA 3EK8A 2F4EA 1CLMA 2DOQA 3WD4A 1ITXA 1RJVA 1MUXA 3D73A 4YGAA 3RMEA 3DVEA 1TUZA 1WB0A 2PPOA 2BECA 2ZQUA 4GAOA 4MSPA 2KSPA 4DRMA 1F71A 3BFBA 2XP8A 1B47A 3CZ1A 2L50A 2KHNA 2M1IA 2I18A 3L4AA 1IJ6A 5HT1A 4ORAB 5J3XA 3S0FA 4MLWA 1K94A 3D75A 4MRXA 1TTXA 3CR4X 3D77A 1UHKA 5CSNA 2G2BA 4HRGA 5PALA 1BJFA 1KK7Y 1S3PA 3UI5A 1KFWA 3ODKA 3ICBA 2FCEA 1K95A 1SRAA 2BCBA 1IX5A 2CBLA 2H8VA 3V2LA 1FKRA 1NX2A 3M0WA 5HL1A 2MAZA 1S6JA 4DT4A 2LLSA 1UWOA 2CNPA 2L51A 2MLYA 1F55A 1OOJA 3WD3A 1WNOA 2MHHA 2MBXA 4GFTA 3SIBA 1CFCA 1YATA 2KQYA 1K9TA 1YRUB 1LG2A 4NDBA 1YUUA 3EG5B 1OSAA 5I2OA 1YUTA 1NWTA 3UI6A 5CSFA 3CGNA 1DJWA 2OTGB 2GGZA 2K7DA 1MWNA 3PATA 1B7TZ 1SL9A 3EIPA 2L2SA 1PSBA 3SG2A 4USLA 2OTGC 1K2HA 1UURA 1B4CA 1U5IA 2COLB 2JRFA 4QJ4B 2GGMA 1PVAA 4ORCB 1FFRA 3OB1B 5ER5A 1K93D 1NSHA 3UF8A 2F3ZA 1QJTA 1M39A 4GIVA 2PI6A 3GK1A 2K2FA 2KR7A 4TYOA 2GTEA 4TX0A 4CPVA 2KQ6A 2MLZA 1AVSA 2KLDA 1GUVA 1CNPA 3BQ3A 2QF8A 2BAPA 3UNWA 4S3JA 4XAKA 3D78A 1J7PA 4ICBA 1PSRA 2LE9B 1YW5A 3FS7A 1IKUA 2KFFA 1JC2A 4TNSA 2XP4A 3RFWA 3B7XA 4DCKA 3QRXA 5K89A 1SW8A 2KDHA 1B9AA 3WNXB 2JZVA 2RUCA 5GQQC 4JWQA 1ALWA 4NZCA 1H0GA 3O5PA 1J55A 4U85A 2KLEA 1QIVA 1MR8A 2B5UB 2ISDA 3BUWB 2JPTA 4ITZA 1L7ZA 2KYCA 1XK4C 4W9PA 4OKHA 2DT2A 3DXLA 4NNRA 1B7TY 1QS7A 4IL1A 4TW7A 2A4JA 3AS2A 1BODA 1CM4A 2ESCA 1JF2A 1EHNA 3N7HA 1FW4A 1E6ZA 3G6MA 3FE6A 1LG1A 1BLQA 3S0DA 1JUOA 1H0IA 1QLSA 3BUOB 1YX7A 2WCMA 3BUXB 1IRJA 2ZRSA 3PM2A 1XFWO 2MLXA 5HWCA 1N2DA 3O5MA 1F8HA 1A2XA 4WK9A 1IJ5A 1IWQA 1DF0B 1WLZA 2LP3A 2JTTA 2Y1MA 2I7AA 2ZQVA 3GK2A 4XYNA 3B6XA 4MNJA 1D1OA 1DJYA 1W7JB 2KAVA 1DJIA 3WQWA 1AJ5A 4GBAA 1ZBVA 3NRKA 4U84A 4AY1A 5BXJA 3B9AA 4ODNA 1QASA 1J4HA 1EL4A 4ZPWR 2JXCA 3G6LA 1EG4A 3WHTB 1RWYA 4OZDA 5JOLA 1TIZA 3DD4A 4IT6A 1NX3A 3TZ1A 3SS5A 2JWWA 3EVUA 2FAPA 2P6BB 1PINA 2M7NA 3SG7A 4U8DA 3FE8A 4I5NB 4MNKA 2LMTA 3CZ2A 3LK1A 3LK0A 5HW6A 4C02B 1QV1A 1F4QA 4PHKA 1GRJA 3SIAA 2F8PA 4AQJA 4IPXA 1BMOA 1NYAA 1Y6WA 3ARYA 1ZMZA 3NSIA 4AQIA 2MNTA 3BJHA 4L9MA 5CSJA 3ALGA 3S0BA 4S3KA 1D7JA 3D74A 1OMVA 5FI6A 1OOFA 2FDMA 3BOWA 2JT3A 3TDIA 3WHUB 2MF9A 3IHZA 1OOHA 3S0EA 2M2AA 1M63B 1OE9B 2I2RE 1W9UA 1D6OA 4HARA 1JFKA 1BOCA 4R5EA 4JYSA 3HCMA 2JZIA 4Z2JA 1QXPA 3B8SA 4ODQA 3SG4A 2KNEA 4ODKA 1R6PA 2LAPA 1GM0A 1LKJA 1Y1XA 3AS0A 1XFXO 2F33A 2KBIA 2OS8B 1ORGA 2PV2A 5HLVA 3EKHA 1X02A 2BKHB 4PE1A 4DWSB 3VROA 4KYNA 4LAWA 3NSKA 2OS8C 2EHBA 3RM1A 1F70A 1L2OB 1IQ5A 2LANA 3CZ0A 4DWSC 3TCZA 4PCWA 3O5LA 2O5GA 4IQ2A 2ZQTA 1P5QA 3O5JA 1AP4A 1L2OC 4N19A 1LA0A 3GU0A 1QIWA 3B7AA 1CMGA 1QPLA 1XFYO 3CHDA 1DELA 3CHFA 1CFPA 1KK8B 3ARSA 3E3RA 4JQ0D 3ARQA 2L5YA 3D76A 3WD1A 4P8XA 4HRHA 4YBHB 2WCFA 2FCDA 1FKFA 2ZR5A 1BR4B 3ARUA 4C0LA 1XFVO 5G08A 4DRNA 1KK8C 2A3EA 3ZNIA 3MDYB 3ARVA 3IQQA 2DPEA 1FPWA 2Q91A 1ROTA 1BL4A 4NDCA 2PYQA 1H4BA 1KCYA 5HBFA 3GPKA 1D2KA 2WCHA 1CFFA 3O5IA 2KBMA 3TDZA 1XHGA 1AUIB 1WY9A 2LP2A 2AUCA 3AS3A 2XP7A 4YRUA 2HPSA 1ZFSA 4R1EA 4R0XA 4QJ3B 2CXJA 1K9PA 1W9VA 3BXWA 1PALA 1DJHA 4MN0A 3CGMA 2KE0A 2WK2A 5JH8A 1S5GZ 4N1GA 3O6BA 1LA3A 3CZ8A 1W9PA 1DVIA 5HKZA 1CDLA 3DF0B 3WIJA 3A8RA 1Z2CB 2K8MB 5CSIA 4QT3A 4W9QA 1E15A 1RECA 3CYZA 1Q6UA 1SBJA 3AROA 1TRFA 4MRYA 1W1YA 2AAOA 1WRKA 4A4BA 2EGDA 1D7HA 5DICA 4M2PA 2WCEA 1D7IA 1EIBA 1NX0A 3WD2A 3CR5X 3PFVA 3NXAA 4PE0A 1JBAA 1PK0D 1HKKA 3IKDA 1Q1CA 3K21A 4LAXA 3WKZA 1RFJA 3CS1A 4QT2A 2KOTA 4PE4A 1SYMA 2BE4A 3UQBA 1GPFA 2KYFA 1S6CA 1J7OA 3LUOA 3EK7A 1EXRA 5I2QA 1QX5B 3NHIA 1MQ1A 3OOBA 4WJXA 5HW7A 2XPBA 2EC6B 1HKJA 1DQEA 1QTXA 1J7QA 1DTLA 2LVIA 1A03A 2ZKMX 3F45A 1TNXA 1Z4HA 3LLEA 3O4YA 3CH9A 1PULA 4Z2KA 2R2IA 1CKKA 1NIWA 2EC6C 2KAXA 1J7RA 2F23A 3ARZA 1OZSA 1SMGA 3TS5B 2P71A 1W9ZA 3TDBA 3IVTA 3KABA 4TW8A 3KAFA 1E6PA 4IJ7A 3B88A 4JFKA 3CZTX 1M46A 1FF1A 1OZOA 3TS5C 2M1UA 4MGVA 1B1GA 4GGFA 3BXKA 2B1UA 1HT9A 2H61A 2LUXA 1FI5A 2DSVA 1W26A 2JT8A 1Y1AA 4BY4A 3CHCA 4JFIA 1W7IB 4MZLA 4BY5A 2I94A 4ZCUA 2DT1A 1OMRA 4GUKA 4JFJA 4J4NA 1CFDA 1RTP1 2DSUA 4DRKA 3R1VA 3I5IB 2JNFA 1C7VA 3O5FA 1SR6B 2ZR6A 2ZFDA 1M45A 4OCIA 3FXYA 4GNKB 1C3ZA 1YURA 2JULA 4WQ3A 5F6TA 4MPKA 3VRPA 1CLBA 1DEKA 3I5IC 3ARTA 1C07A 4TW6A 1SR6C 1CM1A 2M1KB 1J1DA 4L72B 1CDNA 1NCXA 1B8LA 1QATA 1ALVA 1FFQA 1G4YR 2D8NA 1GJYA 5HKGA 1JCHB 3O5QA 3NTPA 4WKHA 4J4OA 1BU3A 2BL0B 4MZKA 1QZ2A 1KQVA 2OPOA 2MLFC 4ML4A 3D0YB 4LGXA 4PHNA 1JF0A 3EVVA 2WCKA 2DSZA 3RGCA 3BYAA 2F2DA 2DT3A 2BL0C 2LMUA 2Y4QA 3TDUA 1U79A 1XO5A 1J4IA 2M97A 4YGCB 3BUNB 3BMBA 1HJVA 1KSOA 2M8UA 1NPQA 5HTGA 3AKAA 2RURA 1RROA 4ETOA 2WCBA
chains in the Genus database with same CATH topology
1YVLA 2LPVA 2Q5AA 5KU1A 2LKNA 3ARPA 3MSEB 1DT7B 3NSLA 3FY1A 1NP8A 1VRKA 1YRTB 2CTNA 4I5LB 1A75A 2A3BA 2LC5A 3OB2B 3PA7A 1XFZO 2KFWA 3KADA 3TC5A 2Y78A 1FKIA 4F0ZB 3KF9A 5KTYA 3RLZA 1KT1A 1CMFA 4DIPA 1C9HA 4YGDB 2HF5A 5DKQA 2RUDA 2MPHA 1SCVA 3CGAA 1FKSA 2LJ4A 2B31A 1CDMA 5GPRA 2ZQSA 1FD9A 3UQAA 1JNSA 1YX8A 1JFJA 1TNPA 1KFXL 1HKMA 3UQIA 2PALA 4A4CA 5AFPA 2WC8A 2RQSA 4WQ2A 5DEZA 1L1PA 1WRZA 2K8IA 4PTMA 2RSEA 1M31A 2PPPA 4ODOA 1S6IA 3B9DA 2LLUA 3FWCA 2XPAA 1KSMA 5DKRA 4DZ2A 1LXFC 2KO7A 1NWRA 1SR0A 2DG9A 1NX1A 1YVHA 4ZS6A 1UR9A 3KAHA 2HQWA 3PRDA 1WRLA 1LVCD 2LGOA 1GOIA 2M7LA 5GPGA 1ZBWA 1K96A 3C1VA 4Q22A 2Y1NA 2AOSA 1HJWA 2L0PA 3O5KA 4QJ5B 3DVJA 1XK4A 1GQMA 2XP9A 1SCMB 3WQVA 2ZNEA 1DJZA 2UZ5A 4DRQA 4XJKA 2A3AA 1QVIZ 1DJGA 1IQ3A 1SNLA 4DRPA 3O5OA 1SCMC 3OX6A 1J4RA 5DO2A 3EY6A 3SG5A 3LL8B 1B6CA 3SG6A 4C0JA 5I2LA 4DIRA 1FKGA 5ER4X 3JYJA 4GPLB 3WL1A 1ZB5A 3GK4X 2BCXA 3RM9A 1BR1B 2JNXA 4CFRA 2ZN9A 1NMWA 1BF5A 1Y1UA 2HQ8A 3H4SE 1DF0A 4W9OA 4N1FA 2QACA 3LCPC 4O2TA 1LL4A 2JOJA 3KAIA 3FWBA 2E30A 2M3WA 2JXLA 3GOFA 1IGVA 1XVJA 4WKFA 2O9OA 2JU0A 2VN1A 4HSZA 3KHEA 2PPNA 4DZ3A 2G9BA 2D9FA 1B8RA 1W1VA 4DRHA 2PBCA 3FIAA 3ZWHA 1F8AB 5GQBA 4PDZA 4JFLA 2WLZA 2WLYA 4DRIA 2F2OA 2Y5IA 2ZR4A 4DRJA 1ZL1A 5D69A 2TN4A 1SL7A 1R2UA 4OVNF 2K2AA 3WL0A 1ZK6A 1NCYA 2YBTA 1IH0A 1C7WA 1QVIY 1OGGA 2ZN8A 1S1EA 1KFUL 3KZ7A 1ZACA 4ODRA 1ZBCA 4P8WA 2PMYA 2K7OA 4QZVB 2MJWB 2F2PA 1X6LA 1K8UA 4ZCVA 3WXAA 4GGQA 2JQ6A 2LNKA 3I6CA 1K9KA 3TUYB 4ODLA 4OR9B 1EG3A 1KFXS 1MF8B 1Q6IA 1BKFA 1O6IA 1U5IB 1GGZA 4CLNA 1ZU8A 4HBOA 4IQCA 2RGIA 1J1EA 3TUYC 4MEWA 3AAJA 1QPFA 1PVBA 3UI4A 5D7FA 1S36A 1IG5A 4KQZA 1F54A 1SYTA 2M08A 4DROA 1JWDA 4DWSA 1SY9A 2DG4A 2K7BA 2IF4A 3RM8A 4PE7A 1TCFA 1JNDA 3B9EA 1UHIA 4GGNA 1N65A 1Y0OA 4MNMA 2RUQA 1XYDA 4DUQA 4YGBB 3O5RA 1N1AA 4YI8A 3PSRA 4FQOA 1EDQA 1AK8A 1M5YA 1MXEA 2BKIB 3PR9A 3VRRA 4Q7NA 3AAKA 5B8IB 4JFMA 4URIA 1SKTA 1Q80A 4PALA 2XP5A 2L5XB 2CT9A 1B8CA 1RD6A 2LHLA 5FYXA 2PASA 1KT0A 5B8IC 2PVBA 2MA2A 4IT4A 1EYMA 2NCOA 1FKDA 1V1FA 4WRIA 4N5XA 1ZOTB 1EQ3A 5IBWA 3OP0A 1DMOA 5HKYA 4W5UA 1A75B 1W1TA 3FAPA 3JVTB 4LAYA 3JTDB 1X6NA 1JNTA 1UR8A 1A29A 1S5GY 4M2QA 2LUCA 1HKIA 2LM5A 1JSAA 1N0YA 1JNEA 1TCOB 2DT0A 1UP5A 3JVTC 3PALA 1FKBA 3WH0A 3JTDC 5DKNA 4LAVA 2KFGA 2BBNA 2M0RA 2VCDA 2FKEA 3CHEA 3PLFB 1TCOC 2KGJA 2G41A 1FKLA 2ZRTA 3O78A 1LL7A 1TOPA 3DF0A 1R9HA 5AANA 3O5GA 1NWSA 1DGVA 4MAVA 1JVWA 4HBEA 2DG3A 2YBUA 1G8IA 2K0JA 1UUSA 3DVKA 4MTVA 4G50A 2LLTA 4ZPTR 3KAGA 2KGRA 3I5FB 3OA5A 3VRQA 4CFQA 4M2OA 3IF7A 2NXQA 4WKAA 4BF8A 1H8BA 2GV5A 2O60A 1UHHA 1AHRA 3I5FC 2L2EA 4DS7A 1CLLA 5CPVA 1CB1A 4HREE 3OX5A 1ODBA 1XFUO 4FN2A 2NLNA 2KAYA 3KCEA 3AQUA 1KFUS 1BT6A 2L98A 1OGBA 2F21A 2H2KA 5J6EA 5D75A 2L4HA 3AKBA 1E8AA 4P5OE 1RK9A 2KFHA 4AOMA 3BUMB 2KI4B 1E6NA 3PN7B 2NZ0A 5AEQA 4XJKB 3SG3A 4L3NA 2E6WA 1S26D 3W4RA 1QLKA 4NSBA 3DVMA 1QX2A 2KI4C 3BOWB 1TNWA 1EH2A 3KEVA 3PN7C 2LVJA 2LV7A 3O5DA 1WAWA 1E9LA 1NSGA 1NH6A 1E6RA 3ALFA 4MZJA 4U86A 4FTGA 2LVKA 1CTRA 1TN4A 2V53A 1CDPA 2G8ZA 4MNLA 4MVFA 3IQOA 2ZNDA 4WIWA 1NWUA 1ZCNA 4TNCA 4Z2GA 1TNQA 3EKJA 2O92A 4DH0A 1KWOB 2WM0A 1TFVA 4PHJA 1UHJA 1FKHA 1WLMA 2M49B 2M9GA 4P8VA 3D10A 2KGBC 1KWOC 4ORBB 3O2PA 5AERA 4ZPVR 2KI3A 3NSOA 1PRWA 2FOTA 2WORA 3CLNA 4YI9A 1SL8A 1LINA 1OWQA 2AMIA 1FKJA 4Z2IA 5HLOA 1CTNA 5DIUA 3QOKA 2ITKA 3D0YA 3EVRA 2BE6A 2JTZA 3SJSA 4PHMA 3ARWA 4YGEB 1HXVA 3IK8A 1A7XA 3KACA 3ARXA 1EJ3A 5HUAA 1Y0VH 4NDDA 1HJXA 3I5GB 1KQMB 5HKWA 3HX4A 1AJ4A 4E68A 4P8UA 1T11A 2MRDA 4D1EA 1WDCB 2HETA 2JC2A 2LVVA 2PRUA 3PRAA 3I5GC 1K9UA 2BCAA 1KQMC 5JJGA 3ARRA 3CWGA 2LMVA 2JT0A 1WDCC 1LL6A 1XRVA 1OQPA 1OMDA 1SK6D 1VF8A 4DRWA 4Q04A 4QIBA 5HW8A 4CIDA 2K61A 1V1GA 1MHOA 1NUBA 4JPZB 1ZUZA 1Q6HA 3PRBA 2KI6D 5AXIA 2WNDA 1ZBKA 4DWSD 3JXVA 2PV1A 4KR0B 3RM4A 3VGOA 1FJDA 2PV3A 1G33A 2F3YA 5I98A 1LJYA 3NI6A 5DIVA 1XA5A 2Q4UA 2LHIA 4Z2HA 2K7CA 2BBMA 3CR2A 2IS9A 2AWGA 1ROUA 2OFNA 3I5HB 3EK4A 4I5KA 2M29A 3VAWA 1LQ0A 2WOSA 1QV0A 2XP3A 4Z2LA 2KI6C 3AS1A 3I5HC 3IKGA 1NMVA 3H9RB 2DSWA 1FAPA 1FBVA 1MXLC 1F4OA 2XP6A 2NCPA 1FI6A 1YR5A 1UHNA 2SASA 2VRGA 4UPGA 4NQGA 1BG1A 1YTZC 1KK7Z 2IUZA 1DGUA 3JYMA 2OLHA 1A4PA 5DF0A 2QPTA 2MLEC 1NCZA 3O5EA 1FKTA 3KO0A 1FKKA 4C0KA 5DITA 4ODMA 4P2YB 3WD0A 5TNCA 2PSRA 1F40A 4MBEA 5HWBA 3KPXA 2FJUB 5HYDA 3OHMB 1GGWA 2CCMA 1J6YA 2A3CA 2N87A 1PBKA 4G2PA 1SPYA 1YUSA 4ODPA 1DJXA 5BPJA 3A4UB 4OV2A 3VRNA 1NWDA 1K90D 4GGFC 3PM8A 4I5JA 5KSZA 2H61C 1W1PA 2LCPA 5I8NA 4FAPA 1QX7A 3CTNA 2L4IA 1HQVA 2SCPA 3EK8A 2F4EA 1CLMA 2DOQA 3WD4A 1ITXA 1RJVA 1MUXA 4YGAA 3RMEA 3DVEA 2PPOA 1WB0A 2ZQUA 2BECA 4GAOA 4MSPA 2KSPA 4DRMA 1F71A 2XP8A 1B47A 2L50A 2KHNA 2M1IA 2I18A 1IJ6A 5HT1A 4ORAB 5J3XA 4MLWA 1K94A 4MRXA 1TTXA 3CR4X 1UHKA 5CSNA 2G2BA 4HRGA 5PALA 1BJFA 1KK7Y 1S3PA 3UI5A 1KFWA 3ODKA 3ICBA 2FCEA 1K95A 1SRAA 2BCBA 1IX5A 2CBLA 1FKRA 1NX2A 3M0WA 2MAZA 1S6JA 4DT4A 2LLSA 1UWOA 2CNPA 2L51A 2MLYA 1F55A 1OOJA 3WD3A 1WNOA 2MHHA 2MBXA 4GFTA 3SIBA 1CFCA 1YATA 2KQYA 1K9TA 1YRUB 1LG2A 4NDBA 1YUUA 1OSAA 5I2OA 1YUTA 1NWTA 3UI6A 5CSFA 3CGNA 1DJWA 2OTGB 2GGZA 2K7DA 1MWNA 3PATA 1B7TZ 1SL9A 2L2SA 1PSBA 3SG2A 4USLA 2OTGC 1K2HA 1UURA 1B4CA 1U5IA 2COLB 2JRFA 4QJ4B 2GGMA 1PVAA 4ORCB 1FFRA 3OB1B 5ER5A 1K93D 1NSHA 3UF8A 2F3ZA 1QJTA 1M39A 4GIVA 2PI6A 3GK1A 2K2FA 2KR7A 4TYOA 4TX0A 4CPVA 2KQ6A 2MLZA 1AVSA 1GUVA 1CNPA 3BQ3A 2QF8A 4S3JA 4XAKA 1J7PA 4ICBA 1PSRA 2LE9B 1YW5A 3FS7A 1IKUA 2KFFA 1JC2A 4TNSA 2XP4A 3RFWA 3B7XA 4DCKA 3QRXA 5K89A 1SW8A 2KDHA 1B9AA 3WNXB 2JZVA 2RUCA 5GQQC 4JWQA 1ALWA 4NZCA 1H0GA 3O5PA 1J55A 4U85A 1QIVA 1MR8A 2ISDA 3BUWB 2JPTA 4ITZA 1L7ZA 2KYCA 1XK4C 4W9PA 4OKHA 2DT2A 4NNRA 1B7TY 1QS7A 4IL1A 4TW7A 2A4JA 3AS2A 1BODA 1CM4A 2ESCA 1JF2A 1EHNA 1FW4A 1E6ZA 3G6MA 1LG1A 1BLQA 1JUOA 1H0IA 1QLSA 3BUOB 1YX7A 3BUXB 1IRJA 2ZRSA 1XFWO 2MLXA 5HWCA 1N2DA 3O5MA 1F8HA 1A2XA 4WK9A 1IJ5A 1IWQA 1DF0B 1WLZA 2LP3A 2JTTA 2Y1MA 2I7AA 2ZQVA 3GK2A 4XYNA 4MNJA 1D1OA 1DJYA 1W7JB 2KAVA 1DJIA 3WQWA 1AJ5A 4GBAA 1ZBVA 3NRKA 4U84A 4AY1A 5BXJA 3B9AA 4ODNA 1QASA 1J4HA 1EL4A 4ZPWR 2JXCA 3G6LA 1EG4A 3WHTB 1RWYA 5JOLA 1TIZA 3DD4A 4IT6A 1NX3A 3TZ1A 2JWWA 3EVUA 2FAPA 2P6BB 1PINA 2M7NA 3SG7A 4U8DA 4I5NB 4MNKA 2LMTA 3LK1A 3LK0A 5HW6A 4C02B 1QV1A 1F4QA 4PHKA 3SIAA 2F8PA 4AQJA 4IPXA 1BMOA 1NYAA 1Y6WA 3ARYA 1ZMZA 3NSIA 4AQIA 2MNTA 4L9MA 5CSJA 3ALGA 4S3KA 1D7JA 1OMVA 2FDMA 3BOWA 2JT3A 3TDIA 3WHUB 2MF9A 3IHZA 2M2AA 1M63B 1OE9B 2I2RE 1W9UA 1D6OA 4HARA 1JFKA 1BOCA 4R5EA 4JYSA 3HCMA 2JZIA 4Z2JA 1QXPA 3B8SA 4ODQA 3SG4A 2KNEA 4ODKA 1R6PA 2LAPA 1LKJA 1Y1XA 3AS0A 1XFXO 2F33A 2KBIA 2OS8B 2PV2A 5HLVA 3EKHA 1X02A 2BKHB 4PE1A 4DWSB 3VROA 4LAWA 3NSKA 2OS8C 2EHBA 3RM1A 1F70A 1L2OB 1IQ5A 2LANA 4DWSC 3TCZA 4PCWA 3O5LA 2O5GA 4IQ2A 2ZQTA 1P5QA 3O5JA 1AP4A 1L2OC 4N19A 1LA0A 1QIWA 1CMGA 1QPLA 1XFYO 3CHDA 3CHFA 1CFPA 1KK8B 3ARSA 3E3RA 4JQ0D 3ARQA 3WD1A 4P8XA 4HRHA 4YBHB 2WCFA 2FCDA 1FKFA 2ZR5A 1BR4B 3ARUA 4C0LA 1XFVO 5G08A 4DRNA 1KK8C 2A3EA 3ZNIA 3MDYB 3ARVA 3IQQA 2DPEA 1FPWA 2Q91A 1ROTA 1BL4A 4NDCA 1H4BA 1KCYA 5HBFA 3GPKA 1D2KA 1CFFA 3O5IA 2KBMA 3TDZA 1XHGA 1AUIB 1WY9A 2LP2A 2AUCA 3AS3A 2XP7A 4YRUA 2HPSA 1ZFSA 4R1EA 4R0XA 4QJ3B 2CXJA 1K9PA 1W9VA 3BXWA 1PALA 1DJHA 4MN0A 3CGMA 2KE0A 2WK2A 5JH8A 1S5GZ 4N1GA 3O6BA 1LA3A 3CZ8A 1W9PA 1DVIA 5HKZA 1CDLA 3DF0B 3WIJA 3A8RA 2K8MB 5CSIA 4QT3A 4W9QA 1E15A 1RECA 1Q6UA 1SBJA 3AROA 1TRFA 4MRYA 1W1YA 2AAOA 1WRKA 4A4BA 2EGDA 1D7HA 4M2PA 2WCEA 1D7IA 1EIBA 1NX0A 3WD2A 3CR5X 3PFVA 3NXAA 4PE0A 1JBAA 1PK0D 1HKKA 3IKDA 1Q1CA 3K21A 4LAXA 3WKZA 1RFJA 3CS1A 4QT2A 2KOTA 4PE4A 1SYMA 2BE4A 3UQBA 1GPFA 2KYFA 1S6CA 1J7OA 3LUOA 3EK7A 1EXRA 5I2QA 1QX5B 1MQ1A 3OOBA 4WJXA 5HW7A 2XPBA 2EC6B 1HKJA 1QTXA 1J7QA 1DTLA 2LVIA 1A03A 2ZKMX 3F45A 1TNXA 3LLEA 3O4YA 3CH9A 1PULA 4Z2KA 2R2IA 1CKKA 1NIWA 2EC6C 2KAXA 1J7RA 3ARZA 1OZSA 1SMGA 3TS5B 3TDBA 3KABA 4TW8A 3KAFA 1E6PA 4JFKA 3CZTX 1M46A 1FF1A 1OZOA 3TS5C 2M1UA 4MGVA 1B1GA 4GGFA 3BXKA 2B1UA 1HT9A 2H61A 2LUXA 1FI5A 2DSVA 1W26A 2JT8A 1Y1AA 4BY4A 3CHCA 4JFIA 1W7IB 4MZLA 4BY5A 2I94A 4ZCUA 2DT1A 1OMRA 4GUKA 4JFJA 4J4NA 1CFDA 1RTP1 2DSUA 4DRKA 3I5IB 2JNFA 1C7VA 3O5FA 1SR6B 2ZR6A 2ZFDA 1M45A 4OCIA 3FXYA 4GNKB 1YURA 2JULA 4WQ3A 5F6TA 4MPKA 3VRPA 1CLBA 3I5IC 3ARTA 1C07A 4TW6A 1SR6C 1CM1A 2M1KB 1J1DA 4L72B 1CDNA 1NCXA 1B8LA 1QATA 1ALVA 1FFQA 1G4YR 2D8NA 1GJYA 5HKGA 3O5QA 3NTPA 4WKHA 4J4OA 1BU3A 2BL0B 4MZKA 1QZ2A 1KQVA 2OPOA 4ML4A 2MLFC 3D0YB 4LGXA 4PHNA 1JF0A 3EVVA 2DSZA 3RGCA 3BYAA 2F2DA 2DT3A 2BL0C 2LMUA 2Y4QA 3TDUA 1U79A 1XO5A 1J4IA 2M97A 4YGCB 3BUNB 1HJVA 1KSOA 2M8UA 1NPQA 5HTGA 3AKAA 2RURA 1RROA 4ETOA 2WCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVL A;  1EYM A;  4AQJ A;  2NCO A;  5TNC A;  2LPV A;  2PSR A;  2Q5A A;  1FKD A;  5KU1 A;  1F40 A;  2LKN A;  1V1F A;  4WRI A;  4IPX A;  3MSE B;  4N5X A;  4MBE A;  1DT7 B;  1BMO A;  1NYA A;  1ZOT B;  3NSL A;  5IBW A;  3KPX A;  5HWB A;  1EQ3 A;  3OP0 A;  1NP8 A;  1VRK A;  1YRT B;  2FJU B;  5HKY A;  2CTN A;  4I5L B;  5HYD A;  1A75 A;  1DMO A;  3OHM B;  1Y6W A;  1GGW A;  2LC5 A;  3OB2 B;  2CCM A;  1ZMZ A;  1A75 B;  3NSI A;  4AQI A;  3PA7 A;  3FAP A;  1J6Y A;  3JVT B;  2MNT A;  4LAY A;  4L9M A;  5CSJ A;  3JTD B;  2N87 A;  1PBK A;  1XFZ O;  2KFW A;  4G2P A;  1SPY A;  1JNT A;  3KAD A;  1A29 A;  3TC5 A;  1D7J A;  1S5G Y;  4M2Q A;  1YUS A;  2LUC A;  2Y78 A;  4ODP A;  1DJX A;  1OMV A;  2LM5 A;  5BPJ A;  1FKI A;  3A4U B;  4OV2 A;  3BOW A;  2JT3 A;  3TDI A;  4F0Z B;  3VRN A;  3KF9 A;  5KTY A;  3RLZ A;  1N0Y A;  1JSA A;  1KT1 A;  1NWD A;  1TCO B;  1CMF A;  4DIP A;  1UP5 A;  1C9H A;  3WHU B;  2MF9 A;  3IHZ A;  2M2A A;  4YGD B;  2HF5 A;  3JVT C;  3PAL A;  1K90 D;  1FKB A;  3WH0 A;  5DKQ A;  4GGF C;  1M63 B;  2MPH A;  2RUD A;  3PM8 A;  3JTD C;  1OE9 B;  4I5J A;  5DKN A;  2I2R E;  5KSZ A;  1SCV A;  2H61 C;  4LAV A;  3CGA A;  2KFG A;  2LCP A;  1FKS A;  2BBN A;  2LJ4 A;  2M0R A;  2VCD A;  1D6O A;  1JFK A;  1BOC A;  2FKE A;  5I8N A;  3PLF B;  1CDM A;  4JYS A;  4FAP A;  1QX7 A;  2ZQS A;  1TCO C;  2KGJ A;  3CTN A;  3HCM A;  1FD9 A;  3UQA A;  2JZI A;  2L4I A;  1QXP A;  1JNS A;  1FKL A;  4ODQ A;  1YX8 A;  3SG4 A;  2ZRT A;  1JFJ A;  2KNE A;  3O78 A;  1TNP A;  1KFX L;  1R6P A;  1TOP A;  1HQV A;  2LAP A;  4ODK A;  1LKJ A;  1Y1X A;  2SCP A;  3DF0 A;  1R9H A;  3EK8 A;  1XFX O;  1CLM A;  2F33 A;  2KBI A;  2OS8 B;  2F4E A;  5AAN A;  2PV2 A;  3UQI A;  2PAL A;  2DOQ A;  5HLV A;  3O5G A;  1RJV A;  3EKH A;  1MUX A;  4YGA A;  1X02 A;  3DVE A;  4A4C A;  5AFP A;  2BKH B;  2WC8 A;  2RQS A;  2PPO A;  1DGV A;  2ZQU A;  2BEC A;  4PE1 A;  4WQ2 A;  4GAO A;  3VRO A;  1JVW A;  4MSP A;  2DG3 A;  3NSK A;  1G8I A;  4LAW A;  1L1P A;  2KSP A;  1WRZ A;  2K8I A;  2OS8 C;  2RSE A;  1M31 A;  2K0J A;  2PPP A;  4ODO A;  1UUS A;  4DRM A;  2EHB A;  3RM1 A;  1S6I A;  3DVK A;  1F70 A;  1L2O B;  1F71 A;  1IQ5 A;  2LLU A;  3FWC A;  2XP8 A;  1B47 A;  3SIA A;  4G50 A;  2LLT A;  2XPA A;  1KSM A;  2LAN A;  5DKR A;  4DZ2 A;  2L50 A;  3TCZ A;  3KAG A;  2KHN A;  2KGR A;  4PCW A;  2M1I A;  2I18 A;  1LXF C;  1IJ6 A;  3I5F B;  2KO7 A;  3O5L A;  5HT1 A;  2O5G A;  4IQ2 A;  4ORA B;  5J3X A;  2ZQT A;  1P5Q A;  2DG9 A;  4MLW A;  1K94 A;  3VRQ A;  4CFQ A;  3O5J A;  1AP4 A;  4MRX A;  1TTX A;  4M2O A;  1L2O C;  3CR4 X;  1NX1 A;  4N19 A;  1LA0 A;  1QIW A;  1CMG A;  1QPL A;  1UHK A;  1YVH A;  3IF7 A;  2NXQ A;  5CSN A;  1XFY O;  2G2B A;  4HRG A;  5PAL A;  4BF8 A;  1BJF A;  1H8B A;  1KK7 Y;  1S3P A;  2GV5 A;  2O60 A;  3UI5 A;  1CFP A;  1KK8 B;  3KAH A;  1UHH A;  1AHR A;  3E3R A;  3I5F C;  3ODK A;  2L2E A;  3ICB A;  4DS7 A;  2HQW A;  1CLL A;  3PRD A;  5CPV A;  2FCE A;  4JQ0 D;  1CB1 A;  1K95 A;  4HRE E;  1SRA A;  2BCB A;  1WRL A;  2CBL A;  3OX5 A;  1ODB A;  1LVC D;  1XFU O;  4HRH A;  4YBH B;  4FN2 A;  2LGO A;  2NLN A;  2M7L A;  2WCF A;  2FCD A;  2KAY A;  3KCE A;  1FKF A;  1KFU S;  1FKR A;  1BT6 A;  2ZR5 A;  1BR4 B;  5GPG A;  4C0L A;  1XFV O;  2L98 A;  5G08 A;  4DRN A;  1K96 A;  1KK8 C;  1NX2 A;  3M0W A;  2F21 A;  2MAZ A;  3C1V A;  3ZNI A;  3MDY B;  2H2K A;  5J6E A;  1S6J A;  3IQQ A;  2Y1N A;  5D75 A;  2L4H A;  3AKB A;  2L0P A;  1E8A A;  1FPW A;  2LLS A;  3O5K A;  2Q91 A;  4QJ5 B;  4P5O E;  3DVJ A;  1ROT A;  1UWO A;  2CNP A;  1RK9 A;  1XK4 A;  2L51 A;  2KFH A;  2MLY A;  1GQM A;  1F55 A;  1OOJ A;  1SCM B;  1BL4 A;  4NDC A;  2XP9 A;  4AOM A;  2ZNE A;  1DJZ A;  2UZ5 A;  2MHH A;  2MBX A;  3BUM B;  1H4B A;  4GFT A;  2KI4 B;  4DRQ A;  1KCY A;  3SIB A;  3GPK A;  4XJK A;  1CFC A;  1YAT A;  3PN7 B;  2NZ0 A;  1QVI Z;  2KQY A;  5AEQ A;  1DJG A;  4XJK B;  3SG3 A;  1YRU B;  1CFF A;  2E6W A;  1IQ3 A;  4NDB A;  1YUU A;  1SNL A;  2KBM A;  3TDZ A;  3O5I A;  1AUI B;  1S26 D;  1WY9 A;  1OSA A;  2LP2 A;  1YUT A;  5I2O A;  4DRP A;  3UI6 A;  2AUC A;  5CSF A;  3CGN A;  1DJW A;  1QLK A;  3O5O A;  2OTG B;  1SCM C;  3OX6 A;  4YRU A;  2XP7 A;  2GGZ A;  1QX2 A;  2HPS A;  2K7D A;  3DVM A;  1MWN A;  2KI4 C;  3BOW B;  1ZFS A;  1TNW A;  1J4R A;  4R1E A;  1EH2 A;  3EY6 A;  4R0X A;  3KEV A;  3LL8 B;  3PAT A;  3PN7 C;  2CXJ A;  1K9P A;  2LVJ A;  4QJ3 B;  3SG5 A;  2LV7 A;  1B7T Z;  1SL9 A;  3O5D A;  1B6C A;  2L2S A;  3SG6 A;  1PSB A;  4C0J A;  1NSG A;  5I2L A;  4DIR A;  1FKG A;  1PAL A;  3SG2 A;  5ER4 X;  3JYJ A;  4MZJ A;  4U86 A;  4GPL B;  4USL A;  4FTG A;  1DJH A;  4MN0 A;  2OTG C;  1K2H A;  3CGM A;  3GK4 X;  2LVK A;  2KE0 A;  1CTR A;  2BCX A;  1UUR A;  1B4C A;  1TN4 A;  1S5G Z;  2V53 A;  1CDP A;  4N1G A;  1U5I A;  2COL B;  3O6B A;  1LA3 A;  1DVI A;  1BR1 B;  2JRF A;  5HKZ A;  1CDL A;  2JNX A;  2GGM A;  3IQO A;  2ZND A;  1PVA A;  2ZN9 A;  4MVF A;  4CFR A;  3DF0 B;  4QJ4 B;  1NMW A;  4ORC B;  1ZCN A;  4TNC A;  1BF5 A;  1Y1U A;  1TNQ A;  3OB1 B;  2HQ8 A;  5ER5 A;  3EKJ A;  3H4S E;  1K93 D;  1DF0 A;  1NSH A;  4W9O A;  3A8R A;  3UF8 A;  4N1F A;  2K8M B;  2QAC A;  2F3Z A;  5CSI A;  1KWO B;  4DH0 A;  4QT3 A;  3LCP C;  1QJT A;  4W9Q A;  4O2T A;  1M39 A;  1REC A;  1Q6U A;  4GIV A;  1SBJ A;  3GK1 A;  2JOJ A;  1TRF A;  2K2F A;  4MRY A;  3KAI A;  2KR7 A;  3FWB A;  2AAO A;  1WRK A;  4PHJ A;  4A4B A;  4TYO A;  1UHJ A;  1FKH A;  1WLM A;  2EGD A;  1D7H A;  2E30 A;  4TX0 A;  2M49 B;  4M2P A;  2M9G A;  2WCE A;  1D7I A;  4CPV A;  3D10 A;  2M3W A;  1NX0 A;  2KQ6 A;  2KGB C;  3CR5 X;  2MLZ A;  2JXL A;  1KWO C;  3NXA A;  3PFV A;  3GOF A;  4ORB B;  1IGV A;  3O2P A;  1XVJ A;  4PE0 A;  5AER A;  1AVS A;  1JBA A;  2KI3 A;  3NSO A;  1PK0 D;  1PRW A;  2FOT A;  2JU0 A;  2WOR A;  1CNP A;  2VN1 A;  3IKD A;  3BQ3 A;  3CLN A;  4HSZ A;  1Q1C A;  3K21 A;  3KHE A;  4YI9 A;  1SL8 A;  1RFJ A;  4LAX A;  1LIN A;  3CS1 A;  2PPN A;  2AMI A;  1FKJ A;  4QT2 A;  4DZ3 A;  1J7P A;  2KOT A;  2G9B A;  4PE4 A;  1SYM A;  5HLO A;  2BE4 A;  4ICB A;  1PSR A;  2D9F A;  3UQB A;  1B8R A;  2KYF A;  1S6C A;  2LE9 B;  1J7O A;  1YW5 A;  3LUO A;  5DIU A;  2PBC A;  3EK7 A;  4DRH A;  3FS7 A;  1EXR A;  3FIA A;  5I2Q A;  2ITK A;  1IKU A;  1QX5 B;  2KFF A;  3ZWH A;  1MQ1 A;  3OOB A;  1F8A B;  4PDZ A;  4JFL A;  3D0Y A;  5HW7 A;  3EVR A;  2EC6 B;  2XPB A;  2BE6 A;  1QTX A;  2F2O A;  2JTZ A;  1JC2 A;  4DRI A;  4ETO A;  1DTL A;  3SJS A;  1J7Q A;  2XP4 A;  4TNS A;  2Y5I A;  2LVI A;  2ZR4 A;  4DRJ A;  3RFW A;  4PHM A;  5D69 A;  4DCK A;  4YGE B;  3B7X A;  1HXV A;  3IK8 A;  3QRX A;  5K89 A;  1SW8 A;  2KDH A;  1B9A A;  3WNX B;  1A03 A;  2JZV A;  1A7X A;  2TN4 A;  1SL7 A;  2ZKM X;  3KAC A;  3F45 A;  1EJ3 A;  1R2U A;  1TNX A;  3LLE A;  5HUA A;  1Y0V H;  3O4Y A;  4OVN F;  2K2A A;  4NDD A;  3I5G B;  1PUL A;  2R2I A;  1KQM B;  1CKK A;  1ZK6 A;  5HKW A;  1NIW A;  2EC6 C;  2KAX A;  5GQQ C;  1J7R A;  1NCY A;  4JWQ A;  3HX4 A;  1AJ4 A;  4E68 A;  1ALW A;  1OZS A;  1SMG A;  3TS5 B;  3TDB A;  1T11 A;  2MRD A;  3O5P A;  4D1E A;  3KAB A;  1WDC B;  1J55 A;  1IH0 A;  1C7W A;  2RUC A;  3KAF A;  4TW8 A;  1QVI Y;  2HET A;  2ZN8 A;  4JFK A;  1S1E A;  2JC2 A;  2LVV A;  4U85 A;  1KFU L;  3CZT X;  2PRU A;  3KZ7 A;  1M46 A;  3I5G C;  1K9U A;  4ODM A;  2BCA A;  1KQM C;  5JJG A;  1QIV A;  1FF1 A;  3CWG A;  1MR8 A;  1OZO A;  2LMV A;  1ZAC A;  4ODR A;  2ISD A;  3BUW B;  3TS5 C;  2JT0 A;  2JPT A;  2M1U A;  2K7O A;  2PMY A;  4ITZ A;  4MGV A;  1L7Z A;  2KYC A;  1WDC C;  1XK4 C;  1OQP A;  4W9P A;  1OMD A;  1SK6 D;  2MJW B;  4OKH A;  4NNR A;  4DRW A;  1B7T Y;  2F2P A;  1QS7 A;  4Q04 A;  4IL1 A;  1B1G A;  4QIB A;  4TW7 A;  5HW8 A;  4GGF A;  4CID A;  2A4J A;  3BXK A;  2B1U A;  1K8U A;  1HT9 A;  2H61 A;  2LUX A;  4ZCV A;  1FI5 A;  2K61 A;  3WXA A;  1W26 A;  1V1G A;  4GGQ A;  1BOD A;  1CM4 A;  1MHO A;  2JT8 A;  1JF2 A;  1Y1A A;  4BY4 A;  1NUB A;  2JQ6 A;  4JPZ B;  1ZUZ A;  4JFI A;  1W7I B;  2LNK A;  1Q6H A;  1FW4 A;  4MZL A;  3I6C A;  1K9K A;  3TUY B;  3PRB A;  2KI6 D;  4BY5 A;  5AXI A;  2WND A;  1EG3 A;  2I94 A;  4OR9 B;  3JXV A;  1KFX S;  1MF8 B;  1BLQ A;  4ODL A;  1JUO A;  1Q6I A;  4ZCU A;  1BKF A;  1QLS A;  1U5I B;  1GGZ A;  3BUO B;  4CLN A;  1YX7 A;  2PV1 A;  3VGO A;  1FJD A;  3BUX B;  1IRJ A;  1OMR A;  2PV3 A;  2ZRS A;  4GUK A;  4JFJ A;  1XFW O;  1G33 A;  2F3Y A;  2MLX A;  1N2D A;  4J4N A;  3O5M A;  5HWC A;  1F8H A;  1A2X A;  1CFD A;  4IQC A;  1RTP 1;  5I98 A;  1IJ5 A;  4DRK A;  2RGI A;  1J1E A;  3TUY C;  1IWQ A;  3NI6 A;  3I5I B;  4MEW A;  3AAJ A;  1QPF A;  1PVB A;  2JNF A;  1C7V A;  3UI4 A;  3O5F A;  1SR6 B;  2ZR6 A;  2ZFD A;  1DF0 B;  5D7F A;  5DIV A;  1XA5 A;  2Q4U A;  1M45 A;  1WLZ A;  2LHI A;  1S36 A;  4OCI A;  1IG5 A;  2LP3 A;  4GNK B;  2JTT A;  1F54 A;  2Y1M A;  1YUR A;  2JUL A;  2M08 A;  2I7A A;  2K7C A;  4WQ3 A;  5F6T A;  2BBM A;  3CR2 A;  2ZQV A;  3VRP A;  2IS9 A;  3GK2 A;  4DRO A;  2AWG A;  4XYN A;  1CLB A;  1JWD A;  1ROU A;  1SY9 A;  3I5I C;  2K7B A;  2DG4 A;  2OFN A;  1C07 A;  3I5H B;  1D1O A;  2IF4 A;  1DJY A;  4PE7 A;  1SR6 C;  1CM1 A;  1TCF A;  3EK4 A;  4TW6 A;  2M1K B;  4I5K A;  1J1D A;  1W7J B;  1UHI A;  4GGN A;  2KAV A;  1N65 A;  2M29 A;  1DJI A;  3VAW A;  1AJ5 A;  4GBA A;  1CDN A;  1Y0O A;  1NCX A;  1B8L A;  1QAT A;  3NRK A;  2RUQ A;  4U84 A;  1XYD A;  2WOS A;  5BXJ A;  1ALV A;  1QV0 A;  4ODN A;  1QAS A;  2XP3 A;  1J4H A;  1G4Y R;  2D8N A;  1GJY A;  1EL4 A;  2KI6 C;  4DUQ A;  3I5H C;  3IKG A;  4YGB B;  3O5R A;  5HKG A;  1N1A A;  1NMV A;  4YI8 A;  3H9R B;  3NTP A;  3O5Q A;  2JXC A;  3PSR A;  4FQO A;  4J4O A;  1EG4 A;  3WHT B;  1RWY A;  1FAP A;  1BU3 A;  2BL0 B;  1AK8 A;  1M5Y A;  1FBV A;  1MXE A;  1MXL C;  4MZK A;  1QZ2 A;  1KQV A;  1F4O A;  5JOL A;  1TIZ A;  2NCP A;  2OPO A;  3DD4 A;  2XP6 A;  2BKI B;  2MLF C;  1NX3 A;  1YR5 A;  3TZ1 A;  3D0Y B;  3VRR A;  1UHN A;  1FI6 A;  4PHN A;  2JWW A;  2SAS A;  3EVU A;  3AAK A;  1JF0 A;  2P6B B;  3EVV A;  2FAP A;  1PIN A;  2VRG A;  3RGC A;  3BYA A;  2M7N A;  3SG7 A;  5B8I B;  4JFM A;  4U8D A;  2F2D A;  4UPG A;  4NQG A;  1SKT A;  1Q80 A;  4I5N B;  2BL0 C;  4PAL A;  1BG1 A;  1YTZ C;  2LMU A;  2Y4Q A;  3TDU A;  2XP5 A;  1KK7 Z;  2LMT A;  3LK1 A;  3JYM A;  1DGU A;  1U79 A;  1XO5 A;  1J4I A;  1A4P A;  2L5X B;  2M97 A;  3LK0 A;  2CT9 A;  3BUN B;  1B8C A;  4YGC B;  2LHL A;  4DT4 A;  5HW6 A;  1KSO A;  4C02 B;  2M8U A;  1QV1 A;  5FYX A;  2QPT A;  1F4Q A;  1NPQ A;  2MLE C;  5HTG A;  1NCZ A;  2PAS A;  3O5E A;  1FKT A;  1KT0 A;  5B8I C;  2PVB A;  3AKA A;  3KO0 A;  2RUR A;  1RRO A;  4PHK A;  1FKK A;  4C0K A;  2MA2 A;  2WCB A;  5DIT A;  2F8P A;  4P2Y B; 
#chains in the Genus database with same CATH topology
 4JKT A;  1YVL A;  3Q8I A;  2LPV A;  2Q5A A;  5KU1 A;  2LKN A;  3ARP A;  3MSE B;  1DT7 B;  3NSL A;  4JD9 A;  3FY1 A;  1NP8 A;  1VRK A;  1YRT B;  2CTN A;  4I5L B;  1A75 A;  2A3B A;  2LC5 A;  3OB2 B;  3PA7 A;  1XFZ O;  2KFW A;  3KAD A;  3TC5 A;  2Y78 A;  4INX A;  1FKI A;  4F0Z B;  3KF9 A;  5KTY A;  3RLZ A;  1KT1 A;  1CMF A;  4DIP A;  1C9H A;  4YGD B;  2HF5 A;  5DKQ A;  2RUD A;  2MPH A;  1SCV A;  3CGA A;  1FKS A;  2LJ4 A;  2B31 A;  1CDM A;  5GPR A;  2ZQS A;  1FD9 A;  3UQA A;  1JNS A;  1YX8 A;  1JFJ A;  1TNP A;  1KFX L;  1HKM A;  3UQI A;  2PAL A;  4A4C A;  5AFP A;  2WC8 A;  2RQS A;  4WQ2 A;  3CAB A;  5DEZ A;  1L1P A;  1WRZ A;  2K8I A;  4PTM A;  2RSE A;  1M31 A;  5I94 A;  2PPP A;  4ODO A;  2ERB A;  1S6I A;  3B9D A;  2LLU A;  3FWC A;  2XPA A;  1KSM A;  5DKR A;  4DZ2 A;  3DY9 A;  1LXF C;  2KO7 A;  1NWR A;  1SR0 A;  2DG9 A;  1NX1 A;  3OGN A;  1T14 A;  1YVH A;  3DYE A;  4ZS6 A;  1UR9 A;  3KAH A;  2QEB A;  2HQW A;  3PRD A;  1WRL A;  1LVC D;  2LGO A;  2WC6 A;  1GOI A;  2M7L A;  5GPG A;  1ZBW A;  1LS8 A;  1K96 A;  3C1V A;  3SS4 A;  4Q22 A;  2Y1N A;  2AOS A;  1HJW A;  2L0P A;  3O5K A;  4QJ5 B;  3DVJ A;  1XK4 A;  1GQM A;  2XP9 A;  1SCM B;  3WQV A;  2ZNE A;  1DJZ A;  2UZ5 A;  4DRQ A;  4XJK A;  2A3A A;  1QVI Z;  1DJG A;  1IQ3 A;  1SNL A;  4DRP A;  3O5O A;  1OOI X;  1SCM C;  3OX6 A;  1J4R A;  5DO2 A;  3EY6 A;  3SG5 A;  3LL8 B;  1B6C A;  3SG6 A;  4C0J A;  5I2L A;  4DIR A;  1FKG A;  5ER4 X;  3JYJ A;  4GPL B;  3WL1 A;  1ZB5 A;  3GK4 X;  2BCX A;  3RM9 A;  2QEH A;  1BR1 B;  2EUL A;  2JNX A;  4CFR A;  2ZN9 A;  1NMW A;  1BF5 A;  1Y1U A;  2HQ8 A;  3H4S E;  1DF0 A;  4W9O A;  4N1F A;  2QAC A;  3LCP C;  4O2T A;  1LL4 A;  1IIO A;  2JOJ A;  3KAI A;  3FWB A;  2E30 A;  3UO9 A;  2M3W A;  2JPO A;  2JXL A;  4F7F A;  3GOF A;  1IGV A;  1XVJ A;  4WKF A;  2O9O A;  2JU0 A;  2VN1 A;  4HSZ A;  3KHE A;  2PPN A;  4DZ3 A;  2G9B A;  2D9F A;  3BFH A;  1B8R A;  1W1V A;  4DRH A;  2PBC A;  3FIA A;  3ZWH A;  1F8A B;  5GQB A;  4PDZ A;  4JFL A;  2WLZ A;  2WLY A;  4DRI A;  2F2O A;  2Y5I A;  2ZR4 A;  4DRJ A;  1ZL1 A;  5D69 A;  2TN4 A;  1SL7 A;  1R2U A;  4OVN F;  2K2A A;  3WL0 A;  1ZK6 A;  5FI7 A;  1NCY A;  2YBT A;  1IH0 A;  1C7W A;  1QVI Y;  1OGG A;  2ZN8 A;  1S1E A;  3R1O A;  1KFU L;  3KZ7 A;  1ZAC A;  4ODR A;  1ZBC A;  4P8W A;  2K60 A;  2PMY A;  2K7O A;  4QZV B;  2MJW B;  2F2P A;  1X6L A;  1K8U A;  4ZCV A;  3WXA A;  4GGQ A;  2JQ6 A;  2LNK A;  3I6C A;  1K9K A;  3TUY B;  4ODL A;  4OR9 B;  1EG3 A;  1KFX S;  1MF8 B;  1Q6I A;  1BKF A;  1O6I A;  1U5I B;  1GGZ A;  4CLN A;  1DC1 A;  1ZU8 A;  4HBO A;  4IQC A;  2RGI A;  1J1E A;  3TUY C;  3PJI A;  4MEW A;  3AAJ A;  1QPF A;  1PVB A;  3UI4 A;  5D7F A;  1S36 A;  1IG5 A;  4KQZ A;  1F54 A;  1SYT A;  2M08 A;  4DRO A;  1JWD A;  4DWS A;  1SY9 A;  2DG4 A;  2K7B A;  2IF4 A;  3RM8 A;  4PE7 A;  1TCF A;  1JND A;  3B9E A;  1UHI A;  4GGN A;  1N65 A;  1Y0O A;  4MNM A;  2RUQ A;  1XYD A;  4DUQ A;  4YGB B;  3O5R A;  1N1A A;  4YI8 A;  3PSR A;  4FQO A;  1EDQ A;  1AK8 A;  1M5Y A;  1MXE A;  2BKI B;  3PR9 A;  1OOG A;  3VRR A;  4Q7N A;  3AAK A;  2WCL A;  5B8I B;  4JFM A;  4URI A;  1SKT A;  1Q80 A;  4PAL A;  5D3O A;  2XP5 A;  2L5X B;  2CT9 A;  4PT1 A;  1B8C A;  5FI2 A;  1RD6 A;  2LHL A;  5FYX A;  2PAS A;  1KT0 A;  5B8I C;  2PVB A;  2MA2 A;  3L4L A;  4IT4 A;  2WCJ A;  1EYM A;  2NCO A;  3NHT A;  1FKD A;  1V1F A;  4WRI A;  4N5X A;  1ZOT B;  1EQ3 A;  5IBW A;  3OP0 A;  1DMO A;  5HKY A;  3FE9 A;  2BNX A;  4W5U A;  1A75 B;  1W1T A;  3FAP A;  3JVT B;  4LAY A;  3JTD B;  1X6N A;  1JNT A;  1UR8 A;  1A29 A;  1S5G Y;  4M2Q A;  2LUC A;  1HKI A;  2LM5 A;  1JSA A;  1N0Y A;  1JNE A;  1TCO B;  2DT0 A;  1UP5 A;  3JVT C;  3PAL A;  1FKB A;  3WH0 A;  3JTD C;  5DKN A;  4LAV A;  2KFG A;  2BBN A;  2M0R A;  2VCD A;  2FKE A;  3CHE A;  3PLF B;  1TCO C;  2KGJ A;  2G41 A;  4INW A;  1FKL A;  2ZRT A;  3O78 A;  1LL7 A;  1TOP A;  3DF0 A;  1R9H A;  5AAN A;  3O5G A;  1NWS A;  2QEV A;  1DGV A;  4MAV A;  1JVW A;  4HBE A;  2DG3 A;  2YBU A;  1G8I A;  2K0J A;  1UUS A;  3DVK A;  4MTV A;  4G50 A;  2LLT A;  4ZPT R;  3KAG A;  2KGR A;  3I5F B;  3OA5 A;  3VRQ A;  4CFQ A;  4M2O A;  2KPH A;  3B87 A;  3IF7 A;  2NXQ A;  4WKA A;  4BF8 A;  1H8B A;  2GV5 A;  2O60 A;  1OW4 A;  1UHH A;  1AHR A;  3I5F C;  2L2E A;  4DS7 A;  1CLL A;  5CPV A;  1CB1 A;  4HRE E;  3OX5 A;  1ODB A;  1XFU O;  4FN2 A;  2NLN A;  3S0A A;  2KAY A;  3KCE A;  3AQU A;  1KFU S;  1BT6 A;  2L98 A;  1OGB A;  2F21 A;  2H2K A;  5J6E A;  5D75 A;  2L4H A;  3AKB A;  1E8A A;  4P5O E;  1RK9 A;  2KFH A;  4AOM A;  3BUM B;  2KI4 B;  1E6N A;  3PN7 B;  2NZ0 A;  2PN0 A;  5AEQ A;  2QEO A;  4XJK B;  3SG3 A;  4L3N A;  2E6W A;  1S26 D;  3W4R A;  1QLK A;  4NSB A;  2L2C A;  3DVM A;  1QX2 A;  2KI4 C;  3BOW B;  2QDI A;  1TNW A;  1EH2 A;  3KEV A;  3PN7 C;  2LVJ A;  2LV7 A;  3O5D A;  1WAW A;  1E9L A;  1NSG A;  1NH6 A;  1E6R A;  3ALF A;  4MZJ A;  4U86 A;  1TUJ A;  4FTG A;  2YGU A;  2LVK A;  1CTR A;  1TN4 A;  2V53 A;  1CDP A;  3R72 A;  2G8Z A;  4MNL A;  4MVF A;  3IQO A;  1P28 A;  2ZND A;  4WIW A;  1NWU A;  1ZCN A;  4TNC A;  4Z2G A;  1TNQ A;  3EKJ A;  1SSE B;  2O92 A;  4DH0 A;  1KWO B;  2WM0 A;  1TFV A;  4PHJ A;  3VB1 A;  1UHJ A;  1FKH A;  1WLM A;  2M49 B;  3RZS A;  2M9G A;  4P8V A;  3D10 A;  2WC5 A;  2KGB C;  1KWO C;  4ORB B;  3O2P A;  5AER A;  4ZPV R;  2KI3 A;  3B86 A;  1PRW A;  2FOT A;  3NSO A;  2WOR A;  3CLN A;  3NGV A;  4YI9 A;  1SL8 A;  1LIN A;  1OWQ A;  2AMI A;  1FKJ A;  4Z2I A;  5HLO A;  1CTN A;  5DIU A;  3QOK A;  2ITK A;  3D0Y A;  3EVR A;  2BE6 A;  2JTZ A;  3SJS A;  4PHM A;  3ARW A;  4YGE B;  1HXV A;  3IK8 A;  1A7X A;  3KAC A;  3ARX A;  1EJ3 A;  5HUA A;  1Y0V H;  4NDD A;  1HJX A;  3I5G B;  2ETN A;  1KQM B;  5HKW A;  3HX4 A;  1AJ4 A;  4E68 A;  4P8U A;  1T11 A;  2MRD A;  4D1E A;  1WDC B;  2HET A;  3K1E A;  2JC2 A;  2LVV A;  2PRU A;  3PRA A;  3I5G C;  1K9U A;  2BCA A;  1KQM C;  5JJG A;  3ARR A;  3CWG A;  3L47 A;  3OBV A;  2LMV A;  2JT0 A;  1WDC C;  1LL6 A;  1XRV A;  1OQP A;  1OMD A;  1SK6 D;  1VF8 A;  4DRW A;  4Q04 A;  4QIB A;  5HW8 A;  4CID A;  2FJY A;  2K61 A;  1V1G A;  1MHO A;  1NUB A;  4JPZ B;  1ZUZ A;  1Q6H A;  3PRB A;  2KI6 D;  1XFR A;  4FQT A;  5AXI A;  2WND A;  1ZBK A;  4DWS D;  3JXV A;  1QWV A;  3DZT A;  2PV1 A;  4KR0 B;  3RM4 A;  3VGO A;  1FJD A;  2PV3 A;  4UDM A;  1G33 A;  2F3Y A;  1E44 A;  5I98 A;  1LJY A;  3NI6 A;  5DIV A;  1XA5 A;  2Q4U A;  2LHI A;  4Z2H A;  2K7C A;  2BBM A;  3CR2 A;  2IS9 A;  2AWG A;  2P70 A;  1ROU A;  2OFN A;  3I5H B;  2PQL A;  3EK4 A;  4I5K A;  2M29 A;  3VAW A;  1C3Y A;  1LQ0 A;  2WOS A;  1QV0 A;  2XP3 A;  4Z2L A;  2KI6 C;  3AS1 A;  3I5H C;  3IKG A;  1NMV A;  3H9R B;  2DSW A;  1FAP A;  1FBV A;  1MXL C;  3SS3 A;  1F4O A;  2XP6 A;  2NCP A;  1FI6 A;  1YR5 A;  1UHN A;  2SAS A;  2VRG A;  3BFA A;  4UPG A;  4NQG A;  3CDN A;  1BG1 A;  1YTZ C;  1KK7 Z;  2IUZ A;  1DGU A;  3JYM A;  2OLH A;  1A4P A;  5DF0 A;  2QPT A;  3QME A;  2MLE C;  1NCZ A;  3O5E A;  1FKT A;  1TWO A;  3KO0 A;  1FKK A;  4C0K A;  5DIT A;  4P2Y B;  4ODM A;  3WD0 A;  5TNC A;  2PSR A;  1F40 A;  3R1P A;  4MBE A;  5HWB A;  3KPX A;  3S0G A;  2FJU B;  5HYD A;  2P4V A;  3OHM B;  1GGW A;  2CCM A;  1J6Y A;  2A3C A;  2N87 A;  1PBK A;  4G2P A;  1SPY A;  1YUS A;  4ODP A;  1DJX A;  5BPJ A;  3A4U B;  4OV2 A;  3VRN A;  1NWD A;  1K90 D;  3O4X A;  4GGF C;  3PM8 A;  4I5J A;  5KSZ A;  2H61 C;  1W1P A;  2LCP A;  3GTY X;  5EL2 A;  5I8N A;  4FAP A;  1QX7 A;  3CTN A;  2L4I A;  1HQV A;  2SCP A;  3EK8 A;  2F4E A;  1CLM A;  2DOQ A;  3WD4 A;  1ITX A;  1RJV A;  1MUX A;  3D73 A;  4YGA A;  3RME A;  3DVE A;  1TUZ A;  1WB0 A;  2PPO A;  2BEC A;  2ZQU A;  4GAO A;  4MSP A;  2KSP A;  4DRM A;  1F71 A;  3BFB A;  2XP8 A;  1B47 A;  3CZ1 A;  2L50 A;  2KHN A;  2M1I A;  2I18 A;  3L4A A;  1IJ6 A;  5HT1 A;  4ORA B;  5J3X A;  3S0F A;  4MLW A;  1K94 A;  3D75 A;  4MRX A;  1TTX A;  3CR4 X;  3D77 A;  1UHK A;  5CSN A;  2G2B A;  4HRG A;  5PAL A;  1BJF A;  1KK7 Y;  1S3P A;  3UI5 A;  1KFW A;  3ODK A;  3ICB A;  2FCE A;  1K95 A;  1SRA A;  2BCB A;  1IX5 A;  2CBL A;  2H8V A;  3V2L A;  1FKR A;  1NX2 A;  3M0W A;  5HL1 A;  2MAZ A;  1S6J A;  4DT4 A;  2LLS A;  1UWO A;  2CNP A;  2L51 A;  2MLY A;  1F55 A;  1OOJ A;  3WD3 A;  1WNO A;  2MHH A;  2MBX A;  4GFT A;  3SIB A;  1CFC A;  1YAT A;  2KQY A;  1K9T A;  1YRU B;  1LG2 A;  4NDB A;  1YUU A;  3EG5 B;  1OSA A;  5I2O A;  1YUT A;  1NWT A;  3UI6 A;  5CSF A;  3CGN A;  1DJW A;  2OTG B;  2GGZ A;  2K7D A;  1MWN A;  3PAT A;  1B7T Z;  1SL9 A;  3EIP A;  2L2S A;  1PSB A;  3SG2 A;  4USL A;  2OTG C;  1K2H A;  1UUR A;  1B4C A;  1U5I A;  2COL B;  2JRF A;  4QJ4 B;  2GGM A;  1PVA A;  4ORC B;  1FFR A;  3OB1 B;  5ER5 A;  1K93 D;  1NSH A;  3UF8 A;  2F3Z A;  1QJT A;  1M39 A;  4GIV A;  2PI6 A;  3GK1 A;  2K2F A;  2KR7 A;  4TYO A;  2GTE A;  4TX0 A;  4CPV A;  2KQ6 A;  2MLZ A;  1AVS A;  2KLD A;  1GUV A;  1CNP A;  3BQ3 A;  2QF8 A;  2BAP A;  3UNW A;  4S3J A;  4XAK A;  3D78 A;  1J7P A;  4ICB A;  1PSR A;  2LE9 B;  1YW5 A;  3FS7 A;  1IKU A;  2KFF A;  1JC2 A;  4TNS A;  2XP4 A;  3RFW A;  3B7X A;  4DCK A;  3QRX A;  5K89 A;  1SW8 A;  2KDH A;  1B9A A;  3WNX B;  2JZV A;  2RUC A;  5GQQ C;  4JWQ A;  1ALW A;  4NZC A;  1H0G A;  3O5P A;  1J55 A;  4U85 A;  2KLE A;  1QIV A;  1MR8 A;  2B5U B;  2ISD A;  3BUW B;  2JPT A;  4ITZ A;  1L7Z A;  2KYC A;  1XK4 C;  4W9P A;  4OKH A;  2DT2 A;  3DXL A;  4NNR A;  1B7T Y;  1QS7 A;  4IL1 A;  4TW7 A;  2A4J A;  3AS2 A;  1BOD A;  1CM4 A;  2ESC A;  1JF2 A;  1EHN A;  3N7H A;  1FW4 A;  1E6Z A;  3G6M A;  3FE6 A;  1LG1 A;  1BLQ A;  3S0D A;  1JUO A;  1H0I A;  1QLS A;  3BUO B;  1YX7 A;  2WCM A;  3BUX B;  1IRJ A;  2ZRS A;  3PM2 A;  1XFW O;  2MLX A;  5HWC A;  1N2D A;  3O5M A;  1F8H A;  1A2X A;  4WK9 A;  1IJ5 A;  1IWQ A;  1DF0 B;  1WLZ A;  2LP3 A;  2JTT A;  2Y1M A;  2I7A A;  2ZQV A;  3GK2 A;  4XYN A;  3B6X A;  4MNJ A;  1D1O A;  1DJY A;  1W7J B;  2KAV A;  1DJI A;  3WQW A;  1AJ5 A;  4GBA A;  1ZBV A;  3NRK A;  4U84 A;  4AY1 A;  5BXJ A;  3B9A A;  4ODN A;  1QAS A;  1J4H A;  1EL4 A;  4ZPW R;  2JXC A;  3G6L A;  1EG4 A;  3WHT B;  1RWY A;  4OZD A;  5JOL A;  1TIZ A;  3DD4 A;  4IT6 A;  1NX3 A;  3TZ1 A;  3SS5 A;  2JWW A;  3EVU A;  2FAP A;  2P6B B;  1PIN A;  2M7N A;  3SG7 A;  4U8D A;  3FE8 A;  4I5N B;  4MNK A;  2LMT A;  3CZ2 A;  3LK1 A;  3LK0 A;  5HW6 A;  4C02 B;  1QV1 A;  1F4Q A;  4PHK A;  1GRJ A;  3SIA A;  2F8P A;  4AQJ A;  4IPX A;  1BMO A;  1NYA A;  1Y6W A;  3ARY A;  1ZMZ A;  3NSI A;  4AQI A;  2MNT A;  3BJH A;  4L9M A;  5CSJ A;  3ALG A;  3S0B A;  4S3K A;  1D7J A;  3D74 A;  1OMV A;  5FI6 A;  1OOF A;  2FDM A;  3BOW A;  2JT3 A;  3TDI A;  3WHU B;  2MF9 A;  3IHZ A;  1OOH A;  3S0E A;  2M2A A;  1M63 B;  1OE9 B;  2I2R E;  1W9U A;  1D6O A;  4HAR A;  1JFK A;  1BOC A;  4R5E A;  4JYS A;  3HCM A;  2JZI A;  4Z2J A;  1QXP A;  3B8S A;  4ODQ A;  3SG4 A;  2KNE A;  4ODK A;  1R6P A;  2LAP A;  1GM0 A;  1LKJ A;  1Y1X A;  3AS0 A;  1XFX O;  2F33 A;  2KBI A;  2OS8 B;  1ORG A;  2PV2 A;  5HLV A;  3EKH A;  1X02 A;  2BKH B;  4PE1 A;  4DWS B;  3VRO A;  4KYN A;  4LAW A;  3NSK A;  2OS8 C;  2EHB A;  3RM1 A;  1F70 A;  1L2O B;  1IQ5 A;  2LAN A;  3CZ0 A;  4DWS C;  3TCZ A;  4PCW A;  3O5L A;  2O5G A;  4IQ2 A;  2ZQT A;  1P5Q A;  3O5J A;  1AP4 A;  1L2O C;  4N19 A;  1LA0 A;  3GU0 A;  1QIW A;  3B7A A;  1CMG A;  1QPL A;  1XFY O;  3CHD A;  1DEL A;  3CHF A;  1CFP A;  1KK8 B;  3ARS A;  3E3R A;  4JQ0 D;  3ARQ A;  2L5Y A;  3D76 A;  3WD1 A;  4P8X A;  4HRH A;  4YBH B;  2WCF A;  2FCD A;  1FKF A;  2ZR5 A;  1BR4 B;  3ARU A;  4C0L A;  1XFV O;  5G08 A;  4DRN A;  1KK8 C;  2A3E A;  3ZNI A;  3MDY B;  3ARV A;  3IQQ A;  2DPE A;  1FPW A;  2Q91 A;  1ROT A;  1BL4 A;  4NDC A;  2PYQ A;  1H4B A;  1KCY A;  5HBF A;  3GPK A;  1D2K A;  2WCH A;  1CFF A;  3O5I A;  2KBM A;  3TDZ A;  1XHG A;  1AUI B;  1WY9 A;  2LP2 A;  2AUC A;  3AS3 A;  2XP7 A;  4YRU A;  2HPS A;  1ZFS A;  4R1E A;  4R0X A;  4QJ3 B;  2CXJ A;  1K9P A;  1W9V A;  3BXW A;  1PAL A;  1DJH A;  4MN0 A;  3CGM A;  2KE0 A;  2WK2 A;  5JH8 A;  1S5G Z;  4N1G A;  3O6B A;  1LA3 A;  3CZ8 A;  1W9P A;  1DVI A;  5HKZ A;  1CDL A;  3DF0 B;  3WIJ A;  3A8R A;  1Z2C B;  2K8M B;  5CSI A;  4QT3 A;  4W9Q A;  1E15 A;  1REC A;  3CYZ A;  1Q6U A;  1SBJ A;  3ARO A;  1TRF A;  4MRY A;  1W1Y A;  2AAO A;  1WRK A;  4A4B A;  2EGD A;  1D7H A;  5DIC A;  4M2P A;  2WCE A;  1D7I A;  1EIB A;  1NX0 A;  3WD2 A;  3CR5 X;  3PFV A;  3NXA A;  4PE0 A;  1JBA A;  1PK0 D;  1HKK A;  3IKD A;  1Q1C A;  3K21 A;  4LAX A;  3WKZ A;  1RFJ A;  3CS1 A;  4QT2 A;  2KOT A;  4PE4 A;  1SYM A;  2BE4 A;  3UQB A;  1GPF A;  2KYF A;  1S6C A;  1J7O A;  3LUO A;  3EK7 A;  1EXR A;  5I2Q A;  1QX5 B;  3NHI A;  1MQ1 A;  3OOB A;  4WJX A;  5HW7 A;  2XPB A;  2EC6 B;  1HKJ A;  1DQE A;  1QTX A;  1J7Q A;  1DTL A;  2LVI A;  1A03 A;  2ZKM X;  3F45 A;  1TNX A;  1Z4H A;  3LLE A;  3O4Y A;  3CH9 A;  1PUL A;  4Z2K A;  2R2I A;  1CKK A;  1NIW A;  2EC6 C;  2KAX A;  1J7R A;  2F23 A;  3ARZ A;  1OZS A;  1SMG A;  3TS5 B;  2P71 A;  1W9Z A;  3TDB A;  3IVT A;  3KAB A;  4TW8 A;  3KAF A;  1E6P A;  4IJ7 A;  3B88 A;  4JFK A;  3CZT X;  1M46 A;  1FF1 A;  1OZO A;  3TS5 C;  2M1U A;  4MGV A;  1B1G A;  4GGF A;  3BXK A;  2B1U A;  1HT9 A;  2H61 A;  2LUX A;  1FI5 A;  2DSV A;  1W26 A;  2JT8 A;  1Y1A A;  4BY4 A;  3CHC A;  4JFI A;  1W7I B;  4MZL A;  4BY5 A;  2I94 A;  4ZCU A;  2DT1 A;  1OMR A;  4GUK A;  4JFJ A;  4J4N A;  1CFD A;  1RTP 1;  2DSU A;  4DRK A;  3R1V A;  3I5I B;  2JNF A;  1C7V A;  3O5F A;  1SR6 B;  2ZR6 A;  2ZFD A;  1M45 A;  4OCI A;  3FXY A;  4GNK B;  1C3Z A;  1YUR A;  2JUL A;  4WQ3 A;  5F6T A;  4MPK A;  3VRP A;  1CLB A;  1DEK A;  3I5I C;  3ART A;  1C07 A;  4TW6 A;  1SR6 C;  1CM1 A;  2M1K B;  1J1D A;  4L72 B;  1CDN A;  1NCX A;  1B8L A;  1QAT A;  1ALV A;  1FFQ A;  1G4Y R;  2D8N A;  1GJY A;  5HKG A;  1JCH B;  3O5Q A;  3NTP A;  4WKH A;  4J4O A;  1BU3 A;  2BL0 B;  4MZK A;  1QZ2 A;  1KQV A;  2OPO A;  2MLF C;  4ML4 A;  3D0Y B;  4LGX A;  4PHN A;  1JF0 A;  3EVV A;  2WCK A;  2DSZ A;  3RGC A;  3BYA A;  2F2D A;  2DT3 A;  2BL0 C;  2LMU A;  2Y4Q A;  3TDU A;  1U79 A;  1XO5 A;  1J4I A;  2M97 A;  4YGC B;  3BUN B;  3BMB A;  1HJV A;  1KSO A;  2M8U A;  1NPQ A;  5HTG A;  3AKA A;  2RUR A;  1RRO A;  4ETO A;  2WCB A; 
#chains in the Genus database with same CATH homology
 1YVL A;  2LPV A;  2Q5A A;  5KU1 A;  2LKN A;  3ARP A;  3MSE B;  1DT7 B;  3NSL A;  3FY1 A;  1NP8 A;  1VRK A;  1YRT B;  2CTN A;  4I5L B;  1A75 A;  2A3B A;  2LC5 A;  3OB2 B;  3PA7 A;  1XFZ O;  2KFW A;  3KAD A;  3TC5 A;  2Y78 A;  1FKI A;  4F0Z B;  3KF9 A;  5KTY A;  3RLZ A;  1KT1 A;  1CMF A;  4DIP A;  1C9H A;  4YGD B;  2HF5 A;  5DKQ A;  2RUD A;  2MPH A;  1SCV A;  3CGA A;  1FKS A;  2LJ4 A;  2B31 A;  1CDM A;  5GPR A;  2ZQS A;  1FD9 A;  3UQA A;  1JNS A;  1YX8 A;  1JFJ A;  1TNP A;  1KFX L;  1HKM A;  3UQI A;  2PAL A;  4A4C A;  5AFP A;  2WC8 A;  2RQS A;  4WQ2 A;  5DEZ A;  1L1P A;  1WRZ A;  2K8I A;  4PTM A;  2RSE A;  1M31 A;  2PPP A;  4ODO A;  1S6I A;  3B9D A;  2LLU A;  3FWC A;  2XPA A;  1KSM A;  5DKR A;  4DZ2 A;  1LXF C;  2KO7 A;  1NWR A;  1SR0 A;  2DG9 A;  1NX1 A;  1YVH A;  4ZS6 A;  1UR9 A;  3KAH A;  2HQW A;  3PRD A;  1WRL A;  1LVC D;  2LGO A;  1GOI A;  2M7L A;  5GPG A;  1ZBW A;  1K96 A;  3C1V A;  4Q22 A;  2Y1N A;  2AOS A;  1HJW A;  2L0P A;  3O5K A;  4QJ5 B;  3DVJ A;  1XK4 A;  1GQM A;  2XP9 A;  1SCM B;  3WQV A;  2ZNE A;  1DJZ A;  2UZ5 A;  4DRQ A;  4XJK A;  2A3A A;  1QVI Z;  1DJG A;  1IQ3 A;  1SNL A;  4DRP A;  3O5O A;  1SCM C;  3OX6 A;  1J4R A;  5DO2 A;  3EY6 A;  3SG5 A;  3LL8 B;  1B6C A;  3SG6 A;  4C0J A;  5I2L A;  4DIR A;  1FKG A;  5ER4 X;  3JYJ A;  4GPL B;  3WL1 A;  1ZB5 A;  3GK4 X;  2BCX A;  3RM9 A;  1BR1 B;  2JNX A;  4CFR A;  2ZN9 A;  1NMW A;  1BF5 A;  1Y1U A;  2HQ8 A;  3H4S E;  1DF0 A;  4W9O A;  4N1F A;  2QAC A;  3LCP C;  4O2T A;  1LL4 A;  2JOJ A;  3KAI A;  3FWB A;  2E30 A;  2M3W A;  2JXL A;  3GOF A;  1IGV A;  1XVJ A;  4WKF A;  2O9O A;  2JU0 A;  2VN1 A;  4HSZ A;  3KHE A;  2PPN A;  4DZ3 A;  2G9B A;  2D9F A;  1B8R A;  1W1V A;  4DRH A;  2PBC A;  3FIA A;  3ZWH A;  1F8A B;  5GQB A;  4PDZ A;  4JFL A;  2WLZ A;  2WLY A;  4DRI A;  2F2O A;  2Y5I A;  2ZR4 A;  4DRJ A;  1ZL1 A;  5D69 A;  2TN4 A;  1SL7 A;  1R2U A;  4OVN F;  2K2A A;  3WL0 A;  1ZK6 A;  1NCY A;  2YBT A;  1IH0 A;  1C7W A;  1QVI Y;  1OGG A;  2ZN8 A;  1S1E A;  1KFU L;  3KZ7 A;  1ZAC A;  4ODR A;  1ZBC A;  4P8W A;  2PMY A;  2K7O A;  4QZV B;  2MJW B;  2F2P A;  1X6L A;  1K8U A;  4ZCV A;  3WXA A;  4GGQ A;  2JQ6 A;  2LNK A;  3I6C A;  1K9K A;  3TUY B;  4ODL A;  4OR9 B;  1EG3 A;  1KFX S;  1MF8 B;  1Q6I A;  1BKF A;  1O6I A;  1U5I B;  1GGZ A;  4CLN A;  1ZU8 A;  4HBO A;  4IQC A;  2RGI A;  1J1E A;  3TUY C;  4MEW A;  3AAJ A;  1QPF A;  1PVB A;  3UI4 A;  5D7F A;  1S36 A;  1IG5 A;  4KQZ A;  1F54 A;  1SYT A;  2M08 A;  4DRO A;  1JWD A;  4DWS A;  1SY9 A;  2DG4 A;  2K7B A;  2IF4 A;  3RM8 A;  4PE7 A;  1TCF A;  1JND A;  3B9E A;  1UHI A;  4GGN A;  1N65 A;  1Y0O A;  4MNM A;  2RUQ A;  1XYD A;  4DUQ A;  4YGB B;  3O5R A;  1N1A A;  4YI8 A;  3PSR A;  4FQO A;  1EDQ A;  1AK8 A;  1M5Y A;  1MXE A;  2BKI B;  3PR9 A;  3VRR A;  4Q7N A;  3AAK A;  5B8I B;  4JFM A;  4URI A;  1SKT A;  1Q80 A;  4PAL A;  2XP5 A;  2L5X B;  2CT9 A;  1B8C A;  1RD6 A;  2LHL A;  5FYX A;  2PAS A;  1KT0 A;  5B8I C;  2PVB A;  2MA2 A;  4IT4 A;  1EYM A;  2NCO A;  1FKD A;  1V1F A;  4WRI A;  4N5X A;  1ZOT B;  1EQ3 A;  5IBW A;  3OP0 A;  1DMO A;  5HKY A;  4W5U A;  1A75 B;  1W1T A;  3FAP A;  3JVT B;  4LAY A;  3JTD B;  1X6N A;  1JNT A;  1UR8 A;  1A29 A;  1S5G Y;  4M2Q A;  2LUC A;  1HKI A;  2LM5 A;  1JSA A;  1N0Y A;  1JNE A;  1TCO B;  2DT0 A;  1UP5 A;  3JVT C;  3PAL A;  1FKB A;  3WH0 A;  3JTD C;  5DKN A;  4LAV A;  2KFG A;  2BBN A;  2M0R A;  2VCD A;  2FKE A;  3CHE A;  3PLF B;  1TCO C;  2KGJ A;  2G41 A;  1FKL A;  2ZRT A;  3O78 A;  1LL7 A;  1TOP A;  3DF0 A;  1R9H A;  5AAN A;  3O5G A;  1NWS A;  1DGV A;  4MAV A;  1JVW A;  4HBE A;  2DG3 A;  2YBU A;  1G8I A;  2K0J A;  1UUS A;  3DVK A;  4MTV A;  4G50 A;  2LLT A;  4ZPT R;  3KAG A;  2KGR A;  3I5F B;  3OA5 A;  3VRQ A;  4CFQ A;  4M2O A;  3IF7 A;  2NXQ A;  4WKA A;  4BF8 A;  1H8B A;  2GV5 A;  2O60 A;  1UHH A;  1AHR A;  3I5F C;  2L2E A;  4DS7 A;  1CLL A;  5CPV A;  1CB1 A;  4HRE E;  3OX5 A;  1ODB A;  1XFU O;  4FN2 A;  2NLN A;  2KAY A;  3KCE A;  3AQU A;  1KFU S;  1BT6 A;  2L98 A;  1OGB A;  2F21 A;  2H2K A;  5J6E A;  5D75 A;  2L4H A;  3AKB A;  1E8A A;  4P5O E;  1RK9 A;  2KFH A;  4AOM A;  3BUM B;  2KI4 B;  1E6N A;  3PN7 B;  2NZ0 A;  5AEQ A;  4XJK B;  3SG3 A;  4L3N A;  2E6W A;  1S26 D;  3W4R A;  1QLK A;  4NSB A;  3DVM A;  1QX2 A;  2KI4 C;  3BOW B;  1TNW A;  1EH2 A;  3KEV A;  3PN7 C;  2LVJ A;  2LV7 A;  3O5D A;  1WAW A;  1E9L A;  1NSG A;  1NH6 A;  1E6R A;  3ALF A;  4MZJ A;  4U86 A;  4FTG A;  2LVK A;  1CTR A;  1TN4 A;  2V53 A;  1CDP A;  2G8Z A;  4MNL A;  4MVF A;  3IQO A;  2ZND A;  4WIW A;  1NWU A;  1ZCN A;  4TNC A;  4Z2G A;  1TNQ A;  3EKJ A;  2O92 A;  4DH0 A;  1KWO B;  2WM0 A;  1TFV A;  4PHJ A;  1UHJ A;  1FKH A;  1WLM A;  2M49 B;  2M9G A;  4P8V A;  3D10 A;  2KGB C;  1KWO C;  4ORB B;  3O2P A;  5AER A;  4ZPV R;  2KI3 A;  3NSO A;  1PRW A;  2FOT A;  2WOR A;  3CLN A;  4YI9 A;  1SL8 A;  1LIN A;  1OWQ A;  2AMI A;  1FKJ A;  4Z2I A;  5HLO A;  1CTN A;  5DIU A;  3QOK A;  2ITK A;  3D0Y A;  3EVR A;  2BE6 A;  2JTZ A;  3SJS A;  4PHM A;  3ARW A;  4YGE B;  1HXV A;  3IK8 A;  1A7X A;  3KAC A;  3ARX A;  1EJ3 A;  5HUA A;  1Y0V H;  4NDD A;  1HJX A;  3I5G B;  1KQM B;  5HKW A;  3HX4 A;  1AJ4 A;  4E68 A;  4P8U A;  1T11 A;  2MRD A;  4D1E A;  1WDC B;  2HET A;  2JC2 A;  2LVV A;  2PRU A;  3PRA A;  3I5G C;  1K9U A;  2BCA A;  1KQM C;  5JJG A;  3ARR A;  3CWG A;  2LMV A;  2JT0 A;  1WDC C;  1LL6 A;  1XRV A;  1OQP A;  1OMD A;  1SK6 D;  1VF8 A;  4DRW A;  4Q04 A;  4QIB A;  5HW8 A;  4CID A;  2K61 A;  1V1G A;  1MHO A;  1NUB A;  4JPZ B;  1ZUZ A;  1Q6H A;  3PRB A;  2KI6 D;  5AXI A;  2WND A;  1ZBK A;  4DWS D;  3JXV A;  2PV1 A;  4KR0 B;  3RM4 A;  3VGO A;  1FJD A;  2PV3 A;  1G33 A;  2F3Y A;  5I98 A;  1LJY A;  3NI6 A;  5DIV A;  1XA5 A;  2Q4U A;  2LHI A;  4Z2H A;  2K7C A;  2BBM A;  3CR2 A;  2IS9 A;  2AWG A;  1ROU A;  2OFN A;  3I5H B;  3EK4 A;  4I5K A;  2M29 A;  3VAW A;  1LQ0 A;  2WOS A;  1QV0 A;  2XP3 A;  4Z2L A;  2KI6 C;  3AS1 A;  3I5H C;  3IKG A;  1NMV A;  3H9R B;  2DSW A;  1FAP A;  1FBV A;  1MXL C;  1F4O A;  2XP6 A;  2NCP A;  1FI6 A;  1YR5 A;  1UHN A;  2SAS A;  2VRG A;  4UPG A;  4NQG A;  1BG1 A;  1YTZ C;  1KK7 Z;  2IUZ A;  1DGU A;  3JYM A;  2OLH A;  1A4P A;  5DF0 A;  2QPT A;  2MLE C;  1NCZ A;  3O5E A;  1FKT A;  3KO0 A;  1FKK A;  4C0K A;  5DIT A;  4ODM A;  4P2Y B;  3WD0 A;  5TNC A;  2PSR A;  1F40 A;  4MBE A;  5HWB A;  3KPX A;  2FJU B;  5HYD A;  3OHM B;  1GGW A;  2CCM A;  1J6Y A;  2A3C A;  2N87 A;  1PBK A;  4G2P A;  1SPY A;  1YUS A;  4ODP A;  1DJX A;  5BPJ A;  3A4U B;  4OV2 A;  3VRN A;  1NWD A;  1K90 D;  4GGF C;  3PM8 A;  4I5J A;  5KSZ A;  2H61 C;  1W1P A;  2LCP A;  5I8N A;  4FAP A;  1QX7 A;  3CTN A;  2L4I A;  1HQV A;  2SCP A;  3EK8 A;  2F4E A;  1CLM A;  2DOQ A;  3WD4 A;  1ITX A;  1RJV A;  1MUX A;  4YGA A;  3RME A;  3DVE A;  2PPO A;  1WB0 A;  2ZQU A;  2BEC A;  4GAO A;  4MSP A;  2KSP A;  4DRM A;  1F71 A;  2XP8 A;  1B47 A;  2L50 A;  2KHN A;  2M1I A;  2I18 A;  1IJ6 A;  5HT1 A;  4ORA B;  5J3X A;  4MLW A;  1K94 A;  4MRX A;  1TTX A;  3CR4 X;  1UHK A;  5CSN A;  2G2B A;  4HRG A;  5PAL A;  1BJF A;  1KK7 Y;  1S3P A;  3UI5 A;  1KFW A;  3ODK A;  3ICB A;  2FCE A;  1K95 A;  1SRA A;  2BCB A;  1IX5 A;  2CBL A;  1FKR A;  1NX2 A;  3M0W A;  2MAZ A;  1S6J A;  4DT4 A;  2LLS A;  1UWO A;  2CNP A;  2L51 A;  2MLY A;  1F55 A;  1OOJ A;  3WD3 A;  1WNO A;  2MHH A;  2MBX A;  4GFT A;  3SIB A;  1CFC A;  1YAT A;  2KQY A;  1K9T A;  1YRU B;  1LG2 A;  4NDB A;  1YUU A;  1OSA A;  5I2O A;  1YUT A;  1NWT A;  3UI6 A;  5CSF A;  3CGN A;  1DJW A;  2OTG B;  2GGZ A;  2K7D A;  1MWN A;  3PAT A;  1B7T Z;  1SL9 A;  2L2S A;  1PSB A;  3SG2 A;  4USL A;  2OTG C;  1K2H A;  1UUR A;  1B4C A;  1U5I A;  2COL B;  2JRF A;  4QJ4 B;  2GGM A;  1PVA A;  4ORC B;  1FFR A;  3OB1 B;  5ER5 A;  1K93 D;  1NSH A;  3UF8 A;  2F3Z A;  1QJT A;  1M39 A;  4GIV A;  2PI6 A;  3GK1 A;  2K2F A;  2KR7 A;  4TYO A;  4TX0 A;  4CPV A;  2KQ6 A;  2MLZ A;  1AVS A;  1GUV A;  1CNP A;  3BQ3 A;  2QF8 A;  4S3J A;  4XAK A;  1J7P A;  4ICB A;  1PSR A;  2LE9 B;  1YW5 A;  3FS7 A;  1IKU A;  2KFF A;  1JC2 A;  4TNS A;  2XP4 A;  3RFW A;  3B7X A;  4DCK A;  3QRX A;  5K89 A;  1SW8 A;  2KDH A;  1B9A A;  3WNX B;  2JZV A;  2RUC A;  5GQQ C;  4JWQ A;  1ALW A;  4NZC A;  1H0G A;  3O5P A;  1J55 A;  4U85 A;  1QIV A;  1MR8 A;  2ISD A;  3BUW B;  2JPT A;  4ITZ A;  1L7Z A;  2KYC A;  1XK4 C;  4W9P A;  4OKH A;  2DT2 A;  4NNR A;  1B7T Y;  1QS7 A;  4IL1 A;  4TW7 A;  2A4J A;  3AS2 A;  1BOD A;  1CM4 A;  2ESC A;  1JF2 A;  1EHN A;  1FW4 A;  1E6Z A;  3G6M A;  1LG1 A;  1BLQ A;  1JUO A;  1H0I A;  1QLS A;  3BUO B;  1YX7 A;  3BUX B;  1IRJ A;  2ZRS A;  1XFW O;  2MLX A;  5HWC A;  1N2D A;  3O5M A;  1F8H A;  1A2X A;  4WK9 A;  1IJ5 A;  1IWQ A;  1DF0 B;  1WLZ A;  2LP3 A;  2JTT A;  2Y1M A;  2I7A A;  2ZQV A;  3GK2 A;  4XYN A;  4MNJ A;  1D1O A;  1DJY A;  1W7J B;  2KAV A;  1DJI A;  3WQW A;  1AJ5 A;  4GBA A;  1ZBV A;  3NRK A;  4U84 A;  4AY1 A;  5BXJ A;  3B9A A;  4ODN A;  1QAS A;  1J4H A;  1EL4 A;  4ZPW R;  2JXC A;  3G6L A;  1EG4 A;  3WHT B;  1RWY A;  5JOL A;  1TIZ A;  3DD4 A;  4IT6 A;  1NX3 A;  3TZ1 A;  2JWW A;  3EVU A;  2FAP A;  2P6B B;  1PIN A;  2M7N A;  3SG7 A;  4U8D A;  4I5N B;  4MNK A;  2LMT A;  3LK1 A;  3LK0 A;  5HW6 A;  4C02 B;  1QV1 A;  1F4Q A;  4PHK A;  3SIA A;  2F8P A;  4AQJ A;  4IPX A;  1BMO A;  1NYA A;  1Y6W A;  3ARY A;  1ZMZ A;  3NSI A;  4AQI A;  2MNT A;  4L9M A;  5CSJ A;  3ALG A;  4S3K A;  1D7J A;  1OMV A;  2FDM A;  3BOW A;  2JT3 A;  3TDI A;  3WHU B;  2MF9 A;  3IHZ A;  2M2A A;  1M63 B;  1OE9 B;  2I2R E;  1W9U A;  1D6O A;  4HAR A;  1JFK A;  1BOC A;  4R5E A;  4JYS A;  3HCM A;  2JZI A;  4Z2J A;  1QXP A;  3B8S A;  4ODQ A;  3SG4 A;  2KNE A;  4ODK A;  1R6P A;  2LAP A;  1LKJ A;  1Y1X A;  3AS0 A;  1XFX O;  2F33 A;  2KBI A;  2OS8 B;  2PV2 A;  5HLV A;  3EKH A;  1X02 A;  2BKH B;  4PE1 A;  4DWS B;  3VRO A;  4LAW A;  3NSK A;  2OS8 C;  2EHB A;  3RM1 A;  1F70 A;  1L2O B;  1IQ5 A;  2LAN A;  4DWS C;  3TCZ A;  4PCW A;  3O5L A;  2O5G A;  4IQ2 A;  2ZQT A;  1P5Q A;  3O5J A;  1AP4 A;  1L2O C;  4N19 A;  1LA0 A;  1QIW A;  1CMG A;  1QPL A;  1XFY O;  3CHD A;  3CHF A;  1CFP A;  1KK8 B;  3ARS A;  3E3R A;  4JQ0 D;  3ARQ A;  3WD1 A;  4P8X A;  4HRH A;  4YBH B;  2WCF A;  2FCD A;  1FKF A;  2ZR5 A;  1BR4 B;  3ARU A;  4C0L A;  1XFV O;  5G08 A;  4DRN A;  1KK8 C;  2A3E A;  3ZNI A;  3MDY B;  3ARV A;  3IQQ A;  2DPE A;  1FPW A;  2Q91 A;  1ROT A;  1BL4 A;  4NDC A;  1H4B A;  1KCY A;  5HBF A;  3GPK A;  1D2K A;  1CFF A;  3O5I A;  2KBM A;  3TDZ A;  1XHG A;  1AUI B;  1WY9 A;  2LP2 A;  2AUC A;  3AS3 A;  2XP7 A;  4YRU A;  2HPS A;  1ZFS A;  4R1E A;  4R0X A;  4QJ3 B;  2CXJ A;  1K9P A;  1W9V A;  3BXW A;  1PAL A;  1DJH A;  4MN0 A;  3CGM A;  2KE0 A;  2WK2 A;  5JH8 A;  1S5G Z;  4N1G A;  3O6B A;  1LA3 A;  3CZ8 A;  1W9P A;  1DVI A;  5HKZ A;  1CDL A;  3DF0 B;  3WIJ A;  3A8R A;  2K8M B;  5CSI A;  4QT3 A;  4W9Q A;  1E15 A;  1REC A;  1Q6U A;  1SBJ A;  3ARO A;  1TRF A;  4MRY A;  1W1Y A;  2AAO A;  1WRK A;  4A4B A;  2EGD A;  1D7H A;  4M2P A;  2WCE A;  1D7I A;  1EIB A;  1NX0 A;  3WD2 A;  3CR5 X;  3PFV A;  3NXA A;  4PE0 A;  1JBA A;  1PK0 D;  1HKK A;  3IKD A;  1Q1C A;  3K21 A;  4LAX A;  3WKZ A;  1RFJ A;  3CS1 A;  4QT2 A;  2KOT A;  4PE4 A;  1SYM A;  2BE4 A;  3UQB A;  1GPF A;  2KYF A;  1S6C A;  1J7O A;  3LUO A;  3EK7 A;  1EXR A;  5I2Q A;  1QX5 B;  1MQ1 A;  3OOB A;  4WJX A;  5HW7 A;  2XPB A;  2EC6 B;  1HKJ A;  1QTX A;  1J7Q A;  1DTL A;  2LVI A;  1A03 A;  2ZKM X;  3F45 A;  1TNX A;  3LLE A;  3O4Y A;  3CH9 A;  1PUL A;  4Z2K A;  2R2I A;  1CKK A;  1NIW A;  2EC6 C;  2KAX A;  1J7R A;  3ARZ A;  1OZS A;  1SMG A;  3TS5 B;  3TDB A;  3KAB A;  4TW8 A;  3KAF A;  1E6P A;  4JFK A;  3CZT X;  1M46 A;  1FF1 A;  1OZO A;  3TS5 C;  2M1U A;  4MGV A;  1B1G A;  4GGF A;  3BXK A;  2B1U A;  1HT9 A;  2H61 A;  2LUX A;  1FI5 A;  2DSV A;  1W26 A;  2JT8 A;  1Y1A A;  4BY4 A;  3CHC A;  4JFI A;  1W7I B;  4MZL A;  4BY5 A;  2I94 A;  4ZCU A;  2DT1 A;  1OMR A;  4GUK A;  4JFJ A;  4J4N A;  1CFD A;  1RTP 1;  2DSU A;  4DRK A;  3I5I B;  2JNF A;  1C7V A;  3O5F A;  1SR6 B;  2ZR6 A;  2ZFD A;  1M45 A;  4OCI A;  3FXY A;  4GNK B;  1YUR A;  2JUL A;  4WQ3 A;  5F6T A;  4MPK A;  3VRP A;  1CLB A;  3I5I C;  3ART A;  1C07 A;  4TW6 A;  1SR6 C;  1CM1 A;  2M1K B;  1J1D A;  4L72 B;  1CDN A;  1NCX A;  1B8L A;  1QAT A;  1ALV A;  1FFQ A;  1G4Y R;  2D8N A;  1GJY A;  5HKG A;  3O5Q A;  3NTP A;  4WKH A;  4J4O A;  1BU3 A;  2BL0 B;  4MZK A;  1QZ2 A;  1KQV A;  2OPO A;  4ML4 A;  2MLF C;  3D0Y B;  4LGX A;  4PHN A;  1JF0 A;  3EVV A;  2DSZ A;  3RGC A;  3BYA A;  2F2D A;  2DT3 A;  2BL0 C;  2LMU A;  2Y4Q A;  3TDU A;  1U79 A;  1XO5 A;  1J4I A;  2M97 A;  4YGC B;  3BUN B;  1HJV A;  1KSO A;  2M8U A;  1NPQ A;  5HTG A;  3AKA A;  2RUR A;  1RRO A;  4ETO A;  2WCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...