4MSWA

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA02
4I77L 5ICYA 1I1AA 4E9LA 4DK6A 2AEPH 1NC4B 4DQOL 1QSFE 1QFHA 2FX9L 4MD4B 1QACA 5HDBE 1A1NB 5EN2A 2HJLB 2JJTA 1Q9WB 1B90A 3QT2A 4RQQB 4Z0BL 3OR7B 4OZFB 2W0LA 2EH7L 3IJYB 4I4WA 3SKOA 2QSCL 3R1GH 3UBXB 4OF3A 4QYOB 2VKXA 3IRPX 4MDJB 4DW2L 2Q87A 1J8HA 4N0FB 1H8OA 2DQTH 4LCWD 3T4AB 5I16B 3MJ9H 35C8H 3UJTH 1A6AA 3LN4B 5FAAA 4JRXE 4XH2B 5IG7B 3V8CA 2E7BA 2H3NB 4FFWC 5E8DL 4OV5B 4Y88A 2BOBB 1RPQA 5GS2H 1YEIL 1MHCA 2VLKE 3QHZH 3U82B 1QOKA 4W6WB 4PGCA 3MNWA 4OCWH 3FJTA 5DUML 4KQ3H 1S7QA 1UB5A 5DJ2B 2Z0BA 3GUTA 5T1LB 1XF2A 4L8SB 5DS8B 5FB8A 4MS8D 1P4BL 4GSDH 4NKOB 4QXTA 2Q3AA 3GSNA 3MZTA 3L3IB 5HD8C 2DQGH 5HHOE 2QQQA 4OZGB 3VXMB 3ULUE 1JWUA 1CVSC 2EE3A 4PYGA 3MGOA 5J13C 4TPRH 5ILTH 5JW4R 3I75A 1H3TA 2LTQC 3GSOB 2PYEA 3TIEA 1A7NL 4XRCA 4ZUSA 3C5ZB 3HPJA 5EB9A 1ZE3C 4Q9QL 2DTML 5IQ9A 4S0SD 1IC4L 3QPQD 4PJ7B 3R4DA 4I1NB 3DXAD 5LXGL 4MNGB 2FBOJ 1DANU 3IF1A 3QUMH 4XH2A 4MVBD 2NX5D 5IIEA 1U8LA 2UZIH 4UT7H 1J0JA 4XPHL 1JUFA 5TF1L 1X4YA 3S37X 1BQHA 1SJEA 2DQCL 3TV3H 3C2AH 4MDJA 1T7ZA 5C9JA 4P4KC 2X4UB 3ECBB 3IDNB 5GRUH 5BO1H 2X41A 1WAAE 3WXVH 2E5EA 1MELA 5GISH 1WFOA 4QCIA 1OSZB 1N0LA 2BNRA 4RRPG 2BERA 3VD3A 2ATPA 4IIQB 1M05B 1PYWB 3FFCB 3PWPB 1J0KA 1OF2A 4XVUD 1U8JB 4MA1C 1SY6A 2P7TA 2QKIB 1SEQH 2X4SB 3V5DB 3ZYOA 5EU4A 4KK5D 4Q2ZB 1EAJA 2X05A 5DHYA 3MR9A 2CK2A 2DQFA 2GITB 4FFYL 1NCCL 2LV4A 1ZTXH 4KWUA 4R97B 3UBXI 5C86A 2R1XA 5DK0A 1YUHB 4HXAL 1KSRA 2X89D 1BF2A 4EDWH 1HNGA 5H37H 5TQ0H 2R23A 1NCBH 5D4QA 3BGMB 4HHAA 5ETUB 1ZLSL 3WFDL 4P5TA 1E28B 1RK1A 4L4VA 4ZYKB 4YDLB 3VCLB 3S8WA 5K9OA 3DXAA 4BQ6A 3QRFM 1NGPL 1JP5A 3U0PB 5IT2L 4ETQB 4JFFB 2FYYA 3ZYZA 1QD0A 3ZE1E 4XCNB 2D03H 2QQKL 2VC2L 4WHTB 4KQ3L 3UPRA 3D2UA 1NGZB 3PXHA 1KLUB 4PV9A 2XKNB 1YQVH 5FB8B 5E2VL 3IVKA 3BKJH 3RDTB 4R26L 2ZPKH 3PWUA 2HT4D 2W59A 5BJTA 4QRUA 2NY4B 4IRJA 5M7QA 4M9PA 1U0QA 3MV9E 3LPGA 4MNQB 4HGMA 1Z5LA 3KDMB 1M7IB 2MFNA 4LCIL 3W11C 3V5KA 3VXUE 1WWAX 4XNUL 2CMRH 4NRYA 2R1WB 4K71C 1T6VN 3OAYK 5CJQH 4Z7WF 4OQTA 4P46A 4YHOL 1WEJL 5C0EB 2OR9H 4MQ7B 2QSVA 1UKQA 1JPSH 1MCWM 1AD0A 1XH3B 5EU6A 3H9SE 4UT9H 3KXFA 1WZLA 4OFPA 3QUZA 2F5AL 3MGAA 4RA3A 5F1SA 4UTAL 2EC9T 2NPLX 4AZ8A 3ULUF 2K1MA 4PJ9A 4QF1A 4NCC1 2GK2A 3T2PA 1QLRA 4IJ3C 1P7KA 4WHYH 3P77A 1VCAA 2E6JA 2UUDH 4IMLB 5SWQA 5L7XH 2DQHH 1LDPH 3HUJA 5KW9L 2VR9A 3GSWA 2WBJD 2ED8A 5IV2B 5FGCB 1ED3B 5EZLA 1INEH 2ATKA 1T21B 4HIEB 4NT6B 4J2XA 4AM0B 1G7IA 4I0PD 5EFIB 4XXCA 4XNZC 3FRPG 1NAMH 3CLFL 3TC9A 5JQHC 2VZ1A 3DUUB 4FXGB 3RWHB 1SEQL 4K2UH 2A6DB 3F5WB 3M17B 5E8NB 3O3AA 2QHRH 4F9LA 2VSCA 1EAPB 1F3JA 1K8IA 1NCCH 4HS3B 4NDMB 4OLWL 3KPNA 1JI1A 3CLEL 3TVMB 1FFPA 4UINH 2K3TA 2HMID 3QHFH 3S96B 3L7EA 2R0ZH 2NZ9C 1CE1L 4YO0A 1GZQA 5F7MC 2EDJA 1KPUA 1XGUA 3THMH 5LKNA 5D7IA 3MCKA 4XAWL 4L9LC 4PD4K 2EECA 3BFOA 1UXWA 4HF5H 2BX5A 2VH5H 3E6HB 4DFHA 1ZHKA 3EJYC 4FQJH 2QBWA 3TA3C 6CGTA 1MIEH 2VN4A 4JFFD 2DI7A 4Z0XA 2XKSA 5TE6H 1RUMH 3QWRA 2ZP0T 5FDWB 1HI6B 2P42B 1Q94B 4PJ7F 4PJ5E 4Q0XL 5IVNA 3HLAA 4PJGF 2NY2D 2FX8L 4QHLB 1ZT1A 2JJUA 3FB5B 4UDTB 5HHPA 2YC1B 5LWYL 1ZGLB 3MRIB 3CZFB 2KUTA 5E94B 5FYJU 3VDBA 1J88A 3KPLA 4KFZC 4Z7OF 5CSZA 4QTIH 1YN6A 3D69A 5E56A 2C4FU 5C0DA 3GBLA 4XVSL 3V5HB 5F1NA 3NABL 1OAKL 3Q0HA 4JZOB 4HJJH 4P9HC 1CGYA 1EEYA 1KACB 4PG2A 2DYPB 1ZGLA 3AY4A 2YRPA 5EU6E 3T2OA 3ARFB 4NGHH 4JFED 2H9GA 4W6XB 4U3CA 1T1YB 2NY7L 2OLDA 4YWGL 2EDDA 1G7PA 5HYEA 2A74A 4UT9L 5D6CA 1T1WA 5IB5A 2HJFA 3E8UH 4JGJA 4Z0XB 5C07A 4LLVB 5E99H 4WWKC 1TTUA 3B9KD 4QY8B 1I85A 4ONFL 2E3VA 3OR6A 4TN9A 3RHWF 1P4IL 3GRWL 3BHBB 3N1MC 4IHOA 5CZVH 1DVFD 3DSFH 5JLZB 2I07A 4M6OL 1T2XA 4N1CA 5J06A 5BW7C 5CCKL 4PRID 3TPKA 2ZCHH 4IRSA 3KLAA 3L3OA 4ZUUB 5L2KE 3CH1B 1BFOA 3LRSB 2JJSA 4HV8B 3MROA 2CQVA 3QUYB 1B3JA 1DBMH 4ONGH 2AJUL 3UROR 3T0EB 2AXJA 3QWQB 4IDLA 2XTJD 4PRAB 4HUWB 3GMPA 5DRWB 4YK4C 5M94B 4MQSB 5F7EL 5C3TA 4EKXA 4M6NL 1IGIH 1QRND 1NGXA 4FOMA 4RGMB 3NAAL 3QHFL 2D7PA 1XF5B 1T66C 4NZRH 2A9ML 4Q2ZA 3QR2A 5A2IH 5EU4B 3FQRA 4HCRL 4Y5VB 5D7IE 1OHQA 4Z78A 4E5XA 1G7IB 1RJYB 5E5RB 3S4SG 4FQ2L 5DJ8A 4FXKA 4D0CB 1VACA 1IAII 2ZUWA 3D85B 3ARGD 3TBTB 2HG5B 3QQ3B 5I1AA 3I3BA 3VFGH 3C09B 1JYXA 2OCFD 4N9OB 4GMTL 4KI5F 5GZND 1UADC 3TT3L 2V9TA 4N1EA 2CKBB 2WBWB 4ODWA 2VDRH 4XC1L 5KZCD 3U9PH 4Q58C 5JTWA 2YUVA 3OKLA 3G5ZB 4S1DD 3ULVH 1XGQA 1DUYB 3DARA 5MEQA 3MRDB 2F54D 3F12A 3FQNB 4YX2L 4I5BA 4J8RB 5FUCC 3C60D 2LE9A 2VISB 1TETL 4LLWB 1LNUA 2HN7A 5EULV 2DQDH 4A6YH 5EPMB 1IM9A 4JJHA 1WFTA 3RX7A 5L9DH 1EXUB 4JJ5B 4F58H 4XVSH 3C6LD 5DEZA 3DV4A 2LFGA 4JANB 1E4XH 4FTVA 2FH8A 2VITA 3FO9A 1CIDA 3CNKA 4OAWB 1KNOB 3MBEB 6FABH 1PZUB 3D2UB 3EOAB 1ZVYA 1O5DT 4J6RL 1TZHB 3QI9D 5CILH 2C7UA 4BSVB 5EORL 3KPSD 2ESVE 4ONFH 2R2EB 4YFLI 1ZKAA 1AJ7H 4WW2C 4MJ5A 5C0RL 1I9EA 3AS2A 4U6YA 5D2NB 1T03L 2AJ3B 3SCMB 5EZOH 5FKPB 1MVUB 2IALA 2NQCA 4P2QB 2VDOH 3CFBA 1NJ9B 1KCVH 3OAYH 4M93B 2VXTL 3ZE1F 1MI5D 4M5ZL 3T08A 4ZS7L 1A22B 4KHXL 1M7DA 2P44B 1FNGA 4Z76A 4PGBA 1G6VK 5DFVC 1FLRL 2EDHA 4QYOA 3MRPB 1KXQE 3O81A 4H88L 4U3XA 3DUHA 5F72S 1UCBH 2H26A 2HH0L 5F7EH 3MREB 4WIQA 2EDTA 5DVNA 4L3EA 3VFPB 4NM8L 3MXVH 2DWDA 1F6AB 3BRDA 4PJAA 5C09A 4KKBC 3DX7A 3BPCA 2AK1H 5T1KB 3ZSSA 2D7OA 1JIBA 3QNXB 3ZE2F 4HBCL 1T04B 1E6JH 4FHBD 3DRTB 3NGBC 4IIQC 3MUY1 5C70A 5D9SA 4ZTPL 4YGAB 5IMMA 5DLMH 1HZHL 1HHIA 3V6BR 1I7TB 1OCWL 1VPOL 1KB5A 1F4YH 1P7QA 2FZ3B 4LSUL 5FECA 4WEUD 5C2BL 1WBYA 1WJ3A 2ITDA 3SO5A 3T2NH 2O5YL 1M7DB 3F7YB 1MRDH 2IPUG 3KLSA 1BQHB 1KC5L 4ZPVA 3QAZB 1DJSA 4I48A 3W9EB 3WIIH 4JRYE 3MFFB 1BQLH 3CFBB 5J57B 1DUZA 3QEQA 1SBSL 2A0LC 3CXDH 5FDYA 5I1GL 3NPSC 1QA9B 2B39A 4YX2H 2PYFB 2ID5A 3BPOB 4RZCA 1R3HB 2AJ3A 4POZD 2E8ZA 3NIDF 1QBAA 3JVGC 2EC9U 4DUXA 1N0XH 1UM5H 3NCCB 4HPYH 2XG5A 1DLFH 3V4UH 4NRZA 3HAEH 1IGFL 3BD4A 3L3DB 4OBSA 4F33A 3QO0B 3ILQD 2NY6D 4PJBF 2CLZB 1JGVL 5IW3A 2ORBH 2GSGA 3GI9H 4JKPL 4NKIL 4OAWA 2VQTA 3S35H 1FAIL 1GIGL 6FABL 3S36H 5I17B 4JVWA 2O5XL 2EYRB 3ME0A 4JANA 3DV4B 3P9MA 3TNNA 3NZ8A 3MNWB 2R0LH 1PY9A 3WIHL 4GJTB 5EPMA 4J23A 3TZVC 4P2OB 5AZEL 5TH2A 5BXFB 1TQBC 5FUCE 1KPRB 4LBEB 3GJEB 3CSBA 5E4EC 3RJQB 4FP8H 4L4TE 3KLDA 3HMXL 1XMWA 4H8WL 3QDGD 1NUGA 1TIUA 5C0GA 4QXWA 1Q72H 2F53A 1FYHB 2DTSA 1CLYH 1N5AA 3QIWA 5M95B 2J12B 5CGMA 1FYTD 1R3KB 2WANA 3G5ZA 1CD8A 3UBXA 5HGAB 4XVTH 4AQOA 2B0SL 2E9WA 4CADB 4BYHA 4MA1B 3BH9B 4HEPG 1HIMH 3SGEI 2APTA 4RMWA 1MREL 3KR3L 4HH9B 4B7LA 3VXSD 5E2TL 4ENEC 4P2OC 2W0FB 3AAZB 1K3IA 1L6XA 1UZ8A 4RMUA 4PJCA 3QDMB 4WW1B 1J1PH 3SOBH 1RIVL 5HHVL 3BESR 4OQTL 1S9WA 4H25A 4NZUL 4HBCH 3UJJL 4OZIE 4OLYH 5DJXA 1P5UA 4WI4A 1UH4A 2QL1A 2R56L 3KPRD 4HUWA 3K8LA 2NXYB 5B39A 4QNPE 1NANH 4X8XA 4ONHA 3ULUH 1JF1B 3JV0A 1PLGL 5HVHB 3OGCA 4G8GB 4XXDA 1XF3B 4HAFA 3NIGE 3ARYA 1JNNL 2W9DH 2YPLD 4YHIA 3S6CA 4UNVA 4LRNL 2ZNXA 2WBJA 4U1LB 4UQ3A 1T1ZB 4HDIA 1A7QH 1DQLH 4R4BA 3T1FA 3WS3A 4CVZB 1XIWC 5JOFB 1CFVH 3CH8A 3VW3H 4JDZA 3LHPL 5EU5B 5HYSG 4WTWA 1D5XA 3OR6B 2DBJA 1MCOL 3KYAA 1QSED 1RZKC 5MENE 3HZYA 4HK3J 3TGXA 2AJVL 1T1WB 4UAOC 2QSQA 4LVNC 4DCQA 3HC0A 5GGUB 5INCA 4TOYH 3ZKND 1CXFA 4JFDA 1HXMB 3ZKMC 4R2GC 3BMVA 4ZSOA 4Q6IB 4L5FL 2GK0A 3S36L 5IJKA 1OWWA 2NTFA 3VWJC 4E0RA 4G9FD 3VXSB 3MODH 3DBXA 3LSOA 1D5ZB 5DMGD 1F8TL 3VGBA 2X4PA 3PWJB 2BVQA 3SE8L 3O3BA 4TUJB 5C0FA 3HPLA 3KS0H 3QULB 5DUPL 1EFQA 3OKEB 1AE6H 3PV7A 3BEWB 1DVFA 1LO3L 2HRPH 1GGIH 3C5ZC 2IMMA 4JZJB 5SWZD 1JBJA 2FJFA 4K3EH 5IK3A 1MRCH 4NQUA 2F53E 1NSNL 4LSDA 5D96C 3ULVD 3MLTA 1NC4D 1TDQA 2WWMD 5KSUA 3U2SA 4Q6YA 4PP2B 3U6RA 1K2DB 4H20H 3JTTA 4Y16A 1RUQH 5TDNA 1HSAB 3WE6B 5MI0C 3TVMD 3T0VA 1EDQA 1MI5B 1IAMA 4KMQA 2ZSWB 3N1QC 3D85D 3QUKB 1A2YA 5DC4B 1VEMA 2A83B 2MMXA 3VJ6A 4GMSL 2WLZA 5D7IB 1P2CA 4O2FA 3OKMA 4UV7H 4ZD3L 3HNSL 2Z4QB 4I0PB 2E27L 4OZIA 1JGEB 4HS8L 4D3CH 5I74B 1LE5A 4ZXBD 1AGBB 3MLRH 4LCYB 4LP5A 1B4JL 2FL5A 3DROA 3P30L 1XCTA 4JQVC 5DWUL 3MCLL 5IVZA 5ACZA 1FCGA 1INQA 4OCLC 1MAKA 2WAHA 3IU4H 3OXSA 4PJHA 1GH7A 4MB4A 3ES6A 2BVOA 1RSFA 3F58L 1BD2E 1M7XA 1GGUA 1MI5E 4HUVB 4K94L 2ZCKL 3S7GA 1R3LB 4XMPH 4AT6A 4Y4KB 2YD3A 2DQUH 5FGCE 3NACL 3TPUB 1IRAY 1O0VA 3Q6GH 5GJTL 1DEDA 3WUWB 4MJ4A 5HDLA 1FO0H 3BZ4A 5EO1A 3OKOA 1L6ZA 4R3SB 1JK8A 1WGOA 4QKXB 4OCMC 1C7SA 1S9YA 4C55A 4AH2A 4PJFE 5IKCB 4PRDB 5CEZL 1C7TA 5IBLD 1IZJA 4TSCL 2ZSWA 5KBNC 4G9FA 3CDGB 4JPIB 1OPGL 1UJ3A 4CVUA 3WKML 2WP3O 3UP1A 3RVWC 1V3MA 3H6JA 3SE8H 5BS0D 5EUKA 2EXWD 1GC1H 1J7VR 4WWKA 4PGDB 2D7TL 4WJ5B 1FNEB 1QZ1A 3EYFA 4WJ5A 4HKZA 4PGEA 2F5BL 1ZSDA 3KYMB 1NSNH 5E70A 2IANB 2AJSL 3HG1A 2XI9A 3LEVH 4RFNC 3QQ4B 3KLHD 3MRRA 3RWJB 4CU6A 3U7AA 3QCTL 2XRAL 1CFNB 4WFFD 2VXVH 4PJ5B 3U48A 1N8ZB 4DOHB 2GKIA 1QFWL 2OL3H 4WU7B 5C09B 1YY9C 3BAEL 4NC1C 3SJVD 5ICXB 4TUOA 5I8EA 4BH8B 1TXKA 4JREB 1ZLUK 4XPTH 5DC0A 2FLBT 2MOVA 4DUWA 3WSQL 1RK1B 1P1ZA 2EDQA 5AEAA 2VLRE 1FP5A 3CFEB 5CEZD 1QFUH 4JREC 5D1ZC 1MCKA 4JY4A 2V5RA 4YHNB 4Z7VF 4O58H 3TJEH 4ZTOL 1K4CA 4ORGB 1MJ8L 4G6AC 5I15L 4RGOL 4G6JH 1C1EH 3KYNB 3MRQA 4J1UB 1PG7L 4ZMAT 2OMBA 2X7LB 3OHXB 2HFEB 4JY4B 5I6XC 4JKMA 4DGVH 5IJVA 2VAJA 3IU4L 5I75C 4FFWD 3VE0A 3MRKB 4NPYA 2X9XA 3HR5A 4G7VH 1N6QH 1J1XH 3GMRB 4HPOH 5E5MB 5I66A 1MJ7H 1BBDH 1N8ZA 1DQJA 3FFCA 2BJML 5J9PB 2XA3A 4DKDC 2YPVL 4JCMA 2MQ0A 5CKAA 1OY3B 4JM2C 4PIRF 3IAQA 3TCLA 3T65B 4TVPH 1C16A 4BK4A 1EIBA 2Y23A 3OAZK 5CJ5A 1VFAB 3W9DB 4K8RC 1T1XA 3GSVA 3L3JA 2NR6D 4M4RA 1EZVX 4NN6B 3DMMB 4BUGA 1L9MA 5K9JL 1U8LB 1T89A 2OTUA 1UH3A 4NQVB 4I0CC 3OB0H 3RWIB 3UAJD 5FCUH 2VE6B 3ZDZF 5FA3B 4EN3A 2SEBA 3AM8C 4TVPE 3MV9D 4PJGB 2DMKA 3MXWL 2UV3A 5JQ6L 2G60L 4NQCA 2P8PB 1DE4B 5F7DA 4LFHD 1OARH 2NZIA 4Y5XB 4NQVA 1LO2H 4NHCH 1UB6A 3GJFA 2FJGA 5I18L 3MRDA 3NPSB 5EWIH 5B39G 1D9KB 1GOGA 4OZIF 2X1QA 4P4KD 3B8YA 4TQEH 3E3QC 5HYIA 1OD7A 2VLLB 1OAXL 1P7QD 5FF6A 1MH5A 3BEWA 4YHKH 3SCMD 3WNLA 1T7WA 3WV0A 5TFSH 1CK0L 5I1KH 5JPNA 1NGQH 5T3ZH 4RAHA 4TSAL 3TPUA 2ADGB 3I02B 3EIFA 3GKZA 4F7CB 1D5MA 5DJZA 4XVUC 4P23B 5FOBB 4MGXA 1ZANH 2X70B 4KK5C 4QOKA 4XCFH 3WYRA 1T20B 4X6DF 5D7IF 2FX7L 5D1XB 3BEVA 1LK3L 1U91B 4BJLA 5B38G 5B8CB 4YHYC 3SEPA 4OF8A 4ORGA 3WNPA 5CJXA 4FQIH 4KK9C 1Q0XH 4LCYA 5J6HA 5K9QI 1JTPA 2EXYC 4KI5E 4KMTH 1AGCA 2V7NA 4I2XA 3T1FB 3RIFK 5HBBA 5C08D 1P1ZB 4N0RA 1X4ZA 2B1AH 4XBPA 1LEGB 1FFOB 3T4YA 4LDEB 2NY5H 1U8HB 4NZTH 4EZMA 1IEBA 4FQXC 1U8PA 4R8WL 1FC2D 1P4LA 1S7RA 1I3GH 5IROA 4NJAL 5JLZA 2ESVB 4EQ2A 5INDA 3KPRB 2B2XH 3VWKB 3QDJB 1WICA 3TA3B 4FQHA 3K2MC 4LSRH 4K3HA 4OKVA 2JIXB 1E4KA 3KNBA 3TCLB 4CN1A 3C5SB 4JR9L 2NY4D 3BPNB 2WWKT 1YEFL 4XP9L 1DBAH 3IFOA 2HT4C 2H9GB 2R29H 3BE1L 1BFTA 3O2WH 4U4BA 5I73C 2FJFB 5IK3B 5T1KA 3N85H 1H9VA 4KV5F 3KJ6L 4N5EC 4O4YH 4L3EB 1PKQE 1CG9A 2ZSVB 2BVQB 1MCFA 1NCWL 3B9KB 3FAXA 3VXSE 1VFOA 1IGMH 2VUYA 1QSEB 5HI3D 2OTPA 2P48B 5GSRA 5JQ6H 2CDGA 2BNQA 2ENSA 4Z76B 3T09A 4OZ4A 5DRNA 4D2NA 1BEYL 2AEQH 1MOEA 4AEIL 2LTQB 4R3SA 1MCEA 1FZKB 3S34L 2R8SL 4Y7MA 2ADJB 2HRLA 3L95B 3HA0A 3QHZL 3O2DL 4GKNB 1EBAA 3BWUC 4HIJB 1MVUA 2IALB 2AKRA 3REVA 1A9EA 1CU4L 1NAMA 4EVNB 2R2BB 4OFDA 1LE9B 1IKNC 2YN5A 2O26U 2VLJB 4XNYH 4ELKB 3SHSA 1D5MB 2IADB 4HIIA 1RIUL 3VA2C 3F7PC 4ZUVB 4OLZH 4PJIA 4UILH 3ABZA 4O02L 4XXDB 4GSDL 1FFNB 2RB8A 3UO1H 2H2SD 3HG1B 2GSGB 2IANA 3ZTNH 3OXSB 4PJHB 1KNOA 4HIXH 5FO8A 3QXWA 3AFLA 4BSWA 4F33B 3UX9B 2HMIC 3JWDH 4PUBL 1RHHA 1CT8B 3M17A 3AXLB 1A7RL 2BY1A 2AJZA 2CJUH 35C8L 1CD1A 5EOCL 4OD1H 3UJTL 4RZCB 5IWLC 3QUML 2IBZX 3OKMB 4V1DB 3BPLC 1RZJL 2COQA 2BRQA 3QZWA 4UNTA 2B1AL 5ANMA 1OB1B 3CD4A 4DEPB 1WZKA 3HB3C 4ZFGH 1S9YB 1ROWA 1IC5L 4U7SA 4G42B 2ITDB 2BNRD 3KPSE 4NJAH 1HHJB 3WE6A 3WXVL 3MLZL 1QPXA 5LBSL 1SY6L 3REWB 3RPKA 2IPKB 1CZ8L 5DD0H 1TPXB 3VXUB 2PTUA 1QLRB 4XGZB 2I60L 3FB6B 1I7UB 4GAYB 3QIWB 1KCSH 1GGBL 1EJOL 3HI1A 1IBGL 5CS7A 5DGQA 4JZNA 1Q9KA 1J5OH 1DBAL 2ZUUA 1VA9A 4G6MH 2YR3A 3KPOA 3RVVD 3GJEA 4PRHB 5JA9A 4RAVB 1BZ9B 1HQ4A 3VXSA 1YYMH 3E6FB 1FN4A 1SJHA 1QR4A 1QUNA 1D5BB 1U3YA 1FLTX 2YN3A 5LG1A 4QXGL 4DVRL 1JF6A 4LARL 1F90H 1T4KA 5ALCH 3WXWL 2XWBA 2EIBA 4C56A 2ZUQB 4NO0A 4WVRA 3BW9B 4AIZA 4YHNA 2GQHA 5C0AB 3IT8D 4WWKD 4OZIB 4UNUA 4Y0GA 1EBPA 3U30C 4PJEE 1QG3A 1UGNA 2L4OA 5ACMA 4YQXH 4JFFA 3QXVA 2A83A 4NWUH 3DVGB 2FD6L 1LILA 1IQDB 4PJ5A 2XQYG 4KJYA 3VCLA 1KOAA 1HYRC 2UY7A 4MCYB 5FO7B 1FFQA 5GGTH 2FHBA 4LPXA 3DIFB 1DEEB 1FNSL 1E4WL 5I2IA 4KGLA 1YQVL 5ETUA 3VGAC 3BGMA 1JNJA 4BQBA 1F4WL 4KVNH 5JHLH 2FDBP 1YNLH 1U2HA 4H5SA 4YK4B 3U4BL 4ALAH 5JIPA 2EDYA 2VDML 3LQAL 1ZMYA 1UM6H 4YC2B 3HE6D 4CUCA 1WFUA 4WWKB 1NEZB 2X4TB 4LK4A 2H6PB 4JQXA 4FN0A 4M03A 1CLOL 4OD2A 4JDVB 5ESAA 1DVFB 5H35A 2W60B 5I1HL 3HPLB 2OR9L 3QULA 2V2TA 1K8DB 1WFNA 1UWEH 1T04A 5DD5H 1JYNA 4RISH 4OD1L 4UTAH 1C12A 1F6AA 1BIHA 1CICD 3ARGC 2QADC 4WUUD 2HT3D 4ODHL 1A6TA 4M1DL 1U8IA 32C2B 5FYLL 2BFVH 5BS0A 5JXEC 3WDIA 3BW9A 4XWGL 1F3DH 1SVZA 1YMMD 3MLZH 1RIHL 2M2DA 4M1GL 4ZFOL 4HKXB 5BV7B 2F53B 1S7UA 3PQYA 4B0MM 3E6HA 1HKFA 2EEDA 5IIEB 4FTVE 4AG4L 3KYOB 1KG0A 3IF1B 3STZB 4X6BB 4ZFZB 5DD1H 2A6IB 3BO8A 4I18C 3T77B 3ARQA 1JRHI 4K2UL 2O61A 3QDJD 1BIIB 5KVFH 1AC6A 3BGFC 3P4NA 1WCBB 2VB5A 5MEPA 5ID0B 1A9BA 3RX8A 1WV7T 3TNNB 3NA4A 1W72L 3HR6A 1KXVC 1Q9KB 4OJFL 1LP9A 1ES0A 4PJIF 1YYML 3M1BB 3G6AB 4C56E 4OGYL 4HCRA 4F15B 4L8BB 2OYPA 1B0GA 3NFNA 4JFZL 3HI6H 3D25A 2X4RA 4JAMB 5ALCL 3WXWH 2X6MA 2YKLL 2G2RB 3U30B 4QO1A 1CGTA 2G5RA 4FTVB 5T1LD 4LNRA 3HZKA 4HZAA 3L5IA 5B21A 1MFEH 4X0KA 3VH8A 5L7XL 2WIIA 4GAJH 4KUZH 2ZUTA 3K0WA 3W39B 2Z93A 1W0VB 4LCCA 2QQNL 4OB5H 3SE4A 1RV6X 3LKRB 1Q1JH 5IBTL 3IXAA 2VZTA 5GSVA 3ZL4H 1XF4A 4ZFOA 4JFEB 4PJBE 4ODUA 2DBLH 3GM0A 5GGTL 2DQJL 1A6AB 1G7PB 1QBLH 3MLSH 4MZ2A 3M45A 2FX8H 3FO1A 4RA0C 3HE6B 5EOTB 3WFZA 2FWOA 5TDOB 4LHUA 1I7RB 2DICA 3CVIH 2WK2A 1OAKH 1XZ0A 1TJIL 1UWGL 5E1AB 3FOLA 1S7XA 3B3IA 4Y19B 5E8PA 1FZMB 3H9HA 2NNAB 2XPGA 5CSZB 1YECL 1Z3GH 4ELKA 4WO4C 3V6OE 2OK0L 4N8PA 4ZAKB 1I1AB 3OF6A 3DX8A 3MACL 4XAWH 3QB7C 4X7SL 3CDFA 5I17A 5BVPH 1FVCA 1KIUA 5ERWA 1IAKB 3T0XA 5I19H 2GFBB 4OZFG 3IDGA 4PG9A 5T3ZD 2Q7YA 5KG9B 5EU5A 1NBQA 3TBYA 1AD9A 4UIKL 1NJ9A 2CIIA 1BJ1J 3N1FC 3RWGB 4HV8A 4UQ3B 1A3LL 1PFCA 3MCKB 4NQXA 3HC3L 1FPTH 4OF7A 4P57A 3ARBD 5FKPA 4XAKD 4CMHC 2AJUH 5F70A 5GHWL 5CEZE 3OGCB 3D39A 3ZSTA 4OT1L 2R2EA 1RZJC 2FGWL 3EUUA 4L3EE 5IW6B 4M6AA 5C09E 3QWOB 2GCYA 5GS0D 2NY6C 1OQXA 4WY7H 3HZMA 5E8NA 1AY1H 4HQQH 2BNQD 3RUGF 2GJZA 4N0UA 1RZGA 4OGYH 3T3MF 2RAMA 1AQKH 3K1KC 1WWCA 2X4SA 3V5DA 1JHLH 4PJCB 1P4IH 1TQCB 1N26A 1FQ9C 3LKSB 2IG2H 3SPVA 3TO4B 5I1IH 3OL2A 2D7QA 1VKXB 5DRXA 3OKDB 4WI2A 5CCKH 5ITFB 3TM6A 1MFBL 3LDBB 2GSIA 5FHAH 5D71H 1GJIA 1U8OB 3GDBA 1IC7H 2RFXB 3QJHB 12E8H 3OKLB 1FCCA 4LLYA 5DJAB 3HMWH 4JQIL 1VERA 5GSVB 4A6YL 4L9LB 1N2RA 3IXAB 1EK3A 5IMOA 4KTDL 3ARBA 3CVIL 2GJ6A 4G7YH 3GJFH 2J1KA 1IGIL 1WTLA 1ZLVK 3GSQA 4ENED 1TJIH 4RWYL 4TSBL 1T7VA 3M8OL 2XXMB 1LO0L 2EKSA 1MCWW 2UUDK 4Y4HB 3MCG1 4P5TC 1WITA 5C08A 5GRVK 3CMOH 4JPKL 2OK0H 3UTSD 5L0QC 1XF5A 3LQAC 4K8RH 4O9HH 1A6ZA 3UTSA 2VWEC 3SDCA 5KANI 1MCNA 1IEHA 3W2DL 4GMTH 1JPGA 4K7PX 4KY1H 3TT3H 4L8SA 5C0BB 3QEHA 5D7KD 4NRZB 1F3JB 1K8IB 1CFTB 1SVCP 2C1OB 2CIKB 1T7YA 5D5MF 1L0YA 4PGCB 5DRZB 4R97C 3ZHDA 5HSFA 3P3YA 1OGTA 4XI5C 3PP4H 4ODSL 2HJKB 2Z35B 3B2VL 1D5IL 4E41A 4PGJA 4IOIA 3GNML 4XPBL 3V6ZB 3GMOB 5HVHC 4P5TB 2BDNH 1ACZA 3PL6B 4Y16D 4YDJA 1XIWD 4PRHE 4ELMA 3P2TA 3VMOA 3O4OC 3N0PB 2ICCA 4Y5YC 4K71B 3T3PF 3RY6C 1IT9H 2Q1EA 5CEYB 2FGWH 1HKLL 2OL3B 1GHFL 3H0TA 1E4XL 5I73B 3VRIA 1YY8B 3L6FB 3IJYA 1QR1A 5DJ0A 1KIRB 4JFYB 2JIXD 3QXAB 5I8OL 3RX5A 5F9DC 1X5IA 2D0GA 1CN4A 2PNDA 4WY7L 3ZKNC 1N3NA 1AD0B 1XH3A 5EU6B 1QSFB 4HK3N 1A1OB 4WFED 3BH8B 5MP6L 3FB7A 3E2HC 3RVUD 5E5MA 1I9RH 2R9HC 4ZTPH 3NCJH 4NPYB 1YN6B 3D69B 5I1JL 5CD5D 5T1MA 3WNNA 1MFDL 2DKMA 4GAGL 1DP0A 4G8IA 3H9SD 4HUXB 4IRJB 3T3ME 4Z95L 3H9SA 3FZUD 2JCCE 5IEKB 4EDXA 1JHKH 2XWTB 4JRXB 3TH2T 1T2QL 3CFKA 5DC9B 5FHAL 1H3PL 3LCYA 2JELL 3QNYB 5HGBA 3CFEA 4P2QA 4RX4D 1S8DA 4LSVL 1X7QA 3V0VB 1TQBB 3QH3A 2B4CC 4XPAH 3UTTE 3AUVA 2E9JA 3GRWA 3N06B 1D6EB 2QV2A 2I07B 5J1SC 4IBLT 3I75B 3G08A 3O45B 3V0VA 4ODXA 5K9QG 3DO7B 2VDKL 2HLAA 4MCZA 5HHXH 4GG8A 4D9RE 4H0GA 3X13A 4KVCL 4MB5A 5DLML 4EBQH 5IOPA 3TN0C 2YD5A 3AREB 1F4YL 4HW6A 4D0DA 1FVDA 2JB6A 3FQUA 2A9NL 1IGCH 1EEYB 4CDGC 5L6YH 1BZ9A 4FXLA 4N1HB 1YJDH 1C5CH 4PRBB 3B2VH 1D5IH 1OF2B 1SMOA 5TQ2H 1REIA 5GGRY 4FZ8L 1I4FA 1LD9B 1RMFL 1N0XL 3FT3B 2C3XA 4HC1H 3EYQC 4M7LH 1LWRA 4ODWB 3OR7A 5GS3A 1I9IH 2XACC 4RQQA 3HI5L 1MFAL 3O0RL 2LAGB 1I8KA 3U79A 3EO9L 3TESA 4EUPH 1Y18A 2EIDA 5ANMB 5EC2B 2V6HA 3NFSL 2OJZH 4O00A 1SQ2N 4EN3C 3SKJH 1KJ2A 3LQMA 2FECL 1UT9A 3RA7H 3X3FL 1WLHA 4L4TA 3LIZL 4K7PL 2VDQL 1I9RL 3S97C 5JXEA 2BVOB 4HKBB 3CXHK 1MRFL 1RJLB 4G3YL 4D0DB 3BWAB 9CGTA 5J89A 2XZZA 3IU3A 2ITCB 1INQB 4W4OC 4HLJA 3BZFB 4K23L 1VSCA 1NDMB 5EZJB 1IAIH 4ODTH 4OM0L 1NGZA 1NMBL 1JHKL 3MOAH 4WRLA 2Y7QB 1AHWA 1A7QL 1DQLL 2Q20A 1H3VA 3IDJA 4OLUH 5ANME 3RWCB 4C4KO 3LD8C 3U4EB 3DHMA 3PGDB 3QIBD 4LSVH 3ZT5A 1NFIB 1YY9D 3DHJA 1T5WA 5E2TH 4HIJA 2FEDC 4L4VB 2VLJE 5K33A 1JPFB 3LQZB 2YSSB 4OGAC 1QFPA 1N6UA 5ESQB 2G75B 3LN5A 1HQRB 1WAAA 4G6AD 2EICA 1BFVL 5FYKH 4F7PA 4APQA 5C8JB 3T8XA 4ACPA 2NY3D 4MNQE 4UDUB 5F6HJ 4C56D 5BZDB 5LVEA 1J9CT 2DAVA 3V4VH 1JL8A 1X3DA 3KHQA 1FDLL 1CDHA 1VGKB 1JN6A 4RGND 1MLBA 1F6FB 5A3ID 1XGRA 1FORL 4Z77B 2X4PB 2WSKA 3C6SA 8FABB 3BH8A 5I74C 5DHVH 3P9LB 4B7IA 4CN6A 3TJHD 3PWPA 3I6KA 4V1DE 1PYWA 3C8HA 4ZUTA 3ARXA 2ZCLH 5IQ7H 3L3KA 3E3QE 3SKUD 3RDTA 1JV5B 3I84A 1MJJA 1A5FL 3G5XA 5BQ7B 4A2LA 3LHPH 1EO8H 3GMQB 3SGJC 4HGWB 5ESQA 4WW2B 4QRQA 3LS5H 3PGFL 3IFNL 5ISZB 2VXQL 2FEEI 2OZ4H 5I76A 5GRJL 4X9HA 5KOVC 2EEAA 1HEZB 2F54E 1G7LA 2M1KA 4OFVA 3U7YL 1IZKA 4N5UA 1FSKB 3HRZB 4NQDB 5F3BB 1U3HA 3PDOA 1L7IH 2ZJSL 4IOIB 5HJ3B 2MWCA 3PDOB 1Z9LA 5EIVA 4HHAB 2E6PA 3TIEB 1U93B 2BSRA 3QUZC 1AD9B 3CVHL 4JQVA 3RTQA 3BRGC 4R90L 3LEYH 5D96B 3P0YL 5C6TL 4K3EL 4FQQB 4NYLA 3TYFB 1Z9OA 1VFMA 1B2WH 1GPOL 1P5VA 5ERWB 4G6FD 5D1QC 4L4TB 4K23H 3FRPA 4HT1L 3HS0A 4LVHB 4ZUTB 4DN3H 3DX8B 1GGYA 1H0DB 3QIUC 5IB2A 2HTKD 3LH2H 2BHZA 1PD6A 1RZ8A 5F7HA 3AAZA 1E4KC 4OLUL 4NO2A 4M3JA 1FZMA 3B3IB 1MHEB 2ZNWA 4MSWB 1RK0B 1U9KA 2X9WA 2WUBH 1U95B 3V4PH 2DRUA 4GMSH 2P5WB 3ALPA 4W4NA 5SX5K 4GW5A 1RJZA 1P84K 2PXYC 4U6XB 4JFPA 2AABL 2EDNA 3K4ZA 4KC3B 5J0BA 2OZ4A 5DXWA 2NY3B 4X6FB 5CJBA 3EOBB 1B4JH 1Q0YL 4KK9D 5D70H 3SO3B 3PHSA 3OB8A 3B2UD 4LAQH 4MMXC 2AXGA 1N64L 4DGYH 1QO3B 3CPLB 2WZPD 2YSSA 4PJ7A 4Z7WA 1OTTC 4PJGA 4Y2DB 4M7ZC 5IQ9B 4NZDA 4NQSA 3WD5H 4Y8DC 4K7FB 5AG9A 5IB3A 2BVTA 1SYSA 4GLRH 2D7TH 2ZCKH 3GSOA 2ZWLT 5HHME 4YBQC 4S2SB 5JW3L 3WDHA 4HWBA 5CSGA 3KYKL 5DO2D 1MF2H 1FGVL 2DM7A 2QEJA 2GJZB 2YXMA 3RP1A 5I1LB 4R7NB 3OKNA 5GPRA 2CXKA 4GG8B 4S1SH 5FM5M 2YD4A 3FHAA 4JFEE 2YD8A 3BZFA 4K55A 3MV7A 1H3UA 3G6AA 4CU8A 1UB5B 3BYTA 5DJ2A 4GS7C 1FJ1A 4D0BB 5HHNA 3BAEH 1JZ8A 5J9PA 1FG2A 4DKFH 2C5DC 3A6CL 2ZG2A 4X5XA 1QEWA 1NGWA 2EIZA 4LSPH 5F1IA 3FHQA 5FM8A 5L2KB 4JHAH 1AQDA 1PY4A 4NQDD 1R24B 1N2RB 4KQ4L 4O58L 3U36A 4DKAA 3JBG7 4WNQB 1A6UL 2NX5A 3FMGL 1JZ5A 2DLIA 1CS6A 2X7LA 4ZPVB 1LO5A 4PRIE 1R5VA 3QJHA 4Y1AA 2Q7YB 4XMLL 5KG9A 1LEIA 1DLHB 4MZ3A 5FGBA 4IS6B 1K4CB 2AP2A 1MPAH 5MI0B 1U8OA 4I9WD 1T0NB 3O6ML 4R90H 1WC7A 1KCLA 2R0WL 4I4WB 3SKOB 1F2QA 5GRVL 4OZFH 5JORB 3MRFA 1A6VH 3N1PC 2OTWB 1HWGB 4QHMB 3FT4A 3JXAA 3DGGA 1U8JA 5K93A 2EDBA 2E7CA 1NC2B 5DYOA 2AK4A 2W9LA 4F8QA 4Z77A 5HHMD 2BHYA 1KJ2H 3FOLB 4TVPL 1U58B 3W0WB 1OSZA 5H35B 4JFYA 4QHKJ 2JB6B 3QNZA 4OFKA 1AFVH 1GVIA 5D6DC 4JFQB 3MV8E 1NEZA 2UYLA 1BZ7B 3V0WL 1HHHB 3STLB 4FA8A 3HNTL 3PP3K 4OBRA 4PJBB 2CUMA 3K46A 3TJEL 1S9KC 3LN5B 1J1OH 4G6JL 3DWTA 4KJPD 2G60H 1PG7H 4MAUH 4L8CB 3LQZA 5D70L 1EHLL 5B38A 2Y5EA 5BV7C 4MLIA 2IQ9H 5CWSB 1UM4L 5C2UB 1CBVL 3QUXA 3RWGA 2GIYA 3VH8B 2EKJA 4PJCE 3DVGA 4TULH 3ROLB 1NANI 1FNFA 5J12C 5A2LH 2XZQH 3UC0H 3L5WA 2BHUA 3H3PH 1DSFL 4Q7DA 4X9GA 1TZHA 1CFSA 4NUGL 4BUHA 2AQ3A 5IVXA 4ODBD 3PL6C 1NBZA 4N8CH 1N5YL 3MV7E 5FKAB 4NQEB 5JHDA 2X40A 4UB0L 2AEPL 5DMYA 1ES0B 3P11L 5C08B 1JMXA 2VLRD 4Y4HA 4FQXB 4CW1B 2YPKB 1WT5A 5E2WH 5EBWA 3RRQA 4FQLH 2BC4A 4M4PA 1S9XB 3RVVC 1CVRA 4KROC 4OLEA 5DMKB 4QT5B 1LK3H 4LSPL 3WFBH 5CINH 4Q9QH 2ZZUT 1IC4H 5FYJL 1GRWA 1CIUA 4GRMB 2DLFL 3G6JE 2KPNA 3WLBA 2VLMD 1PJ9A 4G8FA 5I30L 3MLXL 4NZJA 2PCPA 4KZEH 4U6XA 4ODUB 4NQEE 4MQTB 4ZFOB 3GMLB 1KENH 2OL3A 3DRQA 2QLVB 3VXRA 4NZTL 1Q9WA 5J11C 1U8MA 3E0GA 4C54A 1P2CB 4O2FB 4MA3A 4JN2A 4PJHE 4ELMB 3RQ3A 4Y5XC 1QBML 3QZWB 1YMMA 3WO3B 1MI5A 5E6IC 2R1YA 1R5IA 2HA1A 4J3SA 1R6VA 2CO7B 5T5NF 2Q86B 4JE4B 4LL9A 4RWHA 4JR9H 5IB1A 1ZANL 2DQGL 3B5GA 3HZMB 5EU3B 2R29L 2VUOA 5I1EL 5ITBH 3MLYH 2KL6A 1YEHH 3ZKXB 43CAB 1X5AA 4DOHE 3MQIA 5HGHB 1L4IA 4PJXA 1ZOXA 3ZDYF 5IW6A 4UTBH 3X13B 5CP7B 4YEEA 4KKLD 1RUPL 2CRZA 1JHTB 1MLCB 1HCVA 3G5VA 2VLRB 1Q0XL 2YD1A 5F9AC 5A40E 2NCMA 4L4VD 1ZK9A 1G7QB 4XZUB 3EJJX 4UT7L 2XWJB 3DURB 4M02A 4E0RB 5E6IB 1ODAA 4GBXC 4Y89A 1UM4H 1CICC 2QADD 5D2LF 3ARBB 4X80H 5CEXB 1GCFA 1S7TA 2HT3C 5ISZD 3LRHA 3Q1SH 3BQUA 1QKZL 3QXUA 1LGVA 1FGNH 2O93L 4LLYB 3ETBF 1CLZH 4PREA 3FTGA 4LCCC 1KB5L 1Q9OB 2XWTA 3ZDZE 4BZ1L 3QBTB 3ULUD 4PJAE 1BOYA 4PJDB 3MO1A 3O4LB 1OTUD 4KUCD 1KUMA 2HVKA 1BD2A 3IAGC 2OM5A 3IFLL 1M6OA 5T3XL 3QI9B 3GIZH 1IC1A 3R8QA 4FNLL 1XZ0B 4NQDE 3GGWB 3ROOA 4BFGA 1CQYA 4NN7C 3MRIA 4GW1B 4KZDH 2ADFH 4H1LG 5BMFL 4LASH 5CP7A 3JWDL 1U8QB 5K59E 3BUYA 3TO4D 1NCBL 2ILLA 4AQ1B 1Q94A 5FDWA 4N0UB 5FYJH 4LGRB 1PZ5A 2YA1A 3IJSA 2W07A 1EVTC 2B4CH 3MJ7A 4NFDA 1TCMA 3SKMA 4KU1A 2JJVA 1YEDA 3O8XA 4PJDE 4NBYB 3WBDA 5DR5L 1T5WB 1HOCA 1M71B 5HVWA 1IE5A 4PJFA 3W39A 1UXWB 3PL6A 5HI4C 2QQKH 1CU4H 2IF7A 5HYSA 4KRPB 3Q3GA 4U1JB 4O2EB 2CXGA 4Z8FH 4NQXB 3FCTB 3GMLA 4NKDB 4M93C 3HFML 4CADA 3MZGB 1I3UA 4Y4HC 2ZPKL 4TNWF 3VXQA 3QWRD 4NO0B 1JGDA 3PWPD 4Z5RB 2W65B 3HE7D 4R0LA 4Y4FB 2R2HB 5T33L 1FH5L 3MMEA 5D5MA 4PPTA 4IRJD 3MRBA 1RFDL 5JMRA 1B4RA 3WFHA 1A9BB 4HWEL 5HHOB 1A6ZB 3UTSB 5CZKA 5IUSA 4MX7B 4FXGA 3DUUA 1FFNA 3MRLA 3RWHA 5T5FH 4F57H 2CRYA 2X70A 1FNLA 3H2WA 4HIIB 3RNQB 1TTGA 2IADA 4HIEA 4NT6A 3S5LG 4R96A 4WO4D 4ZXBA 4LPUA 2G9HA 5HYQB 2BY3A 3GSQB 2EYRA 2ZOKB 1GXEA 2W92A 1ORSB 4AEHL 3KPPA 3OZ9L 3IDXH 1IC5H 4FQJL 1LDPL 4LGSB 5EOCJ 3NBNA 4V1DD 2FO1A 2XZCH 4MXWH 4YQXL 5CAYB 1QSZA 4EI6B 4NSKA 1M1SA 3DI2B 3RDTD 2VWEE 3ZYIA 3FO2B 1X4XA 2IAMB 1ND0B 5CZXD 2PO6A 1UWXK 1NAML 1KCSL 4BZ1H 1J5OL 4NCC2 3AMLA 3FONA 3I50H 1FYTA 1G7HA 1DUZB 1TVHA 3VD5A 4NOFA 1C08B 3FT2B 3IFLH 3LQAH 4JLRB 5I9QC 3W5MA 1QNZL 1Z9SA 3GIZL 3HCVB 4UINL 1ULVA 2CD0A 2H6PA 1L9NA 4ZO6A 1QSFD 3D9AH 2X4NB 5D7SL 3IFOB 1OQOA 4HS6B 3EDEA 1UVQA 3MRHA 4KK8D 1KLUA 2N1KA 4NKMB 3QNZB 5KVEH 1PKQB 4L8BA 3L1OH 4P23C 4YIQB 3DO7A 5CKGA 5I71C 3FN0L 1CL7L 4PLOB 1XF1A 2RJMA 4YBLB 4QGYA 1VEOA 4ISVB 3WKNA 4OTXL 4RRPA 5IJKC 3GI8L 2VLJA 4JY6A 3GKWH 4ELMF 5IMLB 4M7KL 5J6GB 2P45B 1I1AD 3BVNB 3SQBA 2PKDA 4JZJC 2CIIB 2FSEB 4X6CF 3JWOC 1J0IA 1T0NA 5FUOH 4DTGH 3ZT6A 4Y19E 4CMMB 2EH8H 1M4KA 2CPCA 2VDPL 3CFKB 4PJDF 1T4KB 3WUZA 1JWMB 5JA8B 2OX5A 4HUNB 1JWMA 1LEIB 4WU5A 2Z8VC 4BH7B 2ENYA 1CLCA 3MV8B 3MJ9A 3G5YA 4PG2C 4WNQA 1FL5B 5KTEL 4X99A 1W8OA 4HK0B 1UZ6E 2F19H 2X1PA 5GGRA 2C9AA 4GRLC 3OKYA 5D7JD 2IPTH 1HDMA 2A9MH 3NA9H 1J12A 2CK0H 5I1CL 3VFTB 5DD5L 4EUPA 4JRYA 4MNHA 4JRYD 1IGTA 4IM8A 2DI8A 1G9NC 4E41E 5CMAB 2B1HL 2C4XA 3MBEA 4JKLA 5ALBL 1E0OB 1PSKL 5CUSL 1U6AH 3MBED 4P9MH 3A0OA 3EOYG 2HWZH 1FNEA 2X9YA 4OV6F 4XC1H 3Q6FA 2XN9B 4YDIL 1XF4B 1IM9B 3KPSB 4JPWH 3RL2A 3MGTB 5F6IB 2HLFC 1MFNA 4HEME 4YXKL 2J6EL 3UPCA 2NY0D 1QO3A 4XCEA 2FR4B 2CLRA 4Y16C 5EBLA 5KSAB 5DRZA 1PQZA 4Q6IC 4LSSH 4LNRB 1R0AL 4X6FA 3JV6B 3VXMA 4DKEH 1OAZH 5L9DL 4W70A 4U1GB 4O51B 4F7TB 1HH6A 1KJVB 3MLPA 2ZUSA 5CD3A 5CMAA 4NO5A 4PV8A 5HHQB 2P5WE 3PIQB 1V7ML 1HYSD 4P9HL 1CDIA 4YBHA 5GRZA 1BWWA 1BMGA 4XNZB 4D9QE 1I7ZA 3EYSH 4QXUL 2DLEA 2JK5B 2R9HD 5J56B 3CVHB 1AJ7L 1D6VH 1RI8A 5CBAB 5EZOL 3UTTA 3VDCA 3MLVL 4M5YH 2CUHA 5E8EB 1KT2A 2VDOL 3ZL4L 5HHMB 4LLQA 1U92B 3FZUC 2G5BB 4NHUA 3ESVF 3DETD 5EIIB 1OOAA 2BNQB 3LKOA 5T3ZE 2DJ4A 3T04D 1ZAGA 3OKDA 2AV7B 3QUYD 5JW5A 1UH2A 5EN2B 1JFQL 4KHTL 3LKQB 5GGVH 4BQCA 5JOPD 3PUCA 4HWNA 5CFHA 4U1IB 3RWIA 3CU7A 2YUWA 4KDTC 3GBNL 5DZNA 3BHBA 4M48L 4Q9BA 3FB8A 4JO1L 3C5SA 3NN8A 5D8JH 4X7SH 2O5ZL 1AQKL 3BIKA 3BZDA 3GMNA 1MCSA 2BMKA 3D0LA 1ZHLA 3AREC 4GG6F 3SY0B 1KIPA 3O3DB 3OTTA 4MAYD 3MUHL 5C0RH 3TN0D 1JE6A 4I18B 2WM0A 4U6HB 4OF0A 1P4LB 4HG4J 2R15A 3LEXA 3ROOB 1MRDL 3OKEA 3FOMA 3O3BB 5C0FB 1KCVL 3DVIA 4W6YB 4F2MA 1SBSH 2DMBA 2A38A 1OGAE 2OJEB 4P2YA 3MNZA 4RMQA 2Q8BL 2VJXA 1MVFA 2EEBA 3JSSA 4PJ8D 4YZFF 4FFZH 2AAVA 5J11B 3VGGA 4DQOH 2GAZB 5HGDA 5KSBE 8CGTA 2HH0H 3IDGB 4PRNA 2E9IA 3W0WE 2XOTA 3L7FA 3MXVL 4A2MA 2DDQL 4NKQB 2XWBB 4D9LL 2OMNA 7FABH 1J0ZA 2MQCA 3QG7H 4OZ4B 4WUUB 4LEOA 3I3DA 4NQCD 5ICXA 4BH8A 4NFBA 1V7MH 4JVPA 5GSRB 5C6WH 2WINA 4CVZA 3RI5K 2O5XH 3PNWB 4GKZB 3VMPA 1UKTA 1F97A 1T5XA 5IGXH 3FOMB 2WIMA 4X8JA 1OGAB 3EJZD 3AVEA 3EFFB 3ALWA 5F6HI 3QEGL 1NFKA 2PW1B 2XY1A 4U6HA 2FBJL 4HKZB 3SQOL 5KSBB 3KXFE 3NCBB 1IFHH 3HMXH 1MFBH 2W65A 3MLVH 2D7MA 4FRWA 4PRIB 5EU3A 4HKBA 4LKCA 4P4KB 4XP4H 3NH7L 5DI8A 1VHPA 2SEBB 4MD0A 1ONQB 1G9NL 4TNVF 3X17A 3QFDB 3QIBC 4U1IA 1NCNA 5C08E 3C8KA 1IT9L 1HOCB 1M71A 4MA3B 5ILTL 3S3SA 4RBPK 4GUPB 3DV6A 1JGUH 1GAFL 4N90E 3RAJH 3K1DA 1WWWX 2ORBL 3ZDXF 5JW5B 1LK2A 1P7HL 4J4PC 2PXYA 1CTNA 3AXLA 1FAIH 1F5WA 5IHUH 5BRZB 1JK8B 1S3KL 5FUZL 1FL6A 4V2BA 4K8RL 4QF1B 4XHQA 1FIEA 4OLYL 1RZFL 3VI4E 2O5ZH 4OCYH 5F96L 3BUYB 4QRPE 2R56H 3MV01 5MEPB 4FG6D 1RVFL 4KGJA 4RGNC 4OLXL 3QEQD 4UV4L 5F7KC 2M8XA 4H8WH 2H2PD 3PWJA 4JKKA 1ZS8B 3JWOL 3QIUA 4I0KA 2KDGA 1CLYL 1PG7W 3TJHC 4WFHD 4ELME 2ADGA 2A73A 5HXMA 5JPNB 5DVMA 2XZAH 5DA0B 3MUGA 3PWUB 5ENWB 3QIWD 4NQEA 2DWEA 4GKNA 2Z8RA 4D94A 2VN7A 5EC1B 1ITCA 4YHPA 3J8F7 3QYCA 2AV1B 4F7MA 2GTZB 3RGVD 4M43L 4HUUB 1NMCB 4ZOEA 4FFYH 1ZVSA 4WHTA 3IS1X 3RWFB 1U8IB 4QLRA 4F7TA 5D72L 1FRGH 3IGAA 4KI5C 4FQ1L 1U8NA 2R0KL 1II4E 1C12B 2IQAB 3MA7B 7FABL 3MPCA 2XYCA 3B9KA 2P8PA 2DI9A 3I2CH 4C59B 2JE8A 3RZWA 1ZA3A 3HG1E 5E2UL 4ZYKA 1Z9MA 4HXBL 1OTSC 4GKOA 4KVCH 3QNYA 1VEPA 3O6KH 5DUPH 3W9EA 3IDMB 3QUZD 1WZ1L 5I1JH 1AE6L 4KJWD 5FO9A 1BOGA 1MFDH 3EYFB 1BGXL 5HDOA 2A9NH 4JRXD 1FZJB 1SMAA 5IT2H 1ADQH 1ZHLB 2Q8AH 3VXTA 2HTLD 1CGSL 3C8DA 4Q74A 4P3DB 1NLBL 2MSPA 2VC2H 2V9QA 4FQHB 2CKNA 3BUTA 1I8LC 4G6KH 4JRYB 1R5WB 3CDGA 4CKVX 1A64A 2AK4B 3X12A 1DQJB 3FB7B 1A1OA 1QRNA 1YZZA 3MA7A 3QXDA 3CX2A 2XA8L 1ACYL 4PJAB 5BV7H 3VFMB 5ADPH 3NMEA 5CJOL 1KBGH 2NLJA 2P5WD 4YXHL 1R3JB 2WQRA 1A6WH 3TH3T 5BOZG 1SM3L 4R0LC 4B50A 4HFUH 4HULB 2R4SL 3MREA 3VG9B 4JG0L 2FIKB 1X44A 1JNHA 4X4YA 2AQ2A 3K8MA 2CMRL 1GZPB 4LFHG 5IF0B 2PXYD 1YMHB 2F58H 3OKOB 3UJIL 2PCPB 1AO7B 4JM2B 1EH9A 3HNSH 2I25N 3JV5A 1K5NA 4RDQF 2Y4SA 5MEND 3TFKD 1N5AB 2VDKH 4MJ6B 3EHBD 1C5BL 3CX5J 4P46C 1IQWL 4WFGE 5AD0B 1F8TH 4JDZB 4L4TD 5JOFA 5IEHA 4FQCH 3GHBL 1RZFH 1RU9L 2HFGH 5HDQH 2DM2A 3U0TA 1OL0A 4QOKB 3G9VA 3RJDA 2JB5H 1MRCL 4U6YB 1BJ8A 4L4JA 1A02N 5F3HB 3MRMA 4UV4H 1RULH 4FQXA 4CW1A 1DBBL 2J4WH 1BVZA 2GHWB 2RQ8A 4QHUB 4MHHI 1INEL 2HVJA 1J87A 4ZNEE 4H20L 2MJWA 5SX4H 4NUJB 2IFFL 3Q5YA 4OCSH 4U31A 3RZCD 4MYWB 4PGEB 2PW2A 3OGOE 4HS6A 2YWZA 3GUTB 2BVYA 2EYSA 1XF2B 2QHRL 1FHGA 3UTOA 5JUEH 4OLWH 4M1CC 4JJ5A 2YUZA 3NIFF 1SHMA 1ONQA 2E27H 5D6DA 1RZ7L 5JW4N 4OV5A 1CD1B 4AEFA 3KPSA 3QDME 5E2JA 2J5LB 3TO2B 2VLJD 5HGAA 5E2UH 4I48B 2OTUB 2AI0H 4EI5C 5CSBA 1QYGH 2IAMA 4WUKH 3TCXA 4CVXB 4ZSOE 4HJ0D 3HC4L 4N0FA 3H42H 2D0HA 3ARFC 1GC1L 1KB5B 1P7QB 4WI6A 3RWFA 3HG1D 5DEFB 3PV6B 4K94H 3I9GL 2VAAB 4OZFA 3WHE1 3GZKA 4F15C 4N0UE 3WUWA 4X8JB 2F74B 5JW4M 3QQ3A 5FA4A 1X5GA 1KCUL 4LSTH 2A73B 2RHEA 2NTFB 1DFBL 1WVZA 1MIML 4Q6IA 2JCCB 3BN9D 2ARJA 2P5EA 4G6KL 3P9MB 4JO3L 3QIUB 2AW2A 4XC3L 2EZ0D 2X1OA 2CDFB 3RKDC 3OB0K 3VE0B 1F00I 3BKML 2VMFA 5GGQH 3RZCA 2DM3A 4X4XB 1YN7B 5E4IA 2Y36H 3B83A 3P73B 2FHFA 3EDFA 1YEEL 4NJ9L 5IVZB 1JZ4A 3VFNA 4ZTOH 2YEZB 5C0CA 2DF3A 2DLTA 1FC1A 1XGYL 2NY7H 5FYKL 1DBJH 1ZEAL 4IRZH 3WS3B 2APBA 1JNHB 3MA9L 1IQWH 2X09A 3O2VL 2H41A 4O2EA 2VDLH 1CE6A 4FZEL 1AQDB 3V4VL 1RU9H 2CSPA 3O4LD 3LEYL 5AYQA 4HWBH 1U36A 2JB5L 5FOJA 3PDDA 1UA6H 1J86A 1T22A 5D7LA 1OAYH 3MNVA 5DQJA 3IB4A 3EYOA 3P4OA 4G8GD 1FVEB 4GKSB 2ZCHL 1PKQA 3ZDYE 3F8UB 3VA6A 5KSUB 1AP2B 3QDAA 5DD6A 4LDLB 2IFFH 3UDWA 3VWKA 1QFWH 2OL3L 3I6KB 2FJHB 4YHML 3G6JA 2FX9H 2PW1A 5EUKB 1ZLWK 3VGHA 3D39D 5MHSD 3SDAC 3PHOA 4YDLC 2DWDB 4G8EA 4TUJA 5FGSA 4ZODA 2AV7A 2NTSP 2PETA 4NZRL 5JOPE 2AABH 1GGCH 4HFWA 4WV1A 3LKOB 5T3XD 3JV4B 4AJ0A 5A2KH 5EIIA 3IGAB 5B8CA 1OVZA 4JFPB 3QO1A 5JDJA 5C0GB 1UACH 3V79C 2V17H 3F7QA 3QJFB 1DQDL 1T20A 3BQUB 1YEIH 1MWAL 4ZPTA 2IH1B 4WI5A 1BBDL 1B2WL 3SCMA 1S9VA 1A14L 2EYTB 1GPOH 4YNYA 1XIWA 4WDIA 5IHLB 2P1YA 5F1OB 4HT1H 3BPLB 3SE4C 4E5XB 1EUTA 4NN5C 5IFAH 1PEWA 4JVUA 4OZHF 2Z8SA 1TFHA 1I3RB 2C1PB 4PV8B 3BOVA 4BQ9A 1KJ3L 4I18A 1IMHC 3WIHA 2APFA 3U83A 4WI8A 3OPZH 3L9RB 3R1GL 3IU3B 1K4DA 1KCRH 1LP9B 4B53A 1JGDB 3CGTA 3BIKB 4KKLC 4CU7A 4LRIC 3CAFA 4NJ9H 4JQXC 2DQTL 1JGEA 3BDYH 4LLDA 3L3OB 4ZUUA 2HFTA 3P4NB 2LU7A 2BSED 2IAMC 3DV6B 4KMTL 2VISA 1EA9C 3CX5K 4TRPH 4YR6A 3MFFA 3WNMA 2YS4A 2XN9A 3C2AL 5ADOL 3S9DB 4MD0B 3S37H 4IHOB 1ZXQA 2Q7NA 1HEZA 1S7WB 3L3JB 1WBYB 4F7EB 1WBZB 4NO3B 4OCWL 4JB9H 4P4KA 5EZIH 3X3GL 4DAGL 4WFFE 4DJMA 3IJSB 4QRPD 1C16B 3QIBB 4XNMA 3GHEL 1P7KB 1QBBA 3SDXA 3VWJB 4PJIE 1RAMA 1CK0H 4XWOD 5ICZA 1J11A 4FMFA 2IANE 5T1DL 4QRRB 4MXVF 1H15A 4G80A 1OP9A 4KHXH 5SWZB 5JNYB 1OTUC 4HWZA 1HDMB 4LMQE 4QWWC 3P0VL 3RWEB 4TTDD 5FYKD 3UDWC 3VWKC 1DR9A 3AS3A 3N85L 4MMZC 4HGKC 4X99B 4NWTL 4H26B 2MKLC 3CZFA 4PJDA 2YPKA 5JR1H 5BZDA 1MFCH 1DZBA 4K9EL 2ZUQC 1YC7A 5LXGH 1A6UH 3GMPB 1IGML 3FMGH 1QHPA 3BP6B 5DRWA 1EHXA 3CDYA 1G9ML 2AXHA 2PTVA 3IVKB 1HXYB 3VMNA 4I13B 3LPFA 4PB9L 1EHLH 3QHTC 3QUXD 3RY4A 2FSEA 3TV3L 4S1RL 1DL7H 3KXFD 1UG9A 3CFDB 1BEYH 2AEQL 5A16A 1S7TB 3NTCH 4IEFB 4JY6B 4BK5A 5CIPH 2VXUH 2WLYA 3GEWB 3T2NL 5EBLB 2D03L 5E6IA 1MAJA 4XCEB 2FR4A 3NIFE 5CWSA 2C7UB 3KS0J 4BSVA 4YHIB 3RL2B 5DHVA 5BZWA 1N5YH 3RIAK 4LLVA 3TWCL 4OLZL 4Y4HD 2Z91A 5HGGS 4WFHE 3QCUH 3V52L 3VG0L 5F9WB 4PGDA 4DGIH 4HPYL 4XMKH 2FHCA 2FZ3A 4IRJC 5FECB 1RURH 5FEBA 2CGRH 3HCVA 1HE7A 3N50A 1CGWA 2V2WA 3LB6C 4RMRA 1DBKH 5C0JA 2YBRB 4XCYA 3WFBL 3FONB 4H1LH 4PJ9D 3RWDB 5CINL 4NKIH 4PRHA 1QP1A 3CSGA 3BDYL 2QKIA 1AXIB 4GBXA 5E00B 3GSNH 3FB5A 4OF5A 5FM5O 4JZNB 1M05A 3EDDA 5GQBA 3DYPA 1X5HA 2OTWA 2R0LL 5EU7C 3EJYD 3GO1H 4MQXC 3TA3D 4NQTA 2VO5A 3O3EB 1HI6A 3L5XH 3S37L 4N8VB 4FMKA 4NRXA 5KN5A 4E42B 2VZOA 3P4LA 4FP8L 4G8FB 5EZIL 2L7UA 5HVGB 1S5IL 2J3SA 1I8LA 4NQED 3H7LA 2NXYD 3BMWA 3X14A 4D9QD 3KXFB 5CZXC 4KPHH 4WI3A 5JIIA 4BFIB 1LHZA 4R26H 4UILL 4Z7VB 1LO4L 3O9WB 4Z7NE 5J8OA 2R1WA 2YPLB 3KAAA 3ET9F 3HPJB 3V6OC 1OAUH 3O11B 3PGCA 1AKJA 3MLYL 2F15A 1GOHA 1K3ZA 2IAND 3J7HA 4NBXB 4XNUH 4YHLL 3CLEH 4WWID 1TENA 2OI9C 5DK3A 3FO0H 2CLVB 2IPUK 4OZHA 4XB7A 4Y4FA 5GS0L 4Z5RA 1MFCL 4WENB 1RIVH 4KK8C 2FL5B 3IJHA 3BJ91 4DVRH 4NKMA 3CSPA 4P23D 3IJHB 1F90L 1G9MH 3QXTA 4NKDA 4R7NA 3QEQE 4UQ2A 1PG7X 1HH6B 3B9KC 3UJJH 1WIPA 5I30H 3MLXH 3CIQA 2CLVA 3NIDE 4OZHB 4S1RH 2YD6A 2EDRA 1OLZA 5C0ND 1T21A 5AAWA 3GM8A 3Q1SL 1S9VB 3ULUL 1P53A 4AENA 2YPLA 1YEDB 1X7QB 3O8XB 1LP9F 3G04B 1I1AC 3BQUC 2VDNL 3QJFA 2D4FA 5DZLA 2BNRE 3KPRE 3U6RB 3AMKA 2XTJC 3LMJL 3FO2A 5DRNB 4IRSD 5LWYH 1DUYA 4EI6A 5I71B 1Q9LB 1MCRA 2NY1C 3DX6A 4LF3A 5T3XH 4C83B 2QQLL 3GGWA 3MLWH 1T66D 2EDWA 1YDPA 3I6GB 5DRXB 3PE9A 4UU9B 2ADFL 5F93C 2J8UB 3D85A 3U0WL 5ID1B 3SBWC 4QXGH 4GRLD 4KDTA 4KTYA 3ZMRA 1ZT1B 4UDTA 3I3EA 2BY0A 1QSEE 2BNRB 4OSUH 4XCYB 3INUL 4NO0D 5GZNC 1QR1B 3N9GH 1MNUL 3EZ8A 3UPRB 4OKVB 2Y6SD 4M1DH 4LPWA 3MBEC 2FD6H 4F7EA 3QWOA 1ETZA 4M9OA 5CHNB 1HSBA 3TNMB 1RUML 3OJMB 2DIAA 3SDDA 3DLQR 3I6LE 5DF0A 1T1ZA 1E4WH 5E7FA 3OG6B 3TEUA 4AG4H 1NEUA 5IMLA 5HYSB 1UENA 4ZUSB 3U4BH 5F1IB 3HRZA 5F3BA 4XPGH 1H3WM 4C58B 1RZIA 5C0CB 4OUOA 1A7OH 1MCDA 1RFDH 5IB4B 2DQIH 4Y2DC 1OGAD 2AJYL 2OQJA 4LASL 1W72H 4NKOA 1U91A 4H0HB 5SWSA 5EO9A 3V0AC 4F57L 5TPWL 4HIHB 2VXSH 2IMNA 3EW3B 4HS8H 1S9WB 4H25B 4YWGH 1BVKA 1QRNE 25C8L 2HKFH 2BVUA 2X4NA 1R5IB 4JFZH 4OI8A 1NC2D 5E99L 1U8QA 1KCKA 4I3SL 2ZKHH 1UZ8B 3P9LA 5I9QB 1FIGL 3SGDI 1MFEL 4NQSB 1EMTH 5F1NB 4AEHH 4GAJL 4KUZL 3F58H 3OZ9H 5E1AA 2PN5A 4DWHA 4RFNB 4JEGB 3OJDA 3KPLB 3QUMB 1SYVB 1S5HB 4P2RA 4M1GH 3LKPA 3BRFA 2I9TB 2PO6B 1Q1JL 5IBTH 3MRJB 4LHUB 5FYLD 1NCAL 3MYJA 1CL7I 4POYA 1LMKA 1EVUA 3BIBX 2Q6WB 1WUNT 4G43A 3SDXB 3Q6GL 2J5LC 3QIBA 4XNMB 1S5HA 4RGMC 1QLFA 3VG9C 1RQ5A 1CD0A 4MSWA 4M7JL 1S7WA 2A77L 2QQLH 3MLWL 4FXKB 5T5FL 2Z93B 2DMCA 1B9ZA 5DJ8B 1UWGH 3D9AL 5AYUL 1I8MA 4BQ8A 1IARB 1NCUA 3U4EA 3QFJD 3UTPD 2AK4E 4Y5VA 1F4XL 4OIIL 4X5WA 1V3LA 3GSVB 4WTXA 1KFAL 5KVEL 1BVKB 4FQ2H 5KVMC 3MRLB 5ISZE 1CL7H 3HTLX 5SV4A 3NOIA 3X11A 5I8CB 3ARED 2F54B 3KPTA 5DJYA 2HKHL 2R39A 5EH1A 1MNUH 3PF2A 2FYYB 2ZUXA 5F1KC 3BWAA 3K4AA 4OLVL 2QR0A 3D18A 4PJEB 5AZ2L 4DFIA 2V5TA 3BXNA 3F6LA 2F5BH 5K9OB 2FIRT 4CNIB 5SWZE 1PW3A 2HAZA 2VLKD 3LEVL 3MRKA 4POZC 5EFIA 5D93B 5H94B 3ZDXE 4Z7VA 3C08L 3KWWA 3BP7B 5CIPA 4YNYB 3WO4C 2R23B 3GK8H 3I6LD 3LN9A 4MJ6A 3ILQC 4UAOB 3VXRB 4LHUD 3O9WC 5I76B 4IMKA 5IR1B 5KTEH 5C07B 1YN7A 5BS0B 4P0DA 4N8VA 5HY9A 1AGEA 2HP4A 1T83C 5D9SB 3QRGH 2JLLA 2NMSA 5GGVY 2AK1L 3KJ4B 3DYMA 4TUOB 1MJ8H 2CK0L 1YPZE 1E4JA 4J6RH 4U1HA 1P9MC 5JZ7C 1UC6A 4OGXL 2R4RH 1JZ6A 5EORH 3VGAB 3ULVF 5E8PB 4GRWH 3S5LA 3WHXB 4N0CD 4UU9A 2AQ1A 3QI9A 5I19L 2BVPA 1YA5A 3AU1B 3EJZC 1J05A 2EE2A 4PLKC 1N7MH 1VESA 5I1IL 2HWZL 5HHPB 3DECA 2L7JA 1A21A 3FFCD 5BJTB 5IOPB 3CK0L 3SGEH 1EO7A 1RUAL 3W0WD 1BQUA 5D71L 1JI2A 4JPWL 4PV9B 4O5LL 1X6NA 1MHHB 1UQSA 5IM7B 3MRGA 3TN0B 5B3JE 3IXTA 2VR5A 3G04A 1YPZB 4OT1H 5F7WC 3E2HB 3L5HA 4JQIH 4ERSH 2WV3A 4MJ5B 4P2OD 1D6EA 5T1KD 3CU1A 3PJSA 3F7RA 2XWJA 5EO0B 4LHJB 2V9RA 4QOKD 4P4RB 4RWYH 4OZGA 2NW2A 2G2RA 2AEWA 3L3IA 4L1HA 1YNKL 5I1CH 4P9HH 3AM8A 1I85C 4C56B 4O9HL 3CXHJ 5C0BD 3HAEA 5ALBH 3VXOA 1XGTA 1W0WB 4PTTB 4QRTA 5GS1A 1BVLB 1I1FB 5C2BH 1EXUA 3RZCB 3BDXA 2O5YH 4H26A 3S35X 4Y4KD 4WGVB 2O61B 4YDIH 3KPOB 4YHKL 4Z7VE 3RWEA 3CXDL 2WBKA 2ATKB 1MUJB 1TPXC 4EEEA 3FT4B 3GNMH 4XPBH 3F12B 1V3JA 3FQNA 3RU8H 5EBGA 1MCBA 1N3NB 5FYJE 2W1NA 3QIWC 1CFBA 1TITA 2P5WA 4XCFL 5IR1A 4Z7UA 4KDVA 1LD9A 1TLKA 1LO0H 4KI5D 4CVXA 2DL2A 3OAUL 2YHGA 4NO2B 1OB1A 2DTMH 2AS5M 3BT2H 3FN3A 1G7JB 1N4XL 1EGJH 2X44D 5DMGC 4Z78B 4YE4H 3STBA 3V6ZA 3VRLE 4NRYB 4U1NA 1J8HD 3WS6C 4X7TB 3C5ZA 5TF1H 3MJGX 2EIEA 5GS1C 2R4RL 5EBMB 4XRCB 4LLMB 2DQCH 1OTSD 5A43C 3C5ZD 5DT1L 1YEGH 2P24A 4AK1A 4HX1B 1BVLA 1DDHA 1I1FA 3O41B 4GQPH 4NYLB 4KJWC 4HUKB 3O6FA 4XBEL 5TGBA 1A3RL 3Q5TA 2WWMC 3RTQB 2H32H 4K3DH 2ED7A 4Z95H 3PP4L 4ODSH 2HTLC 4PLJC 4MCZB 1RUAH 4K3JL 5J3HD 3MROB 4NUJA 1OM3L 4PJIB 3QDGE 2I5YH 4ZUVA 3LPWA 4LLUB 4PJ8A 4QHKI 4NIKB 1S7QB 3O6LL 3DBXB 1G7MA 3LSOB 5GGSA 1LEKB 3MJ8A 2Q8BH 2VIRA 4RIRA 3ZTJG 5FGRA 4DZBA 2V5SA 4OCRL 4KHTH 1BZQK 4F9PA 4N8VG 5GGVL 1WSST 1TVDA 2J8UE 1U3JA 4RFEB 4WEBH 1JTTA 4ZPTB 3D87B 5B38B 1S8DB 1QLFB 4QRQB 3SOBL 5JHDE 4ZXBC 5D1XC 5I8OH 2JJWA 4HGWA 2AV1A 5TQ0L 3JWDC 3SE3C 1DQMH 2HT2C 2WNGA 3EOBA 2WW8A 3OBAA 2V7HB 3CFCL 3L3KB 2P8LA 4P46D 2NW3A 4GQ9H 4HUXA 3CDCA 4PJXF 1GZPA 3C6LB 1KELH 5CP3A 2UWEB 4U0RB 4U1LA 1E4XI 3MR9B 4A6YA 4TUKH 4GRWB 4YXLH 2H32B 2E7HA 2KQMA 4GAGH 1F2XK 3VGEA 3TBVA 3ZHKA 3UYRL 1RUKL 3EGSB 4MLSA 3V9FA 3D2UD 1MY7A 3G6JB 1CDCA 2FJHA 4BFBD 1YJDL 2C3GA 1R5WA 4D8PA 3HI1B 3RU8L 1JVKA 5E2VH 3HUJF 3DGCR 5B4MD 1JPTH 2P5ED 3H9ZA 4YFDB 5JDSB 3RZCC 3H7BB 5EO9B 3REWA 1XGPA 3UO1L 4HZLB 5C9JB 1CXLA 5HD8D 2F9BT 5EUOB 5LGKA 3BYYA 1ZHKB 2P8MA 3QP3A 1QTYT 3TZVB 4RAUA 3PHQB 4M1CD 3BP7A 3SDAA 2FO4A 2BOCB 3HI5H 4TOYL 3JTSA 1R24A 3U36B 3LKQA 5IHUL 4P59L 4YPGB 1OW0C 2X89A 3QPQC 3D0VA 3RVWD 2Y7QA 2F5AH 4YE4L 5IVXE 3EYUH 1NGWB 4MVBC 2EXWC 5CHNA 5F96H 3TNMA 1RHHB 2P46B 2HRPL 4LSQH 2V2XB 2Y1VA 1AO7D 5D1QB 1QLEH 3IETA 1I1YA 4ZFGL 4MWFA 3BEVB 3O2DA 1TZIB 4ZNEA 3GJFK 1I3RA 15C8H 1X5XA 3ZZ1A 5LBSH 4XMPL 3KLHC 1DN0A 3QQ9D 2I60H 4K3JH 1KJ2B 4LKXA 3T0BA 1RUQL 5I75B 1TTFA 3TIDA 5AWNH 1I7ZB 2JCCA 2VQ1A 2NY5C 3BN9C 1CR9L 2P47B 2AGJL 3H9HB 1ZS8A 2BNQE 5ID1A 4LEOB 2BOBA 1VDGA 1JZ2A 4M7LL 5IMOB 4X6EA 1JN6B 3I85A 5D1ZD 1MQKH 4WO4B 3CUPA 1MFAH 3O0RH 4LRIA 4ZS6D 4G43B 3LN4A 5CJQL 1F13A 1KTLA 4FQ1H 3WIFA 5KS9F 3SO3C 1JNLL 1OW0A 3HE6A 1X9QA 5EOTA 4X6DB 3NGBB 1TMCB 3O4LE 4L3CB 5L88L 4S11A 1T6WA 4YGVB 5DWUH 5GZOD 2GI7A 1BFVH 2VL5B 4WO4A 2CLRB 4P46B 2DS4A 1J0HA 1LK2B 5J7CC 1CG9B 2ZSVA 1BHGA 4G3YH 3MGTA 3WO4B 2DQHL 4OZHE 5C07D 1F42A 4YXLL 1NAKH 2XNAB 5KZCB 3ARRA 2EDXA 3T2QA 1ZT4B 1HHGB 4CMHB 3MRNB 1MCJA 4LIQE 4QGTA 4JM2D 5IW1A 1KEGL 3EO1A 1I7TA 1AP2A 3W82A 5MEOA 2EDKA 3QCTH 5KVDH 3S4SB 3TBSA 1A5FH 1TCRA 3IETB 5I0DA 2OQJB 5GIRA 4KAQH 5D7LB 2VQUA 4M43H 2NR6C 2XA8H 4QHUA 4CRPA 5BV7L 3QNXA 4R4FH 1RJLA 4XP6L 4X4MA 1U8PB 4XPTL 1K6QH 5ID0A 3UAJC 3SDAD 5I66B 3GMRA 1CE1H 5H2BA 4TYUA 3VFPA 2B8OT 5HPMB 1LEGA 4PJHF 5MENA 2IBGA 3GSXB 2A6IA 3BO8B 3T77A 4TSCH 3THML 5IJVB 1NKRA 4K7PY 4BFIA 1OWRM 4PYHA 4LCUA 5DFTA 3ZKQD 3AS0A 3E8UL 3VGFA 3X14B 4WUUA 3ARUA 3O6KL 4LLQB 1K5NB 1WZ1H 4XVJH 3UTSE 1AO7A 2VOTA 4FABL 4G7VL 5D7LE 3DMMD 1QLEL 5HYJB 5L8LB 4PP1D 1HH9A 1RULL 4R9HA 3LS4L 2WBJC 3B6SA 5I8EB 1ZLUH 2CKBL 4AIXA 5DTFA 2YPVH 3VXPA 1UEYA 5D2LA 1PGRB 4I0PC 3CFJB 2AXFA 4OCSL 2DKSA 2F74A 1I8IB 2FCBA 3IFNH 4QTIL 1ZHBB 3BZEB 5DJ0B 3VI4F 1X5KA 2OR8A 1KBGL 4NCDA 3WN5B 4S1QH 3JVGA 4M6ML 4PGZA 3IDNA 4HJJL 2X4TA 1NBYB 4JG0H 2NXZD 2XFXA 5JUEL 5CEYA 4LCWA 3OAZH 2NX5E 1MQKL 2FEEL 2MTPA 4APQB 5BVJA 1KIPB 3FO1B 4OGZA 2YA2A 3D0LB 1KGCD 1XFPA 4H5SB 2EXYD 5I15H 3VXUD 5HYJE 2XQYK 1C5BH 3MXWH 3OMZA 5L88H 5I2IB 2ICWA 4QRSA 4AENB 5BRZE 4B41A 5GRWA 1CQKA 4QHNA 5TDPA 1OGTB 3F65A 1OP3H 4JG1H 3VFGL 5KJRH 4QRPB 2PF6A 4C57C 2VDRL 2Z92B 1NAKL 1XGQB 3G6DL 5LCVL 2YXFA 2GY7B 2GTZA 3G9AB 5KOMC 2CKBA 5TFSL 2NY4C 1KEGH 5HVFB 5D7LD 4Z9KB 4X7FC 4JO3H 2NY2C 5JW4Q 3AC0A 4RMSA 1KULA 5MERA 4TTDC 4OD3L 5E6YA 4N5ED 3V4PL 4M6NH 3VWKD 2FX7H 4WCYL 4Z18A 2Y36L 5FCUL 2YWYA 2ESVD 1JZ3A 3O9WA 5F9JB 5IG7A 1YEEH 1BQHG 5HI3C 3ES6B 4PJFF 3EDJA 2W0PA 1EFXD 2NY0B 3MRBB 3C9NA 1S7UB 1Q0YH 4MXQD 4P3CL 4DGYL 3F7VB 3UTZB 3AROA 1YY8A 3L6FA 2VR4A 3T0EA 5EWIL 2IPKA 3T0ED 3V8OA 4NOBA 1MPAL 4XVJL 3ULSA 4LU5H 3U9PL 3ARGA 1I4FB 3SPVB 1AI1L 4QRPA 3UPAA 1T03H 4HWBL 1DVFC 3TBWA 5IESH 3KYKH 4DVBB 1QRNB 4YR6B 1TZGL 3LS4H 3OKKA 4J3TA 4NC1E 5I1KL 1LP9E 5BW7A 4G5ZL 5EG6C 4E41B 3RWJA 4M3KB 3QQ4A 1P4BH 5F7YC 3HC3H 1YEFH 2YBRA 1ORQA 3C2SA 4TVSa 2MNUA 4PTTA 1A6PA 1BLNA 3BE1H 3VXOB 2Z9TA 1BX2B 2DIBA 2DB8A 4M6MH 2XFXB 4U0RC 4J4PA 3VFVA 2YZ1A 1NUNB 3LB6D 3NZHL 1NUDA 5F7FA 3BZEA 3CCHB 1I8IA 4ODXB 1CI5A 4PJ9C 2ADIB 1DEEA 1P84J 3DIFA 3V5HA 4Q97A 5JXAL 5LQBH 4JPIA 2UZIL 1E6JL 3QQNA 4EUPG 5E94A 5I0ZA 2C4FT 2Q76B 2VDLL 2YC1A 3MJ6A 5GGRB 3U46A 3ARDB 3PABA 1OSPH 1NAMB 1KYOJ 3HB3D 4EVNA 4MQXD 4MDIB 2IG2L 1VPOH 4JY5L 5KJRL 3TN0A 1UQSB 1VGEL 5IM7A 2W9EH 4PJ5D 1MHHA 4Z7WE 2PR4H 1AR1C 4AIZB 1F45A 1IAKA 3ZO0A 2GAZA 3QO1B 4S1DC 1JF5A 3TT1L 1BQLL 4EDXB 4J3UA 4OF6A 4M5ZH 4B5EA 4CMMA 4ZS7H 2XQBH 5I1GH 4ZAKA 3RKPA 2A1WH 3B5TA 1J8KA 4F80A 4GT7A 1MJUL 3DURA 4LQFH 3O2WL 4FTVD 1F4HA 5E2WL 4FQLL 4X6CA 1UCBL 4WFGD 4OD3H 3AB0C 3SE9H 4DN4L 4GG6B 3S88L 4BKLB 2XG4A 4NM8H 4ONHB 3TLRA 3C6LC 3OPZL 1NCWH 2DL9A 4JKPH 1I7UA 1BX2A 4GRLA 5ICZB 1RZGB 1DN2A 1XCTB 1RZKH 4MAUL 1OP3K 1AGBA 5MEOB 5DJXB 5IB1B 3VXRD 5BOPA 1UACL 3MNVB 5DQJB 1PKOA 4TRPL 1OCWH 4PS4H 4XTRC 5AZEH 5C0NC 3C8KB 3LV3B 1P69B 3UYOD 3KWWB 3UC0L 2WMPA 2ERJB 5DJ6A 1DSFH 1NMCC 4OM1H 5I1DA 3TBWB 3L3HA 4UOJA 3HZKB 4O2CB 1EX0A 1I9JL 4RBPH 4KKNA 2HJKA 2Z35A 4ZAKC 3SKMB 1TZGH 3DRQB 1RD6A 3D25B 1AGCB 4NFCA 1F58H 2BNUA 2C1OA 3TBYB 3P11H 5JPMB 1ND0A 5F9OL 3VFOB 3CZJA 4NNPL 1JPGB 2DKUA 3V4UL 2H8PA 2NY1D 3RIAF 1IGFH 1YEHL 4GG6A 1HKLH 1KN2L 3EAKA 5T3XE 1P6AB 1XR9B 1OGAA 1WEJH 1A47A 2YRLA 1M6OB 4YUEL 1H5BB 2IWGA 5J12B 4L8DA 4KKBD 5DHXB 1KG0B 2ZOLB 1A9EB 1S7XB 4Z7OE 4KZEL 1MCCA 1FV1A 2XV6B 1DL7L 3PIQA 1OSPL 2XKNA 1BM3H 3FRUB 3P4MA 4UOW0 1AH1A 5JXED 2YPLE 2Y6SC 4JY5H 1IKFH 4NWUL 3RNKA 1BQSA 2APWA 4JPVH 3VFOA 2GUOB 1JWSA 2JJSC 4JGMA 4ZO7A 3BSZH 1WIUA 4ZO9A 3LKPB 1JNNH 2I9TA 1XR8A 2RCSH 3CLFH 5E9DB 2OJEA 1IBGH 4HDIB 1T2QH 4R4BB 2A0LD 3D0VB 3KG5A 3KPQA 1AC0A 4XZUA 5CLWA 1VKXA 1F4WH 4KVNL 5FA3A 4ALAL 4CDHA 3P0VH 3JTSB 4KRPD 3G5VB 3QEQB 3QCUL 3LKSA 3RGVB 4X0KB 2A6JA 4DGIL 1CWVA 2R0ZL 4NNXB 4JO2L 3C5JA 3VFSB 4Y2DD 4KZDL 1DBKL 1KLGA 4G9DA 1YEJH 5CJ8A 1HHIB 5I1HH 3NN8B 4NC2B 5DJCB 3ILPB 2Q86A