4MSWA

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA02
1TTGA 1UZ6E 1FNHA 3EYUH 3RBGA 1A02N 2BJMH 2X4OB 1CVRA 1KELL 1WTLA 3X11B 1RZ7H 3KPSE 1FGVH 3IT8D 4LLMB 3F65A 3RU8L 1H15B 1T1YA 4LARH 2VXTH 5IGXL 4W6WB 5IB1B 5C0JA 2ZSWB 5D1QC 4JDTL 3CVHL 3QDJD 5CEZH 2J1KA 2FECI 1QR1B 3D39A 4K8RD 1FYTD 4NKQB 1CDGA 1RHFA 2J3SA 4PRIB 4NFDA 4DKFL 1FN4B 5DXWA 4PJHA 1S9KC 1G6VK 5FGBC 4O51A 2EDBA 4PUBH 3H2WA 1KCKA 1QQDB 1U8IA 4QWWC 3QWOB 4R6UA 4PRBB 2OBGA 3E3QC 3JWDL 3MTRA 2WK2A 1G7JB 3DV4B 3KLAB 3KR3H 4G8GA 2I24N 2CK0L 5BW7C 3EYQD 4PGBA 4C4KT 5IR1A 5I9QB 4PRHD 4K2UL 3RIFF 2IGFH 3RKPA 4DGYH 4YFLF 4ZFOA 4M00A 3HNSH 2V2TA 1UG9A 3SDXB 3W9EB 3Q0HA 3A6OA 5AYUH 4ZUUB 2VNCA 1FH5H 2X1OA 4YEEA 3GJEB 5EIVA 1MAMH 1V8HA 4OUOA 1VENA 4P3DA 1HZHL 3L6FA 5SWZE 2ZSVA 4PLJC 2ZJSL 5MP6H 3MRPB 3RVTD 1U8HB 2F53A 4QHNB 2CGRL 4LAQL 4G7YL 4HEME 2XQYG 4WTXA 2AXFA 2UZIL 5HGAA 3TN0A 4YFEA 3GM0A 2AJXH 4H0HB 4MLSA 1OPGL 4WFED 1RK0B 5K9KB 4QTIL 4HKJA 5E4EB 2D2OA 4YDLC 4M02A 5DJXB 1GCFA 3U0TB 2HWZH 1AXTH 4EI6A 1ONQA 1A6AA 2UYLB 1PG7X 1DBBL 3MLZL 1NFDE 3RTQD 1OGTB 3IYLW 4P4KC 2B1HL 4OF5A 4PG2C 3DRQB 5ID0A 1AQDB 3HG1E 3O3UN 1XF3A 1C5CH 1F8TL 4LRNH 1GHFH 1PEWA 4HIIA 1JHKL 4DGVL 5F3BB 2KZWA 4EJ1C 5H2BA 2YEZA 2AK4D 2XZQL 3UX9B 4X98B 3ZE0F 4YHNA 1XR9B 4R8WL 4Z95H 4YZFE 4W6YB 5BOZG 2DBJA 1CVSC 2VLRE 1S7RB 1CS6A 3QG6B 3DROB 4JHWL 3LRSA 1LNUB 4JRXA 3QCTL 3C08L 1U8MA 4L3CB 3P0VL 3SKOB 5HYJE 1P4LB 5K33A 1RAMA 3QPXH 4DQOH 1T4KA 1UXWA 3A6BH 4XCFH 2KUTA 4C4KO 1KLUB 2RGSA 4U6YA 1EDQA 1IAKB 3J8F7 5E5RB 3ZT6A 5JXEA 4F7TB 2OTUB 4NO0B 1MY7A 4OLEA 4OFKA 4X80L 1T3FB 5F6HJ 3P73B 5GS1C 1P9MC 1VFAA 3KPQB 4Q2ZB 1OQOA 5J57B 3LD8C 4LBEA 3S5LG 3HZMA 1XCQA 2OR9H 1JF1B 4UT6H 2V5TA 3NIDF 2ZOLB 4OZFH 25C8L 3FO2B 4BQCA 4L8CA 4ZS6D 4DTGH 1I4FA 4OV5B 3PWPB 4YUEL 1GRWA 2JKXA 3SDDA 2AJVH 4M1GL 4BKLA 2KZ1B 2WINA 4NWUH 4NO3B 4V2CB 1LO5B 3Q1SH 4I9WE 4J23A 3GMRB 1E4XL 4HF5L 3MC0A 4PJ8B 4LLUA 3T0EA 4PJBF 3VD9A 1I7UA 4WU5A 4N8VG 4M7KH 4UU9A 1KB9K 5HVFB 5I30H 2FEEL 4F2MB 4UINL 4TULL 2BVOB 1LEIA 5HD8C 4CU6A 1F45A 4PJ5A 4RBPK 5I8OL 1C1EH 3BVNA 1NCCH 2NX5E 2GHWB 1MCOH 3LN5B 3GMQA 3F7RA 5J9PA 2KBGA 5SWSD 2ZUTA 1NGZA 4OF7A 3H42L 1PY9A 4ZSOE 4A6YA 4YHLH 4JFFA 4NRXA 4NQDB 3SE9H 1MCEA 1WCBA 4DAGH 2XKSA 1EO5A 2F54E 3SCMA 1JPFB 3ZT7A 3H9HA 1JI1A 2E7HA 1JV5B 2GITB 2YD7A 3V52H 4I48A 5JR1H 3KJ6L 2DICA 3ZKXB 3F12B 4LKCB 2ZKHH 5GZND 3QIBD 5DTFA 3VH8G 1KTDA 4ZPVA 5C07D 5B8CB 1BIIB 2G60H 1Y6KR 3KPRB 4HFUH 3MV9B 3WDIA 5DJYA 4LCIL 2JCCB 1QLRA 2NY5H 4CW1B 3ME0A 2R2EA 2UY6A 2FYYB 3K8LA 4N90D 5JW4R 2I07A 3BD4A 4U6VH 1TVHB 2J5LC 1FCCA 1G1YA 5I18H 2VAJA 3UBXB 3GSNB 5JIHA 1OAQH 4YPGB 3VFWB 1T1WA 4NC2B 4GLRH 2R9HC 2XWTA 4WI8A 4K9EC 5D1XB 1LE5B 1EHLH 2ZUUA 1HHKB 3N1GC 1UYWH 1F58H 2XIDA 1FLRL 3D39D 3MLRH 5C9JA 4X9HA 3CDFA 3ZE1F 1YMME 1RUKH 3UJTH 3QDAA 2NXZD 4LOUD 3HZYA 3FMGL 4XVUD 3VG9C 3TBVB 2JB6B 2PW2A 4NKIL 3R1GH 3LIZH 3PWVB 2VXQH 3MA7A 3P9WB 3ZDXE 3BKCL 1ZHNB 4OLWL 3DOSA 4D9LH 2EDRA 5L2JB 3GO1H 3RX8A 3RUGB 4AH2B 1KXQE 5E56A 5D4QA 1VB9A 4IOFD 4NZUH 4N9OB 1EIBA 3FT3B 4Z7WA 2DQCL 5DD6B 1H3WM 1A4KA 1AGEA 1FV1A 2D03H 3QEQE 3BH8A 5F72S 2Y7QA 5ITBL 1K4DA 1KEML 2O5YL 1FJ1B 1C16B 1IM9B 3MRLA 1TJGH 5E8NA 3U4AA 2LFGA 4ZO6A 1G0YR 4X6EA 5HJ3A 1H0DB 2MNUA 5E2WL 5JIKA 3SDAC 1TNNA 2AV1B 1T20B 5I19L 2EIZB 1ES0B 5ID1A 1WEJL 5KOVC 3HAEB 2NY3C 3MRGB 5J06A 1CG9A 2F53D 3GFUA 5HHPB 1YC8A 4XAKD 2VDOH 3SOBH 5D7IF 2B0SL 4HCRA 3TN0D 3QDMB 4ZFZA 4WV1A 5LGJA 3KPMA 4X8JB 3ARTA 2DQEL 4N0RA 4L1HA 3O8XA 4NQVA 3V5DB 4DN4H 4F3FB 1UB5A 3OG4B 4OB5H 3BYYA 2XN9D 4GSDH 4YDKL 5T33H 1YEJH 3RVUD 3B83A 3NZHH 4QHMA 3CCHA 3NGBC 4LPXA 3WUZA 4NKMB 5AD0A 4P5KA 2VISA 2X4TA 1AP2B 1XF5A 4PRHB 4OD3L 5F6HI 2F8XC 1N5AB 4WTWA 1N6QH 4OIAA 2DQIL 5INCB 1HQ4B 3HFML 3VH8A 4PYGA 2EDLA 3KPSA 1UWGL 4J3OC 3GHEH 3S37L 1IFHL 4EOWH 1U8LA 5I1LA 4EEEA 5A2KH 4ONHA 4X7SL 5IHUH 3DWTA 4APQD 5IMKA 1I9IL 1UH3A 4JCMA 1G9ML 1UB6A 1KG0B 4FQLH 4OZHE 4ESKA 4J2XA 4U7SA 2IG2H 3KYMB 5EORH 3E2HB 5EOCL 4K7PY 1HHGB 2HRLA 2UUDK 3GSOA 4NN7B 4RA0C 1GGTA 3O3AB 2NW3A 1QLEL 2BCKB 5DUMH 2GFBA 3LOWA 4ZNEE 5IQ9B 4ONGH 4ZPTB 5F97E 5CKAA 3X3GH 4KRNA 3UTZB 5FO7A 3GIZL 1HDMB 3FB6B 3VGFA 3L5WA 5FA3B 4EVNB 4YHKH 1V3KA 5E8EA 4U1JB 4XNQB 1MAKA 4MB3A 3AY4A 5CSBA 4K23L 5EBGA 1QSFB 2EYTA 3FAXA 3IFPB 2EYSB 4KDWA 5JXED 5KSAC 1LP9F 4H8WL 3DI2B 4U7KA 1KXTB 3EO1B 3JBG7 5TE7L 2HKHL 5J11B 4ZYKB 2IQAB 4I5BA 2KL6A 2E8ZA 5JQ6H 1SJHB 3KLHC 2LTQC 4MZ2A 1I85C 1E4KA 1QKZH 1P84K 4NN6C 1D5BB 4U1LA 4X6CF 5FHAL 4JPKH 1XR8B 5EN2A 1QFUL 4MA8L 4IOIA 5CIPA 4L9DA 3KPNA 2R23B 3PP4H 4POUB 5C2BH 2MCPH 3W2DH 4YHOH 3ILQC 4N1HB 3F58H 1KBGH 3TH4T 1WGOA 4YBQD 3SDDD 5SWZA 4IBLT 1KENL 5DD5H 4LDLB 2ZCLH 4E5XB 5IOPA 1BVLB 3T0ED 3WHXA 3RWGB 1V3JA 2EICA 1T0MA 2XTJE 4HIEB 3WYRA 2GK0A 5DLMH 4WUUA 1E4WL 4JN2A 4PJ5D 1S7UA 4WW1B 5DQ9A 3V6FA 1OLLA 4J4PA 3UYOD 2X70B 5F7FA 4S0TD 1HKFA 3L3JB 3VMPA 4HUNB 1BD2B 2GCYB 3BAEL 3LKRA 3FFCE 2B5IB 3B4NA 3KPLB 4MVBC 1NFDA 4RIRB 1Q1JH 1VFBA 4Y88A 1NAML 4AL8L 2YSSA 1SEBA 5EZOL 4JFFD 4HXAH 3OKKA 1ZHKA 4PJEB 4JQVA 4KROC 2HRPL 3HG1A 1AJ7L 4Y2DA 5FV1L 4H20H 1CXFA 2H32B 3SCMD 2VDPH 4P4RA 3KXFD 5DS8B 2A73A 2XZAL 4OLXL 4U0QB 5HHMD 2EDYA 1FQ9C 3NABH 3F7PC 2WSKA 3V0AC 3LPGA 5ICYA 1OP5K 3JVGC 5E2VL 2IFFL 2VLRA 1A7NH 3A0OA 1GSMA 3EFFB 3CLFL 2OJEB 4ELME 4PREB 3DVFA 1MJ7H 5EC1A 2E9IA 3FN3A 5HYJA 4MJ2A 5CSGA 3MGTA 5BXFB 1CGXA 3QI9C 5E70A 1G6RA 4DVRL 1B2WL 4CVUA 1W0WA 1DLFH 4ONOA 1LDSA 4P2QB 4F7PB 3DX8B 3P11H 5C7XL 3LKPB 2BERA 1BJ8A 5FKAA 2EEBA 2OL3B 3P30H 1NSNL 3AUVA 3MMEA 4WHDA 5T3XH 4X9IA 2Z4QA 4TVPH 4RAHA 1NAKL 4M5YL 2VUOA 3LV3A 1F3RB 4K7FA 4OLVL 4X99B 3C5ZC 3S36H 1S7XB 4KC3B 4NN5B 4PGZA 1INQA 1I1AC 1JGLL 4FNLL 3C60A 1DQJB 4R90L 5LCVH 3U4BL 1QRND 5GRUL 4YK4B 5FECA 1TVDA 1UQSA 4X6BB 1T04B 1GPOH 5C07B 2VXSH 3G6JE 3RJQB 4DUVA 9CGTA 4XI5D 1JYVA 2A6KB 3GSUA 1I1RA 1ZHLB 4L8DA 5K9QG 1LK2A 2FWOA 5CSZB 3Q3GA 5DJ8B 1WWAX 5EO1B 3TPUA 4JO1H 3UJJL 1HQRB 4RQQB 3MFGB 3O9WC 1D3CA 3M8OL 3WIFA 4LLVB 1PYWB 4ZUSB 2HJKB 2D7NA 5E7BA 4XNYL 3RAJL 2NY6C 3P4NB 5FUCC 4DVBB 5KG9B 2Z31A 1VA9A 4FABH 3OR6B 2NX5A 1MNUL 2V2WA 4FRWA 1MJUH 1WISA 3UTQA 1BX2B 2VJXA 3O2WH 4JM2B 3TBSB 4LAJH 4Q58C 1JPSH 3DRTB 3UMTA 1ZA6B 4Y5YA 4ZSOA 2VDNH 4XWOD 1N64L 3QHZH 3W0WB 1QFOA 1EVTC 1XIWC 2OR7A 4PBXA 3RX7A 1BZ9A 3SGJC 5ACMA 2F5BL 2RHEA 4FFWC 3O8XD 2F54A 2AV7A 2Y36L 2P24A 4P2OC 1EXUB 3MLYH 1G7QA 2H2SC 1MWAB 5EOTB 3K46A 1I7RA 3KYAA 3OKLB 4XNXL 5GISH 3RWJA 3WDHA 1RUMH 2EXWC 5D96C 2WWMD 4K3JH 5IVXB 1HXYB 3DX7A 5I1GH 4M1DH 1PZUB 3L3DA 1DDHA 5T1MB 5FYJH 3T08A 2Q86A 1NEZG 3E8UH 3U0WH 4J3VA 3IF1A 1J5OH 1OP3K 3VD3A 4ZMAT 3UP1A 3KPSD 1S7SB 5IFAH 4MAYA 2DQHH 2ICEB 1A6UL 2JJVA 1RVFH 1P6FA 2YPVH 5JDSA 1K3IA 1D5XB 1P5VA 3UTSE 4AZ8A 2QQQA 5FYLH 5JZ7D 1CXEA 4J8RB 2HLFD 2ZG2A 2BOCB 1JZ7A 2VL5A 2Z8VC 3VXOA 2PTTA 1DUYB 4S10A 1M7IB 3VFRB 2JIXD 5EUKB 4ALAL 2YD2A 4OGYL 4R26L 2FHBA 5IMMA 1KEGH 4DJMA 3QNZA 3MUGB 5F9OL 3CVIH 1YMMA 4BQ6A 4H1LG 3FN9A 4Y4HA 5DD3H 1RZIA 2WBJA 1KIUA 4QRUA 3CX5J 2DLGA 2XN9B 1CFNA 3I6GA 1AR1D 5EZLA 5E2TH 1OHQA 2XACC 3RWFB 4HS8L 3C6SA 2C9AA 5DFWH 3HB3D 4FXGA 1FE8L 2ADFL 2VZOA 3CK0H 3MRIB 3FT2B 1FZMA 3FB5B 4FQXC 4YXKL 4PPTA 4Y4FC 1N8ZA 1S5HA 5ILTH 1I3GL 1VCAA 1EHXA 3DX6B 1KN2H 3QEQA 3E3QE 4JJ5B 4L3EE 1AO7B 3QIUB 4APQB 1YEEL 4BSWA 1FO0B 3T4YA 4P5TA 1JPTH 1YMHB 3WSQH 1G7PA 4NQCE 3CFBB 4ZFOL 3DUUB 5MEQB 1MCSA 1RJYB 4WHYH 4N0YL 1AIFB 4M8QB 4O2FA 3HI1B 5D93B 1HKLH 2K7QA 1XCTA 5EOCJ 5HHQA 5B4MD 2VABA 3QPQC 3RNKA 3REWA 4Y1AE 4M7JL 5TE4L 4PJCF 3RHWK 4KZEH 3LKQB 3EJZD 4M1CC 1E4XI 5JOFA 5IFHL 4PJGF 1JYNA 3F6IA 1LEGA 5IMLB 3S3JA 3BFOA 1Q72L 4M43L 5DJ2B 3ZE0E 3L3OB 2AJZA 3ALPA 5BZDA 4J4PD 1ZLVK 2CKNA 1Z3GH 2FEEI 4LIQH 1UZ8A 1IC5L 3D0VA 3RA7L 2BY1A 3AS1A 3HS0A 1L9NA 2H2PD 1IE5A 2L7UA 3WCYA 5IWLC 4OIIH 3KDMA 4P46B 5FUOH 3HG1D 4WHTA 4Y2DD 1SHMA 3I50H 5JORB 4BFIA 2Q3AA 5GGUB 1IGJA 4H26A 3C2AH 1Q0YL 3MOAH 4OZHA 3RVVC 4BZ2L 3QUMA 1ZGLM 5E6IA 1JHLH 1NEUA 4HZLA 4HDIA 3DURB 3B9KB 2VLRD 3AVEA 4Y2OA 5J3HC 2E6QA 3G04A 4OSUH 1AC6A 5F7NC 1LDPH 5DSCB 2GTWB 4ZNEA 3O2DA 4UIKH 4MMXC 2MHAB 4IJ3B 1KUMA 3MJ8B 5HYJD 4X6DF 1MCWW 2W0KA 2E7LA 1FG9C 3BT2L 3QIWB 1PVHA 4ZUWA 4XNMB 3NIDE 2DI8A 3WE6B 1UFUA 3DTXA 3C09B 5GRYA 4YX2L 3O6KH 4XPBH 4MQSB 5HDQH 1P53A 2DL9A 4WO4B 4GW1B 3UTOA 1I8KA 4PJBE 1WC7B 1BEYL 2VB5A 1RUQH 1MQKL 4KDTC 2FJHB 4JKPL 1X5ZA 3MREB 4MNQE 5GGRY 2LU4A 3EIFA 1Q9KB 3NTCL 2ESVB 2FZ3A 3KXFB 5F6IC 1T22B 5FGCE 4R7DA 3UPAA 3DVGA 2GUOB 2JJSA 1MFEH 1IQWL 4NKOB 3HPLA 4OM1H 1VADB 4XNUH 2I9TB 5KVDH 4KKLD 2AS5M 1QRKA 1MRCL 5T5FL 3BGFB 1M05A 1TZIA 4FTVB 4GRWB 4IHOB 2A6IA 4NRZB 2OMBA 4OAWB 1SYVB 1ZANL 1U3ZA 3I6KB 1CGUA 5GS3A 1KB5A 4ONFL 3BP6B 5B3JF 3V0VB 5JIIA 4IRSA 4HWBH 5CINH 4NSKA 4O9HH 5E8DL 5F7UA 4GXVH 1JNHA 3P0YH 2Z31D 3IDNA 3VXME 5D5MF 3WFHA 3AXLA 5ISZE 3T0BA 5C0AB 3FFCA 3U30C 3B3IB 3TV3H 3L3GB 3BYTA 2JTDA 5KVGL 5DQDH 1A3LH 4RMWA 3PHSA 4JRYE 4PJAB 3OX8B 4G80B 3VFSB 2Q6WB 1DEEA 3C5SB 2F54D 4EDXB 3FCTB 3S5LB 5ESVA 2A6JB 1EBAA 3Q5YA 3ULVH 5ANMB 1EUUA 1QBAA 1R5VA 3AB0B 5D2NB 4JZNB 4YWGL 4JFDB 1INDL 1RIVH 3D85A 3MV01 3CC5A 1UWXK 4YDVA 5DJZA 3ZE1E 3RIFK 4HMEA 4ZFFB 2QV2A 2CD0A 3KWWB 4ELMA 5KSVA 5IG7B 4PTUB 4PJXE 2EDXA 1UWEL 3AS2A 4P3CL 1RZKL 1NCTA 4JB9L 3ARFC 4FXKB 4N8VB 5F1NB 3BE1L 4U33A 2APVA 5EG6C 4WU7B 7FABL 3ARBC 4XRCA 4JDVB 4ZAKC 2BSRA 4AM0B 2CK2A 4RCAA 1DSFL 2ENSA 5JW4N 3QYCA 2RFXA 3LZFL 5FV2A 1R5IA 3V4UL 5L6YH 1YMMD 4CMMA 5A16A 1LWRA 3LSOB 4Y4HD 1RUPL 4PJ7B 2YZ1A 2WBJD 4Y16C 4GFTB 3P4MB 2XG5A 2DQDH 2PR4H 3PWLB 2BMKA 3PWJB 3L5JA 2NY0D 3ILPA 3N9GH 1BZ7B 5F7HA 2BP3A 4LEOA 5MERB 3FO1A 1J0YA 3HC0B 1SJVA 3G6JA 3PIQA 5MEOA 4OV6F 4NKDA 1MCBA 1ZT4A 2PYEB 2AEPL 4LSRH 3QEQD 3K2MC 5EBWB 2Y5TB 5F3HB 1T2QH 5TQ0H 3B2VH 1S7VA 4LSPL 4XP5H 4M6OL 3VFUA 2R4RH 3AM8A 4K3EL 5C0FA 1EEZB 2X40A 3ULVC 4JREC 2GIYA 1D9KC 3GSRB 1I7TB 1MREH 4JQIL 1SBBA 3TO4B 4GKSB 3UAJC 5DURD 3BPNB 3SJVE 3C5JB 3NMEA 4G8IA 3FT4A 3CLEH 5BS0E 3HN3A 4JLRA 2ZG1A 4YBHA 5TJWK 3H3PL 4R0LA 3GSQB 5GJTL 5L2KB 2DWDA 3SKMA 1TETH 1DE4B 3SY0B 1K4CB 2I60L 3NCCB 4OGAD 1KNOA 4P23D 1CWVA 3HNTH 3DV6A 3KLDA 5FXCH 43CAB 2WBWB 4YJZL 4M62L 1V7MH 2H8PB 2IF7A 3V6ZA 4ZTOH 3OKMB 5IB5A 5DHYA 4WNQB 3WHE1 4LDEB 1N2RB 3TZVA 3ULVF 2YD4A 1A4JB 1FL3A 8CGTA 3OBAA 1JFQH 4L4TD 4BUGA 4K3GA 1OAYH 4ZTPH 3UTSA 1LP9E 1RPQA 1X4ZA 3QCUL 2IADA 2X4SB 2HFGH 3DMMB 1CR9H 1SY6A 4L4VB 3BHBA 5E6ID 1CICC 5TF0A 5E24E 1QEWA 2Q7YA 1ACYH 1UKQA 1L7IH 4LNRB 4FQHA 3BKMH 2Z35B 4J6RL 5CWSB 5L9DL 1U8KB 2VR9A 5FGSA 1BAFH 5D7SL 1B4RA 4X6CE 4YPJA 1WSST 1DVFB 3GKZA 3TGXA 3VFOA 1FZJA 1R3IH 4LSUL 32C2B 4LK4A 2AJUH 5IV2B 1GIGH 5EU7E 5CGYD 1H8SA 2VQ1B 5EWIH 3MNWB 3WLBB 5GS0H 5DRNB 3QUXC 1U8QB 4JFEE 1DBMH 4LPYA 4XPGL 3DVIA 4L8SA 1PQZA 3OJDB 2A83B 3QA3B 1XGPB 1K6QL 3B5GA 4QLRA 5DT1L 1BQLL 3T8XB 3BI9X 4L3EA 3TVMC 1WZ1H 1PG7L 2WWKT 5FYJU 5F21B 2X1PA 5F7YC 2QBWA 4NQCA 4KGLA 2RAMA 3DSNA 1YY9C 4WEBL 2ADIB 4LHUA 3CPLA 2R1WA 4UIMA 2QSQA 5DD1H 4NZJA 4YNYA 3ES6A 2FHCA 1KTLB 5MI0C 2MMXA 4Y1AA 4KPHL 1MCCA 3MJGX 5CZVL 1A14H 2XTJD 3D2UA 1J9CT 2PCPB 1OGAE 3C8KA 1A22B 1KIRB 3D3VB 3HR6A 1X5LA 3EOAA 3ARGA 2XPGA 3U2SB 1L7TH 4MWFB 1BVZA 3I9GH 3QRFM 4OUUA 1VFUA 2ZNWA 1C5BH 3RL1A 2W0LA 2XZCH 3AREB 1I3RB 3FFCD 3S3PA 4HIHA 4MJIE 2YN3A 3CZJA 5SWQA 4CGTA 1KULA 3CXDH 3V6OC 3ZHLA 3QXAA 3L3HA 3FN0L 3TBYA 1CLZL 1P2CA 3TYGH 1T5WA 3O11A 5CD3A 4QT5B 4MS8D 5BMFH 3OR7B 5JPMA 4HD9A 4L9LB 4EI5D 1KPRA 4LKXA 2DYPA 2R4SH 3EFDL 5IROC 3IFOA 1SJEB 2BY3A 3O0RL 2BVPA 4W4OA 1HI6B 4KXZI 3U36A 5A43C 3JV4A 4XMLL 4AEIL 1AD9B 1OARL 1MIEL 5EULV 5IB3B 3E6HA 2W9DH 1ZT7A 3OTTA 4JFZL 4E41E 1GGIH 4FQIL 2H41A 2EXYD 2VH5L 3O81A 1G6RL 3OAZK 1NBQA 3G5ZA 2Z92A 3LN4B 3MOBL 2WWKO 5ETUA 2ICES 3LCYA 1AGFA 4OZFG 4PJBA 1E6OH 1H3PL 3TIDA 1DFBL 2DQTL 1U92A 4RX4D 3O6LL 2NY7H 2X4PB 5FA4A 1IAOA 4MNQA 4WUKH 1JNJA 4PGEB 3ARZA 4ZDHA 2VQUA 1ND0B 1CLYL 3P3YA 1CXLA 3ZTNL 1U8OB 1XZ0B 1QA9A 5F1IB 1P9MA 4JGMA 4XP9L 3O3EB 4NJAH 4G6KH 4JPIA 1T6WA 4HPYH 4N0UE 1FFQA 4CADB 1BVKA 4UILL 5C6WH 5FO8B 2R2HA 2R69H 4UQ2B 3LHPL 5F9WB 1MRFH 4XT1C 3VWJA 4QXTB 1L6ZA 3QSKB 3VXNB 4DFHA 1T1XA 4D8PB 2P49B 1IMHC 4WI3A 1LE9A 1RIHH 3MRRB 4U6TA 5ESQB 1NUGA 3IU4L 1A1NB 5JNYB 4I3SL 3VXMA 3FRUA 5DC4B 1JZ2A 2YR3A 1DTUA 5KJRL 5J13B 1XGYH 1L0XA 4Q6YA 4NJ9L 2ZOKA 3G5XB 5F7EH 3X14B 3MJ7B 4JRYA 4N8PA 3QHFH 2Q20A 4KTEL 4ODHH 4YGAB 1QHPA 2Q7NA 1KLGB 3MO1A 3BEVB 3JXAA 4KGJA 3VGDA 2L4OA 2NY0B 1MVUB 3BZFB 3O6FC 4GUPA 4RWYH 2FRGP 3GSNH 4F8TA 1O0VA 4FQPA 3SDYL 3U0PA 2Z93B 3PF2A 1CGSH 4HBCH 5JPNA 4I18C 5FB8A 4ELKB 3FOLB 3WUWG 3ZTJG 2O61B 2A1WL 1RJZB 1X44A 5DMKB 1YDPB 1A9BB 4OI8A 4P2RB 1CD8A 3TZVD 2X4QA 5F9AC 5CLTA 1KIPA 5FKPA 5L0QB 2VL4A 4I1NB 5TQ2L 4TUJB 5KZCB 4QKXB 5T3XE 1AE6L 4LNVA 1J05B 3WS6A 4TVPE 3EKCA 5DD0L 2EH8H 2QLVB 3PDDA 5CJQH 5JUEH 2ARJA 3QB7C 4Q9QH 5C08E 2DQJH 1GOHA 1MUJB 4U1HA 1A5FH 4IIQA 5GGRA 3MYJB 1A9EA 3OXSB 4OZFA 3JV5A 1QFWI 2FDBP 4OCSL 3EO9L 4JO2L 3BP5B 2WIMA 4TNVF 1YECH 3BZDA 1C7TA 3W39A 4QYOA 1HOCA 4URTB 3MRMA 3LH2L 5FHBL 1LO0H 3T65A 4E9LA 4XCNB 4P23B 4XZUB 2OK0H 3TT3H 1JK8A 3IKCB 1C7SA 4K8RH 3S4SB 4P5MA 1U58A 2F8VA 5I66A 3HAEH 4GAFB 3IDIB 8FABA 1EO8H 3DSFL 4PJCE 5I1IH 2AVGA 3UPRA 3V79C 5I0DA 4NP4H 4X9BA 3V5KA 4HKBB 2B4CL 4YBLB 5BJTB 1NEZB 4PJGE 1M4KA 3HCVA 3RGVA 4F9LA 1AH1A 4L3ED 2Y06H 3TNMB 4U6HA 2XQBH 4DK3A 1QO3B 4L4TB 1I9EA 4KJYA 4LVOB 2IBZY 4KKBD 4PGCB 5KTEH 3MLWL 1CK0H 3CUPA 3TJHC 1MH5B 4LHUD 3S36X 3V0WL 4XCCL 1A2YA 4IMLB 2BVQA 4LPTA 4PG9A 4OF6A 3HUJB 2B20A 5BQ7A 3BO8B 4BH7A 2FX7L 3SEPA 5GGVH 3ROOB 3VCLA 3SJVA 1FNGB 4ORGB 4M6NL 5AG9A 5BS0A 5JOPE 4KUCD 3D2UD 3G5YB 4TVSa 3BPLB 1ZTXH 4XAWL 4H1LB 2CPCA 4KUZL 4S1SL 4GW5A 5HYQA 3KHOA 3ARGD 5I1HH 3P2TA 3TM6A 1VERA 5F1SA 4PRPE 1TJIL 2QADC 5TGBB 4CDHA 5MENB 2PETA 4LQFH 4RGOL 4G6MH 2XNAB 5SX5K 4XP6H 1JGEB 5DK2A 5EC2B 4Z77A 5IESL 4FQQB 1G9MC 1QSVA 2JCCF 3DUSB 1FZKB 4X6DE 2YC1B 3K81A 5E2UH 2NR6D 4O5LL 3WUWA 4FZ8L 5IIEB 1FSKC 2BNUA 1CN4A 2APBA 4U1NA 4M48L 2FGWH 5FYLE 1J11A 1DN0B 3CZFB 1ZVSA 4MSWA 3KVQA 4JFPA 1MEXL 1UXSB 1MIML 3IXAB 4PLOB 5FEBA 1MHPL 1DR9A 5EU5B 4Z8FH 1XF2A 1LP9A 3ZYZA 2ATKA 3PV7A 1CFTB 2DYPD 1MCLA 1ZHBA 3FHAA 4FFVD 4K8RC 5D72H 3RP1A 2DIJA 1BBJA 3BIAX 1JF6A 3ZKSD 1H3TA 4TRPH 4TQEH 4O02L 3VWKB 2ADGA 3MRQB 3P9MA 3D18A 4X6CA 2A77H 4JVUA 2BSED 2LVEA 4H8WC 5CEXB 2J12B 4OKVB 3O2DL 3RUGF 1BMGA 3PGFH 4QO1A 2WIIB 3H0TA 4YR6B 2AXHA 4JFEA 1L4IA 3FTGB 2PTUA 4XXDA 1L6XA 1NLBH 3EYQC 2GY7B 1UH2A 3JWOL 4NIKB 4EXKA 4WWID 3NACH 3MRCB 4G6FD 1QLFA 4QHLA 4XPAH 2EIBA 5B3JE 3UTPE 3WO4C 3F6LA 2ITDB 3Q5TA 3ZKND 1RUAH 5D9SB 5KSAA 3KPTA 1QYGL 2H1PL 2DS4A 5DRWB 5D5ME 2KH2B 4ERSL 2DWEA 4HWEL 4EI5B 1MPAL 2YD6A 3I02B 3E2HC 1T7XA 4ZOCA 1I85A 1VFMA 1PEZA 3THMH 3RVTC 3DIFB 3P9LB 5DEGA 1NCNA 2QQNL 5EA0L 3ZL4H 4RGMB 2HVJA 2R1YA 3MODL 5H37H 1U3HD 1KJ2B 3VJ6B 5ITFB 4NO2A 3VWJD 1EVUA 1KYOK 4MD0A 2H32H 4X7FC 1OGAA 4LIQE 5F88A 1P1ZA 4IDJH 4Q9BA 2YXMA 1KB5L 4P9HL 1MCRA 4Y19E 4S1RL 3VXMD 3MRJB 1IC7H 5IW1A 3RTQC 5ISZD 4MQXD 1KCSH 4PTTB 5J11C 4NPYA 5CJXA 5C0CE 1PKQB 4MJIA 1A47A 4MDJB 1NDGB 3HNVH 4JVWA 4DGIL 3RZCB 2VRAA 1ZE3C 4JRYD 3WEXB 3K2UL 1X6LA 4IRJA 5GSRA 3T2PA 4UDTA 4KKCD 3IS0X 2IQ9L 3KAAA 3OKOA 5HHXH 1I9RL 1MHEA 4GQ9L 3NFSH 3IU3B 2AP2A 4FG6D 3BN3B 1WITA 5BV7L 1MFBL 3VGAB 1TCRA 3MFFA 4HS3B 1EERB 3T3PF 2AQ1A 4UBDD 1JBJA 1IKNA 1U42A 2OL3H 4RFEB 1F4YH 3OKEB 3OB0H 4QXUL 4K7PL 3VXRB 4FFYH 5C0GA 4KRMB 4OLYL 1QFPA 4UT7H 3EYFB 4F37F 1WBYA 3WXWL 1Q0XL 5HVWA 5HHOE 5SX4H 3UROR 1UVQB 3NAAL 1DUZB 5F7KC 4XCYB 3RZWA 5GIRB 2IMMA 1ZA3A 4N5ED 4LSSL 5FAAA 5E2JA 1F11A 4PJDB 4E41A 1KF9B 4MXWH 5IW6A 3MCLL 3BDYH 2I25N 2B5IC 3TCLB 3MRNB 4LGSB 1DANT 1KPUA 1P7KA 2NTFB 2ZUVA 4R96B 3BISA 4M9PA 1ZSDB 3RL2B 5C8JB 4JY4B 2VZUA 3MXWL 2O93L 4ZS6C 1WTGT 3AAZB 1WFUA 3FQXA 3MRFB 3IETA 3LDBC 4XPFH 4Y0GA 4YDIL 3D9AL 4HQQL 3BXNB 4N0UA 1IGFH 3C5ZA 3P40A 5I0ZA 1OSPH 4ODTL 4D0DA 1I1AA 3UYPA 1AGCB 4NZTH 4TTDD 2A9NH 3DI3B 2EDWA 1QFWM 1IBGH 3CFKA 5A2LH 3RGVD 3O4OC 4UAOB 5CJ8A 5HI5D 5IM7B 3VXQA 1JYWA 4TTGA 1MWAH 3NOIA 1R3LA 1A3RH 3BH9B 3QEHB 3P77B 1T1ZA 4XBGB 5DMIH 1Y18A 2R56L 1IEBA 4KK9C 2IFGA 1J1XH 3SKNA 1UJTA 4TSAL 1EAPA 1CFQB 3RWHB 4TOYH 2F74A 4PJEF 4XTRD 1G7HA 1OW0A 1XH3A 3QZWA 5F96L 4C57C 2RBLA 3SJVD 2H6PA 1G0XA 1KC5L 2OP4L 5BS0D 4MD4B 1YPZE 4UV7H 4MHHI 1D5ZA 3OB8A 4KH2A 4NN5C 4HFWB 4NUGH 3REVA 1HHJA 1MHCA 1N7MH 1TJHL 4Z7UE 3PDOA 5JA8B 1F42A 1IGYA 1KCRL 5IBTL 1IL1A 2HMID 3HE6D 4YK4C 5T3ZE 3LMJL 5GZNC 2AJYH 1FVEB 1YQVL 3MACL 1XIWA 3G6DL 5CUSH 5JW3L 1KCVL 3M07A 3OHXB 4OFDA 4Z0XA 3SGJA 5FM5O 5JLZB 3BWAA 1U0QA 5AZ2L 1ZOXA 1HEZB 2XT1B 2ZUQC 4PV9A 1S9WA 4D0CA 3HZVB 1W0VA 1IGML 3GUTB 2CDFB 1NL0H 2ED8A 3MLSL 4MNGB 4ZOEA 3U7YL 3MBEB 5EBMA 3F7YA 5FCUH 1OM3L 4QRQB 3A67L 1UM6L 2AABL 3NPSB 5FUZL 1NBYA 1LO4L 2VAAB 4DN3L 5GHWH 3DECA 5GRJL 1E6JL 4ISVA 4M6AA 1NJ9B 5BRZB 4F8QA 1SY6L 3PGCB 4G8GB 1NC4B 2NXZC 5C08A 4LOUC 4XVUC 4PRDA 3X13A 1GGBH 2R2BB 5E99L 5BZWB 3OPZH 4HGWB 1FO0H 4BK5A 4XNZB 2Z91B 1Z0MA 3FO0H 3TA3B 3CDGB 1DZBA 3KYNB 4JFED 2QTEA 1HSAA 4XVTH 1MFAH 4IOFC 1MLBA 4MCYA 3OKNA 5DHVB 4EIGB 5BVPL 1PDKA 3EHBD 4F58L 1MQ8A 2A74B 4DFIA 1CE6A 5FFLA 4Y8DC 5DUPL 4AMKL 4PJCA 1S78C 5IHBA 2FX8H 1M7DA 4WHYG 3VDBA 3ZYJA 4PJGA 1A64A 4MA1B 5KSAD 4WJ5A 2C7UA 4MJ6B 3VI3F 3QHTC 1Z9LA 3HLAB 1MAJA 4FQXA 4TN9A 5J1AB 3I84A 1IEAA 2EC8A 3IRPX 5TE6H 1UADC 2B2XL 3HC4L 3TT1H 4HX1A 4PJHF 1CFSA 1K8DA 5E9DB 4BH8B 1IGTA 3PHQB 1MCKA 1XEDA 4QNPF 3EGSA 4F9PC 1IAII 3TN0C 1RZFH 2DDQH 1MCJA 1NCDL 1NKOA 4BM7A 3VFMA 3BP7B 3VXUD 1OGAD 2BVTA 2X4UA 1P5UA 3FRPG 3M17B 1V3MA 5IVXF 3V7MA 4PRPA 5ICXA 3RVUC 1KT2A 4R4BA 2ORBH 2WUCL 5DJ0A 5EU3A 1RK1B 4PRIE 4L8BB 1DL7H 3EYUL 3JV6A 4MJID 5GPRA 5IVZB 2BJML 4LRIC 3D5OF 4X6DA 4IRJD 3V5HB 1FVDA 1WBZB 3K1KC 3UO1H 2W9LA 1RZ7L 3GSWA 2C1PB 2ZUWA 3GMPA 1T0NB 1FGVL 4APQC 5I71B 4CN1A 4LARL 2VXTL 5H35B 4ZNCD 5LWYH 4MGXA 5CEZL 3UJIH 1NMCC 3HRZA 4M5ZH 5D93C 3C6LB 1X5IA 2EKSB 5CBEA 3SDXE 1WLHA 2DJUA 1KPVB 1U3HB 1O7VA 4KVNH 5LKNA 2DLEA 5T1KB 3T09A 4Z7OF 3U9PH 5J12B 4PUBL 3V9FA 2ICCA 1L9MA 4OF8A 4HWZB 1OWRM 4D3CH 3TJEH 5BO1H 3GSXB 4RMQA 3W82A 4JANB 4E41D 1CF8H 3KR3L 4Z5RA 2CIIB 4P2CG 4AQ1B 4RMVA 3D0LB 1ZEAH 3QEUB 4L8CB 4GRWH 2CSPA 2OLDA 4OF0A 1CT8A 3EOBB 1XGTB 1A7RH 4BKLB 5DRXB 2IGFL 3VFTB 2K9UA 1GGCH 2V7NB 4DGYL 3QEGL 3HNSL 1MFDH 1OWWA 5AYUL 1VPOH 5AUMA 4HV8B 1FYHB 5B38G 1FH5L 1R3HA 5D5MA 4YBQC 1MAML 3E6FB 2Q87A 1HHHA 3DGCR 3SDDC 3F7QA 3IJHB 4I2XB 1BJMA 5IB2A 4KDTA 3C5ZD 4F80A 1YEDA 3EYOB 3T0EC 1QVOA 6FABH 1I1AD 5MP6L 3MCG1 3MGOB 2C4FT 2PW1A 4PJXB 4UTAH 4O2CB 1X5FA 3DPBA 3QO1B 4KQ3H 3S34H 1M6OB 1EJOH 2AJXL 3F8UB 2HG5A 1NGWA 4BUHA 5C6TH 5IEKB 4R2GD 4U6XA 3B43A 4YE4H 2HH0L 1D6EA 4Y19A 5F9JA 1X5JA 2HWZL 3GJFK 5IVNA 4UZGA 5AG8A 2ARJQ 5C0CA 5ACZB 2D7TH 4LLAA 3GM8A 3TIEB 5HDBF 2NY6D 3PWNA 3RPIB 4KHXL 4ZPVB 3SCMC 1A7PH 4MNHB 3EOTH 1C5CL 1L0YA 4M4PA 1B3JA 4LRNL 3U83A 3ZDYF 1GHFL 3ZYIA 2P1YA 3HA0A 4PGDB 3MLPA 1P7QA 4OD1H 3SDCA 3SE8H 4PB9H 3WXVH 2DI7A 4ODXB 1DLHA 2H26A 2OJZH 1RZKC 3H3BC 3BGFC 1J1OH 4HC1H 4HCRH 2SEBB 1VHPA 5EBLA 4GAGH 2H2SD 4NOFA 3TYFA 3QJFA 5F7DB 4DQOL 3PWPE 2CH8A 3A6BL 3L9RB 4NZRH 1U9KA 3GKWH 3D87B 5DMJB 4MZ3A 5CP7B 3EO0B 3ESVF 1MELA 3FB8A 2OMNA 2VWEE 1QG3A 5LJYH 3FQWA 1NGPH 3DARA 1A1OB 1F3JB 4RAUB 4JCLA 3ARFA 4UQ3B 3BSZH 4MA3A 5C08D 4X4YA 3ARBA 3QXVA 1MCPH 1OTTD 1FL6A 5GRZA 3WIIH 1A4KB 1QOKA 4FP8H 2OR9L 1T80A 5CHNA 5CZXD 3HE6B 1U8JA 4UT6L 3WL9A 3IXTB 2C1OA 4WW2B 3CFDB 4U1MB 4X4XA 4DTGL 4K9EL 5D2NC 1FFOA 4GRWF 4NQDE 5B38A 1FNEA 1Y0LB 2AJVL 4PRNA 1MCNA 4X7TB 4NWUL 4Y16A 4CMHB 1U2CA 2E5EA 4RNRA 1Z9OA 3Q1SL 3PL6B 1ORQB 3LQZA 5A2FA 1WIPA 4HWBA 2J88H 1U91B 2GQHA 4HG4K 2CRZA 4UMGA 4M7KL 5I30L 4OJFH 4ZXBB 3O45B 4FQXD 4Q97A 2A0LD 2HJLB 4WWKB 1C1EL 2EO9A 3IJYB 1HILB 1MCOL 3KPRE 5GGVY 1AGDA 3MV9E 1S7TA 3RWIA 1JGDA 4PJAF 2JCCE 4WFHE 4K3DH 1IILE 3FAWA 4ZQKB 2ICWA 4YHIB 4XWOC 3U1SH 4YHLL 4F7EB 2ADJB 4Y5VA 2BZDA 5GQBA 4DKFH 5JW4M 4ZFGL 5JOPD 3SE9L 4J3UA 4H88H 2IH1B 3O8XC 4DAGL 4OCYH 5HY9B 2CUHA 4Z7UA 4NCC2 1U93A 4PRPD 2OQJB 2VKXA 2WWMC 4GJTB 3V52L 5JR1L 5IJVB 3STBA 2ZKHL 1YNTA 4FQJH 4WDIA 4QGTA 3R4DA 1IAIM 5EO9B 3QUYB 3PHOA 3SPVB 3PXHA 4HH9A 2FSEB 1QBMH 5JHDB 1D7FA 2G60L 2VXUL 3F7VA 1XF4B 4HFUL 1K8IA 1RJLA 3RUGE 1T0PB 1FL5B 5K9JH 3SO3B 4DZBA 3BQUB 2NY5L 2P8PB 4HK0B 4D94A 2NY4B 5DJ6B 2AW2A 5JZ7C 4U6VL 5B39G 5EO0B 5I18L 1NGYA 2HLFC 4YIQB 1OAQL 1S9YB 4OD2B 1N59A 3T0XA 3M1BB 3V4PH 4U7MA 4FQ1H 3RDTA 1EHLL 4DKEL 2ILLA 1UYWL 2CIKB 4PJ7F 4U1SB 3MLRL 2IBGA 3BUYA 4E0RA 4G43A 3KNBA 3UC0H 3VDAA 4HS6A 1RUKL 3UJTL 3BEWA 3DNKA 3VXUB 1T83A 3G08A 2R0KH 5E6YA 1AR1C 1A1MA 3R1GL 3LIZL 4G8FA 5DDHB 3PDGA 1UZ6F 2VXQL 4NQEA 1FFNB 2C5DC 4X5XB 2APXA 2M2DA 3DJ9A 4D9LL 3H7LA 3GO1L 2NXYB 3RWCB 4C83A 2IJ0C 1JUFB 2CMRH 1CCZA 1IZJA 3QDME 1IQDB 3U48A 1E4KC 4NZUL 5DVOA 5C2UB 2Y1VA 5F8RC 3N1QC 5CJBA 3MNZB 3FL7A 2X2YA 2D03L 2E3VA 4M03A 3UTPD 4NDMA 1FNFA 4K94H 4ZO8A 4G9FA 1T0MB 3O3DB 1J7VR 1Q9WB 4PRHE 2CKBL 5JHLH 2X4OA 5J6HB 5DJCB 3VRJA 2YPLB 5DQ9B 3X11A 3C08H 4LLMA 5ESAB 1H15A 3EJZC 4TYUA 2YK1H 2VDOL 1DVFC 4XP1H 5IB1A 3SOBL 1YNKH 2ZSWA 5AWNH 1X5XA 1FAIH 4JKWA 4UNUA 5IB4B 3WN5B 4DN4L 1QR1A 3VD4A 5I16B 4OB5L 4GSDL 5T33L 3T3PE 1ROWA 3IGAB 1SM3H 5DJAB 3QQNA 4HUVB 3MUY1 2W60B 4PRIA 3NZHL 1ORSB 2IH3B 2H2PC 5C0CD 1FN4A 1HNGA 5F1OB 4XCEB 4LHQB 2AJSH 1QQDA 1JWUB 4JQVC 1N6QL 4KVCH 3QWOA 1UACL 4Y2DC 4PRBA 3K7UA 4N1EA 4TNVK 5HDLA 1QSFE 3T4AB 3GHEL 1NKRA 1G7JA 4EOWL 3DV4A 3KLAA 1FC2D 2EYRB 5IHUL 5K9OB 4IEFB 3RBSA 4QTHB 3HE7D 4UDUB 3SDCD 4FQLL 2LAGB 4DZ8B 4I8DA 2IG2L 5EORL 2FIRT 5DUML 3SDXA 3W9EA 4ONGL 1X5GA 3X3GL 4ZUUA 3GJEA 5I8EB 3FQTB 2RR3A 4KZDH 5ADOH 5HHOD 4FMFA 4QOKB 4R2GB 4K94C 2NMSA 4YHKL 5FOJA 2QHRL 1NFDF 5CGTA 2OSLB 2GJ6B 4LF3B 1QP1A 3QUZB 2GAZB 3MRPA 5I76B 2G9HB 1VGEH 4YDJB 5HGBB 4HXBH 1U8HA 3NZ8A 4QHNA 5I1EH 1EMTH 1H5BB 1A6ZB 5D6CB 1BREA 1V05A 5FECB 1I8IA 2WNGA 3ARDB 5TF1H 2G2RB 5JQ6L 1RK0A 2EZ0D 5K9KA 3AS0A 1QKZL 3ARBD 1VACB 4IM8A 5DJXA 4YXHH 4Y5XB 3U0TA 4JPKL 2JK5B 1BD2E 2UYLA 2XZZA 4TNWF 3PP4L 3CH1B 5C2BL 2MCPL 4YHOL 1OGTA 2Q3ZA 3F58L 1KBGL 4KKLC 3GK8H 4L9LC 5KANG 3V95A 3DRQA 4BZ1H 4YFLI 3WFEH 4PJEE 3K74B 1AQDA 1LMKA 4K71B 1NLDH 4Y16D 5DD5L 4OCRH 5BCAA 2ZCLL 2H9GB 3QWQB 4BELD 1YYLH 5F3BA 3QQ4B 4MJ5B 1M71B 3CX5K 5TH2B 3MLTB 4DK6A 4F7CA 4ODWB 5C0DB 4R3SB 3RWEB 2E9BA 3UTTB 4MA7H 1XR9A 4HMDA 5DLML 3FHQA 1S7RA 4YHYC 2WP3O 3DROA 3QG6A 2Q8AL 3EDJA 2C3VB 1LNUA 5C6PB 3KYKH 4L3CA 1ETZB 2HT4D 3SKOA 1P4LA 3I85A 4Y5YC 1Q1JL 1VEOA 3DX7B 4HXAL 4OLZH 1TZHB 4JAMB 1KLUA 4DEPC 3K0WA 1WIOA 3BIKB 4P2QE 1IAKA 3HHRB 4F7TA 4H20L 2OTUA 3QISA 4NO0A 2VDPL 2DB8A 3PE9A 2ZUSA 1T3FA 5T3ZD 4HUXB 2CUMA 3P73A 2HTLD 3TPKA 1W72B 1JZ3A 3NABL 3KPQA 4Q2ZA 4KAQH 1FBIH 1A7NL 2QL1A 2I5YH 2VL5B 1JF1A 1J86A 1EFQA 1MJ7L 3WJLC 5ITBH 4NRYB 4Z7VB 2ZOLA 4B7LA 4QHUB 4X0KB 1T5XB 3IDXH 3FO2A 1PGRB 4R97B 1UA6H 4UNVA 3S35H 4OV5A 3PWPA 1QHOA 4PY8J 5C07E 4BYHA 4NO3A 1LO5A 4JQXA 1J0IA 3GMRA 4PJ8A 1DLFL 3P11L 1PBYA 3RDTD 1M7XA 3PGDB 4DOHB 4CN4A 5T1LB 3P30L 4F2MA 1EEQA 5CCKH 2BVOA 5T3XL 2FH6A 4Y4HC 2WBJC 4TVPL 3UDWC 3LEYH 3BMWA 4JPVL 3S36L 3VI3E 3LN5A 4P57B 2UV3A 2VDML 2NY0C 4G8EB 3NCJH 5D6DA 3QUMH 3K8MA 3NIGF 1G7MB 5DO2D 5FDWA 5LCVL 2WQ8A 3W0WE 3QAZB 4NQDA 1TLKA 4QHKJ 1GPOL 4S1QH 2VXSL 4U05A 3WKMH 4QNPE 5HGGS 3L5XH 1JPFA 3HFMH 1JV5A 2V5YA 2GITA 1G9NH 4H1LH 2YZ8A 4JO1L 4CBPA 3ZZ1A 3F12A 4LKCA 5DMGD 5IVXE 5L0QC 4HBQA 3TEUA 2FIKB 4ODSH 3BKYH 5MEPB 2V17H 5B8CA 1BIIA 3DO7B 2Y6SC 1MJUL 1R0AL 2LQRA 3KPRA 4X6FB 1EZVY 1N3NB 3MV9A 3O2WL 4D9RE 2XKNB 1SQ2N 3TWCH 5K93A 2JCCA 1JPSL 4CW1A 3H7BB 1VEMA 4J12A 3D0VB 1T03H 2VDNL 2FYYA 1QPPA 5DYOB 1TVHA 3QHZL 4M61B 2ERJC 3UBXA 3GSNA 4YPGA 3NPZB 1N26A 2Y72A 4C56B 1KB9J 1FDLH 5D1XA 1LE5A 5EDXA 1HHKA 3MLYL 4N0CC 2DM7A 5EB9A 3IAPA 4OGAC 4NNXB 4LVHC 4P23C 5GISL 2HKHH 3VFPB 1RUML 5HHNB 4PRID 2QR0B 3HR5B 3QFJB 5F1KC 5E08H 1TQCC 3TBVA 5I1GL 1DBJH 2JB6A 4M1DL 4AIOA 2XN9E 3PWVA 5FYJL 3E8UL 2Y9RT 1JCKA 3U0WL 4YBLC 1J5OL 1ZHNA 5J56B 4Z7OE 5L2JA 2BNRD 5IFAL 3B6SB 2DQHL 3RUGA 4AH2A 1WICA 2VZ3A 4QY8B 3MLUH 1RVFL 5E6IC 2HKFH 3N85H 1W0YT 1XGRB 3FT3A 5FYLL 4CU7A 5DD6A 5JA9A 4J1UB 1C12B 1FLTX 3DO3A 3IDYB 4BJLA 4KI5C 1AO7E 3SQBA 4F7MB 1UJ3B 5J6GB 1KEGL 1FJ1A 1C16A 4S11A 1IM9A 2QSVA 1SEQH 3CVIL 3OAYH 5GS0D 5DD3L 4JM4H 4GS7C 1H0DA 5CGYC 1XGQB 2AV1A 4M6MH 1T20A 2DOCA 5DFVD 2EIZA 1ES0A 4G42B 2R0ZH 3HAEA 5E2TL 5I8CB 3MRGA 4LCUB 2XFXB 3Q6GH 4B7IA 5HHPA 2YD9A 3D48R 3AROA 3QDMA 3CK0L 4X8JA 2NY2B 4R4FH 4EUPG 1KIQB 3V5DA 4U3HA 4F3FA 1KJ2H 5ILTL 2CLVB 3G6AB 4GMSH 1KN2L 4C58B 4QRSB 2BHUA 3GBNH 3HE7B 2JJSC 2XZAH 1C8PA 4NKMA 1JPTL 1GGYA 4KI5F 5H37G 2DQFB 1AP2A 3HUJF 4PRHA 3O41B 1FVCB 1N5AA 5F7LB 5INCA 1HQ4A 3WIHL 5GRWA 1VFOA 3CLFH 5E5MB 1HKLL 3OWEA 5HDBE 4X5WB 1PZ5B 4P9HC 2XTJC 2BRRL 4ORZC 1KG0A 1OLZA 4KZEL 3KYMA 3ZDYE 1K2DB 1KN4H 2PO6D 4HT1H 4XB8A 4H25B 1HHGA 2OCFD 1U8PB 3MA9H 3O3AA 2BCKA 2IAMD 1MY5A 5IQ9A 4ZPTA 1Z3GL 4LIQL 3EDEA 3UTZA 4OTXH 1HDMA 5EH1A 3FB6A 5FA3A 4EVNA 4U1JA 5I17B 4XNQA 3D85B 3CU7A 3FQRB 4OIIL 4ODVH 5ENWB 1QSFA 3GMOB 3IFPA 2EYSA 4RDQF 4MS8C 3EO1A 1INEH 3I50L 4G7VH 4NO0D 4ZYKA 2IQAA 1EZVX 4GAYB 3C2AL 5KSBB 4EI5C 4LQ1A 3MOAL 2MKWA 1SJHA 2P5WB 3BKJH 1IT9L 4V1DE 1DBAH 1D5BA 1JHLL 1MCFA 2YXFA 4NHCH 4AEEA 1AXSB 2BXYA 4QHKI 1FPTH 1XR8A 4Z78B 5D7JB 2ESVE 4OSUL 3CU1A 1LDPL 4LU5L 3KXFE 4XHQA 4UIKL 2R23A 4Q74A 4KHTH 4KTYA 5DK0B 2YUXA 3M8OH 5F89B 5HHVL 1BGXH 3GNMH 3X3FH 3P4OB 4JE4B 1OAUH 5MHSE 2GT9B 3QQ9D 4E5XA 2EXYC 3CMGA 4FTVE 3O6KL 4GRWE 1BVLA 4PJ8D 3RWGA 4F15C 1KCUH 4JY5H 4XPBL 2FLBT 3HKFA 2AI0H 2Y25A 4Y4KB 5C9KA 1ACZA 3PP3K 4G3YH 3T77B 4JFQB 1CZ8H 2DMCA 4M7LT 1AY1H 1YPZB 2X6MA 3QDHA 1K3ZA 1RUQL 4WW1A 1BECA 1DQTA 3PIQB 1GXEA 3WFBH 2X70A 3L3JA 1JNNH 1BD2A 1CLCA 5LQBH 1YEGH 2DRUA 2GCYA 5C0AE 3KPLA 4XNXH 4RIRA 3IDUA 2A38A 4JFYB 3QT2A 5TPWH 3EOYG 3VGAC 1MFEL 4OM1L 4Z7NF 1FNSH 4XNUL 2VITB 2ID5A 5KVDL 3LY6A 4PJEA 1B0GB 1W2KT 2H32A 4TSCH 2YKLH 4MX7B 1CU4H 1F02I 1YJDH 5ANME 2EEDA 1B9ZA 2WBKA 5D2NE 3SKJH 4NBXB 4HWBL 5DJDB 5CINL 4O9HL 4JFDE 4BSVB 4LGPB 4HULB 3MLVH 3CFEB 4GXVL 3C9NB 3P0YL 3EFFA 4JN1H 4GAJH 2OJEA 3QULB 4PREA 1HH6B 5HI3D 1QD0A 4DW2H 3MV9D 4OGYH 4QRPD 1AKJB 4WFHD 2VTFA 5BXFA 3TV3L 5F9OH 1X4YA 3NA9H 3BGAA 1A3LL 4HHAB 3KYOB 3VXPB 2IPTH 4R0LC 1FFPB 1HIMH 4P2QA 4F7PA 3DX8A 3LKPA 3ZT5A 5D1XD 4HS8H 1OTUD 2LAAA 3ECBB 2VC2L 2OL3A 2G5BB 1HE7A 3ULVL 4BQBA 2ADFH 5I8KH 4KQ4H 1HINH 4PJ7E 4X99A 1RIVL 1RI8A 1S7XA 12E8H 2D3VA 2MQ0A 3BHBB 5I2IB 1I1YB 1OAKH 4MD5B 1DQJA 1PX4A 1S8DB 2F8OA 1I8MB 2IPUG 2ZWLT 4JO3L 3RGHA 2CRIA 4NHUB 4PJDF 4X6BA 1T04A 3LS4H 5D1QB 5C07A 1NCAH 3TCXA 1FP5A 2A6KA 1ZHLA 4GOSA 2P47B 3L95B 1JTTA 5DHVH 2PYEE 4X8XA 5CSZA 3X12B 5EO1A 1HQRA 4RQQA 4LFHD 1HSBB 4LLVA 1IM9D 1PYWA 4ZUSA 2HJKA 4JFOB 4LCCB 5L6YL 3P4NA 4DVBA 5KG9A 4NFCA 1YJDC 3OR6A 4JY6B 4EQ3A 2DQDL 2PR4L 1BX2A 2CXGA 1JNLH 3N9GL 5DFTA 3DRTA 1ZA6A 2NYYD 2NQCA 4ZUVB 4CN6A 3W0WA 1LGVA 4HIJB 3QDMD 3RPKA 3T1WA 4L8SC 1EEUA 1CDBA 5L2KE 4BFEA 1EXUA 1DBKL 2BNRB 1MWAA 4LSRL 5EOTA 3OKLA 2W0FB 1T2QL 3N1FC 5TQ0L 3B2VL 4KKBC 1T21B 3CSYB 5IVXA 4E42B 1HXYA 2VMFA 3UZQA 3MLXH 4YO0B 4BZ2H 2N56A 5T1MA 5E8OB 5B39B 2AXGB 2JB5H 1KJ3H 4MDIB 1TTFA 1MREL 2XQYK 1S7SA 2ICEA 3OJVC 2OI9C 3W11C 4LLDB 4OCLC 2APWA 2COQA 2VDRH 3CLEL 2QJDA 1D5XA 5D2LB 1AI1L 4L4VE 3RI5F 3ARGC 1JHTB 4J8RA 2BOCA 4Q6IB 4XNZC 1I1FB 1DUYA 4YDLB 1TETL 3NCYS 1M7IA 3TH2T 3A6CH 3D25B 3VFRA 5EUKA 2X89A 5IKCB 2VERN 3MUGA 4F9PA 2XOTA 4XMPH 3Q6FB 1BEYH 4X9FA 5CGMA 4P4KB 2AGJH 3KJ4C 3S7GA 1V7ML 2NR6C 4PLNC 2XN9A 4ZTOL 4TSBH 2NPLX 3RWFA 3CXHK 5CMAB 1QSFD 4RFNC 1KJMB 3W9DB 1BF2A 2VUYA 4LLWB 2D0GA 1U41A 3MRIA 5EIIB 3FT2A 1KJVB 2BDNH 3FB5A 1JFQL 1OTSC 1OAYL 4ZTPL 5C0IB 4LRIA 4CDGC 2HFGL 1CR9L 2N4IA 4FFVC 1IVLA 1EPFA 3DX6A 4KUCF 5T5FH 2HVKB 2AKRB 4WI4A 1ACYL 1L7IL 4JJ5A 4APQA 1AO7A 3QIUA 2X42A 3BKML 1VEPA 4W4OC 2R8SH 1FO0A 1JJUA 3MBXH 1XGUB 4GKZB 1YMHA 3WJJA 3W5NA 3ARRA 5DR5H 2PO6B 3K4DA 3DUUA 5MEQA 1QSED 1PD6A 2VDQH 4B5EA 1RZJH 2VDLH 1R3IL 1S5IL 1RJYA 2OS7A 1AIFA 1TFHA 4M8QA 2AJUL 3IFNH 2DMKA 2IAMB 1GIGL 3HI1A 4OFPA 1HXMB 5EWIL 1CYGA 1JWSB 3DVNB 4PRAB 5KAQF 5GS0L 3D6GA 3VU2A 5C0RH 4XMKH 1DBML 2CXKA 4L1DA 5KVGH 3LKQA 4HEPG 4CU8A 1MHHB 5GS1B 3D3VE 5IMLA 1IRAY 4JG1H 4QRRB 5DJ2A 4YQXL 5HXMA 3L3OA 3LD8B 3ZKNC 4S2SB 4X4ZA 5I71C 1BD2D 1WZ1L 4AIZB 1CGTA 2EO1A 1DCLA 2APTA 4ZUTB 1INDH 5DGQA 4JZOB 3TFKD 3IDJA 4P46A 4QGYA 5CJ5A 5BOPA 5DD1L 2BSTB 5TDOB 5JORA 1U3HC 2IWGA 1UWEH 3VWJC 5GGUA 5HPOA 2BFVL 1QBLH 4JB9H 1A14L 3V6BR 3BE1H 2M1KA 3S88H 4OCWH 2LE9A 1HH9B 1YEKH 7FABH 3DURA 4F33B 3B9KA 1BOGB 1L7TL 5FK9B 5KN5B 3HI6H 1BBDH 5DSCA 3I9GL 2GTWA 2DLFH 4MQXC 2AXJA 2MHAA 3MJ8A 1C5BL 1KCLA 1P69B 5I73C 1TVBB 4OQ1A 2XZCL 3IDMA 4NO5B 3QIWA 5AAMA 4BQ9A 4XNMA 3WE6A 4KKCC 3CXDL 1PSKH 4WI2A 4P2QD 1F4HA 4WRLA 3KGRA 1NH6A 4M7ZC 4FG6C 4KK9D 4WO4A 5DA0B 4GW1A 3ROLB 4CVZB 5ICZB 2BHYA 3SQOL 5BMFL 1WC7A 4UBDC 4OM0H 5M95B 1OAZH 3RWDB 4FQCH 2R4SL 4LPUA 2FJHA 3MREA 1JPGB 1Q9KA 2ESVA 3KXFA 1T22A 1GJIA 2CO7B 4GRLD 3FFDB 2JJTA 4LSPH 3MV8D 4M6OH 4NKOA 3PV6B 1VADA 2I9TA 3NIGE 3M45A 3IDGB 2J5LB 2YN5A 1S7QB 4N5EC 1NBZB 3PNWB 4GKNB 1A9EB 2E7BA 3JV0A 1TZGH 4FTVA 3WS6C 4IHOA 1X4XA 4NRZA 1EV2E 1GGIL 4G6JH 4OAWA 1SYVA 2YA1A 4OCXH 2UVFA 4QRPB 3I6KA 3BUTA 3H3KA 3AU1B 3BP6A 3V0VA 3ZTJH 1I3VA 5HYSB 3I75B 4IIQC 2UVEA 1U58B 3VG9B 2VZTA 3ZE2F 2X7LB 2IC2A 4OGZA 5GJTH 2NY7L 3S96B 2XA8H 4WUKL 5D7IB 1X7QB 4JM2D 5C0AA 4I0CC 3B3IA 3L3GA 2ICWJ 2GEEA 4PJFB 5I6XB 2DTSA 1P4BH 2X1WL 1BJ1J 3NN8B 2D0FA 3W0WD 3NCBB 4JG0L 4NJAL 4PJXF 4PJAA 4G6KL 3OX8A 3HPJB 4RBPH 4HPYL 4G9DB 4KKAD 3UYRH 4G80A 4TTDC 3VFSA 2Q6WA 3T0WA 2HFFB 3C5SA 4EDXA 3FCTA 3RGVC 3S5LA 4F9LC 1QRNA 1HN1A 2R69L 2A6JA 3L3IB 3MV7D 4O4YH 5I1CH 5HI5C 1MRFL 3MGAA 5ANMA 5D2NA 4JZNA 4LSVH 5DVKA 3LKNB 4XWGH 4JFDA 1RIHL 2P7TB 3SDAB 4ZFFA 3WKNA 1S78D 3KWWA 1JWMB 1OB1B 5IG7A 1ZS8B 1EHAA 2OXHA 4P2RE 4PTUA 4XTRC 3WS3B 2DTML 4OQTH 4D9RD 1H3GA 2BC4B 4WHCA 2R2CA 5J4MA 4LVNC 4JPWH 4FXKA 4N8VA 1XGYL 5F1NA 4NYLB 3U4EB 5F7EL 2FEDD 2OTWB 4UUJB 2EIDA 2V2XB 4WU7A 1F3DH 3QHFL 4JDVA 4X83A 4ODHL 1IJ9A 3CJJA 4HW6A 4AM0A 1HHIB 3WBDA 1X9QA 2HMIC 3HE6C 2WZPD 5LXGH 4RWYL 3GSNL 2X89D 1NGQL 1CD0A 1JMXA 1OQXA 5IT2H 1CGSL 4IOSD 4HC1A 4P59L 4HBCL 3NGBB 3TESA 5D7LB 3LSOA 3H9SB 3CIQA 1XFPA 4PJ7A 1C08A 2MTPA 3PJSB 4OI9A 5I15H 4CMHC 2NY5C 3PL6C 3P4MA 3PWLA 3PWJA 4PS4H 4NUJB 1ZHBB 1OY3B 1BZ7A 2FNBA 2QKIB 3KPOB 4PY7B 1PY4A 5MERA 3P9MB 1UM5H 2E8YA 1U3YA 2QQKH 3HC0A 1C5DB 3V7AE 1MF2H 2YA0A 4PLKD 2PYEA 5C09D 5EBWA 5C0BD 2HLAB 2Y5TA 1AO7D 3QIUD 5F3HA 2EH8L 5JUEL 5H94B 4L4TE 2GJJA 2VLJB 4Q9QL 2DQJL 1A5FL 1EEZA 2UZXB 5EU7C 5DRZB 4M4RA 2JIXA 3GSRA 1I7TA 1YECL 4KI5E 3HTLX 3HUJE 1R24B 2CKBB 3LS5H 4GKSA 4L5FH 1LO0L 5IHLB 3C5JA 3EHBC 5I1AB 3TT3L 2OK0L 3ORJA 4NQXB 5AZEH 4K8RL 3S35X 2VOTA 5TDPB 5JOEA 4EXPX 1EO8L 3GSQA 4NN6B 5I1IL 5IBUB 2IPKB 5L2KA 1DE4A 4NP4L 3T1FB 3VXSB 1U8NB 3VFVA 3SY0A 1K4CA 1YEFH 3WNNA 5MENE 3GZKA 2HVJB 2F19H 3PABB 3O3BB 4KJWD 2BNQB 2GSIB 43CAA 5AAWA 4XX1G 1JYXA 4YXLH 1IKFH 5IJKA 4YHZH 5JXAH 3ULUH 2H8PA 1EFXB 1CK0L 1GVIA 3OKMA 1WWCA 1IM3B 4P46D 2FD6H 4LASH 3QUKB 4WNQA 4YH6A 5C70A 1N2RA 4EZMA 1NDMB 1XMWA 3F62A 3NFPB 5ECJE 5GGVL 1A4JA 1GGUA 1QSEB 1YN7B 1ZTXL 3OKYA 2X4SA 4L4VA 1G0DA 1N0XH 1RIUL 3DMMA 2LVCA 1RZ8B 2YBRB 3RIAK 4U1KB 5I1HL 3B9KD 3ESUF 3FB7B 3QNXB 4LNRA 3VFNB 2Z35A 5CWSA 1Z9MA 5FYKD 1U8KA 3S37X 1S7WB 4W4NA 5CJXC 3FQNB 4LQFL 3MOBH 1BFOB 1DVFA 1JN6B 4G6ML 5CLWA 5BVJA 4PR5B 4XP6L 2X4RB 2VN7A 1H3PH 4YHPB 3QIWD 32C2A 4IS6B 4FXLA 2DQTH 3SGKC 4IRJC 2UUDH 3VDCA 5IV2A 1TIUA 3MNWA 5E2UL 3WLBA 5DRNA 4EUPB 1U8QA 4XH2B 4JHBA 2FGWL 4WO4D 2MSPA 4KK8D 4GW4B 3CD4A 4ZOAA 3TBWB 3WV0A 1B90A 2ICWI 4Z8FL 4LSQL 1IKNC 5T1DH 4V1DD 5HVGB 2A83A 3QA3A 1XGPA 5D72L 3T8XA 2GW5A 2D4FA 4R7NB 2ESVD 4TRPL 4TQEL 3G9VA 5J89A 1J8HD 3QI9B 4EKXA 2VLME 5T5NG 2ADIA 1P7KB 5MHSD 2BVEA 4Z76B 4I3SH 4KI1A 5DI8B 4Z7NE 5IQ7H 4FTVD 1KTLA 1UH4A 3UEZA 3STLB 4XVSH 1MVFA 1NLBL 4HPOH 3WNOA 2PCPA 4JR9H 1KIRA 3D3VA 2XWBB 3NACL 5DEFB 2PF6A 5DK3A 3U2SA 4XPAL 2WLZA 4MWFA 4XBEH 3ARYA 5M94B 1RUAL 5C0AD 3AREA 1I3RA 1PKQE 2FBJH 1V5JA 1OCWH 1FNLA 4LEXH 1BM3H 2QQLH 4WY7H 4XP4H 3NFNA 3LEXB 3SE4A 3THML 1WAAF 4HJGB 1P4IH 3GSVB 3QJHA 3ZL4L 4GRLB 4YGVB 4LPCA 4TUOB 1A6WH 4QT5A 3MV8B 2M26A 3OR7A 3O9WB 3B2UD 4L9LA 2CQVA 4R2GC 2DMBA 3ULUF 4JFDD 3JTSB 2Y4SA 4IDJL 2FH8A 1SJEA 2DF3A 1AE6H 3VXRE 1W72H 1FZOB 1H5BC 1IC7L 2ZCHH 1OW0C 1KCSL 4U3XA 1HI6A 4NGHH 1MLCB 3GMMB 4MYWB 1AD9A 2BVYA 3ARDC 4QRTB 3HNVL 1OP5H 5IB3A 1F2QA 3MZTA 5E1AB 5FO9B 5CILH 5I1JH 3WFZA 1NCBH 2CR6A 5DVMA 4JHZA 4Y5XC 4PV8B 4PJDE 3GMLB 4P2OB 5HHXL 3N06B 5DC0A 4LCWD 3LN4A 3DYOA 3NFSL 1GZQA 4CNIB 2B1AH 3QXDB 4IRZH 1AD0B 2OL3L 1BLNB 2X4PA 4LGRB 1F4YL 1FC1A 4PGEA 3MV7B 2B4CH 4FFYL 2D7OA 4DCQB 5KS9B 3S4SG 1ND0A 4UT7L 3QDGB 1G7LB 4Q9CA 3DXAB 1U8OA 1XZ0A 5F1IA 1AHWB 3O3EA 3V7AG 4BSJA 5JQHC 5ERWB 2D31B 4CADA 3UZEA 3HMXH 2P4AB 5FO8A 2N7BA 2X9YA 2PYED 4UQ2A 4MXWL 3WJLA 4NCC1 2X1XR 3BRDA 2IANB 2P8MB 4ODUB 4QXTA 3VXNA 2NW2B 5DMYA 4D8PA 2AERT 3MR9B 3MRRA 3FONB 5ESQA 1OTTC 1OSZB 1A1NA 5JNYA 5CZXC 1NC2B 3FQUB 3TO4D 3PUCA 5I1DB 2V5MA 4GG6B 1JPST 4D9QE 1Q9LB 1A7QH 3G5XA 3X14A 3MJ7A 4XPFL 3UDWA 1SVZA 2R0WH 1N5YL 4IMKC 1IGFL 1MFCH 1KLGA 3BEVA 3GBLA 3TO2B 4Y4FB 5JIPA 5L2KD 3DBXB 4PB0H 1MVUA 2KDGA 3BZFA 4NZTL 3BPCA 2A9NL 2FR4B 1LO3H 1IBGL 4R9HA 2Z93A 4NCDA 1U95B 4X7EC 3EGSB 2A0LC 4ELKA 2I9LB 3FO9B 3FOLA 4EN3B 2O61A 2V9TA 5C09B 1X5AA 5C0BB 5DMIL 1YDPA 1A9BA 4P2RA 4O02H 1J1XL 5IMOB 4RDQG 4TOYL 2NZ9D 4RISH 4MNGE 4NM8H 1JRHH 2I27N 3VGHA 4TUJA 1D5MB 4UV7L 4L4VD 3DMMD 4UT9H 3SGEI 1I1CA 1J05A 3J7HA 1N7ML 1OP3H 4GMTH 5BRZE 1AQKH 4KTDH 4G8GE 4G5ZL 2AJYL 3SGDI 4RSVA 1MUJA 1K5NB 1DVFD 2F5AH 1CL7H 3TNNB 3MYJA 5CUSL 3VG0H 3GMNB 3OXSA 2YUVA 4Z7VF 4CKVX 3BP5A 3QRGH 1TITA 1T89C 4XCNA 4P23A 4XZUA 3GHBH 3IKCA 3S4SA 3H6JA 5E4IA 1MPAH 5LAXB 5E8PB 5D1ZD 5FCUL 3IDIA 5EUOB 1YNLH 4HKBA 5GHWL 5BJTA 1NEZA 2EE6A 4HLZH 5ALBH 4OZ4B 1QO3A 4L4TA 2HFEB 1E28B 1F6AB 1RMFH 2CDGB 4P99A 4ETQB 4PGCA 1KXVC 1GGBL 1YN6B 3OPZL 4HSQA 1ZLSH 1MH5A 1FO0L 4IMLA 5FF6B 1QFWL 2V7HB 2H3NB 3HUJA 5E9DE 3U46A 3BO8A 3FO0L 4P48A 5KSUB 5FM8A 3RVWD 3ROOA 1BHGA 4UTBL 1FNGA 4ORGA 1Q9OB 2CLRB 3V2AR 3WFDH 1R5WB 3G5YA 1YA5A 4H1LA 3BPOC 3D3VD 5INDB 3ARVA 4DWHA 1BFSA 2FX8L 4M93C 5KVFH 5TGBA 1P7HL 2K1MA 4GQ9H 2C3XA 5MENA 2Z8SA 3VRLE 5F6IB 2XNAA 4AEFA 4NNPH 3ARED 3MRKB 1PJ9A 4JRWA 3PQYD 1JGEA 5EC2A 4YC2C 1IC4H 4FQQA 4HUWB 4V1DB 3DUSA 1FZKA 2YC1A 2IALB 2VYRE 5TE6L 5IIEA 3TT1L 1ZLVH 1UJ3C 3T2QA 4I77H 1DN0A 3CZFA 1UXSA 1J8HB 5ADPH 2DDQL 3IXAA 3MCKB 5EU5A 4HJJH 4KV5E 2B8OT 2GK2A 1CFTA 1YYMH 1MRDH 4W6XB 2VE6B 2KPNA 3MCLH 3VWKA 1R6VA 2RQ8A 3MRQA 4XC1H 1CFVH 1MCIA 2ORBL 1P7QB 3BN9D 5A40E 5CEXA 5IHZB 3O2VH 4OKVA 3LKOB 1Z2KA 5FCSH 2WIIA 1QTYT 1FGNH 4YR6A 5K59F 4NNYB 3UO1L 2MWCA 4LMQE 4MXQD 1JIBA 3FTGA 1MCWM 3HE7C 4J3WA 3SDCC 5CBAB 1A0QH 1CFBA 5LWYL 1OVZA 1XAUA 2DQGL 3HRPA 1BFVH 2GSGB 1WBXB 3MRCA 1EO7A 3UJIL 4YHML 4A6YL 4M5ZL 3GI9H 2DBLL 3OAUH 3UBXI 1BJ1H 2ITDA 5D9SA 4MB4A 3KPPB 3BGMB 2YMXH 3ZE2E 3L7EB 4KVNL 3BMVA 4GQPH 5DRWA 4M7LH 4EI5A 1RSFA 2EE2A 3I02A 3BW9B 4O58H 1MI5B 4I2XE 4CJ1A 5T3ZH 4N68A 3DIFA 3P9LA 1WFTA 3V4VH 4D3CL 4HUUB 3BOVA 4ZAKB 1TQBB 5BO1L 3TJEL 4WI9A 1B88A 2R56H 4CVXB 1KJ2A 3VJ6A 3EYSH 2BSSB 5GS2H 5ITFA 3S97C 3RNQB 3ZKQD 2XV6B 2EZ0C 1ZEAL 5GRXG 5CAYB 1ED3B 3RI5K 1NUDA 1A7RL 4AQOA 1GGCL 1ZLWK 3MRJA 3DX9B 4LCWB 1MFDL 4PTTA 5TDNB 1VPOL 3S6CA 1PKQA 3MOQA 1NDGA 2JF1A 3MACH 4RX4A 5E7FA 3RZCA 2CJUL 3WEXA 3JZ7A 1NANH 4U0RC 5EFIB 2ZCKL 4MB5A 1ZGLB 6FABL 4RWHA 3RY4A 1S7TB 3ARUA 4DUXA 5IK3A 4UTAL 3IU3A 4MCZB 4LLQB 2VLLB 2EE9A 3RHWF 4KQ3L 1A7OH 4HS3A 3S34L 3R06B 1EJOL 4RFEA 4BFBD 3IAQA 5C6TL 3OJ2C 2ENYA 3OKEA 4JREB 2HJFB 3VXRA 3LB6D 4YE4L 2HT4C 1E27B 1D9KB 2EECA 5LVEA 5GRJH 3EYFA 1L0QA 4P2RD 4NC1E 1N6UA 1FCGA 4Y5VC 2D7TL 1UVQA 3GJFB 1DUZA 5HTSA 3KLSA 3IJSB 4XCYA 5E99H 1UWXH 1NPUA 5GIRA 5KZCD 2AK1H 4GG8B 5KSBF 1A7PL 1WZMA 3EOTL 1EGJH 4PJDA 1KYOJ 2Y6SD 2PXYB 3DUHA 3TCLA 4I3GA 2HTLC 5EU6B 1WZLA 4OD1L 3SE8L 3OMZA 4PB9L 3E0GA 4JDZB 3CGTA 3MRNA 1QZ1A 4NQUA 4PJIB 3WXVL 2NTFA 2OJZL 2N7AA 5DUPH 3T0DA 4R96A 3U9UB 4KJQD 1FIGH 1D6VH 1ZSDA 5F8QC 3RL2A 4I0PB 3OJMB 4JY4A 4PP2B 1J1OL 4HC1L 5HGDA 4HCRL 5C8JA 3CVHB 3QO0B 3B5HA 4N0CD 4GAGL 1LD9B 5KAQG 1GZPB 43C9B 3AAZA 3MRFA 4EQ2A 3DGGB 1VKXB 4NZRL 3GKWL 3BXNA 3WFCL 1CDHA 1MCHA 2DQUH 1HYSD 4EBQH 1CICB 3H9YA 3INUH 3RDTC 1AGCA 4UOW0 5HGHB 1YPZF 3I3EA 1NGPL 4XBPB 4XGZB 4J3TA 4HH8A 5IM7A 4Z7UF 5I1KH 3BSZL 1T83C 1IGIH 3BH9A 3QEHA 3P77A 1MCPL 4XBGA 2FJFB 5DO2C 2ZP0T 1AGBB 1ZMYA 4FP8L 3QUXB 4KI5D 1X3DA 1JL8A 1CFQA 1A7BA 1NFIB 3RWHA 4RGNB 1F4WH 2HTKD 1DQQB 1DQMH 4MD4A 3IAGC 4HFWA 4AENB 3OL2A 5HVHC 2J8UB 3VRJB 1IGCL 1NCWL 2ZNXA 4NT6B 2J88L 4U1GC 1NGXB 3TVMB 5DMGC 5MEND 5GSVB 1FVEA 1YEIH 3K1DA 2VLKB 5D1ZB 4OJFL 5IF0B 3OHXA 5FGRA 4AY0A 5JLZA 5JHDE 2VSCA 4POYA 2A6DA 3LKSB 2DKSA 5HYFA 1HEZA 1ZV5A 1UKTA 4X7DC 4U1IB 3GUTA 3HZVA 4NQSB 2CDFA 5MI0B 4K3DL 4XVJH 5EZIH 3U6RB 1GAFH 4MNGA 4N9GB 3U1SL 4CL7A 3MBEA 1V7NH 2RCSH 4LCCC 4QRQA 4RZCB 5GGSB 1Z0NA 3ARQA 3UCRA 4H88L 4OCYL 2VAAA 1DQLH 4R4ND 2J4WH 3SGEH 2FL5B 5HSFA 1EUTA 5GGQH 5BRZA 1NJ9A 3VWKD 3NIFF 3PGCA 5DEZA 1NC4A 2E27H 3VXUE 1NMAH 3ULSB 3SGDH 4FQJL 3ELAT 2R2BA 5BZWA 3MXVH 4HGWA 4KMTH 4OZIB 1X5YA 3QR2A 5JW4Q 5IW3A 1QBML 2Z91A 5CEYB 3QEGH 1IAMA 3TA3A 3CDGA 4GBXD 3KYNA 1U3JA 2AEIT 5K9JL 1PLGH 3PQYB 2UWEB 4LCYB 5DHVA 3H8NA 5CD5D 2JELH 2A74A 5I9QC 2NCMA 3NCEB 2CDEB 1TPXB 1VSCA 3V4PL 4PP1D 3GGWB 4FQ1L 1U6AH 3NZ8B 4MJ6A 3MRDB 5GS0C 2XG4A 3HLAA 3UC0L 4OFYD 1I8IB 3CH8A 5J1AA 4WUUE 2R0KL 5DFVC 2VLMD 5DZOA 4Q6IC 4LPVA 2YPLE 4POZD 4BK4A 1UKSA 3B9DA 2HH0H 2O5XH 4BH8A 5E9DA 3L5HA 3PHQA 5A1AA 4X7CC 1WAAE 2FX9H 3QCVH 5SX4I 3HI5H 2CMRL 2VIRB 1SYSB 3EZJB 1ZWIB 3BP7A 5E03A 3OQ3B 2L0DA 5E4EC 4KHXH 3M17A 4FQ2H 5J1TC 4WIQA 2YUWA 4ZODA 5F7MC 3FOMB 2GJZB 5EZJB 3ULUE 1O5DT 4KRPB 4K94L 1FORH 1RK1A 2A9MH 4L8BA 5LGHH 4RFOH 3SDXF 3WDJA 4F7CB 5IVZA 3VXTB 5JHLL 2P5ED 3O6MH 3RZCD 4AT6B 2R29H 3V5HA 3G5VB 3UPCA 5EPMB 1WBZA 3IVKB 2C1PA 1T0NA 5D2LF 2J8OA 5D7KE 5H35A 2YK1L 4XP1L 2YPKB 2PO6C 1YNKL 5AWNL 1IAIL 1FAIL 2DM4A 1CD1B 4ZD3H 2IAMC 4HKXB 4OFIA 2ZPKH 3C6LA 1YUHB 2EKSA 3VXRD 1KPVA 1SM3L 1U3HA 1CBVH 4FFZH 1RHHB 5F44A 5GGTH 5T1KA 2Q76A 3QP3A 3HZKB 4QOKE 4XC3L 2GJ6E 4HWZA 2AJSL 4OLUH 3ETBF 2MJWA 4YAQB 4KVCL 4ZS7L 3GSXA 3PWUB 4JANA 4KMLB 5ISZA 4YFDB 3JWNC 5JDJA 3O6FB 1R3JB 3S8WA 4EIZC 2CIIA 3QH3B 4AYFA 15C8H 2XRAH 3D0LA 3QEUA 4JZJB 4I18B 4K9EH 3EOBA 5HI4D 4WEMB 1XGTA 3LQMA 2ED7A 3LRHA 5DRXA 3VFTA 2EC9U 2V7NA 2P43B 5FIEA 3L1OH 3OAZH 4HV8A 3ARXA 1NBVH 3MYZA 3E6FA 4PJ9B 5E6ZA 5IBLD 4KZDL 3IJHA 5ADOL 4JQXC 4I2XA 1OOAA 4LSDA 3QQ9C 1RURH 1BQHB 3EYOA 4PJ8C 2VWEC 1ZXQA 3O4LB 1VGEL 3MGOA 4HXBL 1KTRL 3GRWH 4PJXA 5I1EL 1EMTL 4O2CA 2VZSA 2WLYA 4L29B 5FDWB 3QO1A 4LL9A 3L7FA 3UTTE 4RAVB 1M6OA 4MQ7B 4O2EB 5TF1L 4ZFGH 4JKLA 1TDQA 2DD8H 3AS3A 5IEKA 3MROB 2C3WA 5D6DC 5L8LB 4YXHL 4F57H 2GTZB 3WNPA 4M9OA 2NZIA 3ZSSA 1RZGB 5ACZA 1LO2L 3VW3H 4JVPA 4D9QD 3GK8L 3TIEA 3WMSA 4BZ1L 3RPIA 4XXCA 5CJOH 3BZ4B 3WFEL 2PYFB 1JMZA 1DQDL 1NLDL 4MNHA 5D71H 3VA6A 2VXUH 4OCRL 3TBTB 1YYLL 4Q7DA 4PGDA 2ATPB 3ZKXC 1OAXH 1OF2B 3MRBB 1NMBH 2X09A 4ODXA 3F5WB 4MA7L 1CE1H 5JO5B 5B8CC 3MNVB 3EZ8A 4ZO9A 5HI3C 2SEBA 4HWUA 4DKEH 4LDOB 1I9JH 3KYKL 1RFDH 2P8LB 3BP4B 4Z7VE 4FZEL 5F7DA 1U2HA 1YY8B 1Q94B 3L9RA 3MBED 4OLZL 5DZNA 5CP7A 3EO0A 5D1XC 1OTUC 2PUQT 4LLYB 1A1OA 2QADB 4DOHE 3BZEB 1F3JA 5BRZD 4RAUA 3W11D 4K07A 2Z9TA 1WJ3A 2VXVH 1NC4D 4G8GD 4UQ3A 5I6XC 5CP3H 1RV6X 1XT5A 5E94B 4KAQL 1FBIL 4N0FB 3CNKA 2I5YL 4GXUN 2FJGB 1FSKB 4LSTH 3HE6A 3TA3D 3IXTA 4MHHG 4H5SB 3QG7H 4WW2A 2NLJB 3LVEA 3CFDA 3IDXL 4U1MA 1OT1A 1UA6L 4P3WA 2X10A 5GJSH 1S9XB 3S35L 2CKBH 1Y0LA 2X4NB 3PXJA 5FOBB 4HLJA 4X7TA 3QDJB 4NC0B 3PL6A 1ORQA 2FO4B 2DIAA 3HC3H 2VZVA 4OGXL 2J2ZA 1FYTB 1U91A 2XWJB 5D70H 1AFVH 1S9VB 3ZKMD 4K3HA 1EEYB 5CCKL 2EDJA 5E00B 4ZXBA 3O45A 4QEGA 2AEQH 1OTSD 2HJLA 1N4XH 3GBMH 3MPCA 4WWKA 5D8JH 1JP5A 3LEYL 3FZUD 3AMKA 3IJYA 1HILA 4PJFF 3OV6A 5IEHB 3NCJL 1NFKA 3QUML 5J1SC 2NYYC 5E9DD 4ZQKA 3BDBA 2W65B 4YHIA 4UOJA 2W92A 1XF1A 1G7IB 1MOEA 4F7EA 2ADJA 4S0SD 1VGKB 5DQJB 2DLTA 5L7XH 1FG2B 3L3KB 2IH1A 3QNYB 4S1QL 4D0BB 4C56E 3WKML 5HY9A 1UACH 3L5XL 3WO4B 4GBXB 4M3KB 5EU4B 1UENA 4KY1H 2OQJA 5J7CC 1G9NL 5IJVA 3MX0A 3QFJE 2M8XA 1MSPA 4OQTA 4ODSL 3BKYL 5EO9A 3QUYA 3SPVA 2V17L 2FSEA 5JHDA 1CIDA 4MXVF 4P9MH 5KVEH 1XF4A 5L8KB 4JRXD 3TWCL 1FL5A 3BQUA 2P8PA 4HK0A