4MSWA

Y78 ester mutant of kcsa in high k+
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Using protein backbone mutagenesis to dissect the link between ion occupancy and C-type inactivation in K+ channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mswA02
5JHLH 1HXYA 3QHTC 4XVTH 3RWIA 5IUSA 3QQ4B 1GC1C 3LKPB 1R3IL 4HIEA 5CBAA 3GMRA 5DRNB 1Y6KR 1TQBB 5EC2B 1JNNL 1C1EL 4IOFC 4MNHB 5JQHC 1R3LA 1BVKB 4LCWD 4MQ7A 4N1CA 5ABDE 4P4RA 2DMKA 4JDVA 3Q48A 3SGJC 3MLVH 1KJVB 1MAML 3K1KC 1Q9WA 1QRKA 2J12B 4FTVB 5C92A 5JW5A 5DMGC 1NBYA 2HT4C 4JHWH 2MOVA 1T1ZA 5F89A 1LO0H 2GK0A 3G6AB 2V5YA 3MFGB 1J8HD 2UZIL 43C9B 3RNQB 1FZJB 3B2VL 3BEWA 3MOBH 4OCSL 3NPZB 4U1HA 4BSVB 5TE6H 3UTPE 1VSCA 4O2EA 4JY6B 2HP4A 1J0JA 4HJGA 5D71L 1KPRB 4BFGA 1JK8A 1HDMB 4D9QD 5J7CC 3GBML 4QHLB 1R3HB 5ISZB 5JIPA 1DQDL 2YXMA 4I0PC 1EO7A 3OWEA 2WAHA 3QUXC 2R0ZL 4G43B 1J05B 1NGPH 5DJAB 1XZ0A 2IG2H 1S7XA 2AK1L 1HCVA 3RQ3A 4OGAD 3MQIA 4QT5B 5C7XL 1HOCB 5BRZA 5JXEA 3G5VA 3ZDYF 4M61B 3ISWA 3QEGL 3U6RB 5TH2B 4PJXE 5HGDA 2DDQL 1MCPH 3JVGA 3S35H 4WW2B 1BIIB 4DTGH 4NYLB 2FL5A 2OLDA 1OGAB 1XF3A 5MEQB 4NKDA 3L9RB 5JA9A 3V6BR 1QACA 1RUPH 4PJBB 4PY7A 5EBLB 3N50A 1NAMB 1JV5B 5HVHC 3H3PL 1BBJA 5JUEH 1FZOB 1EERB 5D2LB 4PRNB 2MHAA 5F88B 3M17A 1N5YL 1G1YA 3D18B 3RL2A 4M6MH 2X4UA 3WFZA 3ARXA 2IAND 5MI0C 3O2VH 2VLLA 5CHNA 1I7TA 4DN4H 4HS3A 1MI5D 3IVKB 2XTJB 3WKNA 1XGYH 3C6LC 1JWUA 3NCJH 5BS0B 1WUNT 4JHZA 4L8SB 2R0LL 3FB7A 1AXSA 3C5ZA 4M48L 1ZLUK 1FBIH 5IVOA 1MJ7L 3VFUA 1Z9OA 1D5MB 4QXGL 5TQ2H 4F57L 1S7RA 5L2KE 3KAAA 2NY2B 4U6TA 2V9QA 3BW9B 3O11A 3QCTL 1C5CH 1G7QB 2F53A 3V6OC 2ZUYA 3FFCD 1JRHH 4ZTOH 5FYJU 3N85L 3GMPB 1N7MH 2QSTA 3VI3E 4JDZB 5HI4D 2EECA 5D1ZA 3UROR 3LHPH 2YPLD 4FP8H 5J9PB 1IM9B 3K3QA 3O3UN 1U92A 2Z93A 1H15B 4WCYH 3VXSB 3RY6A 1J0YA 2CKNA 3V5HA 3HMXA 5BZDA 1U8LA 3PP3H 1WZMA 1KPUB 4IOIA 1RJYB 2ARJQ 4GG6B 1K2DA 1QR1A 5I1CL 4PP1D 2BHYA 4PRBB 5M94B 4K7FB 2SEBA 2FIKA 3UJTH 3WHE1 1I3GL 5JZ7D 2P5EA 4P59L 5KN5A 1F00I 1TJGL 2FGZA 4WIQA 3FQXA 1M05A 1WFNA 3LEYH 2P8PA 3MV7E 5KG9A 4HKBA 4OAWB 2B5IB 2AXJA 2VIRB 4M7KH 4PJ7B 3TT3H 4PJ9D 3C6SB 3MMEA 3UTQB 1R3JA 4MXWL 3O6MH 3TO4C 2VITB 3MNVA 2EIEA 2HLAB 3OZ9H 4HF5H 4M6OH 1M7IB 2NLJB 1QLRA 1Q9KB 4RAUA 2AXGB 1LK3H 5HY9B 4KKAC 3UYRL 3GIZH 4WI2A 3VXPA 4R0LA 1S7UB 3RUGF 4PJAA 2W0FA 3DMMA 3PQYE 1VGKA 3X3FH 5JPNA 3TBWA 3IDYC 2FJGB 4Y4KB 1KGCE 1SJHB 3MLZL 3PV7A 4OLVH 4XCNA 2CIKB 1P7HL 1A1MB 3ZYJA 4XC3H 3HNSL 2FYYB 1XGTA 5GGVL 1KG0B 4OZHF 1FVDA 3EIFA 3FT4B 1DQMH 3CD4A 1OW0C 1MFDL 3GSRB 4IMLB 3RWDB 1RZJH 1SBSH 3TO2A 4P46B 1BQUA 3KHQA 4J1UB 3F6IA 1EXUA 1VACB 3UJJL 3MBEB 1NMBH 4MD4B 4ZYKA 5F1OB 1I1YB 4L4VE 4Y1AB 2MFNA 1TXKA 3HZMA 3OB0H 3NH7H 3B5GA 4RRPA 4JFXA 4JFOB 5F93C 1HHIA 3ROOB 1A1NB 3FO9B 2H1PH 1MWAH 3VE0A 3ZDXE 5L8JB 1ED3B 5TF1L 3IFLH 4MDIA 3B9EA 2V2TB 3K81A 4MNGA 2BRRL 3FB8B 2ZUUA 5DEGB 4IIQC 1EJ6A 2DAVA 3BP7B 2OQJA 1G6RB 1KIUA 2IAMD 2UYLA 4HKZA 1IM3A 4XZUB 1FZKA 4YZFE 3S88H 3QCUL 4UV4H 1A0QL 5L7XH 1AXIB 4XNZC 2GJZA 4RFNC 1AO7B 5E94A 3DRQB 3ETBF 4UQ2A 2H9GA 4ODUB 5EBWB 1S3KL 43CAB 4NJAL 1KLGA 1ZLWH 3T3ME 4E0RA 1CGVA 1HHKB 3BKCL 1A9BB 1J12A 3MLWL 2B2XH 1UCBH 1CDUA 3EYSL 1KIPB 2ZG1A 3PWNB 5IG7A 2NMSA 2OZ4L 3S4SA 4OZGA 4AEHH 2HN7A 3WLWC 2D03L 2HRPH 1Z5LB 1FIGH 1TQCB 4L8DB 5C0CA 3ARDA 2CXGA 1H5BA 1CL7L 4O4YL 1A7PH 3CFKA 4HK0A 3U4BL 4M5ZL 1XGQA 2FCBA 3RI5F 2VDRL 1I4FB 2MWCA 2VAAB 1CXHA 1S9YA 2WNGA 2IBZY 4LCCA 4F3FA 5FK9A 4TSAL 1XR9B 3ULVD 4NGHL 4IDJL 4ODSH 1LILA 3QWRA 3TYFA 4JZOA 4I2XA 1W0VA 2F74B 2XI9A 5I1DB 3C5JA 1NL0L 1OD7A 1AD9A 4ZOAA 1TVHA 1HINL 4LOUD 4NWUH 4Y2DB 4Y5VA 5BCAA 3GJEB 4RMWA 1PLGL 3OJDA 4DK3A 3EJZD 4QTIH 4WI4A 4HHAA 3X14A 1XF2B 4L1HA 3L3HA 2F54D 3JV5A 1OCWH 4PRID 3FRUA 1A3LH 4R4FH 5BRZD 5LBSH 1A47A 3QHZH 1RV6X 3C8DA 3GHBL 2DM2A 3VGFA 2AEQH 1TCRB 5IFHL 5D6DA 3TCLB 1WQVT 2NY1C 3WJLC 1GGIL 2D7TH 4QOKE 5AUMA 4U05A 1RZIB 3GMOA 1FNEB 1A2YB 3VDCA 1CT8B 3MNZA 5GRWA 1VGEL 4UOW0 5CP3A 4RBPH 3SDXB 3L7EA 2YRLA 5JNYB 1YEHL 2IH1B 3BP6B 5EBGA 3FQWA 1T5XB 1LK2B 4J3XA 4WU7B 4K9EC 3FTGA 4PJ8B 4Y19A 1ORSB 2YRZA 4YHOH 5DDHA 4N90D 3N9GL 5DK2A 4ZPVA 1G7JA 1SJEB 2E6QA 2KBGA 2GT9B 2HTKC 3NFSL 1IEAB 1G7MA 3QWOB 3A6BH 4G8GB 3N06B 4EBQL 1BWWA 3UDWA 1JIBA 2ARJB 1Q94B 2XWTB 1YEKL 1DBAL 5IEKA 1VCAA 4QRUB 2X7LB 5E8DH 5H8DA 4OCRH 1CU4L 4GKZB 2IGFL 2P8LB 2OTPA 5IVZA 1IQDB 3WSQL 3EOTH 4PJXF 5ITBH 4G3YL 2MMXA 2VLKE 4LEXL 2AERT 2EKSA 4U1MA 1P5UA 3BAEL 4NQEA 3C5ZD 2IPTH 3EYVA 3B4NA 4ZNCD 1TPXC 3LV3A 4FQXA 2VDLL 3A67L 1P6FA 2F53D 3VXMB 1N59A 4JO3L 4GMSL 5HBBA 1T4KB 4OD1H 2ADGA 3NABH 3QHFL 3QO1B 2Z91A 1JPST 2PR4L 4P2OD 5DC4B 5FO7B 5H37H 3EO1B 3SQBA 4Z7NE 3GJFB 2OYPA 1HK6A 3SO3B 1I75A 4Y2DD 1ZA3A 1NC2D 3VD9A 4YGVA 1CD1B 4PV8B 3KR3H 4KZEH 2Q7NA 3VWKC 1QFWH 2C4FT 3RDTB 2NX5A 1ODAA 1FO0L 5CGMA 3V5DB 3VDAA 1GRWA 2Y9RT 1CFVH 3U0TA 4PJ5A 1X5AA 3ZKXC 3LN5B 5DQ9B 2XWBA 5GJTH 5EC1A 3WFCL 1G7IA 3KNBA 1N4XL 3QJFB 4PGEA 5EUOA 5A3ID 3MJ9L 3E2HC 1FNAA 2XG5A 4OI9A 3O4LD 1F3RB 3F5WB 5GISL 3G6JE 3B3IA 3P0YH 3EYQD 4Z8FH 2IFGA 1IAIM 3E8UL 1ZHNB 3ZKNC 3IYLW 5L2JB 3GBLA 5JR1H 4NZJA 1JF1A 1KC5H 3VI3F 4NZUH 1TMCB 1JYWA 2R2CA 4JQVC 3TBYB 2E9BA 1QHOA 4MAUH 1V3LA 4CU6A 2CR6A 4XPGH 4HQQL 4NO5B 1A6TB 5KBNC 3FMGH 1GZPB 4RRPG 1U3YA 4M7LL 4XB7A 5ENWB 5JPMB 4HLZG 3WFHB 4HKJA 4OF5A 8FABA 4HJJH 3P30L 3EBAA 1ERNA 4FFWC 4OSUL 3ILPB 4HUWB 2EC9U 4B5EA 1U3HB 3L3KB 4JAMB 2JIXB 4J2XA 4KZDH 3DVGB 3L3GA 1P84K 3LD8C 3ILQC 9CGTA 1PQZA 2J6EL 5I8EA 2G75A 4MDJA 5HYQB 1NLBL 3THML 4HH8A 4IMKC 4YHZL 1J0KA 3ZHLA 3RIAF 3X3GH 2ICWA 2I60L 2GCYB 1U8IB 3VXMD 5IJKA 3WO4C 5F7NC 1GC1H 3SE9L 2HFFB 4HGKC 1V7MH 4DN3L 1MHCB 5SX5K 1LD9B 4HBQA 2EDTA 1ROWA 3RWJA 3IJYB 2ZG3A 3SDDC 2X2YA 4RDQG 4XPAH 3RHWK 4QRTA 5F9WB 3QP3A 1MLBA 5TDNB 4QO1A 5F7DA 4N0FB 4LVOC 1IAII 2A2QT 4FQIL 3X13B 2YD6A 3WJJC 3P9MB 4PBWD 1G9NC 1PEZA 1TTFA 3OJMB 5I30L 1IGJA 1U8JB 5MERA 1A6VH 2Y07L 4YPJA 2J8UA 5EU4A 4JFYB 3BDYL 3L5WA 5CZXD 3QNZB 3D3VB 1B2WL 3OX8B 3BI9X 3O9WB 2OSLA 3DVNA 3MUZ1 1N3NB 2CDFB 4LLAA 3CX2A 5CBEA 4APQC 4D3CH 1Q38A 3WIIL 3BPLB 3R06B 2Z31C 5CINH 3U79A 3QI9B 4PRHA 5TQ0H 4R2GB 2A83A 4JM2A 2D7NA 5C2BH 1INEH 3Q6GL 5E6ZA 3TESA 2HTLD 5IBLC 4GRMB 4S1DC 5KW9H 3HE6B 5GRJH 3GSQA 1EEZB 5F6HJ 3WCYA 4EN3B 3S37X 3OKNA 3QUML 4LRNH 3M07A 4C56B 4LNRB 3EOAA 2Q76A 4L5FH 1RMFH 3UYOD 3BN3B 4XVSL 1SY6L 5TF0A 3ZDXF 3IDIA 4DCQB 4KK6D 5HHME 3WHXA 4G6KL 1CF8L 2DQEL 1N2RA 3DBXB 5DHVH 1VPOH 1NGWA 2OZ4A 3WD5L 2X4PA 4R97B 4HZLB 5K9QI 1NAML 5C8JB 4FFVC 4YZFF 1WEJL 5IGXL 1DE4B 1LO3H 3V7AE 3LRSB 2LAGB 4JFPB 2DQIL 3QDJB 4PPTA 1A4JB 3T3MF 3BX7C 3UXFA 2VLJE 3QJHB 5DQDH 4G5ZL 3BZFB 5DMKA 1IGMH 4XAWL 5C0IB 3D1MC 4CNIA 4MJID 2E9IA 4X83A 3BUYA 3O2DL 4ZNEE 3VXNA 1CXLA 3BPNB 5A2FA 4PJHE 4JFDE 3MLRL 4LEOB 4PP2A 1U3JA 2BERA 3H9HA 4R7DA 3SPVA 5HHQB 4P5TB 1IGIL 4WHTA 3STZB 4X5XA 3QIUD 1AC0A 3KPNA 1CFSB 4YDLC 4YX2H 3OXSB 3UTSE 4XBPB 1KTDA 1D3CA 1BLNA 5LGHH 2CKBL 2DQHL 2ZUQB 1KJ2H 5ESVB 4JZJA 2NY4C 3FCTA 5C07A 3MR9A 4NRZB 1KPVA 4YDJB 4XPHL 1ITBB 1LEIB 4U2YA 1X6LA 1JWMB 5EU6A 3U9PH 1WLHA 4Y19D 1E4XH 4XBGA 3T0VA 4QF1B 3MRCB 3MFFA 3QULB 5D8JL 1BEYL 4ZXBC 4HIJA 1CIDA 1R5IB 2CR3A 1WT5C 2ERJB 5J11B 4OFYD 4G6AC 3FQRB 1F11A 3QIBC 5GS1A 1T22B 3ESUF 2W60A 4UTAH 1K5NA 1AGEA 4OF3A 5TDPA 1B0GA 4N0UA 5GZNC 2QSCH 2R56H 1R5VB 4JKWA 3C09B 3KPRD 1FFOA 4OCWH 4D0DB 1NAKH 5ICYB 3RZCB 4AL8H 2CK0L 3IGAB 3QEQA 2AXHA 3GJFK 3C87A 4K3EL 1S5IH 1YEGL 3QUZD 3RVWD 2CMRL 4ZUSA 5EOQL 5SWQB 5D7LE 3FOLB 4YE4L 4JPKL 3J8F7 1T1WA 2YWZA 5DVOA 1UFUA 2VZ3A 2R29H 3ULUD 32C2A 3HPJA 4LSSH 3CFJA 2BFVL 3QDJD 3S34H 3GMMB 2LVEA 5B8CB 4UT7L 4Z7VB 2DF3A 3QXDA 3D39B 3BKMH 1H3WM 5IM7A 3F65A 1P7QD 1BECA 1JI1A 4KK8C 4LCIL 1Q0XL 4NQVA 2BVPA 5GIRA 4PY8J 3FN0L 4WO4A 3MBXH 5E7BA 4JR9L 3UAJD 4HBCL 4G80A 1JNHA 4P23D 3EO9L 1T7VA 1ZANH 4NUJA 4KVCL 1B88A 4PLOB 4H88H 2FEDC 5IHZB 4O2CB 5DJ6A 4DKEL 4K71C 2RFXB 4EQ2A 1FO0A 5T1MB 3SKJH 4L3CB 1JPSH 1ZGLB 3OR7B 1PSKH 1VFBB 4ONHA 4PGBA 2A73A 4ZOCA 1HWGB 2GSGB 3QCVL 4IOSD 3O3AA 2FGWL 3VRIA 3VWJC 4Z7NF 1AKJB 1KCRL 1QRND 2CDEA 3BQUA 3CFCH 4MNQA 1F90H 4LHQB 5B39A 4TUKL 1CK0L 2YK1L 5C08E 3VFGH 2R2BA 4AIZA 1G6RL 5KSBB 1EHLL 2G9HB 3LPWA 4UIMA 3KPSD 4WV1C 3AVEA 3HI5L 4HXBL 5M95B 4JFQB 4HCRH 1RVFH 1D5IL 3MODH 5I8CA 4AMKH 1B4JH 3BGAA 3MREB 5F70A 2D0FA 5ECJE 3O6FC 3U7YH 4GT7A 3CDGB 4N8VA 3S35X 1KT2A 4NO2A 5TGBA 4RX4D 1JNJA 4LLVB 4HH9B 1T20B 4QRRA 2YD1A 1YECL 1KACB 3G6JF 4OQTH 4WFFE 2YN5A 4PJFA 3MRMB 1X9QA 4O2FB 4UAOB 2WBWB 4MZ3A 2EEBA 1K4DB 4Z7WB 3LKPA 1B6DA 3AXLA 4DJMA 1JGUL 5DRNA 4MNHA 3DV6B 5FGSA 1BVKA 2J6EA 4KROC 5DD0H 4BELD 1I85A 2VWEE 2ADFL 4M3JA 4GBXB 4MAYD 3BH9B 4YXLH 1YEJH 3MCLH 3SKUD 4WFHD 1FG2A 4FTVA 4M6NL 4P57A 2F8VA 4MWFB 5T3XE 2DQTL 1GIGH 1NGYB 2EDHA 3G6AA 4OUUB 4BZYA 4O5LL 1KENH 5F7LB 7FABL 5F7MC 2Z0BA 4QXUL 3QDGA 2LV4A 4AEFA 43C9A 3MO1B 3H3BC 4YBQD 2IH3B 3RNQA 1FZJA 4G7VH 5A2KH 4G6MH 3HC0A 2AGJH 3IDMB 4BSVA 2X1OA 3HZVB 1CTOA 4KDWA 3MV9B 4P2QB 4BH7B 4BJLA 4GKSA 3QG7H 4L3EB 1J5OH 4NZRH 3GSNB 5KTEH 4ZAKC 3BZEB 1KPRA 5JMOC 4M1DH 3TF7C 1HDMA 1S9WA 4QHLA 3PIQA 1R3HA 4OCMC 1OD9A 3ZL4H 3TFKD 2B0SH 4NP4L 4G43A 1J05A 4B41A 1Y6MR 4NKMB 1RAMA 1P69B 2R39A 2X4TA 3V79C 5KVEL 5J1TC 2W9EL 4XMKH 3C5SB 1W0WB 4QT5A 2NY0C 1KTLB 4F7TB 1ZK9A 1MLCB 5CGYC 4RNRB 5GSVB 1OB1A 4M61A 3U6RA 5TH2A 2PXYC 4M02A 4GUPB 4PBVC 4QRPE 2VZ1A 3IDNB 2VDOH 3LQAC 3QUMA 4XHJD 1S78D 5EIQA 5CILL 2O5YH 3PF2A 4NYLA 2OTUB 1SY6A 3GUTB 5DHXB 3L5XL 1OGAA 5SX4I 5MEQA 1J1XL 3L9RA 1T0NB 1KCUH 2Q86B 1CGSL 4K9EH 5T3XH 1HSAA 1TJHH 4PJBA 4Q97A 1SEQL 5EBLA 4HGMA 5B22A 1X4XA 1NAMA 1JV5A 4ONGL 4D2NA 3MA9H 5TDOB 4Y4FB 1FZOA 3CVHB 2DJSA 3LH2L 1MPAH 4HPOL 1KELH 1RZ7H 4JO1L 4PRNA 5F88A 4YAQB 3D18A 4R96A 1QSFD 5DQJB 2X10A 4UTBH 1Q9OA 1IC7H 3CJJA 5F72S 1KCSL 1P2CA 5LQBH 2MCPL 4P5MB 5E6IC 3VFMB 2JJWA 3MRGA 2P5EE 3O2DA 1QFHA 3HE7C 5GGTL 1QBMH 1YY8B 4LRIA 1HE7A 5BS0A 4L8SA 4XNQA 1GSMA 5CEXB 1QFOA 1D5MA 5F9AC 4DKFH 1KYOK 2QLVB 1QYGL 1EZVY 4F7CA 3BW9A 1FFNB 4PFEA 4K8RC 12E8H 5E99L 1G7QA 5KZCB 2X9WA 2NXZB 1T83C 3C9NB 4DZBB 3GMPA 4K7PY 1I9RH 4JDZA 3Q5TA 3WNKA 5DS8B 5GS0L 2P5WE 1BM3L 2EDLA 2CGRH 5J9PA 1IM9A 2CKBA 3PHQB 1H15A 4KTYA 4PJHF 5FYJH 5EOCH 2GY5A 4S1RH 3ZYZA 5C0BB 1DJSA 3DHJA 5CWSB 15C8H 3MRFB 1KPUA 1RJYA 3KJ4C 3SDAC 1F45A 1F42A 4LIQE 4LVNB 4Z77B 4PRBA 5ADOH 3T0AA 5C0RH 1S7QB 4K7FA 2AV1B 4NOFA 4PJDE 1ZVSB 5GJSH 5DJ0B 3UPCA 4HKXB 3JWOC 5CLTA 3SEPA 2QBWA 3HMXH 3T1FB 4OAWA 4LASL 2EC9T 3K8MA 4MQSB 2L0DA 2VLMD 3NCMA 4TQEH 3R0NA 5FM5M 2ZPKL 3W82A 3C6SA 2ED7A 3UTQA 1AJ7H 1F4WH 3FJTA 2VITA 1YMME 2HLAA 2H2SC 4LLWB 1M7IA 5DLML 5BW7C 1YEIL 1Q9KA 5HY9A 1RIUL 4W70A 5I73B 4WO4D 2PTTA 1PX4A 1S7UA 5FAAA 2Z8VC 5LAXB 4JY5H 1CXIA 4M7JH 3HG1E 1G0YR 5D5MA 4MNGE 2VLRE 4Y4KA 4ALAH 2KUTA 4JRYD 4P3CH 1SJHA 4N8VG 1D6VH 1AP2B 4CVWA 3I84A 1JL8A 2F5AH 2CIKA 5GRZA 2UVFA 3V0AC 4NQCD 1A1MA 1IAIH 3CFDB 3PL6B 4DVRH 3WEXB 2QQNH 1DLFL 1KN2H 3FO0H 1SHMA 5B38B 2FYYA 3ARQA 4EUPG 3FT4A 4EI5B 4HDIB 2DQJH 2DBLH 3GSRA 1NCBL 2HT2D 4IRZL 1EAJA 4RMVA 1KUMA 4LIQH 2ZNWA 4JM4L 4FZ8H 4OZGE 1UM6L 4P46A 4J1UA 3TWCH 3MBEA 4MD4A 2X05A 1IFHH 4Y1AA 3WFDL 5C0CE 1LGVA 2PKDA 4PB9L 1MHHB 1X44A 3O4OB 3OMZA 1WVZA 5BV7H 5F9JB 1BBDL 2BCKB 2DS4A 4JFOA 3ROOA 4Y5YB 1A1NA 2BXYA 1B3JA 4KJPD 1NFDE 5ID0B 1ED3A 4YFEA 2V2TA 1G9NH 1EFQA 2H32B 4U31A 3CK0H 3FB8A 3VFRA 5DEGA 3BP7A 5GSRB 1G6RA 4XZUA 4Q0XH 1EEYB 2A0LD 4K94L 4F15C 1OTUD 4OGAC 1Z0MA 1B9ZA 4NC1C 1AO7A 3DRQA 3P3YA 1AXTH 4I2XE 4JO2H 4LK4A 4R8WH 3MLUL 4ODUA 4PJCE 5EBWA 5BVJB 43CAA 1X5GA 1N0XL 4YPGB 5DZOA 3VFNB 1KF9B 1A9BA 2DTMH 2NY3B 5KAQG 4PR5B 1KIPA 3PWNA 3PV6B 3RBSA 2IEPA 5HYJD 1Z5LA 5MP6L 4WY7L 3BOVA 4L8DA 3B5TA 3MOQA 4MCYB 3V5KB 2ITCB 3P4NB 4P9MH 2X4NB 5FO8B 1IEBB 3GO1H 4QGTA 1HILB 3MRPB 1TQBC 4J8RB 1RU9H 3QDGD 2X41A 2EDOA 4KKCD 2Z35B 4CVZB 3CLEH 4HK3N 3QXTA 3BESR 5F7YC 1I4FA 5D2NC 3TVMD 2CUMA 2VAAA 4I0KA 1XF1A 2DKSA 1XR9A 2BXZA 4I77H 2YR3A 3NACL 3FRPA 3FFDB 1MFBH 1T21B 5KSAD 1A7NH 1FORL 3NCCB 2R1YB 1WJ3A 1MWAB 1JMZA 2GTWB 2F74A 1F6AB 2X89A 4KJYB 4ERSL 5EWIL 5F1SA 5D93C 5E4EB 1FIEA 3KPMB 4WI6A 3PGFH 1LE5B 3U36B 1XF2A 5I6XB 3OPZL 4WUUA 1MAMH 3QDMD 3STBA 5CJBA 3RIFF 2OP4L 1OSPL 1JYXA 3SGKA 3VRJB 3FB6B 3OAZH 4NKIL 4TNVK 3OKYA 3KWWB 3MROB 5HI4C 3BP5B 3TV3H 2D9CA 4ORGB 2AJ3A 4LHUG 4OTXH 4GW5A 3ZTJG 1TCRA 5DA0B 1MRDL 3TCLA 1PKQA 3IJHB 3PWUB 4FFZH 3OGCB 5DUPL 1FNEA 3GIVB 5HHOB 5JOFB 1CT8A 2XYCA 2GJ6D 4PRPB 3SDXA 1H3VA 2BOCB 5JNYA 3CU1A 2QSVA 3BP6A 2W9LA 4PP1C 1ZT4B 5SV4A 1N26A 2YSSA 1LK2A 4WU7A 3F7QA 2W9DL 3T4YB 5JZ7C 1ORSA 1AQKH 2YD8A 4KRPD 3QEUA 4NBXB 5DVLA 2NX5E 4PLKD 1SJEA 3TBVA 3V8OA 2GT9A 3IFOA 3UTTE 4BK4A 4L4VB 3QWOA 4OF0A 4G8GA 5IK3B 4IRJB 1R0AL 1JHTB 2BSTB 4PJ9C 1OAUH 3WIHL 2ARJA 4DVBA 2XWTA 2FX8L 3L5JA 1OWRM 2XOTA 2QHLA 4OM1L 4QRUA 2X7LA 3TA3B 5I8KH 4LHUD 4GKZA 3QEGH 2AP2A 5KSUB 1GGTA 4G9FE 5EUOE 3VH8B 2P8LA 1QOKA 1IQDA 1IJ9A 4MX7B 1JYNA 4Q7DA 2WBJB 1RUML 2AK4B 1T1XB 5ILTL 4LSRL 2E5EA 3GB7B 2O5XH 5FYKE 3BKYH 3VGGA 2VDNH 1AGCA 3G9VA 1AGDB 5DURD 1JGVL 1EEUA 4RA0C 4C59B 1T4KA 5AAWA 2R4RH 3F7YA 1KSRA 3QO1A 1DQTA 5DUML 1RUQL 5CJQH 1X5IA 1YEEL 1I9EA 3FB5B 3LKQB 5FO7A 1GJIA 5GGTA 3EO1A 5BXFB 2ARWA 2RGSA 4KVNL 3GI8L 4ZSOA 4TOYL 1PAMA 1CD1A 4PV8A 4KY1L 1FNSH 3QXAA 1NCCH 3LKSB 2HKHH 4H20L 3V5DA 2WQRA 3S37L 3V0WL 3KS0H 4GS7B 1OPGH 4JN2B 3HAEG 2N1KA 3MRRB 4OI7A 1QUNA 3LN5A 3REWB 4YLQT 5DQ9A 4Q9RL 4WI7A 4HWUA 5TJWK 3P73B 1V3JA 3QJFA 5ALBL 1F6FB 4N1EA 2FX7H 1CD9B 4XPTH 1JPGB 4DGYL 4NRYB 3SE4C 3ARRA 3EFDL 1ZHNA 5L2JA 3G5XB 2FJFA 4KHTL 4UIKL 3TBYA 3MRHA 2KL6A 2IAMC 1KN4H 4NHCL 2XACC 2FDBP 3IAPA 4NO5A 1C7SA 1A6TA 2HWZH 2ORBL 1QKZH 1GZPA 2WWKT 5EUKB 4EOWL 5ENWA 5DSCB 4JRXA 4WDIA 4Z5RB 4MVBD 3RX7A 4WJ5A 5FYKH 2PO6B 2GEEA 4GRLB 4LF3B 4O51A 3ILPA 5I2IA 4HUWA 3VXRD 1U3HA 1FG9C 4AT6B 3V4PH 3L3KA 4JAMA 2JIXA 2FECI 1NC4D 4H1LH 5CD5D 4PJDF 2QR0B 3BVNB 3IKCB 3DVGA 1FZMA 1UENA 3QUYB 4QOKB 5EZOL 2FB4L 4JEGB 3GHEH 1BQSA 2YXFA 2AK4D 2VYRE 1BD2D 2ZJSL 3U0WH 1AH1A 2BNQE 4RMSA 3B9KB 1I1AB 1QO3A 1OAYH 5IBUG 3T0EE 4PRHE 2GCYA 5C0ND 1U8IA 4UNVA 4MXWH 1UM5H 4ODXA 1YNKH 1IL1B 4ZG1A 4LGRB 3UO1L 1QVOB 1MHCA 2P42B 1LD9A 3SBWC 1UM4L 5J13C 3ULVC 1WCBB 2H2PD 4E41B 3QO0B 4G8EB 5TDNA 5T5FH 4N0FA 2DLHA 5DWUL 4JZNB 4FQLL 4FRWA 3X13A 5BOZG 3L6FB 3P9MA 2JJSA 5DJXB 2HFGL 4LOUC 3AAZA 2NY6B 4N0RA 5I0ZA 4MA8H 3ARWA 3EJZC 2H3NB 1FVCB 1U8JA 2VXUH 1IZKA 4XCCH 3E6FB 1YZZA 3DGCR 2YEZB 4JB9L 4JFYA 3DECA 4B7IA 2APFA 3ARED 2BVUA 3QNZA 3D3VA 5AAMA 1SMAA 3O9WA 3RTQD 1N3NA 2CDFA 2COQA 3PNWB 1HH6B 5ID1B 1HQ4B 5GGVY 3F58H 4XVTL 3R06A 2YKLH 3NZ8B 4OZGF 1DTUA 2A6JB 3O3BB 4NN6C 3VI4F 4GRMA 4CN4A 2DL9A 5E6YA 3HE6A 4JFEB 1EEZA 2IJ0C 4EN3A 1CE6B 4FQQB 4KJWD 4LNRA 2DQDH 3CSBA 4YIQB 1NFDF 1D9KB 2PO6D 2CH8A 1T2QH 4DCQA 3SCMD 4JHWL 2BRRH 1LO0L 2FRGP 2E8ZA 3IXTB 4K3HA 3DBXA 4OF7A 4FOMA 5AZEH 4BQBA 2BSED 1FAIH 3MNWB 2A9MH 2Q6WB 4ZMAT 2WBKA 3TIDA 2G2RB 2XZQH 4HZLA 4MGXA 4CUCA 4KU1A 3MOBL 3LQAH 4LL9A 1DE4A 4LKCB 2W0LA 3BSZH 3LRSA 5TE6L 5EU6E 4A6YB 4AEEA 4ODHH 3RGVD 1HN1A 2FSEB 1S3KH 4JFPA 4PJCF 2EE2A 1Q9LA 2CK2A 2DM7A 3AB0B 4N9GB 4KDTC 3MLWH 3QJHA 3C5ZC 5CIPH 4U1LB 1FGNH 4S0TD 1NDMB 2RIKA 2AXFB 2D9QB 1DBJH 2MTPA 4LEOA 1FL3A 1G9ML 1NGPL 3CLFH 4N0UE 3QAZC 4P5TA 1D5ZB 4TTDD 3RU8H 3STZA 4P2OC 2FR4B 4M4RA 4M5ZH 1DBMH 1CFSA 3QEQE 3Q1SH 3OXSA 4U3XA 4ZFFB 2VDRH 4I0PB 3R8BB 4KXZI 1A4KB 3QUXB 1MCPL 2AJSH 1PG7H 5ESVA 4E42B 3TLRA 3W5NA 4N5ED 2CRYA 4OJFH 3S35L 5J6HB 1T7ZA 4DTGL 4MMXC 4NRZA 1YYMH 1LEIA 3RX5A 1JWMA 2E6JA 3T09A 5FYLE 3OR6B 2ICES 2Y7QB 4PJIB 5A3IC 1KCVL 5F7KC 1FFRA 1PLGH 2BSRB 5DHVB 3QULA 4MB3A 2Z4QA 1R5IA 4YFLI 3P40A 1LE9A 3EYQC 3PGDB 1UEMA 5H2BB 1RFDH 3CMGA 1T22A 1Y0LB 5KS9B 4F80A 1R5VA 3K2MC 4MLSA 1DUZB 4M6ML 1D9KD 5ICYA 1CBVH 4ZFZB 3RZCA 5D1QD 4GMTH 3PWLB 5D7KD 3DO7B 3IGAA 2H26A 2X4OA 2DLEA 4DN4L 5FUOH 3OJ2C 2AI0H 1BQHG 1XGYL 1S8DB 3NCJL 5HVHB 1U2HA 4K23H 5SWQA 5DJZA 3FOLA 3WIHA 1YEHH 5I1AB 3EO0B 4Z78B 5TQ2L 1ADQH 3DURB 4D9QE 1QA9B 3U1SH 1JVKA 5HHNB 1C5CL 5MI0B 4HT1H 1JRHL 2HT3D 3GMMA 4MNQE 5B8CA 3R8QA 1N7ML 1XF4B 2QADD 4Z7VA 3LHPL 1OT1A 2EDEA 4FP8L 3D39A 3C6LB 2CUHA 4WCYL 4DQOH 25C8L 3VFTB 4JFHE 5KVMC 1DBAH 5C0DB 1QFUH 3RPIB 3SE3A 3K4ZA 3RWEB 5EUOF 3WSQH 5FYLH 1JZ8A 4G3YH 4IRSD 4QRRE 3BRGC 5IHZA 3TN0B 3UJTL 1D6EB 2RFXA 5FUCC 5T1MA 4L3CA 3LEYL 4KWUA 1ZGLA 4XAKD 3DYPA 2C5DC 1VFBA 3NFPB 2VKWA 4M7KL 1EO5A 1ZLSH 3TT3L 2BY2A 1JGEB 2YUXA 2PTUA 3MV11 1HXMB 1AKJA 3O6ML 4F37F 4FMFA 3OZ9L 4HF5L 3FZUD 5CZXC 4NN5C 4WENB 1NJ9B 4NSKB 1A6AB 1LK3L 5KSBA 1QP1A 2G9HA 1ONQA 3GIZL 4PJHB 3D69B 1L6XA 1XGPB 4P4KA 4JFQA 1AHWA 3BYTA 3UC0H 2ZSWB 1GGCH 1T3FB 3X3FL 1X5ZA 1RPQA 4DKDC 1KNOB 3VFVA 3MREA 2HTLC 3TO4B 2WP3T 2X4QB 5DC0A 3CDGA 1V05A 4RFEB 1OY3B 1EAPB 4HH9A 1H5BC 4OLVL 3VMNA 3MLYH 4XC3L 3H0TB 3MRMA 2CXKA 4FMKA 4ONOA 2YPLE 4ETQB 1NCWH 2ZKHH 3IDYB 4KK6C 1DQML 5ISZE 1NBQA 1K4DA 1K8DB 2DMCA 4G7YH 5ERWB 4DEPC 4OUOA 1O0VA 1F4YH 1RZJL 3DV6A 4V1DB 2AV7B 5J57B 2DLFL 3KLHD 2N56A 3ABZA 4H0IA 2ICCA 1NMBL 4O02H 5MEND 4GBXA 3BH9A 4ETYA 4IS6B 1QSEB 5DJ8B 3GK8H 1S9KC 1WBYB 3PABB 3NH7L 1U9KA 1H8OA 4XP6H 3MXWL 2AS5M 5FM5O 3ARGD 1MWAL 3PXJA 4OUUA 1NGYA 3IFLL 1WFUA 4XMLL 2PETA 3MO1A 2IH3A 3OHXB 3TN0D 3ZT7A 3MGTB 1UGNA 4PV9A 1I1CA 1X5JA 1OGAE 4UV4L 3QIUC 3L3IA 4HFUH 4P2QA 2UY7A 4BH7A 5IB1B 5L7XL 4JM2F 4RGMC 4I13B 4OFVA 2BVTA 3SJVD 1NGQH 1GCFA 4PJBE 3BZEA 3QR2A 1EDQA 3CU7A 4JJHA 3C08H 2VERN 2OR9H 4XWGH 4CW1B 2B2XL 4IIQB 1UCBL 5D2LE 5D72H 4TUJB 2WSKA 4NKMA 4AEHL 2A77H 2JCCB 4XNZB 4RFNB 1FIGL 3C5SA 1I3RB 1MF2H 1W0WA 3PWJB 4XNYL 2CLVA 2E6PA 5SWZB 1KTLA 1IAMA 1TENA 2E7MA 3DETD 1MLCA 1A7PL 2XTJE 2BC4B 4JFFA 5GSVA 1H8NA 1XIWB 4R7NB 1I7UB 4LQFH 5MEPB 1OQXA 4GUPA 1FL5B 2XZCH 3DXAB 2WWKO 3T8XB 2OTUA 1GL4B 1JFQH 2LQRA 3GUTA 4F33B 1CTNA 2CIIB 3K0WA 4W81A 1T0NA 1DDHB 1JHKH 5IVXE 4WI5A 4ZUTA 3VXSE 3QUZC 3RVWC 4NNPH 4NQDB 4NWUL 1CLOH 1XCQB 4TSBH 5TDOA 5I8OH 4QTIL 4Y4FA 3N1QC 4NC2B 5C08B 2C3VB 1G7HB 3GSVB 1UZ6E 4XVSH 1OCWL 2OJEB 3ULUC 4GG6E 4YAQA 4R4FL 4G8FB 5D7JD 4WNQB 5IIEA 5LBSL 3ARZA 4PUBH 3QHZL 5GPRA 3B9VA 2VXVL 1J9CT 3ORJA 5CMAB 4FQCH 4P5MA 5E9DB 3VFMA 2AEQL 1U8NB 1CYGA 3QIWD 5F7HA 4GQ9H 5DVMA 1YY8A 1WEJH 4KGLA 3QPQD 2HJFA 5CEXA 3JWDH 1NEUA 4PJ7E 3T77B 4V2CB 3C2SA 4M9PA 3UAJC 4KMLB 5A40E 2I27N 4P23C 3RGHA 3C9NA 4DZBA 1D7FA 4XAWH 2ZCHL 5DS8A 1MELA 2NY1B 1Q72H 1LWRA 4J4PD 3PHQA 4M00A 3EUUA 1MY5A 2Y36H 3JV6B 4RGND 5DR5H 1IGIH 3V2AR 5C0BA 3GBNH 2YN3A 3BPCB 5CWSA 1MUJB 3A6BL 1W72B 1CZ8H 3OXRB 3PUCA 3HS0B 3ZSSA 5EN2B 4AENB 5IFAH 4FNLH 5DHYB 5I74C 1MCNA 1JE6A 5E8DL 4EXKA 1FQ9C 1Q0YL 2AV1A 1XIWD 3EOTL 1Z9SA 1ZVSA 4OF6A 5ITBL 3ULVE 3VCLB 4U0RC 1YN6B 4AM0B 2IPTL 1MCHA 4HKXA 1D5XB 3U46B 3T1FA 1CGTA 1JGLH 3C09C 4U0QB 1MCIA 4OD1L 1A5FH 3NABL 4MJ2A 4WI8A 4LPTA 4M93C 5GHWH 1NSNH 4Y1AE 3CCHB 1GAFH 3NCBB 4LLWA 2UZXB 4OKVB 1QEWB 2J2ZA 4JDTH 3NCFB 2ZOLB 3H9SD 3P11H 1FL6B 1NUNB 1K6QH 1TPXB 5IJKC 4HUKB 3BIBX 3KR3L 1KCKA 1QFWL 3WUWB 5LAXA 3A6OA 1ZGLM 1BHGA 1CFVL 3LKRB 2P45B 2GKIA 5GJTL 4UMGA 1I3UA 5EBMB 1WWAX 1AP2A 1IARB 4MAYC 5IMMB 2ZUXA 2WK2A 4QRPB 3CFDA 5IHUH 3PL6A 4JPKH 4YE4H 3VWKB 2YD2A 5KSVB 4D9RE 5B38A 3TYGH 4KRMB 3P0YL 1G6VK 4CMHC 2ICWI 4Z8FL 2E9WA 4F8QA 4EI5A 4HDIA 1EK3A 2WUBH 1JBJA 3LEXB 3ZKXB 4YHYC 5JR1L 2EH8H 4WGVB 1KC5L 4NZUL 4YBQC 4MAUL 4NNYB 1V3MA 4ZTPH 3E2HB 1A6PA 3ULVH 3DVIA 3QDHA 3FN0H 4P4KD 5C6PB 1TTGA 4XCFH 4XCYB 5C0AD 4QGYA 5F9JA 2BCKA 4MHHI 3F7RA 2DQUH 4Y5YA 4HBCH 3EYOA 4HJJL 3EO9H 5ID0A 3NA4A 3TFKC 4LSUH 3WXWH 2BNUB 3O3EB 4K2UH 4TVPD 2FBOJ 3HI6H 4PLNC 3KHOA 1EEYA 1G7LB 2W92A 3T08A 2E7BA 3NMEA 5DGQA 1L9MA 1Z0NA 3UZQA 3X3GL 3EJJX 5BVJA 4KTEH 3QCVH 2ZWLT 3FHAA 1IC1A 2FGWH 1EUUA 1D5BB 4P2RB 4YPGA 1GC1L 2BNRD 1V7ML 3TCXA 3VFNA 4HUNB 4TUKH 4U1IB 2YK1H 4PR5A 5I17A 4XHJC 1S78C 3LD8B 2P5WB 3PV6A 4PTUA 4M8QB 2I9TB 3PHOA 1EHLH 4ISVB 2AJUH 1GGBL 1GHFH 1YEDB 3BO8B 3GKWH 3V5KA 3VFOB 2X4NA 4YWGH 1F4XH 5J3HD 4AEIH 4GJTB 4JCMA 1HILA 2WLZA 4J8RA 1Q1JH 1JHLH 3I2CH 3EYFB 4NCDA 2Z35A 4CVZA 2YBRB 1A6VL 2JLLA 5HI3D 3I6GB 4BSWA 4ZQKB 5DYOA 1BFSA 1OSZA 1CL7I 3FFDA 3FAXA 1T21A 4LVOB 3I85A 4D3CL 1EEQA 1WC7B 2R1YA 1DN0B 1MWAA 2GTWA 5JLZB 2LABA 4KJYA 5L6YH 2CD0A 1BFVH 1FLRH 1IGTB 5FOBB 5CINL 5C2BL 3ARBD 3IDGB 5JHDB 1INEL 3KPMA 1LE5A 3GSXB 1YMMB 2AVGA 2ZSVB 4MCZB 4G8GE 3RVUD 5KW9L 5GRJL 1MSPA 1KB5B 4TNWF 1WWBX 5C09D 4LRNL 2DN7A 4TYUA 3LKNB 4APQB 3VRJA 4L5FL 1RMFL 4XX1G 4P2CG 2E7LC 3KWWA 3MROA 3PQYA 4JFFD 1AY1H 1WTLA 4NNXA 3HG1B 2Z31B 4ORGA 1A7OH 4RMTA 4JREC 2VLRB 1DUYA 2EDFA 2I07A 5DZNA 4AIOA 4WW2F 4PG2C 5E8NB 3PWUA 5HPMA 1VPOL 4D9LH 3OGCA 3GIVA 3PWPD 1N6QH 1VEPA 5HHOA 1X7QB 2AJVH 3VXME 5JOFA 4JO4L 4PRPA 4ZS6D 4OB5H 2BOCA 1LO3L 4ZFOB 5B3NA 3H6JA 5LGJA 5ADPH 4W6YB 1DL7L 1ZT4A 4AY0A 4PJBF 3JTSB 2WP3O 3X12B 1JYVA 5EDXA 3T4YA 1CLZH 1UA6H 5DQDL 2WIIB 1IGML 5D2LF 1I8KA 2LAAA 4OV5B 2XFXB 4L4VA 2VTFA 4BUGA 5IK3A 4IRJA 3X17A 2VXQH 5EOCJ 3D2UB 3Q3GB 3UZEA 1K3IA 1KIRB 2VR9A 3TA3A 1OP9A 5C71A 1CDYA 5B4MD 2UUDH 5KSUA 4ELMB 3L3DA 3VH8A 2F8OA 4KQ3H 4Q6IC 2KDGA 4YX2L 3HPLA 3V9FA 3K4AA 1GZQA 4MX7A 3VXUD 5HYSB 1JPFA 2A1WH 1FSKC 2WBJA 5K9QG 2FEEL 1IGYB 4WO4C 5LGHL 1T1XA 3GB7A 3CXHJ 1KJ2L 2XPGB 3CSPA 5IP4A 1CD8A 1E4WH 1AGDA 4WW1B 3VFWB 1CQYA 5AZ2H 4ODVH 3WS6A 4P49A 3AGVA 2VN4A 1CFTB 1CGSH 3Q2CA 4YDLB 3U9PL 3FB5A 3LKQA 4Z18A 5IVXF 5ACZB 5BXFA 1DANU 1E4XL 4QRQB 5JHDD 4JHAH 1OF2B 2RQ8A 1I1RA 3FQTB 2WQ8A 3NAAH 3ZDZE 2NY4B 2Y4SA 3WNMA 4XVUD 2IPUG 2YHGA 3KYKH 1UZ6F 5D7IB 4NWTH 3SGEI 3QPXH 2XNAA 4GG6F 4TUOA 5C9KA 1F4HA 4JN2A 4UTAL 1H0DB 3D9AH 4I4WB 2HT2C 2MCPH 1NEZB 2QSCL 2R56L 4OCWL 4PD4J 1NAKL 5HJ3B 3P73A 4AL8L 3GJFH 4ZXBB 4HIXH 4JQIH 3UTZB 1S5IL 4HLZH 5HYSG 2Q8BL 2Z9TA 1JPGA 4PJ7F 3VJ6A 3QIBB 2KZWA 3UTPD 5E5RB 1IQWH 1BVZA 4KJPC 3AC0A 4L4TB 4HG4K 4KTDH 2HG5B 5LCVH 4M43L 4MJIE 3G5XA 1J18A 2R29L 3QYCA 3WNLA 1TZIB 4LSSL 1WTGT 3S34L 3TT1L 3L5IA 3QXVA 2A0LC 1I3VA 1OTUC 4MJ6A 3BKML 5EUKA 3ZT5A 4C83B 5DSCA 4Z5RA 1S9VB 3BIAX 3TBSB 3MBXL 3AY4A 4P5KB 5JIHA 4HWEH 4GRLA 4LF3A 1FLTX 5IWLC 2N7AA 3LQMA 1YPZB 3WHE0 4AT6A 2OX5A 4FQ1H 1Z9LA 1NEZG 1ZANL 4U1KB 3W0WB 2QR0A 3ULVF 3BVNA 5DK3A 3QFJD 5FF6B 2F15A 3QUYA 4OIAA 4QOKA 4H88L 2B1HH 5IW3A 2W59A 5DD1H 5CP7A 3CNKA 2V5TA 1V7NH 3SKJL 3B9KA 1JPSL 1I1AA 1JGDA 2X70B 1Y18B 1IGCH 1PSKL 3HUJB 5ITFB 3KDMB 3QH3B 5CJXC 1EGJL 1X5KA 4KKCC 5JORB 4H8WC 1WV7T 1QVOA 4M1CD 5FHAH 3TVMC 2BVQB 2V9RA 1RZKC 3CFCL 1F90L 2OR8A 4EIGB 4C56E 1WCBA 4K71B 3VFGL 3QO0A 4E41A 4G8EA 1VB9A 3BYYA 5KSAC 4GW1B 2AJXH 4OZFB 4JZNA 1UB5B 4PD4K 3SGDH 4HCRL 3ARVA 1RVFL 3L6FA 5DJXA 1I9IH 1EBAA 3MLSH 3MODL 4AMKL 1B4JL 3NFNA 2UVEA 2BVOB 3VWJB 4KJQD 2H3NA 5JOPE 3U7YL 1XGUB 4NIKB 1PG7X 4EI6B 3E6FA 1N5AB 2YEZA 1DLFH 4OT1H 1XMWA 1QQDB 4WV1B 3QDJE 3WYRA 5L2KD 5EO9B 3PNWA 1HH6A 4CAGA 1PZUB 1HQ4A 4ZODA 3RI5K 1LO5B 5SWSD 3I6KA 3NZ8A 4H1LB 3O3BA 1NCAH 5I66B 4JFEA 5DD0L 3TZVD 1CE6A 2DYPA 4FQQA 1U6AH 3LAFA 1YEJL 3MCLL 4A2MA 4QNPE 4QXTB 3PHSA 3EW3B 3KXFB 5E2WH 2DI9A 1M4KA 3G5ZB 5E2VH 5KVGH 1AC6A 2J88H 4KRPC 3MOAL 4XPBH 1GIGL 5FKAA 1KENL 4PLKC 3MNWA 3NTCH 3SDYH 3FT2B 2Q6WA 4KROB 2G2RA 4QXWA 3C60A 4G7VL 4DGVL 4X7SL 4G6ML 3K8KA 5L88H 1KLFA 3MV7D 4LKCA 3SGJA 4LMQE 3N1GC 4NO0A 2CSPA 1E0OB 2FSEA 3G6JA 2KQMA 2WANA 3CC5B 4XNMB 3W2DH 5F96H 4Y2OA 4N9GA 2NYYD 3QG7L 3BZ4B 3NPSC 3EKCA 4NZRL 3ZE0E 5KTEL 4Q2ZB 4M1DL 2JJTC 2W0PA 3K74B 1NDMA 2EZ0D 2AXFA 1LMKA 1FGVL 2B0SL 2XWJA 3BDXA 2UWEB 3K7UA 5JQ6H 4QTHB 1A7RL 3PQYD 2A74B 5L9DH 2FR4A 5JW3H 1FYTB 1A14H 4ZAKB 5EH1A 2HVJA 1KTRL 1KGCD 1UQSB 2OCFD 4I0PA 2B1AH 1VEOA 5C0EA 2KPNA 4KRLB 1TLKA 3DYMA 3GSOB 3GSWB 1DVFD 1A4KA 3FOMA 5HSFA 2GUOB 2IPUK 4E42A 4BSJA 1ZT1B 4B53A 5J6HA 4AYFA 1EFXD 2O5YL 4YK4C 3D48R 2NY0B 4HMDA 1C08B 1B0RB 4NZTH 3DI2B 3OR6A 3Q5OA 5BJTB 2Y7QA 4PJIA 5BMFL 3D39E 4H5SB 2DICA 2VE6B 4WFEE 1KCUL 4K9EL 5DHVA 2BSRA 5T3XL 4M7ZC 2PXYB 1TJHL 1A7BA 4LVEA 1ND0B 2WZPD 4ACPA 5AWNH 3PGDA 5H2BA 3MA9L 5I15H 4M7LT 1NQBA 1Y0LA 1K8IB 1MPAL 5K59E 2BP3A 5KS9A 1KELL 1RZ7L 2R0WH 1ZLVK 3WDJA 2FD6H 5CJOH 2HKFH 4GW4A 1DUZA 3LS4H 4MD5A 4UTBL 3KS0J 4WTXA 1E27B 5K9KB 1AFVH 3DO7A 4L9LC 5FCSH 4ZDHB 5LQBL 4XXDB 2A6KB 4C54A 5L8KB 4LSQH 3HFMH 3O81A 1QBML 2R2HB 4DFHA 1S8DA 4Y16A 2BK8A 4U1NB 3NN8B 4K3JH 1OAXH 1T04B 2D7OA 4MVBC 4LQ1A 5D1XD 5I1AA 3EO0A 3MLXH 4Z78A 1YUHB 4DKFL 2PYED 4EVNB 2JB6B 3DURA 5J6GB 1QA9A 5IMKB 12E8L 5HHNA 3DPBA 3L1OH 5CD5C 1C5BH 4UOJA 4Z7QE 5EO1B 4OLZH 3CZFB 5E6IB 1XF4A 1L0QA 2D3VA 1I9RL 4GO6B 5EZJB 3HE7B 5DRXB 5KSBE 2CGRL 3C6LA 4MD0A 3T0WA 1KJ2A 2H6PA 1H3UA 4B0MM 3D85D 4XP5H 5FYJL 1R0AH 3BGMA 5EOCL 5JMRA 3VFTA 4S1RL 5C0NC 1TFHA 2FX8H 4LLQB 5C0DA 3OL2A 15C8L 1FH5H 5I1HH 2DIAA 4FXGB 4PGCB 3RWEA 3V6OA 3JUYA 2O61B 2F19H 5H37G 5ADOL 1J87A 4LSRH 4YO0A 5C0RL 2H2PC 1D6EA 4MA7H 2V17H 4ZO8A 3T4AB 4J23A 5GJSL 3S5LA 5FM4A 1TJIH 1BJMA 4X8JA 1T6WA 1MHEB 1R5WB 2VB5A 4Z7WE 3NFPA 3KJ4B 3SDAB 1VFUA 4OZ4B 1F2XK 5F44A 1RUQH 2O93L 4TQEL 5T33H 1JGEA 4RDQF 1HXMA 4P2YA 4UT6H 3QZWB 1INQB 3AREC 1NANI 1NJ9A 4NSKA 1A6AA 5EULV 5F1IB 3ZDZF 4ZNEA 1QSFE 3RTQC 3DTXB 4PJHA 4BFBD 3D69A 3RIAK 4F7MB 1XGPA 3MV8B 2NW2B 4MQTB 4ONFH 4JY5L 4M7JL 1T3FA 1MFCH 3JXAA 5B3JE 1KNOA 4FZEH 3MZTA 3TO4A 2D7QA 2X4QA 1L9NA 4ALAL 4IEFB 3UX9B 3DUSB 4GXUN 4RFEA 3EOYG 2RJMA 4KJWC 1EAPA 3MV9E 2F5AL 2FATH 1TETL 1IAIL 1EH9A 4DVRL 4L3EE 2EDJA 3H0TA 3FO0L 1KN2L 2ATPB 1ZLWK 2PO6C 4KHTH 3SCMC 4ETQA 2DBLL 1K8DA 2EYSA 3GRWH 5IHLB 5ERWA 3HNVH 2ESVD 3PDOB 4LCWB 5DO2D 3K4DA 1ZHBB 4LIQL 4FZ8L 4V1DA 1AGFA 2AV7A 5CEYB 3TWCL 2OL3H 1IFHL 3RGVC 4IS6A 2I24N 3BD3A 1YQ2A 3D5OF 5DJ8A 1PD6A 3PABA 3ARYA 4RIRB 5J8OA 2H8PA 5BV7L 4J7RA 4YUEH 1XFPA 1EGJA 3HLAA 3RWFA 5EIIB 1OW0A 4XP1H 3FAWA 1EHNA 4CKVX 4W68A 5ANMB 1J8HB 1G9NL 1KCLA 4YEFA 3B8SA 2VLKD 4I1NB 4K3DH 5IMOB 2XN9D 4J3OC 35C8H 1F02I 3MGTA 2J7LA 4Q0XL 4TTDC 3LB6D 1S7WB 3O45B 5IB1A 2Y5TA 5F3BA 4LPWA 4HCRA 1AXTL 4JO2L 4MZ2A 1CXEA 4R8WL 4MJ5B 3B6SA 1N6VA 3IDXH 3LN9A 3LEVL 3OSKA 5E2UL 5EFIB 4CW1A 3T0DA 2G5RA 2VKXA 4N5EC 3T2OA 4MA3B 1CXFA 2HJKA 4XCEA 4RFOH 2JCCA 4R4ND 1DLHB 1BAFH 3ZLQC 4X6BB 4JRYE 1I3RA 1NUFA 2Y06H 4P9ML 3GSNH 2AJYH 3AMLA 1AGBB 4D94A 2BC4A 4JY4B 3GO1L 4R7NA 1I7UA 2L7JA 1RU9L 4I18C 5MEPA 4HZAA 3C60D 1ES0B 4NRXB 1FL5A 1TNNA 3CLEL 5H94B 5F7WC 3DXAA 3G9AB 1OWWA 4Z6AT 4NO0D 2MJWA 4YHLH 2VZUA 4QHKI 3T8XA 3WFEH 3JUZA 4I77L 4WTZG 1A3QA 1CDCA 1MFBL 4F33A 1D9KC 2D31A 1A7NL 5D1QC 3L95A 4PYHA 3I3BA 2CIIA 1JWSB 1DDHA 3GDBA 2Q87A 4XH2B 4NQDA 1XCQA 4YHKH 3PGFL 1KJMB 5D2NB 5C0BE 4Z76B 4GLRI 1UACH 4WHCA 3FQNA 4LBEA 3M8OH 5C08A 1A22B 1F97A 2C3VA 3GSVA 4RZCB 1HHGB 4QNPF 3O8XD 1B6UA 3SY0B 2IANB 3AB0C 4WNQA 1YDPB 2HT3C 3WN5C 1DANT 1MIEH 2QADC 1MI5B 4H0GA 1S5HB 5CMAA 3TV3L 5J06A 5E9DA 5D93B 4OTXL 1DN2A 5F6HI 5JW4M 1X5FA 3FO1B 4WWKD 1IAOB 3QISA 4KK9D 1N0LA 1J1PL 4FFZL 3QNYB 1A3RH 3CVHH 1I1FB 1OGTA 2Q20A 2IADB 3T77A 2APTA 4DWHA 3FFCB 2Q7YB 1BFOB 4DGIH 4IRSC 4NQXB 3MGAA 3ZE0F 2YPLB 4A2LA 4Y5XA 2LTQC 5I1JH 2F58L 5HYJE 1F3DH 4GXVH 1AQKL 4FQJH 3MZGB 3JV6A 3CFEB 1G9MH 5D7SH 3IETA 3W39B 4DUXA 3H7LA 3BP4B 2YZ1A 2A9NH 1MUJA 1OAUL 3OXRA 5EN2A 5DHYA 4MMZC 5I8KL 1L0YA 4X0KB 2B4CC 2NY5C 2X42A 1EHAA 3QDAA 3FZUC 4XC1H 4L8CB 1S9XB 1H3XA 3VCLA 4Y16D 4AG4L 4YH6A 1YN6A 2DI7A 4AIXA 4YDVB 3S5LG 4AM0A 1WCQA 5FDYA 3U46A 2O5XL 1BZ9B 1MFEH 4WEMB 3G08A 4PJ9B 1HHJB 5DTFA 3BKYL 2VDNL 2GJJA 2P47B 4X8XA 1KCVH 4Z7VF 4X7TB 2R4RL 4HIIB 3PDDA 5FFLA 1URLA 3N1MC 3CPLB 5CJQL 3S36H 3SDCD 3CCHA 4OKVA 4YBLC 1QEWA 3DJ9A 3F12A 2ZOLA 4EUPH 4HS6B 1FL6A 1X4YA 3V95A 4WUKH 1OQOA 1FNSL 5K59F 4XWOD 2ITDB 5J4MA 5F71A 2IC2A 3WUWA 1NCCL 2HKHL 1MAJA 5ESAA 2NPLX 2AW2A 1OPGL 1E28B 1W0YT 3LKRA 2NW3B 5MHSE 4POYA 5HHMD 4G9DB 2DM4A 4XNXL 3DIFB 3RNKB 1U0QA 3KLHC 3UCRA 3P0GB 3EZJB 1OP5K 5IMMA 1SEBB 3RKPA 2J8OA 4QRPA 2ID5A 2X4RB 3BDBA 2FX7L 3VWKA 4XPTL 3MGOB 2JJSC 5GQBA 1QBLH 3ARGC 3V52H 4NZDA 1CFQB 3LEXA 3LCYA 4KHXH 4Z7QF 2P48B 2VLJD 4H8WH 4J6RH 4P99A 4CL7A 5KSBF 3TN0C 2EIBA 5IVXB 1RZKH 1FCCA 1KN4L 5TFSH 5FECB 25C8H 3G6DH 4JFDD 1MH5B 2AJZB 4ODTH 2HWZL 1QKZL 3R1GH 3UYPA 1I9JL 3E6HB 3MACH 1UJTA 4EDWH 5HHPA 2OBGA 2ADIA 4LSVH 2CLZB 2V9TA 2R4SH 5FYKL 3JBG7 1JN6B 1YC7A 4NQSB 3MRIB 4OF8A 3HTLX 4JQVA 4NBYB 3LOWA 4X5LA 4X4MA 1FNFA 3O3EA 1MHPH 3UTSD 3V4PL 2IAMB 4MXQD 1HNFA 1HXYB 1G7LA 3GHEL 3RP1A 4BKLB 4NO3B 5IJVB 2Y1VA 4DOHB 1JI2A 3QUKB 5DD5H 3DETC 3U0WL 4Z7WF 2DIJA 1OAYL 1NLDH 3W9DB 1D5BA 4P2RA 1UM5L 3OF6D 4LPVA 1YNKL 3IU3B 2H32H 4P4RB 4JG0H 1U91B 3IT8D 4U1IA 4WVRA 2P5WA 2I9TA 4ISVA 4L3AA 5F1NB 4IMKA 1T1ZB 3BO8A 5F89B 3VFOA 2VUOA 5T5FL 2AAVA 3VMOA 3C2AH 3IU4H 4WEBL 3U4EA 5B3JF 1YY9D 2NTFB 2IQAA 2WLYA 4F2MB 4MA8L 3VGDA 5HHOE 2VXUL 1EJOH 4HEME 4XCCL 4PRPE 3I6GA 4PJDA 4LPUA 5J13B 4UU9B 4QWWD 1MCJA 3SDDA 5D7LD 3D0LB 5INCB 5D7JC 2A6IA 3MCKB 1JK8B 4LCYB 3ZTJH 3WJJA 3IAQA 1DN0A 5JLZA 4IBLT 3F58L 1IGTA 3QIWC 2YKLL 3IDGA 1M6OB 2DLFH 3QPQC 4PLJD 3GSXA 1YMMA 2F54B 2ZSVA 4MCZA 1S7XB 4PRIB 2X6MA 5EU7E 4AK1A 1KB5A 4LPYA 5BRZB 3G5VB 3PGCB 3L3JB 2FLRT 2XICA 4LDOB 3VXRE 3KLAB 5CEZE 1HQRA 3LKNA 3MXWH 4APQA 4WFGD 2DQDL 4HXAH 5DEZA 4IHOB 5IESH 3HG1A 2Z31A 3ZMRA 5GRVL 4J4PC 4PJEB 1T2QL 1OTSD 3E3QE 4OD2B 4XMLH 2VLRA 2AK4E 2VL5B 1PY9A 5E8NA 4RGNC 1BD2E 1XF5B 1U8HB 4NN6B 1ZHLB 5AZEL 1FAIL 1XH3B 3LQZB 2A9ML 1VERA 2XZQL 1UKQA 2OTWB 3LQAL 4WU5B 4HS8H 1FN4B 3BSZL 3S6CA 2XV6B 4ODHL 3SQOH 4PY7B 2NCMA 3IJSB 4I48B 2PYFB 5DXWA 4XBEH 3JTSA 4M62H 3X12A 1XIWC 2EXWD 3VGEA 2PW1B 1JZ4A 2WIIA 3KPQB 1Z6JT 3GFUA 1FGNL 3FN9A 2MHAB 1UYWH 1I8IB 4OV5A 1CE1H 2XFXA 1DBJL 4XNYH 3CLFL 1RHHB 3D2UA 1QPXA 3Q3GA 4UT9H 4X5WB 5FOJA 1I7TB 1IAKB 1KIRA 3RU8L 4G6FD 4X9FA 4ELMA 1DBML 5GS2D 1NFDA 3Q1SL 1CFNB 3C5ZB 2LU3A 1IGYA 5ICXA 3BT2H 4U49A 4OFKA 3P9LB 2AJSL 1PG7L 4CADB 2F53B 2D4FA 4WFFD 4OJFL 2XPGA 3HAEH 3QAZB 3A0OA 1YYML 2R8SH 4JANB 4U7MA 1Q8MA 4X9GA 3P4OB 4P2OB 4HUUB 5CEZH 1CFTA 4PJCA 5FUZL 1IBGH 1NH6A 5ACZA 4QRQA 3V5HB 1NC2B 4EXPX 4HW6A 5CLWA 1CICA 4OIBA 1KOAA 1J88A 3R0MA 1RFDL 1OT2A 5D7IA 5JXED 1TZGL 2VXVH 1RUKH 4I4WA 5T3XD 2SEBB 4ENED 2WWMD 1VFMA 4KI5E 2LVCA 2X4SB 3B5HA 5HJ3A 2OXGA 1FNLA 1CBVL 1FFPB 4GMTL 1RD6A 2OR7A 3O4LB 3RJDA 1PFCA 1MEXH 3P0VH 1BJ1J 5FUOL 2VQTA 4P4KC 1WT5A 3I6LE 2AI0L 4XGZB 3B9AA 1DQQA 1AHWC 3H9YA 4K23L 3QIBA 4HX1A 1GVIA 3MMEB 4H0HB 5GRUH 4OQ1A 4L4TA 2Z8WC 2HG5A 3MNVB 3RRQA 1ADQL 1NPUA 3U1SL 2Y6SD 1QLRB 1KULA 3VD3A 2ZCHH 4MJ4A 1TZIA 3ZHKA 4HT1L 5FA4A 4E41E 1C8PA 4PJAB 3U2SB 1NBVH 3TBWB 5BVPL 3IRZA 4DQOL 5EB9A 4C83A 1S9VA 1F58H 1QFUL 1KB9K 2DJUA 4U3CA 4P5KA 3M1BB 3ES6B 1HYSD 4XCNB 1YPZA 1Q0YH 1FRGH 1BF8A 1O7VA 5FYLL 3DUUB 4U1KA 4CRPA 3W0WA 1MOEA 4HAFA 3ULSB 5FF6A 1MVFA 1R6VA 1FVDB 1CVSC 1P84J 3BHBA 3HNTH 5GZOD 4Q9BA 4CJ0A 5J3HC 2GITB 2X70A 1Y18A 3HUJA 3B43A 3WNNA 3KDMA 5D1ZD 3QH3A 1ETZB 5JORA 1ZLSL 3QG6B 3OTTA 3H2WA 1XCTB 1QLEH 3U9UB 1ZS8B 3B83A 4JFEE 5HI3C 3IFNH 2BVQA 3D0VA 2P43B 1CQKA 3D87B 2IFFH 3MRDA 3V4UH 3LN4B 3TH2T 4HSQA 2EYTB 1CG9B 2BY3A 3UTTA 3NCYS 4J3SA 1MJJB 1UB5A 5D7KE 1WICA 4Z0XA 3OGOE 3ARBC 5DI8B 4JVPA 3UC0L 1GGCL 1MJUH 2W65A 2WUCH 2OQJB 3LDBC 4PB0H 3EDFA 3VWJA 2P5ED 4G9FA 2CO6B 3RVUC 2EDYA 2X9XA 3P4MB 4Z0BL 2C9AA 5E94B 4ZUUA 4EI6A 1N5AA 4NN5B 4M5YH 5DFTA 3MRBB 5C86A 5FB8B 1NCDH 5C2UB 2EIZB 3MRKA 2ZUSA 1QQDA 4WV1A 3MLYL 5EO9A 3HR5B 4Z95L 2QKIA 3OKKB 5IG7B 3IAGC 1NCWL 2ZKHL 1MFAL 1A7QH 2FIRT 1MCCA 2EICA 3CXDL 1AQDB 4G7YL 4H1LA 4X6CB 1MCKA 3O6FA 4BFEA 1H9VA 1F4YL 3RWCA 1QSZA 5CZVH 5D9SB 4ZS6C 3ARFA 1H5BB 3MRNA 3DMMD 1HIMH 4O02L 1HEZB 1BJ8A 2OXHA 3CFKB 4S11A 5T1LA 2K1MA 4U7SA 3GK8L 4QXTA 4U3HA 5FGCB 4JKPH 5DT1H 4AH2A 5C0GB 4XP6L 4HLJA 3MRQB 3G5ZA 1YC8A 4U6XB 1XGRB 4DAGH 4JJ5B 4DEPB 1S9YB 3ALWA 1BZ7B 4TSCH 3MJGX 3WKMH 3OQ3B 1LEGA 2IF7A 3MYJB 3C5JB 1RZFH 3CC5A 4XNMA 5B4MC 4HFUL 5E03A 4PJIE 1TVHB 4U1JB 5DJYB 3BZ4A 1T03H 1M1SA 1NGQL 4MJIB 4Q2ZA 4B50A 3C08L 3S4SG 3MXVH 2OR9L 4XWGL 2P8MB 2VL4A 3LZFH 1GGBH 2N4IA 3BUTA 5D72L 5KS9E 1T1YB 4A6YH 2A77L 4KMTL 4QTHA 1J86A 2BY1A 3QIUB 2DMBA 2A74A 4RGMB 5BO1H 5GGRY 4NCC1 3EGSA 1MF2L 1FYTA 4UV7H 1ZVYA 4HIHB 4ZAKA 3GMOB 4RAHA 5CD3B 2C7UB 1UQSA 2AABH 4QCIB 4HK3J 1MCWM 1HI6B 1CDIA 4X7CC 4LQFL 3GSOA 3GSWA 4XVUC 3ARTA 2XZCL 5ALCH 1ZT1A 4ODWB 1KEGL 4PRAB 5AEAA 1P4IH 3VA2C 1JFQL 4Y19B 1CI5A 2BNQA 1EPFA 2D7PA 1C08A 1B0RA 5BJTA 4H5SA 1KXVC 2VE6A 3T0EA 2GQHA 3OKLB 1JHKL 4JVUA 2PXYA 5C6WH 1ND0A 3DROB 4NNPL 1CLOL 5DMJB 4TSBL 5IEKB 5C0CD 3ARDD 5I8OL 2G5BB 3WMSA 1UWEH 3V6OE 5I16A 2A38A 4KKLD 2GK2A 3KPRB 3S96A 1NCTA 2YD5A 4PUBL 2XZZA 1LDSA 2Z92B 2B4CH 2NY5H 1E27A 2BVYA 5CSZB 5K9KA 3CH1B 4ZDHA 5CIPA 4FQCL 1BVLB 3QUZB 2A6KA 4X9BA 2LU7A 1EIBA 2KZ1B 2R2HA 4GQ9L 4JO4H 1QLFB 1T04A 3JWDL 3O6LH 3QWRD 1DL7H 1YUHA 4D0CA 5AYUL 4EVNA 2JB6A 5J6GA 4ZO9A 3H42H 1ZA3B 4OIIH 3IDJB 5E6IA 5EZJA 1W8OA 5I76A 3HE7A 2HJLB 2IALB 4FHBD 1CICD 1Q72L 1P7QB 4Q74A 5DRXA 4OBSA 4YQXH 2XKSA 1P4LA 3U0TB 2Y36L 4GG8A 1P1ZB 2YWYA 5DR5L 4LLQA 3EHBD 3GBNL 3OG6B 1CZ8L 5LWYL 4YXKH 4P23B 4PGCA 5IFJB 3SOBH 1JRHI 4M1CC 5IFAL 4FNLL 4C4KT 1T83A 2GI7A 2O61A 1QFPA 1EX0A 5CKAA 1U93A 3AU1B 3VA6A 4MS8D 1CR9H 3T4AA 4X6DE 5GGUB 3CUPB 1JF1B 1MHEA 1R5WA 5D6CA 1WF5A 4I9WE 3SDAA 4OZ4A 4Q6YA 1JGLL 1UXWB 2FECL 5I74B 4KJQC 3UMTA 1QRNB 2J5LC 3ZYOA 3GMQB 5I71B 4V1DE 1A5FL 5EA0L 3HKFA 5GHWL 1NSNL 1GAFL 4WWID 3L3OA 1U8QB 3QZWA 1INQA 4U0RB 5BQ7B 1QSEE 1LDPH 3BN9D 4HKJB 4JDTL 2QTEA 5F1IA 1HSBB 3KPSB 4CMMB 4N1HB 1KLUA 3P11L 2E8YA 3DTXA 1K6QL 5DMIH 4F7MA 3I9GH 1AE6L 5EU3B 4AZ8A 4LLDA 1ADQA 3F6LA 3MV8A 4Y4HA 2IPKB 2NW2A 4OCYH 4KI5F 1WWCA 4JQXA 5DZLA 1CFBA 2EDQA 4M93B 4NQED 4YDKL 1ZEAH 1UC6A 3TZVC 4PGZA 3DUSA 4FQXD 2Q8BH 5C0FA 4JGJA 5IHUL 2ATPA 4M43H 1YQVH 3TYGL 3UBXA 5JO5A 3GGWB 2DIBA 1JTTA 1LP9E 2WUBL 3WIFB 3WUZA 3TT1H 4HFWB 4OCLC 2EH8L 3PDOA 4LCWA 4O9HH 1ZHBA 1A6ZA 3KJ6H 3HN3A 4GQPH 5CEYA 4MAYB 3G5YB 2JCCE 5F7DB 2ZNXA 2NX5D 4ZTPL 3UTTD 2HFEB 3S9DB 5IT2H 2VQ1B 3ULVL 4PJ5D 5SWZE 1S7TA 4XCFL 3MJ8B 4CMHB 4RIRA 2NYYC 4FXKA 2XZAH 1DBKH 2DQUL 4YHYB 4G9FD 1P6AB 5HHVH 4F58H 2J8UB 4LSUL 1J8HA 5ANMA 3WXWL 3L5WB 2EZ0C 3DXAE 5T1KA 5DJCB 1ULVA 4K2UL 5KJRL 5IMOA 3DVNB 4BK5A 3BGFC 1GPOH 3WLBB 3HI6L 1UWXK 4R9HA 3O45A 1HH9A 3MJ7B 3ZO0A 1EGJH 4MJ5A 5J1AB 1YNTA 3MLTB 3OB8A 4KTEL 2FO1A 4H26B 5AYQA 2WW8A 4I3GA 4NQDE 3UPAA 1S7VA 2V7NB 5EFIA 1RSFA 1DVFC 1TVBB 2QQLH 3ARFD 1OP3K 4MA3A 1HHHB 1IKNC 3IDIB 5T1LD 4GKNB 1BPVA 2AJUL 1DLHA 4MHHG 1GHFL 3OV6A 4X6BA 5HGHA 4BH8B 4LAJH 3GKWL 3P77B 4OFIA 1N2RB 5E9DE 4YBHA 1KIQA 1NGWB 4YWGL 1IT9H 1F4XL 1AGBA 4JY4A 4AEIL 2VH5H 5J1SC 5FO9B 1Q1JL 1JHLL 3I2CL 1ES0A 1PKOA 1B4RA 4NRXA 2OL3B 4WHYG 3WV0A 4K7PL 2M26A 1R24B 2WMPA 5I1KH 1FNHA 3RWGB 4PS4H 4U6YB 4KAQH 2Z8SA 1JCKA 3QQ4A 4CNIB 4KFZC 1UCTA 3A6CH 3ECBB 3PXHA 3VDBA 2M2DA 3MLPA 3S36X 4L8BB 2BY0A 5L6YL 5E2TH 5EC2A 1BFVL 1JF6A 1FLRL 4MA1C 4PP2B 4X80H 5E5MB 1OAQH 2XY2A 3VFSB 4XH2A 4R7DB 1KJMA 1QZ1A 5D1XC 3T65B 4X5XB 3SKOB 1KJVA 4LDEB 3O6KH 1QSFB 4OGXH 4YXHH 1LO2H 2IANA 4RWHA 1YDPA 1KTDB 5DJ2B 3MOAH 1AY1L 1S5HA 1A7OL 5C07B 1IAOA 3WE6B 4DGVH 4X7SH 3LY6A 4D9LL 3QNYA 3RX8A 5LG1A 1MREL 3BKJH 1N6QL 1I1FA 5DMYA 2AJVL 5DFWH 2BMKB 2IADA 4JY6A 1XR8B 2BNQD 1K85A 4OB5L 4Y8AA 3FFCA 3T0ED 2Q7YA 4PRHD 1SM3L 4JM2D 4PJIF 1BFOA 1KYOJ 5ADPL 3AFLA 1VADB 4ZUVB 1ORQB 4BZ2H 3F7VB 2YPLA 3I3DA 5ISZA 4JREB 2AQ3A 1WITA 1CLZL 1UA6L 1FGVH 1CXKA 3WFBH 5TE4H 3CFEA 5TDPB 5KS9F 4X99B 5DJAA 1A7RH 3UEZA 1MQKH 1G9EA 5LXGL 2VXQL 1HOCA 2XXCB 4JG1H 1RURH 5F3HB 2EH7H 4ZUSB 5HDBE 5ACMA 4L8CA 5FYJE 1MJ8H 4KQ3L 4JPVH 3QA3B 1XEDA 2NZ9D 2A1WL 5GGSB 4WW2A 4QY8B 1U95B 1BIIA 2X1QA 4IDLA 3AY4C 5ELIA 3CFBB 1BZ9A 1W72H 4PJ9A 2P49B 1E4WL 2FZ3B 4LFHG 5AZ2L 2F5BH 1PVHA 4ODVL 3K2UL 5BMFH 4X7TA 4OLYH 4HIIA 4Z7UB 5IM7B 2BDNH 3E1F1 4Q6IB 3CPLA 1PDKA 4NT6B 2BVPB 1FSKB 5GIRB 1ACYH 3ALPA 4JHAL 4WO4B 5E08H 3CH8A 4HS6A 3T0XA 2OJZH 3K80A 3NAAL 5D2LA 2AKRB 2BOBB 2ITDA 3UP1A 2M1KA 3P2TA 3KYKL 4NWTL 2YA1A 3QPXL 4KI1A 5EZLB 2B8OT 1E28A 1L7TH 5DO2C 4X4ME 3D9AL 4JRYB 3FQUB 2NW3A 4DW2H 5DJ6B 3CIQA 4G9DA 4I3SH 4O58H 3IVKA 3DIFA 3RNKA 4KRNA 2P4AB 4F37K 4PJGE 4QHMB 4NQCB 4PTTB 3DYOA 1OARH 4V2BA 5C07D 4HIXL 1SEBA 3O3DB 4JQIL 2X4RA 4PGBB 3ZSTA 1QFWI 2A73B 1OM3H 3MGOA 5JIKA 5EU6D 3QB7C 4LPCA 5FGBC 1IQWL 4LFHD 4P2RE 1RULH 1PG7W 4HV8B 4KTDL 5LCVL 1CFQA 5HPOA 4K3GA 4X4ZA 1K9TA 4AIZB 2W0KA 3TNNB 3HRZB 2R2EB 5IVXA 5FECA 5IKCB 3VXSA 3LB6C 4XX1E 1GOHA 1PBYA 1EO8H 1MH5A 4C55A 4JE4B 3T2NH 1F5WA 4P0DA 3SE4A 1MVUB 1CVRA 3DGGB 2CLZA 4LARL 4X9IA 4L29B 4GG6A 3VXUE 3QEQD 4N8VB 4HWEL 2XQBH 2EE3A 1CS6A 1JN6A 4LDLB 4NQSA 3MRIA 4U7KA 1P9MC 2MKLC 3U48A 4JN1L 3RY4A 1GOFA 1EBPA 5F8QC 1A6UH 2IAMA 4FQ1L 5JOEA 4Q9QH 1FAKT 2R1WB 4HWNA 4PJFB 5D70H 4HWBH 4R4NC 4EUPB 4X6DF 2B1HL 5DD1L 4BKLA 4NO3A 5IJVA 1V7NL 2QQKH 3QUKA 1CLCA 4M9OA 3AXLB 3OKDB 2VIRA 3QRGH 4PJ7A 4PYGA 2VXTH 4C57C 5FYLD 5JHDE 4KUZH 1IGCL 3W9DA 3ROLB 5I1GH 3IU3A 3C60C 1U91A 5B39G 5IQ7H 2NLJA 5FHAL 2AXGA 5IB5B 2Q8AH 3V6ZB 1FG2B 2YPKB 2D4DA 3QFDB 4P57B 5F1NA 5HYJB 4W4OC 2JF1A 2P7TB 1N6UA 5GRVK 2DKUA 2AJXL 3INUL 4S1QH 2FJGA 3QDGB 4HD9A 2NTFA 1I9IL 1E4KC 3MLSL 3HC0B 5T1KD 3O2WL 4ELKB 4F2MA 4EJ1C 1UVQB 3EDJA 3ELAT 3R4DA 4YR6B 3TVMB 3SBWA 3O0RH 3ZHDA 4E5XB 4HPYH 1RZ8B 1TETH 4UU9A 1RJCA 5GRXG 4GKSB 3QQ3B 3O8XC 3D0LA 4OT1L 5INCA 5KSAB 1KG0A 3BRFA 2NR6D 3MCKA 1S9WB 4LCYA 1SBBA 5J56B 3PIQB 2AEPH 4C4KO 1LP9F 4WI3A 4IMLA 3RWDA 3BQUD 4MNQD 3CDYA 4WWKC 1M6OA 4KK9C 5D96C 1VACA 5I9QC 2JCCF 2X4TB 4P3DB 3QDMB 1I1YA 2F54A 4G6JH 1NCAL 1NUDA 4GRWE 2PW2B 4PRIA 3STLB 1YYLH 3PGCA 3L3JA 4JFHD 1ZTXH 1U6AL 3DARA 1G7PB 3VGBA 3KLAA 1RIVH 1OB1B 3VRLE 2V7HB 4ELME 3FO9A 2GTZB 2ILLA 2ZOKB 2DKMA 2W07A 3QFJE 4IHOA 3RAJH 4PJEA 4OD2A 5E2WL 5E2VL 5KVGL 3QUMB 2J88L 2VL5A 2F9BT 4QRRD 4XPBL 1XF5A 1U8HA 1ZHLA 1WZKA 3WXVH 4H25B 1XH3A 3LQZA 3NTCL 3SDYL 1BFTA 2GJ6B 3EDEA 1KB5H 5CCKH 3SE8H 2OTWA 5L88L 4WU5A 1FN4A 4MXVE 5IB2B 3E0GA 3RBGA 1HSAB 1IKFH 3IJSA 3MYZA 3W2DL 4KKBD 4I48A 5F96L 2PYFA 1HHKA 2I5YH 4HWZB 3LEVH 5E2UH 3WBDA 1VDGA 2PW1A 4KRPB 5E2JA 4ZD3H 2C3GA 4Y16C 1YA5A 3KPQA 5D7IE 1I8IA 2CUIA 4Z7OE 4R96B 4WGWB 1RZGB 4FTVD 3WS3B 1F3DJ 1W8NA 1Q9OB 5JQ6L 1P2CB 1RHHA 3T1WA 4X5WA 2GHWB 4LHUB 3MRGB 1IAKA 3ULUL 4NPYB 5L9DL 5JW3L 4KDTA 3NPSB 3SDCC 4XNQB 1A14L 3F62A 5M7QA 4W6WB 1CFNA 2DWDB 1P7KB 2DD8H 2B1AL 5LVEA 4F7CB 4XWOC 3P9LA 4CADA 4L4TE 4NM8H 4GRWH 5DURB 5I1EH 3SN6N 2APBA 2R9HD 5SWSE 4JANA 1UJ3C 3P4OA 4P2OA 4HUUA 5T3ZE 2BX5A 2CKBB 2VR4A 5I1DA 1U8PB 5ISZD 4NZTL 3LIZH 4Y2DA 3PG2A 2FEEI 4Y7MA 3GJEA 1NC2A 3RY5A 3SHSA 4FABH 2BHZA 2VMFA 2VSCA 5AWNL 5I15L 2APVA 1ZLVH 1T0PB 4BUHA 3VU2A 3QXWA 4YK4B 4TPRH 1YPZE 2E27H 2R0WL 3B2UD 2FD6L 3J7HA 4KH2A 5CJOL 2HKFL 3W0WE 3LS4L 2X4SA 1E4XI 1FFPA 1AFVL 1TZHB 1J1PH 4M7ZB 3O4LA 1RZIA 1R3KB 2X40A 1A2YA 3LS5H 4LSQL 3HFML 4XGZA 1YMHB 4ZFGH 4K3JL 1OAXL 3HUJE 5IQ9B 1OGAD 3BIKB 2IH1A 3MLXL 1T5XA 3ZTNH 3TBTB 4KMQA 1KXQE 2LE9A 2XA8H 3OBAA 3WDHA 2F58H 4HUVB 3L1OL 4PJ8A 1C5BL 4MXQC 4RAVB 4L9LB 2ENYA 4OLZL 4X4XB 2PTTB 4KPHH 1MCDA 2XT1B 3U2SA 5CSGA 1IEAA 1ITCA 1U2CA 1H8SA 1ZSDB 4XP5L 5D5MB 3HAEB 3ARUA 4P9HC 1Q94A 1EVTC 1Z3GH 2RAMA 4I3RH 1RIHH 3VXRB 1FH5L 5I1HL 3M1BA 3ES6A 1NC4B 1JTPA 2XTJD 2NNAB 5HDBF 5T3ZH 3BE1H 2X5PA 2F19L 4AG4H 3DUUA 5BS0D 1F8TH 3ULSA 2A6DB 5I1LB 1MNUL 5JW4R 3DSFH 1BD2B 1TVDA 4MA7L 2V17L 2NY2D 5DK0B 4NJ9H 1M7XA 3PJSB 1TJIL 3VXMA 3GZKA 3EFFB 1YY9C 2GITA 1RJZB 2ZCKL 4KUCF 3RKDD 1ETZA 3QG6A 1IM9D 1C7TA 2V5RA 5JW4Q 2N7BA 5J12C 1XCTA 5T33L 4HJ0D 1ZE3C 3GJFA 3U9UA 2UV3A 1ZS8A 3L7FB 3VXSD 2AEIT 4QWWC 4UT6L 1E6JH 4X4YB 3V7MA 1V5JA 3LN4A 3RDTA 5L0QC 1OHQA 2EYTA 4U2ZA 1CG9A 4ZS7H 3KXFE 3JTTB 4NFCA 1MJJA 3U4AA 4MSWB 1FDLH 3HB3D 1WZLA 2EDRA 4ONFL 5DI8A 3VFRB 4XNXH 4XVJH 2IMMA 1MFCL 3C8KB 3KPPB 5A2IH 4PLJC 1II4E 4PJGF 4FZEL 2Y72A 3P4MA 3AREB 3BJLA 1DP0A 2PYEE 3MRBA 3F5WA 5IBUB 5FB8A 3RTQB 2EIZA 2FATL 1VFOA 4J3WA 2DQGH 2VZSA 4KDVA 4OZFH 3FN3A 4NFBA 1LNUB 3HR5A 3F8UB 2YUWA 4XXCC 1OTSC 3OKKA 5E1HB 3NCEB 3GRWL 1AQDA 4X6CA 3ZE2E 3HNVL 3OKMB 2ZZUT 2VXSL 4UB0H 2PTVA 5D9SA 2UWEE 3EAKA 1I9JH 2OL3L 1HEZA 3ZE1E 3HZKB 5JPMA 3WFHA 3WO3B 1FYTE 4YHPB 2DBJA 1NFKA 4OCXH 4Y4KD 3SCMB 2EXWC 4MQXD 4YUEL 5C0GA 3MRQA 4U6XA 4X6FB 5FIEA 3S98A 1XGRA 4XP1L 4JJ5A 4YHNB 4EDXB 4LU5H 2VQUA 1BZ7A 4F9LA 1I7RB 5HYQA 5DC9B 4K3DL 4UQ3B 1JTOA 4TNWK 3RGVB 35C8L 4UZGA 3MYJA 3QSKB 5FHBL 3OJVC 3QQNA 3LRHA 4PGDB 3U30C 1YN7B 5IF0B 4U1JA 5DJYA 3LMJH 2ICEB 5F6IC 5I19H 4XTRD 4P46D 2HFFA 3IDXL 2EC8A 4MJIA 3QXUA 4U6VH 3MBED 2J4WH 3D6GA 4WUUB 4Y1AD 4G42B 2P8MA 4GAYB 2R69H 3IJYA 4R90H 2FH6A 1T1YA 4LLYB 4RFOL 3QIUA 2AJ3B 1BAFL 4GW5B 4WEBH 4Y5XC 1IZJA 2DLGA 1PKQB 1A8JH 4WRLA 4R26H 4OFPA 2Y06L 4HIHA 3GSNL 4LP5A 2AJYL 1WWWX 2FLBT 4G8IB 4OLXH 4N0CD 5CD3A 2C7UA 4FG6D 4QCIA 3NIDE 4X7EC 1QG3A 2VWEC 1HI6A 5GRYA 2DJ4A 1CIUA 1L6ZA 2Q3AA 1AO7D 5JXEC 4JFZH 4XMPH 4ODWA 2DB8A 4PRAA 3FRPG 4YHLL 3OX8A 4D9RD 2YSSB 2EDNA 1NDGB 3WFEL 4N0YH 4ENEC 1INDH 2ESVE 2WWMC 3CDCA 4KV5E 2PCPB 5EIVA