4MT5A

Crystal structure of mub-rv
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
184
structure length
184
Chain Sequence
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKTVVYVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for adaptation of lactobacilli to gastrointestinal mucus.
pubmed doi rcsb
source organism Lactobacillus reuteri
molecule tags Protein binding
molecule keywords Mucus binding proteinn
total genus 34
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17965 MucBP_2 Mucin binding domain
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A02
3.10.20.470 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A01
3I57A 3Q69A 3LYYA 4MT5A 2LFIA 3NZ3A
chains in the Genus database with same CATH superfamily
1DYQA 1OQQA 2E3TA 3IG3A 3ETRA 5AZGA 3H9DA 4RGMA 5C23A 2QJLA 1YN3A 2GB1A 4Q2JA 3RNBC 3UF8A 3TJPA 3MC9A 1EWCA 5AZFA 2BB5A 1HA5A 4ZRIA 2WXOA 1PDXA 4PS3A 2KJRA 2KVZA 4ARCA 3KQ4A 1EUVB 4LNKA 1FNVA 3BZDB 2Z8LA 2ZPNA 3WALA 5BMHA 4MGZE 2R61A 4W9JA 2IY0B 3MP9A 3ZRCA 1HXYD 4AP4C 3NZUA 2Y5PA 3VUWA 2AQ2B 2DWQA 4MM3A 4PK1A 2PPHA 3N1XC 3OAWA 1V1PA 3V62A 4USAA 3S2AA 1IUEA 1XXGA 1JQ4A 3BWUD 4KIKA 1QQRA 1WJ4A 1P9DU 1WGYA 4WJQA 3ZJUA 1J19A 5DPSA 3AE6B 1FD6A 4XYCA 4LNOA 3VFKA 3I57A 3N1ZC 3NRZA 3P42A 1N63A 4YT0B 3ZO5B 1R7SA 2LRUA 3WAPA 2LWPA 3SHQA 2DENB 2N1VA 1E5WA 1UGMA 2KLCA 3AB5A 3APCA 3MJWA 2TSSA 4JWUC 4I6PA 4WAFA 3U7ZA 2D07B 2M19A 4HWIB 4YSYB 4IM3A 3NS1A 3FKYA 1GC6A 4W9EA 1SJED 1YD8U 3ZJVA 2FIFA 1JWBD 2WXKA 1VR9A 2LHDA 3H7PA 1B9RA 2VH1A 3OJ3A 3L54A 2BKFA 2W54A 5FR6A 3K9PB 2WP9B 3GZNB 4IM2A 3WAOA 1UBQA 3VXWA 2WXGA 3Q6BA 1VLBA 4GU2A 1EU4A 5CHVC 3AE3B 3CMMB 1WWTA 5G2NA 2NBVB 1Q5WB 3UI3A 2MRPA 1FFUA 4FJVB 2UU7A 2AWTA 4C4VA 1FCCC 3RN9C 4KV2A 3EC8A 2C7HA 2BT6A 4N59A 3L4PA 4L23A 5J17A 4A55A 4GDKA 3ML9A 1OEYA 4GB9A 1XO3A 3R7RA 5AUIA 5CHWA 4YSZB 2KN5A 3SR6A 1IBXB 3P2BA 2JY6A 3L10B 4A20A 2ZCBA 1RFAA 5AUKA 3ZJTA 3UQAA 2K8HA 5EE0A 4EUTA 3N30A 3B1LX 2WXFA 1EM7A 4ZHOA 3Q3OC 5D2MB 5E6OA 2D3GA 4WIPA 4W9GA 3DBRB 3VUXA 2L83A 3AI5A 1WMHA 2PLPA 2CKHB 2OEDA 2N9KA 4P1CC 2LGSA 3AMZA 4EE2A 1GOZA 3KYCD 1RFKA 1TBEA 2G45B 1TS4A 2H88B 2LVQA 3DDCB 3SU8X 3VR8B 4C7ZA 1PYWD 3HM3A 4I6LB 2KACA 1RAXA 3BK2A 2CJOA 1ZDVA 2NCNA 3E9SA 2MX2A 3U8ZA 1XF5L 4EKUA 2GBRA 5KHOA 1T0SC 1NVID 1NYQA 2N9EB 3L08A 3AH7A 5EE9A 3KUZA 3KWLA 2PKOA 1N62A 2QCZA 4L2YA 1D5MC 1WZ3A 1V1PB 2QMTA 1UUPA 1C1YB 1WXQA 2MHJA 1I4RA 1KF6B 3ZGZA 1ET6A 2M0AA 3BYTB 3VTVA 2OHFA 3U4EG 2QDFA 2IGDA 2IZVB 3PRMB 2PE6B 4CO7A 1Q0WB 1P7EA 2LEKA 4R3DA 1ACCA 1ZUD2 2MBOA 3WAMA 5JHBA 3ZYYX 4RF1A 1ZGUB 2L7RA 1B1ZA 1FEHA 4M02A 2M56B 2JZ3B 1TKYA 1VRAB 3QA8A 2BYFA 4OVVA 2GBKA 1X1MA 1YN4A 3ZTDA 4XC2A 2ICIA 1PUTA 3I9V1 4FA6A 5J2RA 4M00A 3WIMA 5HI1A 2LZ6A 1UWXA 5D94A 4PT5A 1V49A 2BS4B 1Y8RC 4LNFA 1QT9A 4CHKA 4EEWA 2KWUB 2DHZA 1FFVA 4K3BA 2MLBA 4KDLB 4HCPB 2KANA 2PMVA 2CU3A 2ACZB 2JSVX 3Q8BA 4NAMA 3NY5A 1ESFA 1LGRA 2Y5BB 3RMKC 4DWFA 4H2AA 1WE7A 1TY2A 2KWVB 2O2VB 2ONQA 1YX5B 3RYTA 1RM6C 3OLMD 2C7MB 2WXQA 2GLSA 1WXSA 3VAWA 2DZJA 4OZCA 4TUUA 3CIRB 1CMXB 2L05A 1J0GA 3DOWA 3W9CB 1ZE3D 3GS2A 2D11A 1SIFA 3QCAA 1D3ZA 1T3QA 1DOYA 4DHJB 2D3BA 3DBLB 3DBHI 1YJ1A 4PYUA 1PGAA 4LJOB 1DOXA 2BS3B 1S1QB 3EHVA 2RDBC 4HRSA 1WX8A 2IO1B 1FNUA 2ZNVC 3N9YC 1ZXIA 5BO4B 4WQMA 3A9JB 3A1QA 1L6VA 2M8SA 4YWGG 3SDLC 4M8MA 4G3XB 4NY0A 3VVWB 2DYBA 2ZZPB 2NTTA 2JXTA 2K8BA 5IA7A 4HVBA 1QOAA 2A5UA 1XLPA 3DVNU 3H8HA 1E7UA 2AX5A 1D5ZC 1C4AA 3Q8EA 1QKZA 1OQYA 5FK9C 5L83A 1E8ZA 1NI3A 4MJSA 5DPWA 2RDHA 4GOCA 1XLQA 3IAM1 1YN5A 4HK2A 3NG0A 2HE7A 1E8WA 2ZW0A 3ZRFA 4WWMA 4GLSC 3PVLA 1UNSA 1I7HA 4KSKC 2KMCA 2K0PA 1F77A 3V60A 1HZ5A 2BS2B 1V8CA 4LJPB 3H6NA 3PS6A 4AJYB 4B0MA 2LVPA 2ZCCA 2GBMA 4MH0E 4OZBA 4A90A 4EZLA 2ZNVB 3BINA 2GOWA 4K7WA 3M3JA 3PGEA 4JPSA 3DHGC 2VH2A 3H7PB 3MFGA 2BWES 1GJZA 2PVOD 1QOBA 1BUIC 2OJWA 2WNMA 2K22A 3NHEB 2KO3A 3KW5B 1SE3A 3TBLD 3A4SC 2DZKA 3ZKJC 1I4XA 5C3JB 2KDMA 2J7QB 1TS3A 3R3MA 1KOTA 2HTME 2EMTA 5C1ZA 4G50A 2WX1A 1UBIA 1VZ6A 1PGXA 4TQ1A 5BYQA 2IO2B 3Q3NC 2X38A 2JUOA 2BWFA 2FUG1 3PZ8A 2GRIA 2V1YA 3PLUA 3EGRA 2WHIA 3BVZA 3TEWA 4BFRA 3DHHC 4KZCA 4C00A 3ZIMA 2RR9A 1TZ1A 2C9WB 1OQRA 1WI0A 4FBJB 1Z5SB 4HDOA 4CQNA 1HTQA 3AE1B 2DYMA 3Q3FA 3T8MA 2FBWB 5BMGA 1D5XC 3M62B 1F2RI 4A6QA 3KH0A 2JQRB 3PZDA 3MC8A 1WX7A 2AQ1B 2WYQA 4DDGD 1I35A 2IO3B 4JLCA 1A5RA 3AE5B 1JWAD 2Y3AA 2J53A 3BVGA 2C60A 1LFDA 1E7VA 2LJ5A 4LTUA 4W9KA 1V81A 4WWNA 1SB3C 2W55A 3R7QA 4PS7A 2N7JA 3RNAC 2INNE 1XD3B 4ANUA 2O6VB 3B2GA 2BYEA 3DWMA 2MCNB 1WGHA 1K50A 2K1FA 4BOZB 5JZEB 1WE6A 2VZKD 1PFDA 2LXCA 3ZVVA 4M0WB 2IJ0A 2LUEA 2NBWB 4HCNB 1ISNA 3WA0A 3IBEA 1Q10A 4S0RA 3K9OB 3ZDTA 1V6EA 2KT7A 4OW0A 2HDEA 2JYEA 5D7GA 1AARA 1MI0A 1V5TA 4II3B 4XX5A 3UIPB 5IKCM 3W5UB 2NPTA 1VDVA 4KKJA 4O1NA 2QC8A 5JHAA 1WR6E 4EZKA 1R4NI 2KNBA 2W3RA 3ONSA 1WJNA 1RYJA 3W5VB 1L5PA 2BW2A 3H7SA 2PJHA 3DBHB 2RMMA 4LNIA 1VZ7A 3CWIA 3PLVA 2NTSA 2JYTA 3WANA 5IO9A 1MVKA 4NQKE 1KJTA 3L17A 2D3AA 2K8CA 5IAAC 3EECA 2MBQA 1P0RA 4W9FA 1F52A 1GB1A 2KZRA 4N58A 4W9IA 2WXLA 4BKTA 1VD2A 1WFYA 2NBUA 4B9KA 2IGGA 1MPEA 4UDUC 4M8NA 1E10A 4AWJA 2I38A 5BMIA 2UWQA 2IYDB 3RZFA 1TGZB 2KFJA 3RZWC 2DLBA 4KX6B 2K39A 4XWTA 2BGFA 3FC4A 4A3PA 1XCTL 1WXAA 3A9KA 1VJKA 4DXFA 3Q2AC 3V05A 3MTNB 4BZAA 5L95C 4MDKE 2Z0DB 1TKEA 1JMLA 1L0YB 3KVFB 4NNJB 2H89B 3ML8A 4GGQA 1T0QC 2A4ZA 2LVOA 2MA9B 5G5GA 1N61A 2W82A 3CSFA 1TS5A 1N60A 1YX6B 2FUHB 3O65B 2K6DB 3HVZA 2IY1B 2FCSA 2QILA 3RPFC 4G11A 2KK8A 3ZXVA 4JE3B 3URYA 2KTRB 1GB4A 1OEYJ 4N9F4 1JALA 2QIEB 2WU5B 3U52E 1HTOA 2LMCA 4M0WA 2AL3A 1U4AA 5J18A 2BYTA 1XLNA 3NUHB 1SJHD 4FLHA 4RM9A 3CSTA 3TIXA 2I2YA 1QOFA 4GIVA 2I1KA 2J0JA 1QF6A 3AULA 4BAXA 1MHHE 4P16A 1I4GA 2JWUA 2WDQB 2LASA 3PTFC 4WH4A 2VRRB 2K3UA 3DPDA 4YTMB 1GAQB 2NS5A 1K52A 2IDYA 1EO6A 3IT4B 2PIAA 3AM9A 5HG2A 4RH6A 4WURA 1ET9A 5FKAC 2KD0A 4FXCA 1WGKA 4W9DA 4ANVA 1N5WA 2FNJB 4NQLB 4HJKA 4RNAA 1XT9B 1T5XD 1KLVA 3DBRI 2ON8A 1ZOYB 1BMLC 2J0MA 3QC8B 4XDDA 3EUB2 2GBJA 2CHZA 3IHPC 1TZOA 1C4CA 3KWVA 2YEPB 2GI9A 1M94A 1E9MA 4KVGB 1KFYB 1HZ6A 2BBCA 4EZJA 2G4SA 4JWSC 5BYRA 4FJZA 1HE8A 2IPKD 1STEA 3PZ7A 2RDGA 2HTHA 2MBEA 2XEWA 1QOGA 3JSVB 4II2B 3EA6A 2INCC 2L52A 1KM7A 1AYFA 2FE8A 1IPGA 1GG3A 1WYWB 1ROEA 2KWCA 4DHZE 2CR5A 3I3TB 4E74A 2KDBA 1GPXA 4WWPA 2DAJA 1SXTA 2RGFA 3AU5A 2JZPA 1C76A 1G6JA 1CK1A 3QHTA 2HJ8A 1FXAA 4ZHPA 4OVZA 3W1SA 4HKQA 3GZNI 1T6BX 3CF6E 4A3OA 4WJNA 4J3OD 1H4RA 3UQBA 4AQ7A 1WR1A 1GUAB 1KRHA 2CU1A 2IBIB 1FMAD 3NZSA 2M0XA 1TIFA 3ZXRA 3M95A 5DPRA 1WZ0A 3LDZE 1C78A 2INDC 5HHDG 3RNEC 3AU4A 3DHIC 3AE7B 4HDQA 5I4DA 1AW7A 3I5JC 3LXFA 3A9KB 4TKNA 4ACFA 1IGDA 2L76A 2KQSA 2HD5B 3PSEB 1S3SG 3C19A 4IG7B 2KLGA 2KMAA 2WDTB 2B76B 2W9NA 3R2TA 4OZAA 3APFA 2DNFA 3JSVA 4N6EB 2KC2A 2LGIA 2Z0EB 1KH0A 4YXDB 2SAKA 3AE4B 1TT5B 4B6WA 1YQ4B 4GN1A 2XNAC 4E3CA 4MSQB 4YSXB 1YJJA 2OOBB 1WGGA 3P63A 3W1SC 2ASQA 4URKA 2BF8B 4GXBA 3RD2A 1C79A 4K3CA 1E8YA 2KJ6A 4BOSC 4KIKB 2V3SA 4ITKA 4K7SA 4BVUC 4XZ4A 5D3IB 1SE2A 2WXRA 3P4SB 1TY0A 3U2SC 4DXAB 1AWDA 2WLBA 3N20C 4MM3B 1I42A 4JL9A 3R66C 1VCBA 1WJUA 4BBNC 1I4QA 2L3ZA 1V86A 4HKZE 4LDTB 4IWOA 2G3QB 4TMAB 4RFBA 3AEDB 2L1AA 3HRDD 2C7NB 4RM8A 3QJZA 2QEJC 3FILB 2XK5A 3Q8CA 2Y5CA 1UH6A 2NMQA 3LYYA 1Z2MA 4GDLB 3QWZB 4K81A 1OTRB 2V4LA 1EF1A 3ZNID 2RD0A 3IT6B 3QQ8B 4X57B 5HFYA 4P7IA 4JQWC 4IC7B 2IGHA 4P6VF 5GXGB 4K7UA 1D6EC 4JIOU 1EWYC 2JRIB 2O6VA 2KDEB 1SBBB 3U7DA 3TEXA 4A8XC 1WY8A 4ZRJA 1HEZE 1IGCA 1T0RC 3FILA 3X23A 4WJPA 4KGTA 5KHQA 2YEPF 4QAYA 4ZYSA 1JWSD 2L0FA 3U30A 4D2KA 3KUCB 1P7FA 1FIQA 1N5XA 2KJHB 1UGJA 2BB6A 4XGAB 4ZOHC 4ZRQA 2N9XA 3KUDB 2FCMA 3NOBA 5E6JA 4ICUA 5LNK1 2K5PA 5HKHA 2ZEQA 3VH4B 3RNGC 3PREA 3IFWB 1K51A 4WAAA 1LQBA 2WDVB 5IN7A 1SF0A 2KYWA 3Q3JA 3ZQ4A 2AYOB 4YTNB 2MP2A 4NJ7A 1SE4A 2MBBB 5E6NA 3OWEB 2G4DB 1FO4A 1L0VB 4A9AA 1WRDB 2WGSA 1WF9A 4MGIE 1ZKHA 4NAWA 3VRAB 4FHKA 3EFUA 2N1WA 4EFOA 4LCDE 3AE8B 1UZXB 4DHJD 2M4NA 4IDIA 5G55A 2WDRB 4KGSA 4HPPA 4C80A 4JGHB 3P4QB 1C77A 2LUMA 5LXIB 2PVGC 4BKSD 3HIZA 1V2YA 2RPQA 1IYFA 4W9HA 1WJ6A 2B3AA 3WCQA 3DVNV 3VH3B 2LJIA 2KKCA 1K53A 1V97A 2DBYA 4LNNA 1T0YA 1VZ8A 2KX0A 4BBNF 3PT2B 1ZP0B 1IBXA 1WRIA 1L0XB 4TV3A 1BT0A 2NPTB 3O13A 4FADA 3MC0B 1LM8B 2LXAA 4GDKB 5GMVA 2WXPA 3TUOA 2KHWB 4AJWA 3VQIA 4HPLB 2LFIA 1Q1OA 1MG4A 4C4VB 2JWZA 4LDTD 4ICVA 5MPOA 1MG8A 2D10A 1WXMA 3EFCA 4IW0A 1XEEA 2E6XA 2KQ4X 3B08A 3VDZA 5IP4D 1JCKB 3N3KB 1LO5D 3ZUNA 3NVYA 4G0NB 3W2DA 3DVGX 3DWGC 4GMVA 4KKIA 5CTRC 3ZDMC 3A1QB 1FCLA 3BY4B 2N9PC 3T3NA 3AEAB 4REZA 4XWWA 1WM2A 2K9XA 1PGBA 4ZRPA 3GP7A 2LI5A 3J9CA 4DHZB 3JW0X 4HXDA 2L0TA 3RNFC 1JRPA 4F7ZA 4S17A 2UYZB 4W9CA 2MEKA 3L13A 3V3XA 1SEBD 1ZW7A 1L4DB 4US9A 4NAWB 3HUIA 1AN8A 4LK0M 4XE0A 3PHXB 3TL5A 4US8A 1P98A 5EE1A 1V1OA 2V3NA 3MHZA 1SIJA 2WQYB 3ZNHB 2QSDA 4RF0A 3N1YC 2X8XX 2O2VA 4K1RB 2V4IB 3T9LA 2N0SB 1CZPA 2KAJA 2MH7A 2JX5A 3B2FA 1FM0D 2EKIA 2J4XA 4DDID 4IUMB 5G5HA 3RNCC 3APDA 3PO0A 5D3DA 2W3SA 2J52A 4MGKE 4DQOC 2LHEA 1FXIA 1YJIA 3Q8FA 3BK1A 1Y56A 1L6UA 3L0WB 4AOFA 3LJ3A 3MJ5A 2BYVE 2ZVNA 1CJEA 3N32A 2KQ7A 3Q3MC 5DPTA 1IP9A 1F0ZA 3RUIB 2PE9A 4BKGA 2JPHA 1QLBB 2KTRA 3BYYB 1ZPSA 2KX3A 2G1EA 1C3TA 1YQBA 3ZW3A 2WXIA 5AZHA 4RCOA 3QX1A 2KN4A 4FN2A 3GE3C 3ZLZA 4MSMB 1M4VA 1N6ZA 3AE9B 1XQQA 4RGNA 4W9LA 2K6QA 2LGDA 2VZKB 1YNTE 1UF0A 3AEBB 3QAQA 4B0EA 5JXVA 2JRHA 1WGDA 3OG5A 3R8BA 3X0WA 2XN9C 4TSSA 4PYZA 3A33B 1OFFA 1E0ZA 4HPMB 4GDLA 3RI7C 1FXTB 3RFZB 1RWSA 1WM3A 2KFKA 3AECB 2XK5B 3GE8C 3HK0A 2REXA 3Q69A 2KC1A 4L1BA 4F1SA 2AQ3B 2CHXA 2NVUI 4KDIC 3SFEB 2L00B 4I6NB 3AV8A 2LGYA 3P4PB 3UIOB 1E90A 2EMSA 4E71A 1BXTA 1JW9D 4IWQA 2KMMA 1WX9A 5CHFA 2WX0A 4J6IA 4C56C 1E7PB 1JRUA 5CX3A 1P1AA 3TMPB 1ZDXA 3PHWB 3LB8C 1C4PA 2MW5A 1NYRA 1DOIA 3IVFA 1J7AA 2DYOA 2EKEC 2FIDA 2INPE 3B9JA 2OJRA 4MT5A 3V6CB 2N7EA 3KLSX 2ZJDA 3PV1A 2MJ3A 2JZZA 5E6PA 3TEYA 3NS8A 1L2NA 2LD9A 2Q5WD 2KDIA 4KZ0A 3AEEB 2AL6A 3AXCA 1LXDA 2KWDA 4AUQC 5FR3A 1R4MI 3UGBB 5EE3A 3NJTA 3RT3B 2KDFB 3PRPB 4FJYA 2JT4B 1E6EB 3DQVA 3OJ4B 4WJOA 4OHJA 3A4RA 4MELA 2KFKB 2JVCA 2K25A 1NBFC 2V3PA 3DVGY 3UINB 2KVRA 3SFDB 1V80A 3VUYA 4NPNA 1SSNA 1PQSA 2PW9A 3GB1A 2G9HD 4HROA 4ANWA 5TR5A 1I4HA 3BIID 2RSUA 1DGJA 3AEFB 1XCQL 2WU2B 1JWMD 4CYEA 1FPYA 3VTUA 1YMHE 2ZW1A 3B0AA 4F8CB 3IAS1 4LLGM 4TQ0A 4C7YA 3VR9B 4KSLC 3ZNGC 4HJGE 3C0RB 1KLGD 3AEGB 4NJCA 4RGTA 1EF5A 3QIJA 1QZEA 2R2QA 2YLMA 4IM0A 3V6EB 1R4NB 4OVUA 3DBSA 3P4RB 1MHXA 1KTKA 2JF5A 2N9LA 1A70A 2J0KA 4PS8A 3RULA 3AN1A 3QARA 1WH3A 4RGOS 3TEZA 2LRWA 3D32A 4FHJA 3ABVB 2AEHA 1F2RC 4ARIA 3RCZA 1ENFA 3E56A 1GC7A 3TSSA 4XDCA 1P3QU 3P1MA 1QILA 1RLFA 2WXHA 3FAHA 1JROA 2BQQA 2NR2A 1NDDA 2L8JA 1XLOA 1RRBA 3JVZX 2DZMA 2MJEA 2I1JA 2BKRB 1WYGA 3W1YA 2CHWA 3PPAA 2WWZA 1J7BA 3NVWA 5IOIA 1V9JA 4JX1C 4KGRA 2GBNA 2DZIA 3BVMA 2WS3B 2Z59B 2FAZA 4ZDVA 4MACA 3Q14C 4WQOB 2PTLA 1UELA 2WXJA 2C5LC 2RPVA 4ZYNA 1TJEA 1WMHB 4ASWC 1WXVA 3HHMA 2JU6X 2N7DA 1UD7A 1TKGA 5T8IA 4DXGA 1SGHA 1ZXHA 1YQ3B 1F1HA 3DCGA 3NZ3A 4BKSA 1TS2A 1D4BA 2V9HA 2DX5B 3QK0A 1FRDA 1YIWA 2MWSB 1K8RB 2D3CA 4AS1A 2O6VD 3ENEA 2ZPYA 3ZTCA 1GNUA 3NVZA 1I4PA 2IO0B 2J42A 4RMAA 1H8CA 2R2OA 3GOEA 3NVVA 2M1MA 4M01A 2XBBC 2EELA 2YVCA 4HLEA 3SD5A 5H8YE 2KOXA 3VTWA 5TSSA 2QHOA 3TCAA 4P1BC 5EDSA 4GSWA 4FULA 2WXNA 2MQJA 4MGYE 3T3OA 3KYDD 2CS4A 1FRRA 3IXSA 4MH8A 1EU3A 3I63C 2M17A 2L32A 1MFWA 2JXXA 1L7YA 4MEMA 3JYUA 4IKGA 1SE9A 1YOVB 2MBHA 4WWOA 3MHSD 3HM6X 4MJSB 2PEAA 5LLIA 1J8CA 4YL8A 1F9JA 1UWMA 4YTPB 1WGRA 4NZLB 4IWPA 5JH5C 1TTNA 2CJNA 1KLUD 3Q8AA 2BPSA 1NEKB 4B95A 1C9FA 1HQRD 1V5OA 1FNWA 1WSPA 2D2QA 4EOYA 1WIAA 3A9JA 4HEA1 5BYSA 2MP2B 4NJ6A 3VRBB 2DAFA 3H1UA 2D5GA 3SEBA 1L4ZB 5H92C 3ALBA 1R4MB 1NENB 2HJ1A 1JWUD 3AE2B 1J7CA 2BVCA 1NI2A 2FCQA 2FCNA 1CQVA 1TYGB 3HVDA 3ECIA 2ZVOA 3V61A 1E8XA 3PRZA 1OGWA 2N4FA 3DBLI 2MJDA 3M63B 2LGXA 2MSED 5C2TB 2V0GA 5AEKB 3VHTC 2WXMA 2SEBD 3ZNZB 5LXHA 2KXJA 4IOIE 4DK5A 3R2IA 3C8YA 3L16A 2KTFA 4DBGA 1MJDA 4ZRKA 2BTEA 2GMIC 5DCNA 5D6JB 4ANXA
chains in the Genus database with same CATH topology
1F77A 3AEBB 4B0EA 5JXVA 1HZ5A 2BS2B 1V8CA 3R8BA 1DYQA 4AQ7A 1OQQA 2XN9C 2E3TA 3ETRA 4TSSA 1KRHA 4RGMA 1FMAD 2QJLA 4B0MA 1YN3A 2GB1A 4Q2JA 1OFFA 4OZBA 1E0ZA 4A90A 3RFZB 1C78A 1EWCA 5HHDG 1RWSA 2BB5A 1HA5A 2WXOA 1PDXA 4JPSA 4ARCA 3KQ4A 3AE7B 3AECB 5I4DA 1AW7A 3LXFA 3MFGA 1FNVA 3Q69A 3BZDB 2Z8LA 4L1BA 2AQ3B 5BMHA 1IGDA 2R61A 3SFEB 2PVOD 1QOBA 1BUIC 2WNMA 2K22A 3AV8A 3P4PB 3MP9A 1HXYD 1BXTA 1JW9D 2B76B 2Y5PA 2KMMA 2AQ2B 3R2TA 1SE3A 2DWQA 4OZAA 1I4XA 5C3JB 2KDMA 4C56C 1E7PB 4N6EB 2LGIA 1TS3A 1ZDXA 1KH0A 4YXDB 2HTME 2SAKA 3LB8C 1C4PA 3AE4B 1V1PA 1YQ4B 1NYRA 1VZ6A 1DOIA 1PGXA 4TQ1A 2XNAC 5BYQA 4USAA 1IUEA 1XXGA 1JQ4A 4YSXB 3BWUD 1J7AA 1YJJA 2X38A 3P63A 1QQRA 2FUG1 3PZ8A 2GRIA 2DYOA 3ZJUA 3EGRA 3AE6B 1FD6A 3BVZA 3TEWA 2INPE 1C79A 3B9JA 4MT5A 3I57A 3KLSX 3NRZA 3P42A 1N63A 4ITKA 4YT0B 2MJ3A 1R7SA 1OQRA 3TEYA 4CQNA 2Q5WD 3AE1B 2DYMA 3AB5A 2FBWB 5D3IB 5BMGA 1SE2A 2WXRA 3P4SB 3AEEB 1D5XC 1TY0A 2TSSA 1F2RI 4A6QA 3U2SC 4JWUC 4WAFA 1AWDA 2WLBA 4MM3B 3U7ZA 2KWDA 2JQRB 5FR3A 2AQ1B 1I4QA 5EE3A 2M19A 4HKZE 4YSYB 4TMAB 3NS1A 4RFBA 3AE5B 3AEDB 1JWAD 2L1AA 1E6EB 3HRDD 2Y3AA 2J53A 1SJED 3BVGA 3ZJVA 2WXKA 1JWBD 4OHJA 1VR9A 2LHDA 2QEJC 1B9RA 3FILB 4LTUA 3Q8CA 2Y5CA 2V3PA 2NMQA 2W54A 1SB3C 3LYYA 3SFDB 2W55A 2N7JA 2WP9B 1SSNA 4GDLB 2INNE 2PW9A 3GB1A 3B2GA 2G9HD 2WXGA 4HROA 3DWMA 1VLBA 1K50A 1I4HA 3BIID 1EU4A 3IT6B 5HFYA 3AE3B 2VZKD 1WWTA 2IGHA 1PFDA 1DGJA 3AEFB 4P6VF 5GXGB 1XCQL 2WU2B 1JWMD 3UI3A 1FFUA 1D6EC 2IJ0A 1EWYC 1YMHE 2ZW1A 1FCCC 3IAS1 1Q10A 4LLGM 4TQ0A 4C7YA 3VR9B 4OW0A 1SBBB 4A8XC 2HDEA 2BT6A 4N59A 3L4PA 4L23A 4HJGE 3TEXA 2JYEA 5D7GA 1HEZE 4A55A 1MI0A 1IGCA 1KLGD 3AEGB 3FILA 4NJCA 4RGTA 4KGTA 1XO3A 3W5UB 2YEPF 3P4RB 5AUIA 1VDVA 4KKJA 4O1NA 4ZYSA 4YSZB 1MHXA 3SR6A 2W3RA 1IBXB 1JWSD 1KTKA 2N9LA 4D2KA 1RYJA 1A70A 1P7FA 3W5VB 1L5PA 1FIQA 1N5XA 2BW2A 5AUKA 3ZJTA 3AN1A 5EE0A 1UGJA 4RGOS 3TEZA 2RMMA 2BB6A 4ZOHC 2WXFA 4ZRQA 1EM7A 4ZHOA 1VZ7A 3CWIA 2NTSA 2JYTA 5E6JA 3ABVB 1MVKA 5LNK1 4WIPA 1F2RC 2K5PA 4ARIA 2L83A 1ENFA 2PLPA 3E56A 2OEDA 3TSSA 4XDCA 2N9KA 1K51A 1GB1A 3AMZA 1QILA 3P1MA 4EE2A 2WXHA 1GOZA 3FAHA 1JROA 2WDVB 1RFKA 1SF0A 4N58A 1XLOA 3ZQ4A 1TS4A 2WXLA 2H88B 4YTNB 2MJEA 1SE4A 3VR8B 3OWEB 1WYGA 1PYWD 4C7ZA 1L0VB 1FO4A 4A9AA 2IGGA 2KACA 3VRAB 1J7BA 3BK2A 1MPEA 3NVWA 4UDUC 2CJOA 1E10A 1ZDVA 3E9SA 4JX1C 4KGRA 1XF5L 3BVMA 2WS3B 3AE8B 2I38A 5BMIA 4IDIA 4MACA 1NVID 1NYQA 2WDRB 4KGSA 2PTLA 2DLBA 4KX6B 4C80A 3P4QB 1C77A 2LUMA 2WXJA 2RPVA 3AH7A 4XWTA 1TJEA 3FC4A 5EE9A 2PVGC 1XCTL 3KWLA 2PKOA 1N62A 2JU6X 1VJKA 4DXFA 4L2YA 1TKGA 1D5MC 3V05A 1V1PB 2QMTA 3WCQA 5T8IA 1UUPA 2LJIA 4DXGA 1K53A 1WXQA 1V97A 2DBYA 1ZXHA 1I4RA 1TKEA 1JMLA 1VZ8A 1KF6B 1YQ3B 1ET6A 3ZGZA 1L0YB 3NZ3A 2M0AA 1TS2A 2H89B 3BYTB 1D4BA 2OHFA 3U4EG 2IGDA 1FRDA 1ZP0B 1IBXA 1WRIA 1L0XB 4AS1A 1P7EA 2LEKA 3O13A 1ACCA 1ZUD2 4R3DA 5G5GA 1N61A 2W82A 1TS5A 1N60A 3MC0B 3NVZA 1I4PA 2J42A 3HVZA 4GDKB 3ZYYX 2WXPA 3TUOA 2QILA 4RF1A 3NVVA 3RPFC 4JE3B 3VQIA 2LFIA 3URYA 1B1ZA 1FEHA 1GB4A 2M56B 1TKYA 1VRAB 1JALA 2QIEB 2EELA 2WU5B 3U52E 2LMCA 4M0WA 5H8YE 1YN4A 5MPOA 5TSSA 2BYTA 2ICIA 1PUTA 3I9V1 2E6XA 1XEEA 1XLNA 2KQ4X 3NUHB 1SJHD 2WXNA 3T3OA 5HI1A 1JCKB 1FRRA 3IXSA 4MH8A 2I2YA 1UWXA 1QOFA 1EU3A 1LO5D 3NVYA 4PT5A 2L32A 3W2DA 3DWGC 4KKIA 4IKGA 2BS4B 1QF6A 1FCLA 1QT9A 1MHHE 4P16A 1I4GA 2JWUA 2WDQB 3T3NA 3AEAB 1FFVA 4WH4A 4REZA 4XWWA 2K3UA 2K9XA 2PMVA 1PGBA 4ZRPA 3GP7A 4YTMB 2CU3A 2ACZB 2JSVX 3Q8BA 4NAMA 1ESFA 1GAQB 3J9CA 1UWMA 1K52A 2IDYA 4YTPB 4NZLB 4H2AA 1JRPA 3IT4B 2PIAA 3AM9A 1TY2A 2CJNA 5HG2A 4RH6A 4WURA 1ET9A 2MEKA 1KLUD 2ONQA 5FKAC 3Q8AA 4FXCA 3V3XA 1SEBD 1NEKB 1C9FA 1HQRD 1RM6C 1WGKA 1FNWA 1WSPA 1L4DB 1N5WA 4US9A 2WXQA 4NAWB 3HUIA 1AN8A 4RNAA 1T5XD 4LK0M 2ON8A 1ZOYB 4XE0A 1BMLC 4US8A 4OZCA 4HEA1 5EE1A 5BYSA 3CIRB 1V1OA 2V3NA 3EUB2 4XDDA 3MHZA 1SIJA 3W9CB 2WQYB 1ZE3D 3GS2A 3VRBB 2QSDA 1TZOA 1C4CA 4RF0A 2D5GA 1T3QA 1DOYA 3KWVA 3SEBA 1L4ZB 2V4IB 5H92C 2YEPB 2GI9A 1E9MA 2N0SB 1NENB 1JWUD 1PGAA 3AE2B 1DOXA 1KFYB 1CZPA 2BS3B 1HZ6A 2KAJA 1J7CA 2BBCA 2MH7A 4HRSA 4JWSC 2JX5A 3B2FA 5BYRA 1FM0D 2EKIA 2J4XA 1FNUA 2IPKD 3N9YC 1ZXIA 1STEA 3PZ7A 1CQVA 2RDGA 5G5HA 1TYGB 4WQMA 3HVDA 3PO0A 5D3DA 1L6VA 2W3SA 2J52A 4YWGG 1QOGA 3EA6A 4DQOC 2L52A 2LHEA 2NTTA 2FE8A 1AYFA 1FXIA 1YJIA 2JXTA 3Q8FA 3BK1A 1QOAA 1Y56A 1L6UA 1XLPA 1ROEA 2MJDA 3H8HA 3MJ5A 2AX5A 1CJEA 5C2TB 1D5ZC 1C4AA 2V0GA 1GPXA 3Q8EA 2WXMA 1QKZA 2SEBD 1F0ZA 5FK9C 1SXTA 3BYYB 1QLBB 1ZPSA 1NI3A 2JZPA 1C76A 2RDHA 2VZKB 4IOIE 2G1EA 1CK1A 1XLQA 3IAM1 1YN5A 3R2IA 1FXAA 3C8YA 4ZHPA 2WXIA 4RCOA 2KN4A 2BTEA 4OVZA 2ZW0A 3W1SA 4WWMA 1M4VA 4HKQA 4GLSC 1T6BX 3AE9B 1UNSA 1I7HA 4RGNA 1YNTE 2K0PA 4J3OD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I57 A;  3Q69 A;  3LYY A;  4MT5 A;  2LFI A;  3NZ3 A; 
#chains in the Genus database with same CATH topology
 1DYQ A;  1OQQ A;  2E3T A;  3IG3 A;  3ETR A;  5AZG A;  3H9D A;  4RGM A;  5C23 A;  2QJL A;  1YN3 A;  2GB1 A;  4Q2J A;  3RNB C;  3UF8 A;  3TJP A;  3MC9 A;  1EWC A;  5AZF A;  2BB5 A;  1HA5 A;  4ZRI A;  2WXO A;  1PDX A;  4PS3 A;  2KJR A;  2KVZ A;  4ARC A;  3KQ4 A;  1EUV B;  4LNK A;  1FNV A;  3BZD B;  2Z8L A;  2ZPN A;  3WAL A;  5BMH A;  4MGZ E;  2R61 A;  4W9J A;  2IY0 B;  3MP9 A;  3ZRC A;  1HXY D;  4AP4 C;  3NZU A;  2Y5P A;  3VUW A;  2AQ2 B;  2DWQ A;  4MM3 A;  4PK1 A;  2PPH A;  3N1X C;  3OAW A;  1V1P A;  3V62 A;  4USA A;  3S2A A;  1IUE A;  1XXG A;  1JQ4 A;  3BWU D;  4KIK A;  1QQR A;  1WJ4 A;  1P9D U;  1WGY A;  4WJQ A;  3ZJU A;  1J19 A;  5DPS A;  3AE6 B;  1FD6 A;  4XYC A;  4LNO A;  3VFK A;  3I57 A;  3N1Z C;  3NRZ A;  3P42 A;  1N63 A;  4YT0 B;  3ZO5 B;  1R7S A;  2LRU A;  3WAP A;  2LWP A;  3SHQ A;  2DEN B;  2N1V A;  1E5W A;  1UGM A;  2KLC A;  3AB5 A;  3APC A;  3MJW A;  2TSS A;  4JWU C;  4I6P A;  4WAF A;  3U7Z A;  2D07 B;  2M19 A;  4HWI B;  4YSY B;  4IM3 A;  3NS1 A;  3FKY A;  1GC6 A;  4W9E A;  1SJE D;  1YD8 U;  3ZJV A;  2FIF A;  1JWB D;  2WXK A;  1VR9 A;  2LHD A;  3H7P A;  1B9R A;  2VH1 A;  3OJ3 A;  3L54 A;  2BKF A;  2W54 A;  5FR6 A;  3K9P B;  2WP9 B;  3GZN B;  4IM2 A;  3WAO A;  1UBQ A;  3VXW A;  2WXG A;  3Q6B A;  1VLB A;  4GU2 A;  1EU4 A;  5CHV C;  3AE3 B;  3CMM B;  1WWT A;  5G2N A;  2NBV B;  1Q5W B;  3UI3 A;  2MRP A;  1FFU A;  4FJV B;  2UU7 A;  2AWT A;  4C4V A;  1FCC C;  3RN9 C;  4KV2 A;  3EC8 A;  2C7H A;  2BT6 A;  4N59 A;  3L4P A;  4L23 A;  5J17 A;  4A55 A;  4GDK A;  3ML9 A;  1OEY A;  4GB9 A;  1XO3 A;  3R7R A;  5AUI A;  5CHW A;  4YSZ B;  2KN5 A;  3SR6 A;  1IBX B;  3P2B A;  2JY6 A;  3L10 B;  4A20 A;  2ZCB A;  1RFA A;  5AUK A;  3ZJT A;  3UQA A;  2K8H A;  5EE0 A;  4EUT A;  3N30 A;  3B1L X;  2WXF A;  1EM7 A;  4ZHO A;  3Q3O C;  5D2M B;  5E6O A;  2D3G A;  4WIP A;  4W9G A;  3DBR B;  3VUX A;  2L83 A;  3AI5 A;  1WMH A;  2PLP A;  2CKH B;  2OED A;  2N9K A;  4P1C C;  2LGS A;  3AMZ A;  4EE2 A;  1GOZ A;  3KYC D;  1RFK A;  1TBE A;  2G45 B;  1TS4 A;  2H88 B;  2LVQ A;  3DDC B;  3SU8 X;  3VR8 B;  4C7Z A;  1PYW D;  3HM3 A;  4I6L B;  2KAC A;  1RAX A;  3BK2 A;  2CJO A;  1ZDV A;  2NCN A;  3E9S A;  2MX2 A;  3U8Z A;  1XF5 L;  4EKU A;  2GBR A;  5KHO A;  1T0S C;  1NVI D;  1NYQ A;  2N9E B;  3L08 A;  3AH7 A;  5EE9 A;  3KUZ A;  3KWL A;  2PKO A;  1N62 A;  2QCZ A;  4L2Y A;  1D5M C;  1WZ3 A;  1V1P B;  2QMT A;  1UUP A;  1C1Y B;  1WXQ A;  2MHJ A;  1I4R A;  1KF6 B;  3ZGZ A;  1ET6 A;  2M0A A;  3BYT B;  3VTV A;  2OHF A;  3U4E G;  2QDF A;  2IGD A;  2IZV B;  3PRM B;  2PE6 B;  4CO7 A;  1Q0W B;  1P7E A;  2LEK A;  4R3D A;  1ACC A;  1ZUD 2;  2MBO A;  3WAM A;  5JHB A;  3ZYY X;  4RF1 A;  1ZGU B;  2L7R A;  1B1Z A;  1FEH A;  4M02 A;  2M56 B;  2JZ3 B;  1TKY A;  1VRA B;  3QA8 A;  2BYF A;  4OVV A;  2GBK A;  1X1M A;  1YN4 A;  3ZTD A;  4XC2 A;  2ICI A;  1PUT A;  3I9V 1;  4FA6 A;  5J2R A;  4M00 A;  3WIM A;  5HI1 A;  2LZ6 A;  1UWX A;  5D94 A;  4PT5 A;  1V49 A;  2BS4 B;  1Y8R C;  4LNF A;  1QT9 A;  4CHK A;  4EEW A;  2KWU B;  2DHZ A;  1FFV A;  4K3B A;  2MLB A;  4KDL B;  4HCP B;  2KAN A;  2PMV A;  2CU3 A;  2ACZ B;  2JSV X;  3Q8B A;  4NAM A;  3NY5 A;  1ESF A;  1LGR A;  2Y5B B;  3RMK C;  4DWF A;  4H2A A;  1WE7 A;  1TY2 A;  2KWV B;  2O2V B;  2ONQ A;  1YX5 B;  3RYT A;  1RM6 C;  3OLM D;  2C7M B;  2WXQ A;  2GLS A;  1WXS A;  3VAW A;  2DZJ A;  4OZC A;  4TUU A;  3CIR B;  1CMX B;  2L05 A;  1J0G A;  3DOW A;  3W9C B;  1ZE3 D;  3GS2 A;  2D11 A;  1SIF A;  3QCA A;  1D3Z A;  1T3Q A;  1DOY A;  4DHJ B;  2D3B A;  3DBL B;  3DBH I;  1YJ1 A;  4PYU A;  1PGA A;  4LJO B;  1DOX A;  2BS3 B;  1S1Q B;  3EHV A;  2RDB C;  4HRS A;  1WX8 A;  2IO1 B;  1FNU A;  2ZNV C;  3N9Y C;  1ZXI A;  5BO4 B;  4WQM A;  3A9J B;  3A1Q A;  1L6V A;  2M8S A;  4YWG G;  3SDL C;  4M8M A;  4G3X B;  4NY0 A;  3VVW B;  2DYB A;  2ZZP B;  2NTT A;  2JXT A;  2K8B A;  5IA7 A;  4HVB A;  1QOA A;  2A5U A;  1XLP A;  3DVN U;  3H8H A;  1E7U A;  2AX5 A;  1D5Z C;  1C4A A;  3Q8E A;  1QKZ A;  1OQY A;  5FK9 C;  5L83 A;  1E8Z A;  1NI3 A;  4MJS A;  5DPW A;  2RDH A;  4GOC A;  1XLQ A;  3IAM 1;  1YN5 A;  4HK2 A;  3NG0 A;  2HE7 A;  1E8W A;  2ZW0 A;  3ZRF A;  4WWM A;  4GLS C;  3PVL A;  1UNS A;  1I7H A;  4KSK C;  2KMC A;  2K0P A;  1F77 A;  3V60 A;  1HZ5 A;  2BS2 B;  1V8C A;  4LJP B;  3H6N A;  3PS6 A;  4AJY B;  4B0M A;  2LVP A;  2ZCC A;  2GBM A;  4MH0 E;  4OZB A;  4A90 A;  4EZL A;  2ZNV B;  3BIN A;  2GOW A;  4K7W A;  3M3J A;  3PGE A;  4JPS A;  3DHG C;  2VH2 A;  3H7P B;  3MFG A;  2BWE S;  1GJZ A;  2PVO D;  1QOB A;  1BUI C;  2OJW A;  2WNM A;  2K22 A;  3NHE B;  2KO3 A;  3KW5 B;  1SE3 A;  3TBL D;  3A4S C;  2DZK A;  3ZKJ C;  1I4X A;  5C3J B;  2KDM A;  2J7Q B;  1TS3 A;  3R3M A;  1KOT A;  2HTM E;  2EMT A;  5C1Z A;  4G50 A;  2WX1 A;  1UBI A;  1VZ6 A;  1PGX A;  4TQ1 A;  5BYQ A;  2IO2 B;  3Q3N C;  2X38 A;  2JUO A;  2BWF A;  2FUG 1;  3PZ8 A;  2GRI A;  2V1Y A;  3PLU A;  3EGR A;  2WHI A;  3BVZ A;  3TEW A;  4BFR A;  3DHH C;  4KZC A;  4C00 A;  3ZIM A;  2RR9 A;  1TZ1 A;  2C9W B;  1OQR A;  1WI0 A;  4FBJ B;  1Z5S B;  4HDO A;  4CQN A;  1HTQ A;  3AE1 B;  2DYM A;  3Q3F A;  3T8M A;  2FBW B;  5BMG A;  1D5X C;  3M62 B;  1F2R I;  4A6Q A;  3KH0 A;  2JQR B;  3PZD A;  3MC8 A;  1WX7 A;  2AQ1 B;  2WYQ A;  4DDG D;  1I35 A;  2IO3 B;  4JLC A;  1A5R A;  3AE5 B;  1JWA D;  2Y3A A;  2J53 A;  3BVG A;  2C60 A;  1LFD A;  1E7V A;  2LJ5 A;  4LTU A;  4W9K A;  1V81 A;  4WWN A;  1SB3 C;  2W55 A;  3R7Q A;  4PS7 A;  2N7J A;  3RNA C;  2INN E;  1XD3 B;  4ANU A;  2O6V B;  3B2G A;  2BYE A;  3DWM A;  2MCN B;  1WGH A;  1K50 A;  2K1F A;  4BOZ B;  5JZE B;  1WE6 A;  2VZK D;  1PFD A;  2LXC A;  3ZVV A;  4M0W B;  2IJ0 A;  2LUE A;  2NBW B;  4HCN B;  1ISN A;  3WA0 A;  3IBE A;  1Q10 A;  4S0R A;  3K9O B;  3ZDT A;  1V6E A;  2KT7 A;  4OW0 A;  2HDE A;  2JYE A;  5D7G A;  1AAR A;  1MI0 A;  1V5T A;  4II3 B;  4XX5 A;  3UIP B;  5IKC M;  3W5U B;  2NPT A;  1VDV A;  4KKJ A;  4O1N A;  2QC8 A;  5JHA A;  1WR6 E;  4EZK A;  1R4N I;  2KNB A;  2W3R A;  3ONS A;  1WJN A;  1RYJ A;  3W5V B;  1L5P A;  2BW2 A;  3H7S A;  2PJH A;  3DBH B;  2RMM A;  4LNI A;  1VZ7 A;  3CWI A;  3PLV A;  2NTS A;  2JYT A;  3WAN A;  5IO9 A;  1MVK A;  4NQK E;  1KJT A;  3L17 A;  2D3A A;  2K8C A;  5IAA C;  3EEC A;  2MBQ A;  1P0R A;  4W9F A;  1F52 A;  1GB1 A;  2KZR A;  4N58 A;  4W9I A;  2WXL A;  4BKT A;  1VD2 A;  1WFY A;  2NBU A;  4B9K A;  2IGG A;  1MPE A;  4UDU C;  4M8N A;  1E10 A;  4AWJ A;  2I38 A;  5BMI A;  2UWQ A;  2IYD B;  3RZF A;  1TGZ B;  2KFJ A;  3RZW C;  2DLB A;  4KX6 B;  2K39 A;  4XWT A;  2BGF A;  3FC4 A;  4A3P A;  1XCT L;  1WXA A;  3A9K A;  1VJK A;  4DXF A;  3Q2A C;  3V05 A;  3MTN B;  4BZA A;  5L95 C;  4MDK E;  2Z0D B;  1TKE A;  1JML A;  1L0Y B;  3KVF B;  4NNJ B;  2H89 B;  3ML8 A;  4GGQ A;  1T0Q C;  2A4Z A;  2LVO A;  2MA9 B;  5G5G A;  1N61 A;  2W82 A;  3CSF A;  1TS5 A;  1N60 A;  1YX6 B;  2FUH B;  3O65 B;  2K6D B;  3HVZ A;  2IY1 B;  2FCS A;  2QIL A;  3RPF C;  4G11 A;  2KK8 A;  3ZXV A;  4JE3 B;  3URY A;  2KTR B;  1GB4 A;  1OEY J;  4N9F 4;  1JAL A;  2QIE B;  2WU5 B;  3U52 E;  1HTO A;  2LMC A;  4M0W A;  2AL3 A;  1U4A A;  5J18 A;  2BYT A;  1XLN A;  3NUH B;  1SJH D;  4FLH A;  4RM9 A;  3CST A;  3TIX A;  2I2Y A;  1QOF A;  4GIV A;  2I1K A;  2J0J A;  1QF6 A;  3AUL A;  4BAX A;  1MHH E;  4P16 A;  1I4G A;  2JWU A;  2WDQ B;  2LAS A;  3PTF C;  4WH4 A;  2VRR B;  2K3U A;  3DPD A;  4YTM B;  1GAQ B;  2NS5 A;  1K52 A;  2IDY A;  1EO6 A;  3IT4 B;  2PIA A;  3AM9 A;  5HG2 A;  4RH6 A;  4WUR A;  1ET9 A;  5FKA C;  2KD0 A;  4FXC A;  1WGK A;  4W9D A;  4ANV A;  1N5W A;  2FNJ B;  4NQL B;  4HJK A;  4RNA A;  1XT9 B;  1T5X D;  1KLV A;  3DBR I;  2ON8 A;  1ZOY B;  1BML C;  2J0M A;  3QC8 B;  4XDD A;  3EUB 2;  2GBJ A;  2CHZ A;  3IHP C;  1TZO A;  1C4C A;  3KWV A;  2YEP B;  2GI9 A;  1M94 A;  1E9M A;  4KVG B;  1KFY B;  1HZ6 A;  2BBC A;  4EZJ A;  2G4S A;  4JWS C;  5BYR A;  4FJZ A;  1HE8 A;  2IPK D;  1STE A;  3PZ7 A;  2RDG A;  2HTH A;  2MBE A;  2XEW A;  1QOG A;  3JSV B;  4II2 B;  3EA6 A;  2INC C;  2L52 A;  1KM7 A;  1AYF A;  2FE8 A;  1IPG A;  1GG3 A;  1WYW B;  1ROE A;  2KWC A;  4DHZ E;  2CR5 A;  3I3T B;  4E74 A;  2KDB A;  1GPX A;  4WWP A;  2DAJ A;  1SXT A;  2RGF A;  3AU5 A;  2JZP A;  1C76 A;  1G6J A;  1CK1 A;  3QHT A;  2HJ8 A;  1FXA A;  4ZHP A;  4OVZ A;  3W1S A;  4HKQ A;  3GZN I;  1T6B X;  3CF6 E;  4A3O A;  4WJN A;  4J3O D;  1H4R A;  3UQB A;  4AQ7 A;  1WR1 A;  1GUA B;  1KRH A;  2CU1 A;  2IBI B;  1FMA D;  3NZS A;  2M0X A;  1TIF A;  3ZXR A;  3M95 A;  5DPR A;  1WZ0 A;  3LDZ E;  1C78 A;  2IND C;  5HHD G;  3RNE C;  3AU4 A;  3DHI C;  3AE7 B;  4HDQ A;  5I4D A;  1AW7 A;  3I5J C;  3LXF A;  3A9K B;  4TKN A;  4ACF A;  1IGD A;  2L76 A;  2KQS A;  2HD5 B;  3PSE B;  1S3S G;  3C19 A;  4IG7 B;  2KLG A;  2KMA A;  2WDT B;  2B76 B;  2W9N A;  3R2T A;  4OZA A;  3APF A;  2DNF A;  3JSV A;  4N6E B;  2KC2 A;  2LGI A;  2Z0E B;  1KH0 A;  4YXD B;  2SAK A;  3AE4 B;  1TT5 B;  4B6W A;  1YQ4 B;  4GN1 A;  2XNA C;  4E3C A;  4MSQ B;  4YSX B;  1YJJ A;  2OOB B;  1WGG A;  3P63 A;  3W1S C;  2ASQ A;  4URK A;  2BF8 B;  4GXB A;  3RD2 A;  1C79 A;  4K3C A;  1E8Y A;  2KJ6 A;  4BOS C;  4KIK B;  2V3S A;  4ITK A;  4K7S A;  4BVU C;  4XZ4 A;  5D3I B;  1SE2 A;  2WXR A;  3P4S B;  1TY0 A;  3U2S C;  4DXA B;  1AWD A;  2WLB A;  3N20 C;  4MM3 B;  1I42 A;  4JL9 A;  3R66 C;  1VCB A;  1WJU A;  4BBN C;  1I4Q A;  2L3Z A;  1V86 A;  4HKZ E;  4LDT B;  4IWO A;  2G3Q B;  4TMA B;  4RFB A;  3AED B;  2L1A A;  3HRD D;  2C7N B;  4RM8 A;  3QJZ A;  2QEJ C;  3FIL B;  2XK5 A;  3Q8C A;  2Y5C A;  1UH6 A;  2NMQ A;  3LYY A;  1Z2M A;  4GDL B;  3QWZ B;  4K81 A;  1OTR B;  2V4L A;  1EF1 A;  3ZNI D;  2RD0 A;  3IT6 B;  3QQ8 B;  4X57 B;  5HFY A;  4P7I A;  4JQW C;  4IC7 B;  2IGH A;  4P6V F;  5GXG B;  4K7U A;  1D6E C;  4JIO U;  1EWY C;  2JRI B;  2O6V A;  2KDE B;  1SBB B;  3U7D A;  3TEX A;  4A8X C;  1WY8 A;  4ZRJ A;  1HEZ E;  1IGC A;  1T0R C;  3FIL A;  3X23 A;  4WJP A;  4KGT A;  5KHQ A;  2YEP F;  4QAY A;  4ZYS A;  1JWS D;  2L0F A;  3U30 A;  4D2K A;  3KUC B;  1P7F A;  1FIQ A;  1N5X A;  2KJH B;  1UGJ A;  2BB6 A;  4XGA B;  4ZOH C;  4ZRQ A;  2N9X A;  3KUD B;  2FCM A;  3NOB A;  5E6J A;  4ICU A;  5LNK 1;  2K5P A;  5HKH A;  2ZEQ A;  3VH4 B;  3RNG C;  3PRE A;  3IFW B;  1K51 A;  4WAA A;  1LQB A;  2WDV B;  5IN7 A;  1SF0 A;  2KYW A;  3Q3J A;  3ZQ4 A;  2AYO B;  4YTN B;  2MP2 A;  4NJ7 A;  1SE4 A;  2MBB B;  5E6N A;  3OWE B;  2G4D B;  1FO4 A;  1L0V B;  4A9A A;  1WRD B;  2WGS A;  1WF9 A;  4MGI E;  1ZKH A;  4NAW A;  3VRA B;  4FHK A;  3EFU A;  2N1W A;  4EFO A;  4LCD E;  3AE8 B;  1UZX B;  4DHJ D;  2M4N A;  4IDI A;  5G55 A;  2WDR B;  4KGS A;  4HPP A;  4C80 A;  4JGH B;  3P4Q B;  1C77 A;  2LUM A;  5LXI B;  2PVG C;  4BKS D;  3HIZ A;  1V2Y A;  2RPQ A;  1IYF A;  4W9H A;  1WJ6 A;  2B3A A;  3WCQ A;  3DVN V;  3VH3 B;  2LJI A;  2KKC A;  1K53 A;  1V97 A;  2DBY A;  4LNN A;  1T0Y A;  1VZ8 A;  2KX0 A;  4BBN F;  3PT2 B;  1ZP0 B;  1IBX A;  1WRI A;  1L0X B;  4TV3 A;  1BT0 A;  2NPT B;  3O13 A;  4FAD A;  3MC0 B;  1LM8 B;  2LXA A;  4GDK B;  5GMV A;  2WXP A;  3TUO A;  2KHW B;  4AJW A;  3VQI A;  4HPL B;  2LFI A;  1Q1O A;  1MG4 A;  4C4V B;  2JWZ A;  4LDT D;  4ICV A;  5MPO A;  1MG8 A;  2D10 A;  1WXM A;  3EFC A;  4IW0 A;  1XEE A;  2E6X A;  2KQ4 X;  3B08 A;  3VDZ A;  5IP4 D;  1JCK B;  3N3K B;  1LO5 D;  3ZUN A;  3NVY A;  4G0N B;  3W2D A;  3DVG X;  3DWG C;  4GMV A;  4KKI A;  5CTR C;  3ZDM C;  3A1Q B;  1FCL A;  3BY4 B;  2N9P C;  3T3N A;  3AEA B;  4REZ A;  4XWW A;  1WM2 A;  2K9X A;  1PGB A;  4ZRP A;  3GP7 A;  2LI5 A;  3J9C A;  4DHZ B;  3JW0 X;  4HXD A;  2L0T A;  3RNF C;  1JRP A;  4F7Z A;  4S17 A;  2UYZ B;  4W9C A;  2MEK A;  3L13 A;  3V3X A;  1SEB D;  1ZW7 A;  1L4D B;  4US9 A;  4NAW B;  3HUI A;  1AN8 A;  4LK0 M;  4XE0 A;  3PHX B;  3TL5 A;  4US8 A;  1P98 A;  5EE1 A;  1V1O A;  2V3N A;  3MHZ A;  1SIJ A;  2WQY B;  3ZNH B;  2QSD A;  4RF0 A;  3N1Y C;  2X8X X;  2O2V A;  4K1R B;  2V4I B;  3T9L A;  2N0S B;  1CZP A;  2KAJ A;  2MH7 A;  2JX5 A;  3B2F A;  1FM0 D;  2EKI A;  2J4X A;  4DDI D;  4IUM B;  5G5H A;  3RNC C;  3APD A;  3PO0 A;  5D3D A;  2W3S A;  2J52 A;  4MGK E;  4DQO C;  2LHE A;  1FXI A;  1YJI A;  3Q8F A;  3BK1 A;  1Y56 A;  1L6U A;  3L0W B;  4AOF A;  3LJ3 A;  3MJ5 A;  2BYV E;  2ZVN A;  1CJE A;  3N32 A;  2KQ7 A;  3Q3M C;  5DPT A;  1IP9 A;  1F0Z A;  3RUI B;  2PE9 A;  4BKG A;  2JPH A;  1QLB B;  2KTR A;  3BYY B;  1ZPS A;  2KX3 A;  2G1E A;  1C3T A;  1YQB A;  3ZW3 A;  2WXI A;  5AZH A;  4RCO A;  3QX1 A;  2KN4 A;  4FN2 A;  3GE3 C;  3ZLZ A;  4MSM B;  1M4V A;  1N6Z A;  3AE9 B;  1XQQ A;  4RGN A;  4W9L A;  2K6Q A;  2LGD A;  2VZK B;  1YNT E;  1UF0 A;  3AEB B;  3QAQ A;  4B0E A;  5JXV A;  2JRH A;  1WGD A;  3OG5 A;  3R8B A;  3X0W A;  2XN9 C;  4TSS A;  4PYZ A;  3A33 B;  1OFF A;  1E0Z A;  4HPM B;  4GDL A;  3RI7 C;  1FXT B;  3RFZ B;  1RWS A;  1WM3 A;  2KFK A;  3AEC B;  2XK5 B;  3GE8 C;  3HK0 A;  2REX A;  3Q69 A;  2KC1 A;  4L1B A;  4F1S A;  2AQ3 B;  2CHX A;  2NVU I;  4KDI C;  3SFE B;  2L00 B;  4I6N B;  3AV8 A;  2LGY A;  3P4P B;  3UIO B;  1E90 A;  2EMS A;  4E71 A;  1BXT A;  1JW9 D;  4IWQ A;  2KMM A;  1WX9 A;  5CHF A;  2WX0 A;  4J6I A;  4C56 C;  1E7P B;  1JRU A;  5CX3 A;  1P1A A;  3TMP B;  1ZDX A;  3PHW B;  3LB8 C;  1C4P A;  2MW5 A;  1NYR A;  1DOI A;  3IVF A;  1J7A A;  2DYO A;  2EKE C;  2FID A;  2INP E;  3B9J A;  2OJR A;  4MT5 A;  3V6C B;  2N7E A;  3KLS X;  2ZJD A;  3PV1 A;  2MJ3 A;  2JZZ A;  5E6P A;  3TEY A;  3NS8 A;  1L2N A;  2LD9 A;  2Q5W D;  2KDI A;  4KZ0 A;  3AEE B;  2AL6 A;  3AXC A;  1LXD A;  2KWD A;  4AUQ C;  5FR3 A;  1R4M I;  3UGB B;  5EE3 A;  3NJT A;  3RT3 B;  2KDF B;  3PRP B;  4FJY A;  2JT4 B;  1E6E B;  3DQV A;  3OJ4 B;  4WJO A;  4OHJ A;  3A4R A;  4MEL A;  2KFK B;  2JVC A;  2K25 A;  1NBF C;  2V3P A;  3DVG Y;  3UIN B;  2KVR A;  3SFD B;  1V80 A;  3VUY A;  4NPN A;  1SSN A;  1PQS A;  2PW9 A;  3GB1 A;  2G9H D;  4HRO A;  4ANW A;  5TR5 A;  1I4H A;  3BII D;  2RSU A;  1DGJ A;  3AEF B;  1XCQ L;  2WU2 B;  1JWM D;  4CYE A;  1FPY A;  3VTU A;  1YMH E;  2ZW1 A;  3B0A A;  4F8C B;  3IAS 1;  4LLG M;  4TQ0 A;  4C7Y A;  3VR9 B;  4KSL C;  3ZNG C;  4HJG E;  3C0R B;  1KLG D;  3AEG B;  4NJC A;  4RGT A;  1EF5 A;  3QIJ A;  1QZE A;  2R2Q A;  2YLM A;  4IM0 A;  3V6E B;  1R4N B;  4OVU A;  3DBS A;  3P4R B;  1MHX A;  1KTK A;  2JF5 A;  2N9L A;  1A70 A;  2J0K A;  4PS8 A;  3RUL A;  3AN1 A;  3QAR A;  1WH3 A;  4RGO S;  3TEZ A;  2LRW A;  3D32 A;  4FHJ A;  3ABV B;  2AEH A;  1F2R C;  4ARI A;  3RCZ A;  1ENF A;  3E56 A;  1GC7 A;  3TSS A;  4XDC A;  1P3Q U;  3P1M A;  1QIL A;  1RLF A;  2WXH A;  3FAH A;  1JRO A;  2BQQ A;  2NR2 A;  1NDD A;  2L8J A;  1XLO A;  1RRB A;  3JVZ X;  2DZM A;  2MJE A;  2I1J A;  2BKR B;  1WYG A;  3W1Y A;  2CHW A;  3PPA A;  2WWZ A;  1J7B A;  3NVW A;  5IOI A;  1V9J A;  4JX1 C;  4KGR A;  2GBN A;  2DZI A;  3BVM A;  2WS3 B;  2Z59 B;  2FAZ A;  4ZDV A;  4MAC A;  3Q14 C;  4WQO B;  2PTL A;  1UEL A;  2WXJ A;  2C5L C;  2RPV A;  4ZYN A;  1TJE A;  1WMH B;  4ASW C;  1WXV A;  3HHM A;  2JU6 X;  2N7D A;  1UD7 A;  1TKG A;  5T8I A;  4DXG A;  1SGH A;  1ZXH A;  1YQ3 B;  1F1H A;  3DCG A;  3NZ3 A;  4BKS A;  1TS2 A;  1D4B A;  2V9H A;  2DX5 B;  3QK0 A;  1FRD A;  1YIW A;  2MWS B;  1K8R B;  2D3C A;  4AS1 A;  2O6V D;  3ENE A;  2ZPY A;  3ZTC A;  1GNU A;  3NVZ A;  1I4P A;  2IO0 B;  2J42 A;  4RMA A;  1H8C A;  2R2O A;  3GOE A;  3NVV A;  2M1M A;  4M01 A;  2XBB C;  2EEL A;  2YVC A;  4HLE A;  3SD5 A;  5H8Y E;  2KOX A;  3VTW A;  5TSS A;  2QHO A;  3TCA A;  4P1B C;  5EDS A;  4GSW A;  4FUL A;  2WXN A;  2MQJ A;  4MGY E;  3T3O A;  3KYD D;  2CS4 A;  1FRR A;  3IXS A;  4MH8 A;  1EU3 A;  3I63 C;  2M17 A;  2L32 A;  1MFW A;  2JXX A;  1L7Y A;  4MEM A;  3JYU A;  4IKG A;  1SE9 A;  1YOV B;  2MBH A;  4WWO A;  3MHS D;  3HM6 X;  4MJS B;  2PEA A;  5LLI A;  1J8C A;  4YL8 A;  1F9J A;  1UWM A;  4YTP B;  1WGR A;  4NZL B;  4IWP A;  5JH5 C;  1TTN A;  2CJN A;  1KLU D;  3Q8A A;  2BPS A;  1NEK B;  4B95 A;  1C9F A;  1HQR D;  1V5O A;  1FNW A;  1WSP A;  2D2Q A;  4EOY A;  1WIA A;  3A9J A;  4HEA 1;  5BYS A;  2MP2 B;  4NJ6 A;  3VRB B;  2DAF A;  3H1U A;  2D5G A;  3SEB A;  1L4Z B;  5H92 C;  3ALB A;  1R4M B;  1NEN B;  2HJ1 A;  1JWU D;  3AE2 B;  1J7C A;  2BVC A;  1NI2 A;  2FCQ A;  2FCN A;  1CQV A;  1TYG B;  3HVD A;  3ECI A;  2ZVO A;  3V61 A;  1E8X A;  3PRZ A;  1OGW A;  2N4F A;  3DBL I;  2MJD A;  3M63 B;  2LGX A;  2MSE D;  5C2T B;  2V0G A;  5AEK B;  3VHT C;  2WXM A;  2SEB D;  3ZNZ B;  5LXH A;  2KXJ A;  4IOI E;  4DK5 A;  3R2I A;  3C8Y A;  3L16 A;  2KTF A;  4DBG A;  1MJD A;  4ZRK A;  2BTE A;  2GMI C;  5DCN A;  5D6J B;  4ANX A; 
#chains in the Genus database with same CATH homology
 1F77 A;  3AEB B;  4B0E A;  5JXV A;  1HZ5 A;  2BS2 B;  1V8C A;  3R8B A;  1DYQ A;  4AQ7 A;  1OQQ A;  2XN9 C;  2E3T A;  3ETR A;  4TSS A;  1KRH A;  4RGM A;  1FMA D;  2QJL A;  4B0M A;  1YN3 A;  2GB1 A;  4Q2J A;  1OFF A;  4OZB A;  1E0Z A;  4A90 A;  3RFZ B;  1C78 A;  1EWC A;  5HHD G;  1RWS A;  2BB5 A;  1HA5 A;  2WXO A;  1PDX A;  4JPS A;  4ARC A;  3KQ4 A;  3AE7 B;  3AEC B;  5I4D A;  1AW7 A;  3LXF A;  3MFG A;  1FNV A;  3Q69 A;  3BZD B;  2Z8L A;  4L1B A;  2AQ3 B;  5BMH A;  1IGD A;  2R61 A;  3SFE B;  2PVO D;  1QOB A;  1BUI C;  2WNM A;  2K22 A;  3AV8 A;  3P4P B;  3MP9 A;  1HXY D;  1BXT A;  1JW9 D;  2B76 B;  2Y5P A;  2KMM A;  2AQ2 B;  3R2T A;  1SE3 A;  2DWQ A;  4OZA A;  1I4X A;  5C3J B;  2KDM A;  4C56 C;  1E7P B;  4N6E B;  2LGI A;  1TS3 A;  1ZDX A;  1KH0 A;  4YXD B;  2HTM E;  2SAK A;  3LB8 C;  1C4P A;  3AE4 B;  1V1P A;  1YQ4 B;  1NYR A;  1VZ6 A;  1DOI A;  1PGX A;  4TQ1 A;  2XNA C;  5BYQ A;  4USA A;  1IUE A;  1XXG A;  1JQ4 A;  4YSX B;  3BWU D;  1J7A A;  1YJJ A;  2X38 A;  3P63 A;  1QQR A;  2FUG 1;  3PZ8 A;  2GRI A;  2DYO A;  3ZJU A;  3EGR A;  3AE6 B;  1FD6 A;  3BVZ A;  3TEW A;  2INP E;  1C79 A;  3B9J A;  4MT5 A;  3I57 A;  3KLS X;  3NRZ A;  3P42 A;  1N63 A;  4ITK A;  4YT0 B;  2MJ3 A;  1R7S A;  1OQR A;  3TEY A;  4CQN A;  2Q5W D;  3AE1 B;  2DYM A;  3AB5 A;  2FBW B;  5D3I B;  5BMG A;  1SE2 A;  2WXR A;  3P4S B;  3AEE B;  1D5X C;  1TY0 A;  2TSS A;  1F2R I;  4A6Q A;  3U2S C;  4JWU C;  4WAF A;  1AWD A;  2WLB A;  4MM3 B;  3U7Z A;  2KWD A;  2JQR B;  5FR3 A;  2AQ1 B;  1I4Q A;  5EE3 A;  2M19 A;  4HKZ E;  4YSY B;  4TMA B;  3NS1 A;  4RFB A;  3AE5 B;  3AED B;  1JWA D;  2L1A A;  1E6E B;  3HRD D;  2Y3A A;  2J53 A;  1SJE D;  3BVG A;  3ZJV A;  2WXK A;  1JWB D;  4OHJ A;  1VR9 A;  2LHD A;  2QEJ C;  1B9R A;  3FIL B;  4LTU A;  3Q8C A;  2Y5C A;  2V3P A;  2NMQ A;  2W54 A;  1SB3 C;  3LYY A;  3SFD B;  2W55 A;  2N7J A;  2WP9 B;  1SSN A;  4GDL B;  2INN E;  2PW9 A;  3GB1 A;  3B2G A;  2G9H D;  2WXG A;  4HRO A;  3DWM A;  1VLB A;  1K50 A;  1I4H A;  3BII D;  1EU4 A;  3IT6 B;  5HFY A;  3AE3 B;  2VZK D;  1WWT A;  2IGH A;  1PFD A;  1DGJ A;  3AEF B;  4P6V F;  5GXG B;  1XCQ L;  2WU2 B;  1JWM D;  3UI3 A;  1FFU A;  1D6E C;  2IJ0 A;  1EWY C;  1YMH E;  2ZW1 A;  1FCC C;  3IAS 1;  1Q10 A;  4LLG M;  4TQ0 A;  4C7Y A;  3VR9 B;  4OW0 A;  1SBB B;  4A8X C;  2HDE A;  2BT6 A;  4N59 A;  3L4P A;  4L23 A;  4HJG E;  3TEX A;  2JYE A;  5D7G A;  1HEZ E;  4A55 A;  1MI0 A;  1IGC A;  1KLG D;  3AEG B;  3FIL A;  4NJC A;  4RGT A;  4KGT A;  1XO3 A;  3W5U B;  2YEP F;  3P4R B;  5AUI A;  1VDV A;  4KKJ A;  4O1N A;  4ZYS A;  4YSZ B;  1MHX A;  3SR6 A;  2W3R A;  1IBX B;  1JWS D;  1KTK A;  2N9L A;  4D2K A;  1RYJ A;  1A70 A;  1P7F A;  3W5V B;  1L5P A;  1FIQ A;  1N5X A;  2BW2 A;  5AUK A;  3ZJT A;  3AN1 A;  5EE0 A;  1UGJ A;  4RGO S;  3TEZ A;  2RMM A;  2BB6 A;  4ZOH C;  2WXF A;  4ZRQ A;  1EM7 A;  4ZHO A;  1VZ7 A;  3CWI A;  2NTS A;  2JYT A;  5E6J A;  3ABV B;  1MVK A;  5LNK 1;  4WIP A;  1F2R C;  2K5P A;  4ARI A;  2L83 A;  1ENF A;  2PLP A;  3E56 A;  2OED A;  3TSS A;  4XDC A;  2N9K A;  1K51 A;  1GB1 A;  3AMZ A;  1QIL A;  3P1M A;  4EE2 A;  2WXH A;  1GOZ A;  3FAH A;  1JRO A;  2WDV B;  1RFK A;  1SF0 A;  4N58 A;  1XLO A;  3ZQ4 A;  1TS4 A;  2WXL A;  2H88 B;  4YTN B;  2MJE A;  1SE4 A;  3VR8 B;  3OWE B;  1WYG A;  1PYW D;  4C7Z A;  1L0V B;  1FO4 A;  4A9A A;  2IGG A;  2KAC A;  3VRA B;  1J7B A;  3BK2 A;  1MPE A;  3NVW A;  4UDU C;  2CJO A;  1E10 A;  1ZDV A;  3E9S A;  4JX1 C;  4KGR A;  1XF5 L;  3BVM A;  2WS3 B;  3AE8 B;  2I38 A;  5BMI A;  4IDI A;  4MAC A;  1NVI D;  1NYQ A;  2WDR B;  4KGS A;  2PTL A;  2DLB A;  4KX6 B;  4C80 A;  3P4Q B;  1C77 A;  2LUM A;  2WXJ A;  2RPV A;  3AH7 A;  4XWT A;  1TJE A;  3FC4 A;  5EE9 A;  2PVG C;  1XCT L;  3KWL A;  2PKO A;  1N62 A;  2JU6 X;  1VJK A;  4DXF A;  4L2Y A;  1TKG A;  1D5M C;  3V05 A;  1V1P B;  2QMT A;  3WCQ A;  5T8I A;  1UUP A;  2LJI A;  4DXG A;  1K53 A;  1WXQ A;  1V97 A;  2DBY A;  1ZXH A;  1I4R A;  1TKE A;  1JML A;  1VZ8 A;  1KF6 B;  1YQ3 B;  1ET6 A;  3ZGZ A;  1L0Y B;  3NZ3 A;  2M0A A;  1TS2 A;  2H89 B;  3BYT B;  1D4B A;  2OHF A;  3U4E G;  2IGD A;  1FRD A;  1ZP0 B;  1IBX A;  1WRI A;  1L0X B;  4AS1 A;  1P7E A;  2LEK A;  3O13 A;  1ACC A;  1ZUD 2;  4R3D A;  5G5G A;  1N61 A;  2W82 A;  1TS5 A;  1N60 A;  3MC0 B;  3NVZ A;  1I4P A;  2J42 A;  3HVZ A;  4GDK B;  3ZYY X;  2WXP A;  3TUO A;  2QIL A;  4RF1 A;  3NVV A;  3RPF C;  4JE3 B;  3VQI A;  2LFI A;  3URY A;  1B1Z A;  1FEH A;  1GB4 A;  2M56 B;  1TKY A;  1VRA B;  1JAL A;  2QIE B;  2EEL A;  2WU5 B;  3U52 E;  2LMC A;  4M0W A;  5H8Y E;  1YN4 A;  5MPO A;  5TSS A;  2BYT A;  2ICI A;  1PUT A;  3I9V 1;  2E6X A;  1XEE A;  1XLN A;  2KQ4 X;  3NUH B;  1SJH D;  2WXN A;  3T3O A;  5HI1 A;  1JCK B;  1FRR A;  3IXS A;  4MH8 A;  2I2Y A;  1UWX A;  1QOF A;  1EU3 A;  1LO5 D;  3NVY A;  4PT5 A;  2L32 A;  3W2D A;  3DWG C;  4KKI A;  4IKG A;  2BS4 B;  1QF6 A;  1FCL A;  1QT9 A;  1MHH E;  4P16 A;  1I4G A;  2JWU A;  2WDQ B;  3T3N A;  3AEA B;  1FFV A;  4WH4 A;  4REZ A;  4XWW A;  2K3U A;  2K9X A;  2PMV A;  1PGB A;  4ZRP A;  3GP7 A;  4YTM B;  2CU3 A;  2ACZ B;  2JSV X;  3Q8B A;  4NAM A;  1ESF A;  1GAQ B;  3J9C A;  1UWM A;  1K52 A;  2IDY A;  4YTP B;  4NZL B;  4H2A A;  1JRP A;  3IT4 B;  2PIA A;  3AM9 A;  1TY2 A;  2CJN A;  5HG2 A;  4RH6 A;  4WUR A;  1ET9 A;  2MEK A;  1KLU D;  2ONQ A;  5FKA C;  3Q8A A;  4FXC A;  3V3X A;  1SEB D;  1NEK B;  1C9F A;  1HQR D;  1RM6 C;  1WGK A;  1FNW A;  1WSP A;  1L4D B;  1N5W A;  4US9 A;  2WXQ A;  4NAW B;  3HUI A;  1AN8 A;  4RNA A;  1T5X D;  4LK0 M;  2ON8 A;  1ZOY B;  4XE0 A;  1BML C;  4US8 A;  4OZC A;  4HEA 1;  5EE1 A;  5BYS A;  3CIR B;  1V1O A;  2V3N A;  3EUB 2;  4XDD A;  3MHZ A;  1SIJ A;  3W9C B;  2WQY B;  1ZE3 D;  3GS2 A;  3VRB B;  2QSD A;  1TZO A;  1C4C A;  4RF0 A;  2D5G A;  1T3Q A;  1DOY A;  3KWV A;  3SEB A;  1L4Z B;  2V4I B;  5H92 C;  2YEP B;  2GI9 A;  1E9M A;  2N0S B;  1NEN B;  1JWU D;  1PGA A;  3AE2 B;  1DOX A;  1KFY B;  1CZP A;  2BS3 B;  1HZ6 A;  2KAJ A;  1J7C A;  2BBC A;  2MH7 A;  4HRS A;  4JWS C;  2JX5 A;  3B2F A;  5BYR A;  1FM0 D;  2EKI A;  2J4X A;  1FNU A;  2IPK D;  3N9Y C;  1ZXI A;  1STE A;  3PZ7 A;  1CQV A;  2RDG A;  5G5H A;  1TYG B;  4WQM A;  3HVD A;  3PO0 A;  5D3D A;  1L6V A;  2W3S A;  2J52 A;  4YWG G;  1QOG A;  3EA6 A;  4DQO C;  2L52 A;  2LHE A;  2NTT A;  2FE8 A;  1AYF A;  1FXI A;  1YJI A;  2JXT A;  3Q8F A;  3BK1 A;  1QOA A;  1Y56 A;  1L6U A;  1XLP A;  1ROE A;  2MJD A;  3H8H A;  3MJ5 A;  2AX5 A;  1CJE A;  5C2T B;  1D5Z C;  1C4A A;  2V0G A;  1GPX A;  3Q8E A;  2WXM A;  1QKZ A;  2SEB D;  1F0Z A;  5FK9 C;  1SXT A;  3BYY B;  1QLB B;  1ZPS A;  1NI3 A;  2JZP A;  1C76 A;  2RDH A;  2VZK B;  4IOI E;  2G1E A;  1CK1 A;  1XLQ A;  3IAM 1;  1YN5 A;  3R2I A;  1FXA A;  3C8Y A;  4ZHP A;  2WXI A;  4RCO A;  2KN4 A;  2BTE A;  4OVZ A;  2ZW0 A;  3W1S A;  4WWM A;  1M4V A;  4HKQ A;  4GLS C;  1T6B X;  3AE9 B;  1UNS A;  1I7H A;  4RGN A;  1YNT E;  2K0P A;  4J3O D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...