4MT5A

Crystal structure of mub-rv
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
184
structure length
184
Chain Sequence
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKTVVYVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mucus binding proteinn
publication title Structural basis for adaptation of lactobacilli to gastrointestinal mucus.
pubmed doi rcsb
source organism Lactobacillus reuteri
molecule tags Protein binding
total genus 34
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17965 MucBP_2 Mucin binding domain
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A02
3.10.20.470 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A01
3LYYA 3Q69A 2LFIA 3NZ3A 3I57A 4MT5A
chains in the Genus database with same CATH superfamily
1YQ3B 3Q3OC 4GIVA 2PEAA 1VZ7A 2QDFA 1HZ6A 1VLBA 2V9HA 1GG3A 4WJOA 4ZHOA 4IC7B 1JWMD 4ZHPA 2WXFA 2QIEB 2UYZB 4PS7A 1F2RC 2LGDA 5L83A 2KVZA 2L52A 2PTLA 3HK0A 4DHZE 4RCOA 3PLVA 1UZXB 3PVLA 3IT6B 2INCC 4LTUA 1S3SG 3KVFB 3AE3B 4M0WB 1L4DB 2V3SA 3ZUNA 3ZRFA 2JZZA 2JXTA 3R2TA 1XF5L 2NTSA 3Q3FA 3NS1A 1GJZA 2IYDB 1L7YA 2KTFA 1ROEA 4US9A 2PPHA 1VDVA 2M8SA 3W9CB 1PQSA 2Y5PA 1STEA 5T8IA 2KVRA 2RR9A 2NR2A 5FR6A 3MTNB 2WXRA 4BFRA 3PRZA 1FM0D 1MFWA 2RMMA 1VZ6A 4JQWC 2ON8A 1WMHB 3K9PB 4BKSA 2KFKB 3V6EB 1WX9A 3PS6A 2LEKA 1R4NI 2LVPA 1YQBA 1WGKA 1TTNA 2DBYA 2AQ1B 2LVOA 2K1FA 1C4CA 1TKEA 4IDIA 2YLMA 4RM8A 2BTEA 4LNIA 1WGYA 5DCNA 3BIID 3W5VB 4GDKB 1XLPA 4MH0E 4TMAB 3L08A 4WQMA 1FXTB 1E8XA 3B1LX 3QWZB 1UF0A 2MBOA 4N58A 3KUDB 4BOSC 1EUVB 2HDEA 3A4RA 3Q8BA 4TUUA 1GC7A 1GOZA 4P1BC 3TCAA 4XC2A 2NVUI 2H89B 1A5RA 2WYQA 3RNEC 1N62A 2REXA 2CU1A 1SF0A 4NJ7A 4ZRKA 3RNAC 3BZDB 2MJEA 2KDEB 3BYTB 4OZBA 4EOYA 2J53A 4DHJB 2NMQA 1FRDA 3CF6E 1YJJA 2D3AA 1TT5B 4XGAB 3QA8A 2L0FA 3BYYB 4NAWB 3I57A 1WH3A 1P98A 3A1QA 3NS8A 2JU6X 4ZRPA 2KFJA 2KJHB 2N1VA 2ZVOA 2QHOA 1E8ZA 4HROA 3KQ4A 4ANWA 4R3DA 4KKIA 3UGBB 4BBNC 2K39A 2G45B 1TY2A 2I1JA 1OGWA 1TZ1A 1BMLC 2ZZPB 2ZNVC 2INDC 1D4BA 2VRRB 2JRIB 1GNUA 4A90A 2DZMA 1FNUA 1I4RA 3VXWA 1QILA 3T3NA 4ANVA 2JF5A 2KANA 3A9KB 2VH2A 1HTOA 3Q8AA 3AECB 1UWMA 3NG0A 4ITKA 5FR3A 1C77A 2Y3AA 1IGDA 2XN9C 4GLSC 3B0AA 2YEPB 2I1KA 2KWDA 3D32A 2MBBB 4P6VF 2IPKD 3VDZA 3U4EG 1UELA 3P2BA 2BYEA 2V0GA 2KOXA 2JZPA 1L6UA 5H8YE 1OFFA 3W1SC 3AI5A 1BXTA 4GB9A 1NEKB 2KWCA 5G2NA 3PO0A 4KSKC 4EE2A 3A9JA 1YN5A 3KW5B 5C2TB 3QHTA 4MGKE 5JHBA 4JE3B 2K0PA 1PGXA 3ZNID 3B2FA 4GGQA 1V1PB 2HD5B 3P4PB 2IGHA 2WXHA 3IXSA 5CHVC 2J4XA 4W9GA 3W1SA 1HE8A 4C7ZA 3SD5A 3R8BA 1ZE3D 2OEDA 2PE9A 2BYVE 3ZVVA 3DBHI 2JT4B 4FN2A 3RUIB 1KTKA 2WHIA 5AUKA 3Q6BA 4GXBA 2GBJA 2JUOA 2GBNA 4XWTA 2KN4A 3U8ZA 4WJQA 1I4QA 1FNVA 2WXQA 3DHGC 2KX0A 3AE6B 3DBSA 1XD3B 1IBXB 4A55A 1IYFA 4YTMB 3GZNI 4HEA1 3T3OA 4JPSA 2JX5A 2RPQA 3WA0A 4P7IA 2FIFA 4N9F4 4LK0M 1K51A 2EMTA 1G6JA 1F52A 2VH1A 4S17A 4IWPA 1L0XB 4E3CA 2DAFA 3HVDA 4B95A 1E0ZA 5DPTA 3QK0A 2JZ3B 4RH6A 5CHWA 2M1MA 3RZWC 4F8CB 5G5GA 2GBKA 3DBRI 1GAQB 2TSSA 4FHJA 1M94A 1WXMA 1YMHE 4NQKE 4RFBA 5AUIA 2O2VA 2FAZA 2WDVB 2AEHA 1KLUD 3M63B 2WGSA 4K7UA 1SE4A 1SIFA 4WWMA 2BS4B 2FCQA 2OHFA 1Q5WB 2K6QA 3R7QA 3ZXVA 5AZFA 3PTFC 5LLIA 4M0WA 4KDIC 1C4PA 4KGRA 3TSSA 2JYEA 1WX7A 1QF6A 3SEBA 2KX3A 1WXSA 2K22A 5IA7A 3A4SC 3HVZA 5FKAC 1JROA 1K50A 3B9JA 3NHEB 3Q3NC 2C5LC 4W9KA 3VUWA 1GPXA 3NVZA 2FNJB 2WXKA 4JLCA 4C56C 2WXPA 3N30A 3SDLC 2CJOA 3QAQA 2BT6A 4AP4C 2IY1B 4FBJB 2IO3B 2RDGA 2M17A 3AEBB 1CK1A 2MHJA 4MM3B 3NVWA 5C3JB 1J0GA 3PREA 2FE8A 1SBBB 3I5JC 2OJWA 3VHTC 1E7PB 3AU5A 3X23A 3BINA 2JWUA 2KJRA 2BB6A 4M8MA 4W9HA 1QZEA 2J42A 1YOVB 1YX5B 2WXMA 1OQYA 1UGJA 2UU7A 4YSYB 2PE6B 4IUMB 3IAS1 1V1OA 2V4LA 3AEDB 1WRDB 1EF1A 1V97A 3DBLB 4II3B 1F9JA 4NJCA 1C78A 2Z59B 1P7EA 1WXAA 2KMAA 4YSXB 2JRHA 1TGZB 4D2KA 5HHDG 4DBGA 3QIJA 1E9MA 2BBCA 1CMXB 1V6EA 4KZ0A 4W9FA 3DWGC 4HDOA 4LNFA 5I4DA 2ZPYA 1N6ZA 1TIFA 3MP9A 4YTPB 2RGFA 1T0YA 4RNAA 4CHKA 1WIAA 1DOXA 2IDYA 3VTUA 3AULA 1WFYA 5CTRC 1D5ZC 3V62A 1TS5A 1TJEA 2FUG1 4EUTA 3V05A 1V5OA 2IBIB 2SAKA 2X38A 2BPSA 1AARA 3BY4B 2N9KA 3C19A 2M0AA 1ESFA 5EE9A 3Q69A 1T0QC 2MEKA 2KO3A 1T0SC 1WJNA 2MP2B 1UWXA 1L0YB 3OWEB 4K3CA 2DLBA 4W9JA 2WXOA 4OVVA 1JRPA 1EM7A 2BKFA 4B0MA 2XK5B 2X8XX 4A6QA 1UD7A 3IT4B 1B1ZA 2ZCCA 2ZJDA 2NTTA 1SJHD 4C4VB 1YNTE 1PGBA 1WE7A 1NBFC 3ZJTA 2JY6A 1XEEA 3Q3MC 1FCLA 5BMIA 4ZRJA 2ZPNA 1H8CA 2MQJA 3TMPB 1SGHA 3AEAB 3PZ7A 4OZCA 1YN3A 1TS2A 1TKYA 3TUOA 5D2MB 3EC8A 2LWPA 3N1ZC 3AEEB 2KQ7A 2NS5A 2OOBB 1UBIA 4RGMA 2L1AA 1T5XD 5DPRA 2HTHA 4M02A 2D3GA 4MGIE 1TKGA 1DOYA 4QAYA 3ZLZA 4ICUA 3VRAB 2WXGA 1YJ1A 3CIRB 3NJTA 3FILA 4WAAA 5KHQA 4XZ4A 1WXQA 1NYQA 1V1PA 1R4MI 1QOGA 3WIMA 4KX6B 4HPLB 2J0JA 1R4NB 3AE7B 2LMCA 1FPYA 2DAJA 3IBEA 1IPGA 2KLGA 2C9WB 3MJWA 4HKQA 2IGDA 4LNNA 2IO2B 2FCSA 2JSVX 1WY8A 4ASWC 2MW5A 1HEZE 1XLOA 1C9FA 5D3IB 1MHXA 4DWFA 3UF8A 1OTRB 1V80A 2KT7A 2EKEC 2Y5CA 4WJPA 3DVNV 2KXJA 2N9PC 3CWIA 4MJSB 1SB3C 1IBXA 5BMHA 3TJPA 2C60A 5KHOA 3OLMD 1EU4A 2W54A 1MPEA 3MFGA 1V9JA 2HE7A 2M56B 1UH6A 3H9DA 1T6BX 2MWSB 5C1ZA 2O6VA 1NENB 1VCBA 2KMCA 1ZP0B 1GB1A 2KTRA 3WANA 5BO4B 3AE9B 2DNFA 1JMLA 3RPFC 3U30A 2BKRB 3ZNZB 4FADA 4IWOA 3Q2AC 1ENFA 4IM3A 3Q8EA 4EZLA 2INPE 4B9KA 2ASQA 1T0RC 5JZEB 3ML8A 4ZOHC 3CSFA 3J9CA 3EHVA 3O65B 2B76B 3SHQA 2W3RA 3P63A 1YN4A 4JGHB 2C7MB 3ABVB 4YL8A 1BT0A 3PRMB 5D94A 3OJ3A 4ZYNA 2J0KA 5JHAA 1K52A 2D3BA 2I2YA 1XQQA 2N7DA 2DZIA 1RFKA 5DPWA 3WALA 1I42A 3P4QB 3MHSD 2IJ0A 4ANXA 1K53A 3PLUA 1FNWA 1KOTA 1E90A 2LVQA 2CHXA 3E56A 2R2QA 3SFEB 1C1YB 1PYWD 1XCQL 4A3OA 3TEYA 2KDMA 2EKIA 3P42A 3ZYYX 3U7DA 1V2YA 3U7ZA 2V3NA 2PMVA 3ZGZA 3IG3A 3JW0X 3FAHA 4US8A 2JYTA 2N4FA 4YTNB 2HTME 2H88B 5EE1A 2KWVB 3MHZA 1TBEA 4OZAA 1VZ8A 4IKGA 3I63C 1CZPA 1RFAA 1D5XC 1AN8A 1J7AA 1NVID 2LRUA 2AQ2B 3UINB 2B3AA 3PZ8A 1NYRA 4HK2A 4MH8A 3RYTA 2PVGC 1TS3A 2K8CA 1EWCA 4BKTA 1QOBA 2NPTA 4IOIE 4JL9A 1JALA 3VH3B 2JQRB 3DBHB 2K8BA 2KAJA 5EDSA 3HRDD 4K1RB 4IG7B 2JWZA 3APFA 1HXYD 2NBWB 4MELA 2Z0DB 2IY0B 2MBEA 2PJHA 2GOWA 1X1MA 3DHHC 1YIWA 2KDFB 2ZVNA 1IP9A 3APDA 1JCKB 3GZNB 4W9IA 1WE6A 4HPMB 2CU3A 3U2SC 4X57B 2MH7A 1XCTL 3MC0B 4LNOA 2L05A 1E6EB 2VZKD 4DK5A 4LNKA 3DWMA 2BWFA 3TEZA 3DQVA 5IP4D 4W9EA 3MC8A 1JWSD 1JWBD 3DVNU 4CQNA 2G1EA 4EFOA 4P16A 2MP2A 3DBRB 4A8XC 3VRBB 3KYCD 3S2AA 3H1UA 3UI3A 2L3ZA 1LO5D 2L7RA 4GDLA 4NZLB 2XK5A 3C0RB 1FO4A 2GI9A 1ZUD2 2WWZA 2GLSA 3LXFA 1EU3A 3ZKJC 2BS2B 1SE3A 2J0MA 3TIXA 2FCNA 2LGXA 3BVGA 3ONSA 3RFZB 4TV3A 1F2RI 4WQOB 1I4XA 3ZNHB 3LB8C 1J19A 3BVMA 1DOIA 1LM8B 1FIQA 3H8HA 3AV8A 4TKNA 3HHMA 2MBHA 2G4DB 3BVZA 2HJ8A 3ZTDA 2KACA 3N3KB 3EGRA 2WQYB 1OQRA 1E8YA 3RULA 3KUZA 2GB1A 1E7VA 2J7QB 4FLHA 2KYWA 4DXAB 4RF1A 2LASA 4UDUC 4KSLC 1L2NA 1WGDA 3I3TB 2ZEQA 4BOZB 4BZAA 1Q1OA 2K6DB 1Y8RC 2JPHA 2NBUA 4NQLB 2N9XA 3BK2A 1DYQA 1I4PA 1WR6E 1P0RA 4I6PA 1RWSA 2RDBC 1V5TA 1ZW7A 4HJGE 2WS3B 5HG2A 4PK1A 2L0TA 3M95A 1UNSA 2G9HD 5GXGB 1L4ZB 1R7SA 1LFDA 3IFWB 4FULA 2QMTA 1WGHA 4W9DA 3NY5A 1WMHA 3C8YA 4II2B 3IHPC 1QOFA 2XNAC 2BF8B 2KFKA 2KWUB 3SU8X 4XWWA 4S0RA 2KQSA 4GSWA 1XT9B 2MJDA 1XXGA 3AM9A 4XDDA 1YQ4B 3Q8FA 4YWGG 4G50A 4IW0A 3AE5B 3GS2A 1N63A 3JYUA 5CHFA 2DYMA 3MJ5A 3GOEA 2QCZA 3H7PB 1WX8A 1ZDVA 1WXVA 3TEXA 3TBLD 4A3PA 2FUHB 4GDKA 4USAA 2BS3B 2LI5A 3PZDA 3VQIA 2DHZA 2KC1A 1ET9A 1I35A 1Z5SB 5GMVA 4KIKB 3AB5A 4O1NA 3PSEB 1ET6A 3AE4B 5LXHA 4KKJA 2BWES 2ZNVB 4LDTB 4JX1C 1F0ZA 3KWVA 1JWAD 4G0NB 1IGCA 4WIPA 4KGSA 3RMKC 3CMMB 2KDBA 5JXVA 2CKHB 4LJOB 2MA9B 2FBWB 4RGNA 1SE2A 3GE8C 3AU4A 4WAFA 4K7WA 4HRSA 4E71A 4AWJA 3W2DA 1TS4A 3HM3A 5TR5A 3R3MA 2CHZA 4BKSD 3IVFA 4NAWA 1GB4A 1EWYC 3P4RB 2AWTA 1UBQA 3N20C 3QCAA 3NUHB 1MHHE 5HKHA 3RCZA 3A9JB 4ZRQA 3KUCB 4WH4A 4J6IA 1ZXHA 3L17A 1TYGB 2O6VD 4DDGD 4MSQB 4HCPB 3AH7A 2DX5B 4WJNA 2IGGA 3OJ4B 1WYWB 4YXDB 2DWQA 1PFDA 2MSED 1WJUA 3AN1A 3ZO5B 1J7BA 5LXIB 4EZJA 2ICIA 3V61A 2JXXA 4PYZA 4WWPA 5IN7A 5IO9A 4AJYB 3A9KA 1FRRA 2C7NB 4EZKA 1P7FA 2K9XA 1JRUA 2KKCA 5JH5C 4RF0A 1VD2A 2MRPA 5LNK1 4HVBA 4RM9A 5G55A 2D5GA 3A33B 1RRBA 4FJZA 2N0SB 5E6JA 2D10A 3JVZX 5J18A 1R4MB 3RN9C 1AW7A 2CHWA 4K3BA 3AE8B 3LYYA 3NOBA 2IO1B 4ZYSA 1C76A 2M4NA 2G3QB 2RD0A 4AJWA 3EA6A 2W9NA 3DVGY 3L0WB 4HWIB 1YX6B 4BBNF 1MG8A 2A4ZA 3MC9A 3ZXRA 2CJNA 2K25A 3AE2B 2FIDA 1QKZA 1RYJA 4ARCA 2A5UA 2K5PA 2O2VB 3Q3JA 4LJPB 4HPPA 2E6XA 2Y5BB 4TQ1A 2CS4A 5D7GA 2LHEA 2IO0B 1C3TA 3ETRA 1KM7A 1OEYA 3R66C 5DPSA 2W55A 4L2YA 1AWDA 4MT5A 1Y56A 3W1YA 1L5PA 3UIPB 2RSUA 5BYSA 3EECA 5IKCM 1RM6C 1WF9A 4GOCA 1N5WA 2XBBC 1Q10A 4YSZB 4C7YA 2L76A 4YT0B 5EE0A 1KH0A 2DZKA 2Z0EB 2QSDA 4LDTD 4KVGB 1ZGUB 4W9CA 3DHIC 5E6PA 2LXCA 3LDZE 1L6VA 3QJZA 1MI0A 2PVOD 2WXNA 1QT9A 4EEWA 2K8HA 2OJRA 5AEKB 2WXLA 1ZXIA 3SR6A 3UQAA 1D5MC 2W3SA 4G3XB 4PS8A 3VUYA 5TSSA 1E7UA 3Q8CA 4A9AA 2MBQA 3TEWA 2CR5A 2E3TA 3N1YC 1V81A 4ZDVA 1FMAD 4M01A 2UWQA 3DVGX 1WZ0A 2HJ1A 1HA5A 1SJED 2VZKB 2WDQB 3EUB2 2D3CA 2PKOA 3L10B 4TQ0A 3ZQ4A 1WWTA 2WXIA 1ZKHA 5D3DA 4HCNB 3DCGA 3AEGB 1B9RA 1ZPSA 4DQOC 1QQRA 4C80A 2N9EB 1WGGA 2ONQA 3ZRCA 4XX5A 4HJKA 2WU5B 1EO6A 4LCDE 4TSSA 3UQBA 2I38A 4Q2JA 1WR1A 2R61A 3ECIA 4FJVB 4G11A 4KZCA 1QLBB 1WJ4A 3NRZA 1HZ5A 2WXJA 4AUQC 1HQRD 3KH0A 3M3JA 2V3PA 4M00A 3ENEA 2N7EA 1OQQA 1A70A 3JSVB 2DYBA 3RNCC 3NZUA 3VVWB 4AQ7A 3L16A 1NI2A 2KZRA 3AXCA 2LUEA 5E6NA 1VRAB 3PHWB 1HTQA 2RDHA 3NVVA 3QC8B 3FC4A 3FKYA 1P3QU 1JQ4A 1CJEA 2GBMA 4RGTA 1NDDA 2M0XA 3ZJUA 3N32A 3APCA 2LD9A 1KF6B 2PW9A 4DDID 3IAM1 1EF5A 2LRWA 2D11A 3WAOA 3NVYA 4XE0A 2FCMA 4B6WA 2ZW0A 3I9V1 4DXFA 1WZ3A 4MM3A 2QJLA 1KFYB 2KK8A 2ZCBA 1LXDA 3RD2A 4DHZB 3PPAA 2N1WA 3RI7C 2QC8A 4E74A 3H7PA 5HFYA 1P1AA 2LGSA 4GU2A 2MJ3A 3GB1A 3V3XA 2WNMA 2M19A 1D6EC 2QILA 2KLCA 3VR9B 3WCQA 5CX3A 1MJDA 1C79A 3H6NA 4KIKA 2BVCA 2KHWB 2BW2A 3EFCA 4KV2A 2L83A 2V1YA 3P4SB 1WGRA 2BGFA 1L0VB 1TY0A 3HIZA 3B08A 1T3QA 4N6EB 2INNE 2LZ6A 1SXTA 4HLEA 3V60A 4MDKE 3E9SA 4NNJB 4CO7A 3RT3B 2KMMA 1VR9A 1E8WA 1KJTA 1FFVA 3KWLA 4MEMA 1J7CA 2LHDA 4K81A 2LUMA 1PUTA 2D2QA 2KC2A 1FCCC 3ZDTA 2LGYA 1E5WA 1WI0A 5EE3A 2MLBA 5IOIA 1U4AA 4OW0A 5G5HA 5C23A 1E10A 4XYCA 2D07B 5J17A 1P9DU 3FILB 1D3ZA 2IZVB 3UIOB 2C7HA 4FA6A 2K3UA 1RAXA 1QOAA 3RNFC 4K7SA 3ALBA 3N9YC 2QEJC 2W82A 2DZJA 2KN5A 3GP7A 2AX5A 3SFDB 4BAXA 3R2IA 1KRHA 2WX0A 3CSTA 3QARA 4N59A 1FXAA 3H7SA 2WP9B 1V86A 2V4IB 3ZTCA 1N61A 1YD8U 4F7ZA 1SSNA 2MCNB 3VUXA 4AOFA 1FD6A 4ACFA 1M4VA 4NAMA 3URYA 3K9OB 3X0WA 4C4VA 1V8CA 3RZFA 5D6JB 1H4RA 3HM6X 4M8NA 4BKGA 1MG4A 1I4GA 3BWUD 4PYUA 1S1QB 2KD0A 3N1XC 4DHJD 2KQ4X 2O6VB 4A20A 2WX1A 4ZRIA 3TL5A 4IWQA 2KTRB 1Z2MA 4I6LB 2ZW1A 3ML9A 1GUAB 5IAAC 2EMSA 5E6OA 3VAWA 1KLGD 2DENB 3O13A 4FJYA 1UUPA 1ISNA 3B2GA 4WURA 1LGRA 3L54A 1F1HA 1SE9A 4JWUC 1OEYJ 3T8MA 2YEPF 4AS1A 1XLNA 1WRIA 4L23A 5BMGA 3T9LA 4HXDA 4OVUA 3RNGC 4J3OD 1PDXA 4FXCA 1SIJA 3AMZA 3PHXB 4RGOS 3LJ3A 3NZSA 2LJ5A 4C00A 2LGIA 4P1CC 4MJSA 2WLBA 1WM2A 4ANUA 4IM2A 2AYOB 3A1QB 3ZW3A 2AL3A 1I4HA 2N9LA 2G4SA 4B0EA 3M62B 1WJ6A 3DDCB 2ACZB 2WDTB 3PGEA 4NY0A 5FK9C 5L95C 2LJIA 4KGTA 4EKUA 1WSPA 1V49A 3KLSX 3GE3C 1FFUA 3OAWA 1MVKA 2KJ6A 3ZJVA 3ZIMA 1N60A 2GBRA 2RPVA 4OVZA 1AYFA 2XEWA 4FHKA 2L00B 5AZHA 1KLVA 1JW9D 3WAMA 1BUIC 3RNBC 2N7JA 3AEFB 4GMVA 4WWNA 3KYDD 4REZA 1LQBA 3OG5A 4KDLB 5BYRA 5BYQA 4I6NB 4DXGA 5MPOA 2MX2A 3VH4B 1GC6A 4MGZE 4JIOU 2BYTA 2GRIA 2JVCA 2BYFA 2AQ3B 1VJKA 5H92C 3AE1B 4LLGM 3EFUA 4CYEA 3VR8B 3DOWA 1XO3A 3NZ3A 4HKZE 1IUEA 2GMIC 1ACCA 2Q5WD 2BB5A 3DPDA 4BVUC 4L1BA 1ZDXA 1TZOA 2L32A 3W5UB 4H2AA 1C4AA 3VTVA 2Z8LA 1ZOYB 4PS3A 4NJ6A 2NPTB 3JSVA 4ARIA 3P1MA 3VFKA 4MACA 1I7HA 3ZNGC 4OHJA 1YJIA 5HI1A 4RMAA 2KDIA 1JWUD 4URKA 1NI3A 1SEBD 2J52A 1RLFA 3BK1A 2R2OA 3PT2B 1FXIA 4F1SA 2DYOA 3U52E 3R7RA 4ICVA 4IM0A 1Q0WB 3DBLI 3VTWA 4MSMB 4MGYE 2L8JA 3PV1A 4WWOA 2PIAA 2WDRB 1J8CA 1WM3A 3V6CB 1UGMA 3L4PA 3WAPA 1PGAA 4HDQA 1DGJA 1WYGA 1CQVA 1F77A 3QQ8B 4JWSC 2NCNA 2EELA 1XLQA 2AL6A 3HUIA 4W9LA 4GDLB 3PRPB 5AZGA 2WU2B 4XDCA 2YVCA 2NBVB 2SEBD 2PLPA 1K8RB 3QX1A 4NPNA 2LXAA 2BQQA 4GN1A 3L13A 5J2RA 3Q14C 1FEHA 4PT5A 2KNBA 2LFIA 3ZDMC 1N5XA
chains in the Genus database with same CATH topology
1A70A 1YQ3B 3NVWA 5C3JB 2FE8A 1SBBB 1JWSD 1JWBD 1VZ7A 4AQ7A 4CQNA 2G1EA 1HZ6A 1VRAB 4P16A 1E7PB 2RDHA 4A8XC 3VRBB 3NVVA 3FC4A 3UI3A 1LO5D 1VLBA 4ZHOA 1JQ4A 1JWMD 1CJEA 4NZLB 4ZHPA 4RGTA 2WXFA 2QIEB 3ZJUA 1F2RC 1FO4A 2L52A 2GI9A 2JWUA 2PTLA 1KF6B 1ZUD2 2BB6A 2PW9A 4RCOA 3IAM1 3LXFA 1EU3A 2J42A 2WXMA 2BS2B 3IT6B 3NVYA 1SE3A 4XE0A 4LTUA 1UGJA 3AE3B 3BVGA 2ZW0A 3I9V1 4YSYB 1L4DB 3IAS1 3RFZB 4DXFA 1F2RI 1V1OA 3AEDB 2JXTA 3R2TA 1I4XA 1XF5L 2QJLA 3LB8C 2NTSA 1V97A 1KFYB 3BVMA 1DOIA 3NS1A 1FIQA 4NJCA 3H8HA 3AV8A 1C78A 1P7EA 1ROEA 4US9A 1VDVA 3BVZA 3W9CB 4YSXB 2KACA 5HFYA 2Y5PA 1STEA 5T8IA 3EGRA 4D2KA 2WQYB 5HHDG 2MJ3A 2WXRA 3GB1A 3V3XA 2WNMA 2M19A 1D6EC 1OQRA 1FM0D 1E9MA 2QILA 2BBCA 3VR9B 3DWGC 2GB1A 3WCQA 2RMMA 5I4DA 1VZ6A 1C79A 2ON8A 4RF1A 3MP9A 4YTPB 4UDUC 4RNAA 2BW2A 1DOXA 2IDYA 2LEKA 1D5ZC 1TS5A 1TJEA 2FUG1 2L83A 3P4SB 3V05A 1WGKA 2DBYA 2SAKA 1L0VB 1TY0A 2X38A 2AQ1B 2N9KA 3BK2A 2M0AA 1ESFA 1DYQA 5EE9A 1I4PA 3Q69A 1T3QA 1C4CA 1TKEA 4IDIA 2MEKA 4N6EB 2INNE 1SXTA 1RWSA 2BTEA 3E9SA 4HJGE 2WS3B 5HG2A 3BIID 1UWXA 1L0YB 1UNSA 3W5VB 2G9HD 5GXGB 3OWEB 1L4ZB 1R7SA 1VR9A 2DLBA 1XLPA 2KMMA 1FFVA 2QMTA 4GDKB 2WXOA 4TMAB 1JRPA 1EM7A 3KWLA 4B0MA 4WQMA 1J7CA 2LHDA 2LUMA 1PUTA 4A6QA 3C8YA 1FCCC 3IT4B 1QOFA 2XNAC 1B1ZA 5EE3A 4N58A 4OW0A 2HDEA 4XWWA 3Q8BA 5G5HA 1GOZA 1E10A 2NTTA 1SJHD 1YNTE 2MJDA 1PGBA 3FILB 1XXGA 3AM9A 4XDDA 1YQ4B 3ZJTA 2H89B 2K3UA 3Q8FA 4YWGG 1XEEA 1QOAA 3AE5B 1N62A 5BMIA 1FCLA 3GS2A 1N63A 2DYMA 3N9YC 2QEJC 2W82A 3AEAB 1SF0A 3MJ5A 3PZ7A 3GP7A 4OZCA 1YN3A 1TS2A 1TKYA 3TUOA 3BZDB 2MJEA 1ZDVA 2AX5A 3BYTB 4OZBA 3SFDB 3TEXA 3R2IA 1KRHA 2J53A 4N59A 1FXAA 2NMQA 1FRDA 3AEEB 4USAA 2WP9B 4RGMA 1YJJA 2BS3B 2V4IB 1N61A 2L1AA 1SSNA 1T5XD 3VQIA 3BYYB 4NAWB 3I57A 1ET9A 1FD6A 1M4VA 3AB5A 4NAMA 3URYA 4O1NA 1TKGA 1ET6A 2JU6X 3AE4B 4ZRPA 1DOYA 3VRAB 1V8CA 2WXGA 4KKJA 3CIRB 3FILA 1WXQA 4JX1C 1NYQA 1V1PA 1F0ZA 1QOGA 4KX6B 3KWVA 4HROA 3KQ4A 1JWAD 1I4GA 3BWUD 4R3DA 1IGCA 3AE7B 4KKIA 2LMCA 4WIPA 4KGSA 1TY2A 2KQ4X 1BMLC 5JXVA 4HKQA 2IGDA 2JSVX 2FBWB 4RGNA 1SE2A 1D4BA 1HEZE 4WAFA 2ZW1A 1XLOA 4A90A 4HRSA 1C9FA 5D3IB 1MHXA 3W2DA 1TS4A 1FNUA 1I4RA 1QILA 1KLGD 3T3NA 1GB4A 3O13A 1EWYC 2Y5CA 3P4RB 1UUPA 3B2GA 4WURA 3CWIA 3NUHB 3Q8AA 1SB3C 1MHHE 1IBXA 3AECB 1UWMA 4ZRQA 4ITKA 5FR3A 5BMHA 1C77A 4JWUC 1EU4A 2YEPF 2Y3AA 4WH4A 1IGDA 2XN9C 2W54A 1MPEA 3MFGA 4GLSC 1XLNA 4AS1A 1ZXHA 1TYGB 2YEPB 2M56B 2KWDA 1WRIA 4L23A 5BMGA 3AH7A 4J3OD 1PDXA 1T6BX 2IGGA 4FXCA 4P6VF 1SIJA 2IPKD 4YXDB 1NENB 2DWQA 1ZP0B 1PFDA 3AMZA 3U4EG 3AN1A 1GB1A 4RGOS 1J7BA 2V0GA 3AE9B 2JZPA 1JMLA 3RPFC 2ICIA 1L6UA 5H8YE 1OFFA 2LGIA 1BXTA 1NEKB 3PO0A 1FRRA 1ENFA 2WLBA 3Q8EA 1P7FA 4EE2A 2K9XA 2INPE 4RF0A 1YN5A 5C2TB 5LNK1 1I4HA 2N9LA 4ZOHC 4JE3B 2K0PA 2D5GA 3J9CA 4B0EA 1PGXA 2ACZB 5FK9C 2B76B 3B2FA 1V1PB 3P4PB 2N0SB 2IGHA 2WXHA 3IXSA 2LJIA 4KGTA 5E6JA 2W3RA 3P63A 1WSPA 1YN4A 2J4XA 3W1SA 4C7ZA 3KLSX 3R8BA 1FFUA 3ABVB 1ZE3D 1MVKA 2OEDA 1AW7A 3ZJVA 3AE8B 3LYYA 4ZYSA 1N60A 1C76A 2RPVA 4OVZA 1K52A 1AYFA 1KTKA 1JW9D 1BUIC 5AUKA 2N7JA 3AEFB 2I2YA 3EA6A 4REZA 4XWTA 2KN4A 1RFKA 5BYRA 1I4QA 3P4QB 5BYQA 2IJ0A 4DXGA 5MPOA 1FNVA 2WXQA 1K53A 3AE6B 1FNWA 2CJNA 1IBXB 3E56A 4A55A 3AE2B 4YTMB 4HEA1 1QKZA 1RYJA 4JPSA 3T3OA 4ARCA 3SFEB 2K5PA 2BYTA 2GRIA 2JX5A 2AQ3B 1VJKA 5H92C 3AE1B 4LLGM 1PYWD 1XCQL 3TEYA 3VR8B 2E6XA 1XO3A 4TQ1A 3NZ3A 4HKZE 1IUEA 5D7GA 2KDMA 1K51A 2LHEA 4LK0M 2EKIA 1ACCA 3ETRA 3P42A 3ZYYX 1L0XB 3HVDA 2Q5WD 2W55A 4L2YA 1AWDA 2BB5A 4MT5A 1E0ZA 1Y56A 4L1BA 1ZDXA 1TZOA 2L32A 3U7ZA 3W5UB 1L5PA 2V3NA 2PMVA 1C4AA 4H2AA 5BYSA 3ZGZA 4RH6A 1RM6C 1ZOYB 2Z8LA 3FAHA 4ARIA 3P1MA 5G5GA 2JYTA 4US8A 1N5WA 4MACA 4YTNB 1GAQB 1I7HA 1Q10A 4YSZB 2HTME 4C7YA 2H88B 2TSSA 4YT0B 4OHJA 1YJIA 5EE0A 5EE1A 1KH0A 5HI1A 3MHZA 2QSDA 4OZAA 1JWUD 1VZ8A 4IKGA 1YMHE 1NI3A 1SEBD 1CZPA 2J52A 4RFBA 5AUIA 1L6VA 3BK1A 1D5XC 1AN8A 1J7AA 1MI0A 2PVOD 2WXNA 1QT9A 2WDVB 1NVID 2AQ2B 1KLUD 2WXLA 3PZ8A 1SE4A 1NYRA 1ZXIA 3SR6A 1FXIA 1D5MC 2BS4B 4WWMA 2W3SA 2OHFA 4MH8A 2DYOA 3U52E 2PVGC 1TS3A 5TSSA 3Q8CA 4A9AA 3TEWA 2E3TA 1EWCA 4M0WA 1QOBA 1FMAD 4IOIE 1C4PA 4KGRA 3TSSA 2PIAA 2WDRB 1JALA 2JQRB 2JYEA 1HA5A 1SJED 2KAJA 2VZKB 2WDQB 3EUB2 1QF6A 3HRDD 2PKOA 3L4PA 3SEBA 4TQ0A 3ZQ4A 1WWTA 2WXIA 2K22A 1HXYD 5FKAC 3HVZA 1JROA 1PGAA 1K50A 5D3DA 1DGJA 3AEGB 1B9RA 1WYGA 1CQVA 1F77A 1ZPSA 3B9JA 4JWSC 4DQOC 1QQRA 4C80A 1GPXA 3NVZA 2EELA 2ONQA 1XLQA 3HUIA 4GDLB 2WU5B 2WXKA 1JCKB 2WU2B 4TSSA 4C56C 2I38A 4XDCA 2WXPA 2CU3A 4Q2JA 2R61A 3U2SC 2SEBD 2PLPA 2MH7A 1XCTL 3MC0B 1QLBB 3NRZA 2CJOA 1HZ5A 2WXJA 1HQRD 1E6EB 2BT6A 2VZKD 1FEHA 2RDGA 4PT5A 2LFIA 3DWMA 2V3PA 3AEBB 3TEZA 1CK1A 1N5XA 1OQQA 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYY A;  3Q69 A;  2LFI A;  3NZ3 A;  3I57 A;  4MT5 A; 
#chains in the Genus database with same CATH topology
 1YQ3 B;  3Q3O C;  4GIV A;  2PEA A;  1VZ7 A;  2QDF A;  1HZ6 A;  1VLB A;  2V9H A;  1GG3 A;  4WJO A;  4ZHO A;  4IC7 B;  1JWM D;  4ZHP A;  2WXF A;  2QIE B;  2UYZ B;  4PS7 A;  1F2R C;  2LGD A;  5L83 A;  2KVZ A;  2L52 A;  2PTL A;  3HK0 A;  4DHZ E;  4RCO A;  3PLV A;  1UZX B;  3PVL A;  3IT6 B;  2INC C;  4LTU A;  1S3S G;  3KVF B;  3AE3 B;  4M0W B;  1L4D B;  2V3S A;  3ZUN A;  3ZRF A;  2JZZ A;  2JXT A;  3R2T A;  1XF5 L;  2NTS A;  3Q3F A;  3NS1 A;  1GJZ A;  2IYD B;  1L7Y A;  2KTF A;  1ROE A;  4US9 A;  2PPH A;  1VDV A;  2M8S A;  3W9C B;  1PQS A;  2Y5P A;  1STE A;  5T8I A;  2KVR A;  2RR9 A;  2NR2 A;  5FR6 A;  3MTN B;  2WXR A;  4BFR A;  3PRZ A;  1FM0 D;  1MFW A;  2RMM A;  1VZ6 A;  4JQW C;  2ON8 A;  1WMH B;  3K9P B;  4BKS A;  2KFK B;  3V6E B;  1WX9 A;  3PS6 A;  2LEK A;  1R4N I;  2LVP A;  1YQB A;  1WGK A;  1TTN A;  2DBY A;  2AQ1 B;  2LVO A;  2K1F A;  1C4C A;  1TKE A;  4IDI A;  2YLM A;  4RM8 A;  2BTE A;  4LNI A;  1WGY A;  5DCN A;  3BII D;  3W5V B;  4GDK B;  1XLP A;  4MH0 E;  4TMA B;  3L08 A;  4WQM A;  1FXT B;  1E8X A;  3B1L X;  3QWZ B;  1UF0 A;  2MBO A;  4N58 A;  3KUD B;  4BOS C;  1EUV B;  2HDE A;  3A4R A;  3Q8B A;  4TUU A;  1GC7 A;  1GOZ A;  4P1B C;  3TCA A;  4XC2 A;  2NVU I;  2H89 B;  1A5R A;  2WYQ A;  3RNE C;  1N62 A;  2REX A;  2CU1 A;  1SF0 A;  4NJ7 A;  4ZRK A;  3RNA C;  3BZD B;  2MJE A;  2KDE B;  3BYT B;  4OZB A;  4EOY A;  2J53 A;  4DHJ B;  2NMQ A;  1FRD A;  3CF6 E;  1YJJ A;  2D3A A;  1TT5 B;  4XGA B;  3QA8 A;  2L0F A;  3BYY B;  4NAW B;  3I57 A;  1WH3 A;  1P98 A;  3A1Q A;  3NS8 A;  2JU6 X;  4ZRP A;  2KFJ A;  2KJH B;  2N1V A;  2ZVO A;  2QHO A;  1E8Z A;  4HRO A;  3KQ4 A;  4ANW A;  4R3D A;  4KKI A;  3UGB B;  4BBN C;  2K39 A;  2G45 B;  1TY2 A;  2I1J A;  1OGW A;  1TZ1 A;  1BML C;  2ZZP B;  2ZNV C;  2IND C;  1D4B A;  2VRR B;  2JRI B;  1GNU A;  4A90 A;  2DZM A;  1FNU A;  1I4R A;  3VXW A;  1QIL A;  3T3N A;  4ANV A;  2JF5 A;  2KAN A;  3A9K B;  2VH2 A;  1HTO A;  3Q8A A;  3AEC B;  1UWM A;  3NG0 A;  4ITK A;  5FR3 A;  1C77 A;  2Y3A A;  1IGD A;  2XN9 C;  4GLS C;  3B0A A;  2YEP B;  2I1K A;  2KWD A;  3D32 A;  2MBB B;  4P6V F;  2IPK D;  3VDZ A;  3U4E G;  1UEL A;  3P2B A;  2BYE A;  2V0G A;  2KOX A;  2JZP A;  1L6U A;  5H8Y E;  1OFF A;  3W1S C;  3AI5 A;  1BXT A;  4GB9 A;  1NEK B;  2KWC A;  5G2N A;  3PO0 A;  4KSK C;  4EE2 A;  3A9J A;  1YN5 A;  3KW5 B;  5C2T B;  3QHT A;  4MGK E;  5JHB A;  4JE3 B;  2K0P A;  1PGX A;  3ZNI D;  3B2F A;  4GGQ A;  1V1P B;  2HD5 B;  3P4P B;  2IGH A;  2WXH A;  3IXS A;  5CHV C;  2J4X A;  4W9G A;  3W1S A;  1HE8 A;  4C7Z A;  3SD5 A;  3R8B A;  1ZE3 D;  2OED A;  2PE9 A;  2BYV E;  3ZVV A;  3DBH I;  2JT4 B;  4FN2 A;  3RUI B;  1KTK A;  2WHI A;  5AUK A;  3Q6B A;  4GXB A;  2GBJ A;  2JUO A;  2GBN A;  4XWT A;  2KN4 A;  3U8Z A;  4WJQ A;  1I4Q A;  1FNV A;  2WXQ A;  3DHG C;  2KX0 A;  3AE6 B;  3DBS A;  1XD3 B;  1IBX B;  4A55 A;  1IYF A;  4YTM B;  3GZN I;  4HEA 1;  3T3O A;  4JPS A;  2JX5 A;  2RPQ A;  3WA0 A;  4P7I A;  2FIF A;  4N9F 4;  4LK0 M;  1K51 A;  2EMT A;  1G6J A;  1F52 A;  2VH1 A;  4S17 A;  4IWP A;  1L0X B;  4E3C A;  2DAF A;  3HVD A;  4B95 A;  1E0Z A;  5DPT A;  3QK0 A;  2JZ3 B;  4RH6 A;  5CHW A;  2M1M A;  3RZW C;  4F8C B;  5G5G A;  2GBK A;  3DBR I;  1GAQ B;  2TSS A;  4FHJ A;  1M94 A;  1WXM A;  1YMH E;  4NQK E;  4RFB A;  5AUI A;  2O2V A;  2FAZ A;  2WDV B;  2AEH A;  1KLU D;  3M63 B;  2WGS A;  4K7U A;  1SE4 A;  1SIF A;  4WWM A;  2BS4 B;  2FCQ A;  2OHF A;  1Q5W B;  2K6Q A;  3R7Q A;  3ZXV A;  5AZF A;  3PTF C;  5LLI A;  4M0W A;  4KDI C;  1C4P A;  4KGR A;  3TSS A;  2JYE A;  1WX7 A;  1QF6 A;  3SEB A;  2KX3 A;  1WXS A;  2K22 A;  5IA7 A;  3A4S C;  3HVZ A;  5FKA C;  1JRO A;  1K50 A;  3B9J A;  3NHE B;  3Q3N C;  2C5L C;  4W9K A;  3VUW A;  1GPX A;  3NVZ A;  2FNJ B;  2WXK A;  4JLC A;  4C56 C;  2WXP A;  3N30 A;  3SDL C;  2CJO A;  3QAQ A;  2BT6 A;  4AP4 C;  2IY1 B;  4FBJ B;  2IO3 B;  2RDG A;  2M17 A;  3AEB B;  1CK1 A;  2MHJ A;  4MM3 B;  3NVW A;  5C3J B;  1J0G A;  3PRE A;  2FE8 A;  1SBB B;  3I5J C;  2OJW A;  3VHT C;  1E7P B;  3AU5 A;  3X23 A;  3BIN A;  2JWU A;  2KJR A;  2BB6 A;  4M8M A;  4W9H A;  1QZE A;  2J42 A;  1YOV B;  1YX5 B;  2WXM A;  1OQY A;  1UGJ A;  2UU7 A;  4YSY B;  2PE6 B;  4IUM B;  3IAS 1;  1V1O A;  2V4L A;  3AED B;  1WRD B;  1EF1 A;  1V97 A;  3DBL B;  4II3 B;  1F9J A;  4NJC A;  1C78 A;  2Z59 B;  1P7E A;  1WXA A;  2KMA A;  4YSX B;  2JRH A;  1TGZ B;  4D2K A;  5HHD G;  4DBG A;  3QIJ A;  1E9M A;  2BBC A;  1CMX B;  1V6E A;  4KZ0 A;  4W9F A;  3DWG C;  4HDO A;  4LNF A;  5I4D A;  2ZPY A;  1N6Z A;  1TIF A;  3MP9 A;  4YTP B;  2RGF A;  1T0Y A;  4RNA A;  4CHK A;  1WIA A;  1DOX A;  2IDY A;  3VTU A;  3AUL A;  1WFY A;  5CTR C;  1D5Z C;  3V62 A;  1TS5 A;  1TJE A;  2FUG 1;  4EUT A;  3V05 A;  1V5O A;  2IBI B;  2SAK A;  2X38 A;  2BPS A;  1AAR A;  3BY4 B;  2N9K A;  3C19 A;  2M0A A;  1ESF A;  5EE9 A;  3Q69 A;  1T0Q C;  2MEK A;  2KO3 A;  1T0S C;  1WJN A;  2MP2 B;  1UWX A;  1L0Y B;  3OWE B;  4K3C A;  2DLB A;  4W9J A;  2WXO A;  4OVV A;  1JRP A;  1EM7 A;  2BKF A;  4B0M A;  2XK5 B;  2X8X X;  4A6Q A;  1UD7 A;  3IT4 B;  1B1Z A;  2ZCC A;  2ZJD A;  2NTT A;  1SJH D;  4C4V B;  1YNT E;  1PGB A;  1WE7 A;  1NBF C;  3ZJT A;  2JY6 A;  1XEE A;  3Q3M C;  1FCL A;  5BMI A;  4ZRJ A;  2ZPN A;  1H8C A;  2MQJ A;  3TMP B;  1SGH A;  3AEA B;  3PZ7 A;  4OZC A;  1YN3 A;  1TS2 A;  1TKY A;  3TUO A;  5D2M B;  3EC8 A;  2LWP A;  3N1Z C;  3AEE B;  2KQ7 A;  2NS5 A;  2OOB B;  1UBI A;  4RGM A;  2L1A A;  1T5X D;  5DPR A;  2HTH A;  4M02 A;  2D3G A;  4MGI E;  1TKG A;  1DOY A;  4QAY A;  3ZLZ A;  4ICU A;  3VRA B;  2WXG A;  1YJ1 A;  3CIR B;  3NJT A;  3FIL A;  4WAA A;  5KHQ A;  4XZ4 A;  1WXQ A;  1NYQ A;  1V1P A;  1R4M I;  1QOG A;  3WIM A;  4KX6 B;  4HPL B;  2J0J A;  1R4N B;  3AE7 B;  2LMC A;  1FPY A;  2DAJ A;  3IBE A;  1IPG A;  2KLG A;  2C9W B;  3MJW A;  4HKQ A;  2IGD A;  4LNN A;  2IO2 B;  2FCS A;  2JSV X;  1WY8 A;  4ASW C;  2MW5 A;  1HEZ E;  1XLO A;  1C9F A;  5D3I B;  1MHX A;  4DWF A;  3UF8 A;  1OTR B;  1V80 A;  2KT7 A;  2EKE C;  2Y5C A;  4WJP A;  3DVN V;  2KXJ A;  2N9P C;  3CWI A;  4MJS B;  1SB3 C;  1IBX A;  5BMH A;  3TJP A;  2C60 A;  5KHO A;  3OLM D;  1EU4 A;  2W54 A;  1MPE A;  3MFG A;  1V9J A;  2HE7 A;  2M56 B;  1UH6 A;  3H9D A;  1T6B X;  2MWS B;  5C1Z A;  2O6V A;  1NEN B;  1VCB A;  2KMC A;  1ZP0 B;  1GB1 A;  2KTR A;  3WAN A;  5BO4 B;  3AE9 B;  2DNF A;  1JML A;  3RPF C;  3U30 A;  2BKR B;  3ZNZ B;  4FAD A;  4IWO A;  3Q2A C;  1ENF A;  4IM3 A;  3Q8E A;  4EZL A;  2INP E;  4B9K A;  2ASQ A;  1T0R C;  5JZE B;  3ML8 A;  4ZOH C;  3CSF A;  3J9C A;  3EHV A;  3O65 B;  2B76 B;  3SHQ A;  2W3R A;  3P63 A;  1YN4 A;  4JGH B;  2C7M B;  3ABV B;  4YL8 A;  1BT0 A;  3PRM B;  5D94 A;  3OJ3 A;  4ZYN A;  2J0K A;  5JHA A;  1K52 A;  2D3B A;  2I2Y A;  1XQQ A;  2N7D A;  2DZI A;  1RFK A;  5DPW A;  3WAL A;  1I42 A;  3P4Q B;  3MHS D;  2IJ0 A;  4ANX A;  1K53 A;  3PLU A;  1FNW A;  1KOT A;  1E90 A;  2LVQ A;  2CHX A;  3E56 A;  2R2Q A;  3SFE B;  1C1Y B;  1PYW D;  1XCQ L;  4A3O A;  3TEY A;  2KDM A;  2EKI A;  3P42 A;  3ZYY X;  3U7D A;  1V2Y A;  3U7Z A;  2V3N A;  2PMV A;  3ZGZ A;  3IG3 A;  3JW0 X;  3FAH A;  4US8 A;  2JYT A;  2N4F A;  4YTN B;  2HTM E;  2H88 B;  5EE1 A;  2KWV B;  3MHZ A;  1TBE A;  4OZA A;  1VZ8 A;  4IKG A;  3I63 C;  1CZP A;  1RFA A;  1D5X C;  1AN8 A;  1J7A A;  1NVI D;  2LRU A;  2AQ2 B;  3UIN B;  2B3A A;  3PZ8 A;  1NYR A;  4HK2 A;  4MH8 A;  3RYT A;  2PVG C;  1TS3 A;  2K8C A;  1EWC A;  4BKT A;  1QOB A;  2NPT A;  4IOI E;  4JL9 A;  1JAL A;  3VH3 B;  2JQR B;  3DBH B;  2K8B A;  2KAJ A;  5EDS A;  3HRD D;  4K1R B;  4IG7 B;  2JWZ A;  3APF A;  1HXY D;  2NBW B;  4MEL A;  2Z0D B;  2IY0 B;  2MBE A;  2PJH A;  2GOW A;  1X1M A;  3DHH C;  1YIW A;  2KDF B;  2ZVN A;  1IP9 A;  3APD A;  1JCK B;  3GZN B;  4W9I A;  1WE6 A;  4HPM B;  2CU3 A;  3U2S C;  4X57 B;  2MH7 A;  1XCT L;  3MC0 B;  4LNO A;  2L05 A;  1E6E B;  2VZK D;  4DK5 A;  4LNK A;  3DWM A;  2BWF A;  3TEZ A;  3DQV A;  5IP4 D;  4W9E A;  3MC8 A;  1JWS D;  1JWB D;  3DVN U;  4CQN A;  2G1E A;  4EFO A;  4P16 A;  2MP2 A;  3DBR B;  4A8X C;  3VRB B;  3KYC D;  3S2A A;  3H1U A;  3UI3 A;  2L3Z A;  1LO5 D;  2L7R A;  4GDL A;  4NZL B;  2XK5 A;  3C0R B;  1FO4 A;  2GI9 A;  1ZUD 2;  2WWZ A;  2GLS A;  3LXF A;  1EU3 A;  3ZKJ C;  2BS2 B;  1SE3 A;  2J0M A;  3TIX A;  2FCN A;  2LGX A;  3BVG A;  3ONS A;  3RFZ B;  4TV3 A;  1F2R I;  4WQO B;  1I4X A;  3ZNH B;  3LB8 C;  1J19 A;  3BVM A;  1DOI A;  1LM8 B;  1FIQ A;  3H8H A;  3AV8 A;  4TKN A;  3HHM A;  2MBH A;  2G4D B;  3BVZ A;  2HJ8 A;  3ZTD A;  2KAC A;  3N3K B;  3EGR A;  2WQY B;  1OQR A;  1E8Y A;  3RUL A;  3KUZ A;  2GB1 A;  1E7V A;  2J7Q B;  4FLH A;  2KYW A;  4DXA B;  4RF1 A;  2LAS A;  4UDU C;  4KSL C;  1L2N A;  1WGD A;  3I3T B;  2ZEQ A;  4BOZ B;  4BZA A;  1Q1O A;  2K6D B;  1Y8R C;  2JPH A;  2NBU A;  4NQL B;  2N9X A;  3BK2 A;  1DYQ A;  1I4P A;  1WR6 E;  1P0R A;  4I6P A;  1RWS A;  2RDB C;  1V5T A;  1ZW7 A;  4HJG E;  2WS3 B;  5HG2 A;  4PK1 A;  2L0T A;  3M95 A;  1UNS A;  2G9H D;  5GXG B;  1L4Z B;  1R7S A;  1LFD A;  3IFW B;  4FUL A;  2QMT A;  1WGH A;  4W9D A;  3NY5 A;  1WMH A;  3C8Y A;  4II2 B;  3IHP C;  1QOF A;  2XNA C;  2BF8 B;  2KFK A;  2KWU B;  3SU8 X;  4XWW A;  4S0R A;  2KQS A;  4GSW A;  1XT9 B;  2MJD A;  1XXG A;  3AM9 A;  4XDD A;  1YQ4 B;  3Q8F A;  4YWG G;  4G50 A;  4IW0 A;  3AE5 B;  3GS2 A;  1N63 A;  3JYU A;  5CHF A;  2DYM A;  3MJ5 A;  3GOE A;  2QCZ A;  3H7P B;  1WX8 A;  1ZDV A;  1WXV A;  3TEX A;  3TBL D;  4A3P A;  2FUH B;  4GDK A;  4USA A;  2BS3 B;  2LI5 A;  3PZD A;  3VQI A;  2DHZ A;  2KC1 A;  1ET9 A;  1I35 A;  1Z5S B;  5GMV A;  4KIK B;  3AB5 A;  4O1N A;  3PSE B;  1ET6 A;  3AE4 B;  5LXH A;  4KKJ A;  2BWE S;  2ZNV B;  4LDT B;  4JX1 C;  1F0Z A;  3KWV A;  1JWA D;  4G0N B;  1IGC A;  4WIP A;  4KGS A;  3RMK C;  3CMM B;  2KDB A;  5JXV A;  2CKH B;  4LJO B;  2MA9 B;  2FBW B;  4RGN A;  1SE2 A;  3GE8 C;  3AU4 A;  4WAF A;  4K7W A;  4HRS A;  4E71 A;  4AWJ A;  3W2D A;  1TS4 A;  3HM3 A;  5TR5 A;  3R3M A;  2CHZ A;  4BKS D;  3IVF A;  4NAW A;  1GB4 A;  1EWY C;  3P4R B;  2AWT A;  1UBQ A;  3N20 C;  3QCA A;  3NUH B;  1MHH E;  5HKH A;  3RCZ A;  3A9J B;  4ZRQ A;  3KUC B;  4WH4 A;  4J6I A;  1ZXH A;  3L17 A;  1TYG B;  2O6V D;  4DDG D;  4MSQ B;  4HCP B;  3AH7 A;  2DX5 B;  4WJN A;  2IGG A;  3OJ4 B;  1WYW B;  4YXD B;  2DWQ A;  1PFD A;  2MSE D;  1WJU A;  3AN1 A;  3ZO5 B;  1J7B A;  5LXI B;  4EZJ A;  2ICI A;  3V61 A;  2JXX A;  4PYZ A;  4WWP A;  5IN7 A;  5IO9 A;  4AJY B;  3A9K A;  1FRR A;  2C7N B;  4EZK A;  1P7F A;  2K9X A;  1JRU A;  2KKC A;  5JH5 C;  4RF0 A;  1VD2 A;  2MRP A;  5LNK 1;  4HVB A;  4RM9 A;  5G55 A;  2D5G A;  3A33 B;  1RRB A;  4FJZ A;  2N0S B;  5E6J A;  2D10 A;  3JVZ X;  5J18 A;  1R4M B;  3RN9 C;  1AW7 A;  2CHW A;  4K3B A;  3AE8 B;  3LYY A;  3NOB A;  2IO1 B;  4ZYS A;  1C76 A;  2M4N A;  2G3Q B;  2RD0 A;  4AJW A;  3EA6 A;  2W9N A;  3DVG Y;  3L0W B;  4HWI B;  1YX6 B;  4BBN F;  1MG8 A;  2A4Z A;  3MC9 A;  3ZXR A;  2CJN A;  2K25 A;  3AE2 B;  2FID A;  1QKZ A;  1RYJ A;  4ARC A;  2A5U A;  2K5P A;  2O2V B;  3Q3J A;  4LJP B;  4HPP A;  2E6X A;  2Y5B B;  4TQ1 A;  2CS4 A;  5D7G A;  2LHE A;  2IO0 B;  1C3T A;  3ETR A;  1KM7 A;  1OEY A;  3R66 C;  5DPS A;  2W55 A;  4L2Y A;  1AWD A;  4MT5 A;  1Y56 A;  3W1Y A;  1L5P A;  3UIP B;  2RSU A;  5BYS A;  3EEC A;  5IKC M;  1RM6 C;  1WF9 A;  4GOC A;  1N5W A;  2XBB C;  1Q10 A;  4YSZ B;  4C7Y A;  2L76 A;  4YT0 B;  5EE0 A;  1KH0 A;  2DZK A;  2Z0E B;  2QSD A;  4LDT D;  4KVG B;  1ZGU B;  4W9C A;  3DHI C;  5E6P A;  2LXC A;  3LDZ E;  1L6V A;  3QJZ A;  1MI0 A;  2PVO D;  2WXN A;  1QT9 A;  4EEW A;  2K8H A;  2OJR A;  5AEK B;  2WXL A;  1ZXI A;  3SR6 A;  3UQA A;  1D5M C;  2W3S A;  4G3X B;  4PS8 A;  3VUY A;  5TSS A;  1E7U A;  3Q8C A;  4A9A A;  2MBQ A;  3TEW A;  2CR5 A;  2E3T A;  3N1Y C;  1V81 A;  4ZDV A;  1FMA D;  4M01 A;  2UWQ A;  3DVG X;  1WZ0 A;  2HJ1 A;  1HA5 A;  1SJE D;  2VZK B;  2WDQ B;  3EUB 2;  2D3C A;  2PKO A;  3L10 B;  4TQ0 A;  3ZQ4 A;  1WWT A;  2WXI A;  1ZKH A;  5D3D A;  4HCN B;  3DCG A;  3AEG B;  1B9R A;  1ZPS A;  4DQO C;  1QQR A;  4C80 A;  2N9E B;  1WGG A;  2ONQ A;  3ZRC A;  4XX5 A;  4HJK A;  2WU5 B;  1EO6 A;  4LCD E;  4TSS A;  3UQB A;  2I38 A;  4Q2J A;  1WR1 A;  2R61 A;  3ECI A;  4FJV B;  4G11 A;  4KZC A;  1QLB B;  1WJ4 A;  3NRZ A;  1HZ5 A;  2WXJ A;  4AUQ C;  1HQR D;  3KH0 A;  3M3J A;  2V3P A;  4M00 A;  3ENE A;  2N7E A;  1OQQ A;  1A70 A;  3JSV B;  2DYB A;  3RNC C;  3NZU A;  3VVW B;  4AQ7 A;  3L16 A;  1NI2 A;  2KZR A;  3AXC A;  2LUE A;  5E6N A;  1VRA B;  3PHW B;  1HTQ A;  2RDH A;  3NVV A;  3QC8 B;  3FC4 A;  3FKY A;  1P3Q U;  1JQ4 A;  1CJE A;  2GBM A;  4RGT A;  1NDD A;  2M0X A;  3ZJU A;  3N32 A;  3APC A;  2LD9 A;  1KF6 B;  2PW9 A;  4DDI D;  3IAM 1;  1EF5 A;  2LRW A;  2D11 A;  3WAO A;  3NVY A;  4XE0 A;  2FCM A;  4B6W A;  2ZW0 A;  3I9V 1;  4DXF A;  1WZ3 A;  4MM3 A;  2QJL A;  1KFY B;  2KK8 A;  2ZCB A;  1LXD A;  3RD2 A;  4DHZ B;  3PPA A;  2N1W A;  3RI7 C;  2QC8 A;  4E74 A;  3H7P A;  5HFY A;  1P1A A;  2LGS A;  4GU2 A;  2MJ3 A;  3GB1 A;  3V3X A;  2WNM A;  2M19 A;  1D6E C;  2QIL A;  2KLC A;  3VR9 B;  3WCQ A;  5CX3 A;  1MJD A;  1C79 A;  3H6N A;  4KIK A;  2BVC A;  2KHW B;  2BW2 A;  3EFC A;  4KV2 A;  2L83 A;  2V1Y A;  3P4S B;  1WGR A;  2BGF A;  1L0V B;  1TY0 A;  3HIZ A;  3B08 A;  1T3Q A;  4N6E B;  2INN E;  2LZ6 A;  1SXT A;  4HLE A;  3V60 A;  4MDK E;  3E9S A;  4NNJ B;  4CO7 A;  3RT3 B;  2KMM A;  1VR9 A;  1E8W A;  1KJT A;  1FFV A;  3KWL A;  4MEM A;  1J7C A;  2LHD A;  4K81 A;  2LUM A;  1PUT A;  2D2Q A;  2KC2 A;  1FCC C;  3ZDT A;  2LGY A;  1E5W A;  1WI0 A;  5EE3 A;  2MLB A;  5IOI A;  1U4A A;  4OW0 A;  5G5H A;  5C23 A;  1E10 A;  4XYC A;  2D07 B;  5J17 A;  1P9D U;  3FIL B;  1D3Z A;  2IZV B;  3UIO B;  2C7H A;  4FA6 A;  2K3U A;  1RAX A;  1QOA A;  3RNF C;  4K7S A;  3ALB A;  3N9Y C;  2QEJ C;  2W82 A;  2DZJ A;  2KN5 A;  3GP7 A;  2AX5 A;  3SFD B;  4BAX A;  3R2I A;  1KRH A;  2WX0 A;  3CST A;  3QAR A;  4N59 A;  1FXA A;  3H7S A;  2WP9 B;  1V86 A;  2V4I B;  3ZTC A;  1N61 A;  1YD8 U;  4F7Z A;  1SSN A;  2MCN B;  3VUX A;  4AOF A;  1FD6 A;  4ACF A;  1M4V A;  4NAM A;  3URY A;  3K9O B;  3X0W A;  4C4V A;  1V8C A;  3RZF A;  5D6J B;  1H4R A;  3HM6 X;  4M8N A;  4BKG A;  1MG4 A;  1I4G A;  3BWU D;  4PYU A;  1S1Q B;  2KD0 A;  3N1X C;  4DHJ D;  2KQ4 X;  2O6V B;  4A20 A;  2WX1 A;  4ZRI A;  3TL5 A;  4IWQ A;  2KTR B;  1Z2M A;  4I6L B;  2ZW1 A;  3ML9 A;  1GUA B;  5IAA C;  2EMS A;  5E6O A;  3VAW A;  1KLG D;  2DEN B;  3O13 A;  4FJY A;  1UUP A;  1ISN A;  3B2G A;  4WUR A;  1LGR A;  3L54 A;  1F1H A;  1SE9 A;  4JWU C;  1OEY J;  3T8M A;  2YEP F;  4AS1 A;  1XLN A;  1WRI A;  4L23 A;  5BMG A;  3T9L A;  4HXD A;  4OVU A;  3RNG C;  4J3O D;  1PDX A;  4FXC A;  1SIJ A;  3AMZ A;  3PHX B;  4RGO S;  3LJ3 A;  3NZS A;  2LJ5 A;  4C00 A;  2LGI A;  4P1C C;  4MJS A;  2WLB A;  1WM2 A;  4ANU A;  4IM2 A;  2AYO B;  3A1Q B;  3ZW3 A;  2AL3 A;  1I4H A;  2N9L A;  2G4S A;  4B0E A;  3M62 B;  1WJ6 A;  3DDC B;  2ACZ B;  2WDT B;  3PGE A;  4NY0 A;  5FK9 C;  5L95 C;  2LJI A;  4KGT A;  4EKU A;  1WSP A;  1V49 A;  3KLS X;  3GE3 C;  1FFU A;  3OAW A;  1MVK A;  2KJ6 A;  3ZJV A;  3ZIM A;  1N60 A;  2GBR A;  2RPV A;  4OVZ A;  1AYF A;  2XEW A;  4FHK A;  2L00 B;  5AZH A;  1KLV A;  1JW9 D;  3WAM A;  1BUI C;  3RNB C;  2N7J A;  3AEF B;  4GMV A;  4WWN A;  3KYD D;  4REZ A;  1LQB A;  3OG5 A;  4KDL B;  5BYR A;  5BYQ A;  4I6N B;  4DXG A;  5MPO A;  2MX2 A;  3VH4 B;  1GC6 A;  4MGZ E;  4JIO U;  2BYT A;  2GRI A;  2JVC A;  2BYF A;  2AQ3 B;  1VJK A;  5H92 C;  3AE1 B;  4LLG M;  3EFU A;  4CYE A;  3VR8 B;  3DOW A;  1XO3 A;  3NZ3 A;  4HKZ E;  1IUE A;  2GMI C;  1ACC A;  2Q5W D;  2BB5 A;  3DPD A;  4BVU C;  4L1B A;  1ZDX A;  1TZO A;  2L32 A;  3W5U B;  4H2A A;  1C4A A;  3VTV A;  2Z8L A;  1ZOY B;  4PS3 A;  4NJ6 A;  2NPT B;  3JSV A;  4ARI A;  3P1M A;  3VFK A;  4MAC A;  1I7H A;  3ZNG C;  4OHJ A;  1YJI A;  5HI1 A;  4RMA A;  2KDI A;  1JWU D;  4URK A;  1NI3 A;  1SEB D;  2J52 A;  1RLF A;  3BK1 A;  2R2O A;  3PT2 B;  1FXI A;  4F1S A;  2DYO A;  3U52 E;  3R7R A;  4ICV A;  4IM0 A;  1Q0W B;  3DBL I;  3VTW A;  4MSM B;  4MGY E;  2L8J A;  3PV1 A;  4WWO A;  2PIA A;  2WDR B;  1J8C A;  1WM3 A;  3V6C B;  1UGM A;  3L4P A;  3WAP A;  1PGA A;  4HDQ A;  1DGJ A;  1WYG A;  1CQV A;  1F77 A;  3QQ8 B;  4JWS C;  2NCN A;  2EEL A;  1XLQ A;  2AL6 A;  3HUI A;  4W9L A;  4GDL B;  3PRP B;  5AZG A;  2WU2 B;  4XDC A;  2YVC A;  2NBV B;  2SEB D;  2PLP A;  1K8R B;  3QX1 A;  4NPN A;  2LXA A;  2BQQ A;  4GN1 A;  3L13 A;  5J2R A;  3Q14 C;  1FEH A;  4PT5 A;  2KNB A;  2LFI A;  3ZDM C;  1N5X A; 
#chains in the Genus database with same CATH homology
 1A70 A;  1YQ3 B;  3NVW A;  5C3J B;  2FE8 A;  1SBB B;  1JWS D;  1JWB D;  1VZ7 A;  4AQ7 A;  4CQN A;  2G1E A;  1HZ6 A;  1VRA B;  4P16 A;  1E7P B;  2RDH A;  4A8X C;  3VRB B;  3NVV A;  3FC4 A;  3UI3 A;  1LO5 D;  1VLB A;  4ZHO A;  1JQ4 A;  1JWM D;  1CJE A;  4NZL B;  4ZHP A;  4RGT A;  2WXF A;  2QIE B;  3ZJU A;  1F2R C;  1FO4 A;  2L52 A;  2GI9 A;  2JWU A;  2PTL A;  1KF6 B;  1ZUD 2;  2BB6 A;  2PW9 A;  4RCO A;  3IAM 1;  3LXF A;  1EU3 A;  2J42 A;  2WXM A;  2BS2 B;  3IT6 B;  3NVY A;  1SE3 A;  4XE0 A;  4LTU A;  1UGJ A;  3AE3 B;  3BVG A;  2ZW0 A;  3I9V 1;  4YSY B;  1L4D B;  3IAS 1;  3RFZ B;  4DXF A;  1F2R I;  1V1O A;  3AED B;  2JXT A;  3R2T A;  1I4X A;  1XF5 L;  2QJL A;  3LB8 C;  2NTS A;  1V97 A;  1KFY B;  3BVM A;  1DOI A;  3NS1 A;  1FIQ A;  4NJC A;  3H8H A;  3AV8 A;  1C78 A;  1P7E A;  1ROE A;  4US9 A;  1VDV A;  3BVZ A;  3W9C B;  4YSX B;  2KAC A;  5HFY A;  2Y5P A;  1STE A;  5T8I A;  3EGR A;  4D2K A;  2WQY B;  5HHD G;  2MJ3 A;  2WXR A;  3GB1 A;  3V3X A;  2WNM A;  2M19 A;  1D6E C;  1OQR A;  1FM0 D;  1E9M A;  2QIL A;  2BBC A;  3VR9 B;  3DWG C;  2GB1 A;  3WCQ A;  2RMM A;  5I4D A;  1VZ6 A;  1C79 A;  2ON8 A;  4RF1 A;  3MP9 A;  4YTP B;  4UDU C;  4RNA A;  2BW2 A;  1DOX A;  2IDY A;  2LEK A;  1D5Z C;  1TS5 A;  1TJE A;  2FUG 1;  2L83 A;  3P4S B;  3V05 A;  1WGK A;  2DBY A;  2SAK A;  1L0V B;  1TY0 A;  2X38 A;  2AQ1 B;  2N9K A;  3BK2 A;  2M0A A;  1ESF A;  1DYQ A;  5EE9 A;  1I4P A;  3Q69 A;  1T3Q A;  1C4C A;  1TKE A;  4IDI A;  2MEK A;  4N6E B;  2INN E;  1SXT A;  1RWS A;  2BTE A;  3E9S A;  4HJG E;  2WS3 B;  5HG2 A;  3BII D;  1UWX A;  1L0Y B;  1UNS A;  3W5V B;  2G9H D;  5GXG B;  3OWE B;  1L4Z B;  1R7S A;  1VR9 A;  2DLB A;  1XLP A;  2KMM A;  1FFV A;  2QMT A;  4GDK B;  2WXO A;  4TMA B;  1JRP A;  1EM7 A;  3KWL A;  4B0M A;  4WQM A;  1J7C A;  2LHD A;  2LUM A;  1PUT A;  4A6Q A;  3C8Y A;  1FCC C;  3IT4 B;  1QOF A;  2XNA C;  1B1Z A;  5EE3 A;  4N58 A;  4OW0 A;  2HDE A;  4XWW A;  3Q8B A;  5G5H A;  1GOZ A;  1E10 A;  2NTT A;  1SJH D;  1YNT E;  2MJD A;  1PGB A;  3FIL B;  1XXG A;  3AM9 A;  4XDD A;  1YQ4 B;  3ZJT A;  2H89 B;  2K3U A;  3Q8F A;  4YWG G;  1XEE A;  1QOA A;  3AE5 B;  1N62 A;  5BMI A;  1FCL A;  3GS2 A;  1N63 A;  2DYM A;  3N9Y C;  2QEJ C;  2W82 A;  3AEA B;  1SF0 A;  3MJ5 A;  3PZ7 A;  3GP7 A;  4OZC A;  1YN3 A;  1TS2 A;  1TKY A;  3TUO A;  3BZD B;  2MJE A;  1ZDV A;  2AX5 A;  3BYT B;  4OZB A;  3SFD B;  3TEX A;  3R2I A;  1KRH A;  2J53 A;  4N59 A;  1FXA A;  2NMQ A;  1FRD A;  3AEE B;  4USA A;  2WP9 B;  4RGM A;  1YJJ A;  2BS3 B;  2V4I B;  1N61 A;  2L1A A;  1SSN A;  1T5X D;  3VQI A;  3BYY B;  4NAW B;  3I57 A;  1ET9 A;  1FD6 A;  1M4V A;  3AB5 A;  4NAM A;  3URY A;  4O1N A;  1TKG A;  1ET6 A;  2JU6 X;  3AE4 B;  4ZRP A;  1DOY A;  3VRA B;  1V8C A;  2WXG A;  4KKJ A;  3CIR B;  3FIL A;  1WXQ A;  4JX1 C;  1NYQ A;  1V1P A;  1F0Z A;  1QOG A;  4KX6 B;  3KWV A;  4HRO A;  3KQ4 A;  1JWA D;  1I4G A;  3BWU D;  4R3D A;  1IGC A;  3AE7 B;  4KKI A;  2LMC A;  4WIP A;  4KGS A;  1TY2 A;  2KQ4 X;  1BML C;  5JXV A;  4HKQ A;  2IGD A;  2JSV X;  2FBW B;  4RGN A;  1SE2 A;  1D4B A;  1HEZ E;  4WAF A;  2ZW1 A;  1XLO A;  4A90 A;  4HRS A;  1C9F A;  5D3I B;  1MHX A;  3W2D A;  1TS4 A;  1FNU A;  1I4R A;  1QIL A;  1KLG D;  3T3N A;  1GB4 A;  3O13 A;  1EWY C;  2Y5C A;  3P4R B;  1UUP A;  3B2G A;  4WUR A;  3CWI A;  3NUH B;  3Q8A A;  1SB3 C;  1MHH E;  1IBX A;  3AEC B;  1UWM A;  4ZRQ A;  4ITK A;  5FR3 A;  5BMH A;  1C77 A;  4JWU C;  1EU4 A;  2YEP F;  2Y3A A;  4WH4 A;  1IGD A;  2XN9 C;  2W54 A;  1MPE A;  3MFG A;  4GLS C;  1XLN A;  4AS1 A;  1ZXH A;  1TYG B;  2YEP B;  2M56 B;  2KWD A;  1WRI A;  4L23 A;  5BMG A;  3AH7 A;  4J3O D;  1PDX A;  1T6B X;  2IGG A;  4FXC A;  4P6V F;  1SIJ A;  2IPK D;  4YXD B;  1NEN B;  2DWQ A;  1ZP0 B;  1PFD A;  3AMZ A;  3U4E G;  3AN1 A;  1GB1 A;  4RGO S;  1J7B A;  2V0G A;  3AE9 B;  2JZP A;  1JML A;  3RPF C;  2ICI A;  1L6U A;  5H8Y E;  1OFF A;  2LGI A;  1BXT A;  1NEK B;  3PO0 A;  1FRR A;  1ENF A;  2WLB A;  3Q8E A;  1P7F A;  4EE2 A;  2K9X A;  2INP E;  4RF0 A;  1YN5 A;  5C2T B;  5LNK 1;  1I4H A;  2N9L A;  4ZOH C;  4JE3 B;  2K0P A;  2D5G A;  3J9C A;  4B0E A;  1PGX A;  2ACZ B;  5FK9 C;  2B76 B;  3B2F A;  1V1P B;  3P4P B;  2N0S B;  2IGH A;  2WXH A;  3IXS A;  2LJI A;  4KGT A;  5E6J A;  2W3R A;  3P63 A;  1WSP A;  1YN4 A;  2J4X A;  3W1S A;  4C7Z A;  3KLS X;  3R8B A;  1FFU A;  3ABV B;  1ZE3 D;  1MVK A;  2OED A;  1AW7 A;  3ZJV A;  3AE8 B;  3LYY A;  4ZYS A;  1N60 A;  1C76 A;  2RPV A;  4OVZ A;  1K52 A;  1AYF A;  1KTK A;  1JW9 D;  1BUI C;  5AUK A;  2N7J A;  3AEF B;  2I2Y A;  3EA6 A;  4REZ A;  4XWT A;  2KN4 A;  1RFK A;  5BYR A;  1I4Q A;  3P4Q B;  5BYQ A;  2IJ0 A;  4DXG A;  5MPO A;  1FNV A;  2WXQ A;  1K53 A;  3AE6 B;  1FNW A;  2CJN A;  1IBX B;  3E56 A;  4A55 A;  3AE2 B;  4YTM B;  4HEA 1;  1QKZ A;  1RYJ A;  4JPS A;  3T3O A;  4ARC A;  3SFE B;  2K5P A;  2BYT A;  2GRI A;  2JX5 A;  2AQ3 B;  1VJK A;  5H92 C;  3AE1 B;  4LLG M;  1PYW D;  1XCQ L;  3TEY A;  3VR8 B;  2E6X A;  1XO3 A;  4TQ1 A;  3NZ3 A;  4HKZ E;  1IUE A;  5D7G A;  2KDM A;  1K51 A;  2LHE A;  4LK0 M;  2EKI A;  1ACC A;  3ETR A;  3P42 A;  3ZYY X;  1L0X B;  3HVD A;  2Q5W D;  2W55 A;  4L2Y A;  1AWD A;  2BB5 A;  4MT5 A;  1E0Z A;  1Y56 A;  4L1B A;  1ZDX A;  1TZO A;  2L32 A;  3U7Z A;  3W5U B;  1L5P A;  2V3N A;  2PMV A;  1C4A A;  4H2A A;  5BYS A;  3ZGZ A;  4RH6 A;  1RM6 C;  1ZOY B;  2Z8L A;  3FAH A;  4ARI A;  3P1M A;  5G5G A;  2JYT A;  4US8 A;  1N5W A;  4MAC A;  4YTN B;  1GAQ B;  1I7H A;  1Q10 A;  4YSZ B;  2HTM E;  4C7Y A;  2H88 B;  2TSS A;  4YT0 B;  4OHJ A;  1YJI A;  5EE0 A;  5EE1 A;  1KH0 A;  5HI1 A;  3MHZ A;  2QSD A;  4OZA A;  1JWU D;  1VZ8 A;  4IKG A;  1YMH E;  1NI3 A;  1SEB D;  1CZP A;  2J52 A;  4RFB A;  5AUI A;  1L6V A;  3BK1 A;  1D5X C;  1AN8 A;  1J7A A;  1MI0 A;  2PVO D;  2WXN A;  1QT9 A;  2WDV B;  1NVI D;  2AQ2 B;  1KLU D;  2WXL A;  3PZ8 A;  1SE4 A;  1NYR A;  1ZXI A;  3SR6 A;  1FXI A;  1D5M C;  2BS4 B;  4WWM A;  2W3S A;  2OHF A;  4MH8 A;  2DYO A;  3U52 E;  2PVG C;  1TS3 A;  5TSS A;  3Q8C A;  4A9A A;  3TEW A;  2E3T A;  1EWC A;  4M0W A;  1QOB A;  1FMA D;  4IOI E;  1C4P A;  4KGR A;  3TSS A;  2PIA A;  2WDR B;  1JAL A;  2JQR B;  2JYE A;  1HA5 A;  1SJE D;  2KAJ A;  2VZK B;  2WDQ B;  3EUB 2;  1QF6 A;  3HRD D;  2PKO A;  3L4P A;  3SEB A;  4TQ0 A;  3ZQ4 A;  1WWT A;  2WXI A;  2K22 A;  1HXY D;  5FKA C;  3HVZ A;  1JRO A;  1PGA A;  1K50 A;  5D3D A;  1DGJ A;  3AEG B;  1B9R A;  1WYG A;  1CQV A;  1F77 A;  1ZPS A;  3B9J A;  4JWS C;  4DQO C;  1QQR A;  4C80 A;  1GPX A;  3NVZ A;  2EEL A;  2ONQ A;  1XLQ A;  3HUI A;  4GDL B;  2WU5 B;  2WXK A;  1JCK B;  2WU2 B;  4TSS A;  4C56 C;  2I38 A;  4XDC A;  2WXP A;  2CU3 A;  4Q2J A;  2R61 A;  3U2S C;  2SEB D;  2PLP A;  2MH7 A;  1XCT L;  3MC0 B;  1QLB B;  3NRZ A;  2CJO A;  1HZ5 A;  2WXJ A;  1HQR D;  1E6E B;  2BT6 A;  2VZK D;  1FEH A;  2RDG A;  4PT5 A;  2LFI A;  3DWM A;  2V3P A;  3AEB B;  3TEZ A;  1CK1 A;  1N5X A;  1OQQ A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...