4MT5A

Crystal structure of mub-rv
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
184
structure length
184
Chain Sequence
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKTVVYVGDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for adaptation of lactobacilli to gastrointestinal mucus.
pubmed doi rcsb
source organism Lactobacillus reuteri
molecule tags Protein binding
molecule keywords Mucus binding proteinn
total genus 34
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17965 MucBP_2 Mucin binding domain
A PF17966 Mub_B2 Mub B2-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.460 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A02
3.10.20.470 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4mt5A01
2LFIA 3I57A 4MT5A 3NZ3A 3Q69A 3LYYA
chains in the Genus database with same CATH superfamily
1DGJA 2GBMA 5IAAC 3BZDB 3Q8EA 4GU2A 2FCQA 3IXSA 1JWSD 4KSLC 4CHKA 2M19A 1P7EA 2KMMA 5FR6A 1HQRD 3K9PB 1QZEA 3N30A 5J17A 4ZRIA 1QILA 2PE6B 1NENB 4FN2A 3VXWA 2GOWA 1Z5SB 2KDMA 3Q6BA 4FHJA 1WX7A 2ASQA 3ZDMC 1L4ZB 4IWOA 1U4AA 1NI2A 3NZUA 3Q8AA 3RT3B 2QMTA 4LNNA 1I7HA 4IOIE 3DOWA 4N6EB 3NOBA 5D7GA 4WWNA 4QAYA 2TSSA 2V0GA 2PKOA 4XGAB 1SIJA 4DHZE 1A70A 3TEZA 1NI3A 2JZPA 4TUUA 4WJQA 2KVZA 1WGGA 4MDKE 2G9HD 3ZGZA 5C3JB 3AE1B 1MG8A 3KUCB 5J18A 4HKZE 3K9OB 1HTOA 2DAFA 2LJIA 2KLGA 1KOTA 2MQJA 4NQLB 1RWSA 3I9V1 4KX6B 2JWUA 3QA8A 2OJWA 1GUAB 3H9DA 3PSEB 4DDID 3TBLD 3ZYYX 3PO0A 5BMHA 1UELA 2XNAC 3BYTB 3Q69A 1OQRA 2WXRA 4M0WB 1XQQA 4PYUA 1YNTE 3KYCD 4C4VA 2Y5CA 2EMSA 2INPE 2ZPNA 3KW5B 2WXKA 3RNAC 4B6WA 1DYQA 1N5XA 1F77A 1GG3A 3Q3NC 1N60A 5FK9C 2R61A 5T8IA 4AWJA 2V4LA 1E7PB 2LVQA 1RRBA 4PK1A 2HTME 3WAOA 2KXJA 3M62B 2WNMA 4URKA 1QOFA 1PUTA 2AYOB 1OGWA 4FULA 4RGMA 1OQQA 5HI1A 1FXAA 1YX6B 2LXCA 4XDCA 1UGMA 3L08A 3Q8BA 1TTNA 5IN7A 2D3BA 2RR9A 4KVGB 2PW9A 1FD6A 1KTKA 1N63A 1HEZE 3UQBA 2CJNA 3ZNGC 1QLBB 2WXGA 4N9F4 3N1YC 2MP2A 4J3OD 1TS3A 3PTFC 1SE3A 3MJ5A 2ZNVB 4N58A 1FXIA 4WWPA 2LRUA 4I6NB 1N61A 4WURA 2NCNA 1UZXB 4D2KA 2M1MA 1WYGA 3U7ZA 4MSQB 3PRPB 4MM3A 5GMVA 2DYBA 1I42A 2IGHA 3APFA 2EKEC 4YSYB 4JX1C 3L16A 3W5UB 4HRSA 1MG4A 1RLFA 4HWIB 1NBFC 1UWMA 3L54A 1C76A 3I5JC 4RGTA 2Y5PA 3KQ4A 3OJ3A 2BVCA 3ZVVA 3WCQA 5LNK1 3UIPB 1Y56A 3KVFB 3AEEB 4TV3A 1YN3A 2JPHA 2UU7A 1WF9A 2L0TA 2BBCA 2HJ1A 2RMMA 4HKQA 3NS8A 2NBUA 4I6PA 3AN1A 3SR6A 2XBBC 1TKEA 4M02A 4K3CA 2MW5A 4KGRA 2XK5B 2IO2B 4BKSD 4KV2A 1JQ4A 4HCPB 2QHOA 2MLBA 3DCGA 1WFYA 3W5VB 1EWYC 2KDFB 2L0FA 4OZAA 2MH7A 2M8SA 5IP4D 3ZO5B 3SDLC 3B08A 2BGFA 2M0XA 4BKGA 3GE8C 1E6EB 3GS2A 1V1PA 4JWUC 4NJCA 3DHIC 5KHOA 1IBXA 3P63A 4LNFA 2W3SA 4ZRQA 1LO5D 4G3XB 1M4VA 3ALBA 1YJIA 1K53A 4ZHPA 4JLCA 1M94A 3ZTDA 2GB1A 2Y3AA 2G45B 2JXXA 2XK5A 3X23A 1SB3C 4FADA 1V97A 1FNVA 4OZBA 2JRHA 1YD8U 2FIFA 4NJ6A 1GNUA 4DHJD 3RZFA 2OJRA 1Q5WB 2FUG1 2IGGA 4KSKC 1E8WA 3MP9A 1V5OA 2KJHB 2WS3B 2HJ8A 3RN9C 1Z2MA 1FM0D 4W9KA 1L0XB 1D6EC 2IGDA 4NAWA 1TZ1A 3ZJUA 1L0YB 2PPHA 2KTRA 3M3JA 1D3ZA 4G11A 2WP9B 2N0SB 4P7IA 3QARA 3TSSA 1OTRB 3B2GA 2J0KA 1N6ZA 1V8CA 3ZRCA 4LNIA 1D4BA 3HIZA 5AZGA 4ZDVA 1HA5A 3NS1A 3A1QB 1VZ8A 2K3UA 5LXIB 2L8JA 1I4HA 1L6VA 1UBIA 3E9SA 3RUIB 2IY1B 3ONSA 1JRUA 1WY8A 3AMZA 4HXDA 3DDCB 1WMHA 5C23A 4M8MA 4CO7A 4NAMA 4JWSC 2VZKB 2QSDA 2E3TA 4BVUC 1TZOA 1WXAA 3H1UA 3S2AA 4RGOS 2WHIA 3B2FA 1ISNA 2L83A 2L76A 1C4CA 3BVMA 1S1QB 2UYZB 3V61A 4K7UA 4YL8A 3VR9B 4HVBA 2KHWB 4JE3B 1I4QA 1HTQA 1TYGB 4REZA 2NR2A 3J9CA 3DPDA 4LJOB 2XEWA 4IM0A 5JHAA 1XLOA 2SEBD 2KDEB 4C4VB 4S17A 5IO9A 2PMVA 2KQ7A 2V1YA 4KKJA 2J42A 1V86A 2V4IB 1F9JA 3T3OA 3WAMA 4JPSA 1V5TA 4XC2A 3VUYA 4TKNA 2K0PA 2LHEA 4WAFA 4MJSA 1KM7A 4HEA1 4IDIA 2B76B 4GMVA 4LNOA 4M00A 3NVYA 4FLHA 1OQYA 4IKGA 1WXMA 3VQIA 4GDLB 2FIDA 4KZCA 2D3AA 3BINA 3TL5A 4II2B 1SE2A 4GIVA 2L3ZA 5BYRA 1V1PB 3ZXVA 1TGZB 1H4RA 2OOBB 3OLMD 1GJZA 5IKCM 1E0ZA 2MBEA 1FO4A 2V3SA 4HROA 4O1NA 1T0RC 2MJDA 2LWPA 5I4DA 4P6VF 3TIXA 4IG7B 3DBRI 2BB6A 2Q5WD 1VZ7A 3A4RA 5BYSA 1KF6B 3AEDB 3VH4B 1C78A 2WDVB 4RM8A 2GBRA 3AE3B 2LUMA 4X57B 1WSPA 2J52A 4G50A 4XX5A 1IBXB 2FAZA 5IOIA 3APDA 2YEPB 3SFDB 3KLSX 5BMGA 2WDTB 2R2QA 4MT5A 1I4RA 4RH6A 4YXDB 4US8A 4NNJB 3GOEA 1J8CA 4LK0M 1KLGD 1WI0A 3MJWA 2DZMA 4IW0A 2IJ0A 1GOZA 2L05A 3NRZA 1JWMD 3JW0X 4K7WA 1J7BA 4GN1A 2VRRB 2E6XA 3TEXA 3VHTC 4BAXA 4EKUA 2N1WA 2C5LC 4AS1A 1V81A 4KZ0A 3PHXB 2LEKA 2A5UA 3NG0A 4W9LA 3CWIA 1FRDA 1YMHE 1PGXA 5MPOA 2XN9C 4TMAB 3N3KB 5HG2A 1IP9A 2O6VD 5JXVA 1P7FA 4RF0A 3T8MA 3L10B 1FXTB 4GXBA 3L0WB 3A33B 1WJ4A 4L1BA 1WJ6A 4HJGE 4DXFA 5E6JA 1EU3A 2LGIA 4OVZA 4II3B 1XCQL 4EZLA 1TIFA 1MHHE 2MBHA 1BMLC 3P42A 3AXCA 4MACA 3VUWA 2KMCA 1FFUA 5EE1A 3FC4A 2D10A 4HDQA 3U8ZA 4IUMB 2DNFA 3VRAB 1WMHB 1XLPA 5HHDG 1E8XA 1EU4A 4RNAA 1RFAA 3AE9B 3OG5A 3HM3A 5H8YE 1P3QU 3URYA 4MGZE 3NVZA 4MM3B 3EA6A 1YN4A 4PS7A 1WJNA 2VH2A 2CKHB 1R4MB 2JU6X 5J2RA 4W9CA 4US9A 4AJYB 3AEBB 2AQ2B 3DBHB 4GOCA 2KQ4X 2JRIB 2WQYB 4IWPA 3JVZX 1ZP0B 1JALA 2WDQB 3PRMB 2GLSA 3Q14C 2V3PA 2NMQA 3EFCA 1UGJA 2JYTA 3A9KB 1R4NI 3SU8X 4C00A 2DZKA 3ENEA 3N32A 4B0MA 1SJHD 1SSNA 4E71A 1FEHA 5D2MB 1LGRA 3DBHI 2JZ3B 1TS4A 3CSFA 3PGEA 1HE8A 1ZPSA 2D5GA 2RPVA 4F8CB 3PLVA 3DWGC 4BBNF 1K50A 2KWUB 2KVRA 2BTEA 1T0QC 1JWUD 4ZHOA 1TJEA 1BUIC 1QT9A 1XCTL 1SGHA 4HPPA 4EEWA 2IY0B 1I4XA 2I2YA 1XD3B 2INDC 3PVLA 5D94A 4EFOA 3DVGX 2BB5A 2C7MB 5D3DA 2K1FA 1AW7A 2JVCA 3TCAA 3W2DA 1KLUD 1PGBA 1WM3A 1YIWA 1OEYA 4AP4C 1LM8B 4IC7B 3AEAB 2DX5B 1R4MI 2DBYA 2VZKD 3DBSA 4IM3A 4EZJA 3BVGA 2QIEB 4MH8A 1PDXA 3LJ3A 1YQBA 3PZDA 1TS5A 2PTLA 3HVDA 1YQ4B 3P4QB 3U52E 4F1SA 3NY5A 4EZKA 1WGHA 1V49A 1ZE3D 4B95A 3U2SC 1WRIA 3LDZE 2KX0A 4FJYA 3GZNI 1MJDA 3IAS1 1SE4A 2MWSB 2KQSA 3B0AA 2N7DA 1F0ZA 2N7JA 3I63C 1AARA 1EF5A 2CHZA 2KWVB 1SIFA 2WX0A 1QOBA 2PVGC 2PJHA 2PEAA 1P0RA 4K3BA 3VTVA 3SHQA 3H8HA 3IFWB 2BYEA 5IA7A 1UF0A 1MHXA 2RDGA 3R2IA 2LVOA 2N9PC 4C7ZA 2WXLA 2Z0DB 3JYUA 4OW0A 1TBEA 2JX5A 1WRDB 4A20A 3QK0A 2ZCCA 2NPTA 4NPNA 1WXVA 3KYDD 2JT4B 1R4NB 2IPKD 4PT5A 2BT6A 2K9XA 3SEBA 4ZYSA 2QJLA 5AEKB 1YJ1A 3H6NA 1RFKA 2WX1A 1JW9D 4FHKA 3V3XA 4M8NA 2KJ6A 4JL9A 4DHJB 3W1SC 3B9JA 3MHSD 3AM9A 3FAHA 3EUB2 2WYQA 1RAXA 1I35A 2AX5A 2OEDA 1GC6A 2DZJA 3BIID 3GZNB 3WAPA 4W9IA 2C7HA 4ANUA 1YOVB 1ZKHA 2GRIA 3DBRB 5KHQA 1C1YB 2MJEA 1CK1A 1KH0A 3O65B 4NY0A 5E6PA 2W82A 2Z59B 1IYFA 1B1ZA 3ZW3A 1ZXHA 3RZWC 4K81A 4JQWC 2ZNVC 1Q1OA 3BK2A 3MHZA 5G2NA 5EE3A 3LXFA 3RNCC 2C7NB 2ICIA 2LD9A 4A8XC 4R3DA 5H92C 2CHWA 1V6EA 4AJWA 4MJSB 2LGXA 4FXCA 2C9WB 2G3QB 1BXTA 4BOSC 1GAQB 2W54A 4KGTA 1PYWD 3L17A 5GXGB 2CU1A 2GMIC 1Y8RC 3ABVB 3IVFA 2GBKA 1B9RA 5DPTA 2BQQA 1TKGA 3UQAA 4A3OA 1NEKB 3RD2A 3RI7C 2M17A 3SFEB 3DVGY 3W9CB 4KIKA 1P1AA 3RNBC 2LXAA 1EF1A 1VCBA 2J0JA 4WJNA 4G0NB 3AE4B 1C4PA 2AEHA 5TR5A 1VR9A 3IBEA 1J0GA 2J4XA 2G1EA 2RDHA 5AUKA 3Q8CA 2ZCBA 2D11A 3CF6E 2KTFA 3UI3A 2A4ZA 3RPFC 1WWTA 3DWMA 2LRWA 3ZKJC 4ZRKA 1RYJA 3QAQA 1TS2A 3AU5A 5G5HA 3E56A 2LASA 5FKAC 2JXTA 3VAWA 2LVPA 5JZEB 3N20C 4XYCA 2GBNA 3Q3OC 2WU2B 1WXSA 3A1QA 3MFGA 4GDKA 1T3QA 1WH3A 3AI5A 2N9XA 3RYTA 1VD2A 1G6JA 5LXHA 4BOZB 1N5WA 3V6EB 3MTNB 2QILA 4W9JA 4W9GA 2JSVX 1A5RA 3NZ3A 4K7SA 3PZ7A 2QC8A 4HK2A 5JH5C 1MPEA 3V60A 1XLNA 2ZW1A 3ZJVA 2LUEA 1V1OA 3HK0A 3C0RB 3UF8A 3R8BA 2MHJA 1TKYA 4M01A 3BWUD 1QKZA 1EO6A 3V62A 1SXTA 2KFKA 2WXNA 1WZ0A 5BYQA 3ZQ4A 2J7QB 2Z8LA 4LLGM 3UINB 3VTWA 1ET9A 4WAAA 3H7SA 4DXGA 1KRHA 4F7ZA 4EUTA 1JRPA 4DK5A 3N1XC 2EELA 3LYYA 2ZPYA 4ANWA 2KMAA 2D2QA 5L83A 4OVVA 4S0RA 5AZHA 2WXJA 2DZIA 2ZJDA 5DPRA 2K39A 3NZSA 2MSED 2FCMA 2KWCA 1FNUA 1DOYA 2BS2B 5AUIA 3NVVA 3P1MA 2GI9A 4WWMA 2V9HA 5CHFA 4AOFA 3AB5A 1WGKA 2NVUI 4B9KA 3IT6B 1V9JA 2IYDB 1KFYB 1WXQA 2L52A 3C8YA 1ROEA 2KFJA 2R2OA 2AL3A 1EWCA 2CHXA 4W9HA 5DCNA 2D3GA 2MBQA 2K6QA 2L32A 2KDBA 4NJ7A 4C7YA 3QCAA 3GP7A 1L4DB 3TEWA 1CJEA 2MA9B 2NTSA 1PGAA 4A6QA 1E7UA 2HDEA 1FPYA 1Q10A 2AQ3B 4DQOC 3WALA 5CX3A 1WZ3A 3HHMA 3NJTA 2IO0B 4WH4A 4MSMB 1F2RC 3IG3A 1IUEA 2MX2A 3N1ZC 4OVUA 1FIQA 3AEGB 2LGSA 3RULA 3QWZB 3RMKC 1KJTA 1ZXIA 3BK1A 2RDBC 1GPXA 2AWTA 2BS4B 2IO1B 3R7RA 2CU3A 2N9KA 3T9LA 2KZRA 3MC8A 3TMPB 1ACCA 4LTUA 1JWBD 1ZOYB 2QDFA 2FE8A 2KYWA 5C1ZA 4BKTA 4LCDE 2HD5B 4MGIE 2KT7A 1E90A 2YEPF 3ML9A 2KKCA 5BMIA 3ECIA 1FMAD 3PREA 2BW2A 1NDDA 4AUQC 4GDLA 2EMTA 1WM2A 3KWLA 3JSVB 2INCC 2IZVB 2KDIA 4K1RB 5CHWA 3ZXRA 4AQ7A 2KANA 1L7YA 4PYZA 4PS3A 1UD7A 1PQSA 1T5XD 3VVWB 1WIAA 4A90A 1X1MA 2Y5BB 2N9EB 2O2VA 2KC1A 1LQBA 1F1HA 2YVCA 3PRZA 1CZPA 4ICUA 1E9MA 1WX8A 2J0MA 3UIOB 1FCLA 3DBLB 1T0SC 5EE0A 2W9NA 3RCZA 1E8ZA 1C77A 5E6OA 1HZ5A 3AE8B 3FILB 1GB4A 1UBQA 3HUIA 2WXFA 2WXHA 2M4NA 2NS5A 2WXMA 3KUZA 2BPSA 3VTUA 3AULA 4M0WA 3I57A 3HRDD 1SEBD 1XXGA 1I4GA 2N7EA 4WJOA 3C19A 2ZEQA 3ZNID 5E6NA 3ZNHB 3WIMA 1FRRA 1TY2A 2K22A 5D3IB 3RFZB 3PT2B 2FBWB 2BWES 3T3NA 3ZRFA 1OFFA 3D32A 1R7SA 4E3CA 3QJZA 2FUHB 2C60A 1T0YA 4GSWA 3TUOA 1L5PA 3VUXA 1VLBA 4WQMA 4GB9A 4Q2JA 4DXAB 1QOGA 4ARCA 1MFWA 1ZW7A 3V6CB 4E74A 3AE7B 1K8RB 2KX3A 4ICVA 1PFDA 2KD0A 4IWQA 3R66C 2WU5B 2M56B 2WXPA 4ZRPA 1C79A 4RF1A 4MH0E 1WR6E 2WXIA 2KNBA 2REXA 4GDKB 2KN5A 1E7VA 1IGDA 3TEYA 1J19A 1YX5B 4W9FA 1OEYJ 2GBJA 1UH6A 1XEEA 4CYEA 2LGYA 4RCOA 1P98A 4NAWB 1XT9B 3Q3FA 3DHGC 2RD0A 1L0VB 4ZYNA 3QQ8B 4GGQA 4KDIC 4XDDA 3LB8C 2X38A 1AN8A 1FNWA 4HJKA 2G4SA 1E5WA 2J53A 4WIPA 1F2RI 3DVNV 4DHZB 2KO3A 4P1BC 3PPAA 1FCCC 3OAWA 1XF5L 4XWTA 1FFVA 1WE7A 5EE9A 3RNGC 2JF5A 4MELA 1WR1A 3Q3MC 2PIAA 2NBWB 3CIRB 4HPLB 2KC2A 2MJ3A 3JSVA 1WGDA 4HCNB 1N62A 4DBGA 2RGFA 2L1AA 1E8YA 1AYFA 3KUDB 4ARIA 1JROA 1TY0A 1QQRA 2MRPA 4OZCA 1EM7A 2W3RA 3HVZA 4JIOU 2ACZB 4LDTB 2BYFA 4P1CC 2N9LA 3DQVA 3R7QA 1KLVA 2WWZA 4XE0A 3P4RB 2JY6A 2MP2B 2SAKA 1C4AA 4FBJB 4TSSA 3FILA 4ACFA 2ZZPB 2BKFA 4USAA 1YN5A 4ITKA 3PV1A 2RPQA 2LFIA 2LHDA 1QF6A 5DPWA 2I1JA 1JCKB 1NYQA 1WGRA 2QEJC 2BKRB 4HLEA 3ZDTA 3P4PB 3VDZA 2Z0EB 1L6UA 4ANXA 4EE2A 4LNKA 3BY4B 1MI0A 1YQ3B 2D3CA 1NYRA 3ZUNA 1CMXB 1VJKA 1ET6A 4YTPB 2KN4A 4C80A 1K51A 5JHBA 4H2AA 2UWQA 2JUOA 2ONQA 1QOAA 4KKIA 3Q8FA 1IPGA 2WXQA 1J7CA 5FR3A 2D07B 1C9FA 4A55A 2MCNB 4MEMA 2L7RA 2EKIA 3ZNZB 5L95C 5EDSA 3ZIMA 3QC8B 1XLQA 2B3AA 1T6BX 2MBOA 4WJPA 3V05A 1BT0A 5HKHA 2LMCA 4L23A 3HM6X 3AH7A 5BO4B 4FA6A 1UNSA 4GLSC 3NUHB 1J7AA 5C2TB 3QIJA 4YWGG 2DENB 1YJJA 2QCZA 2WLBA 3L13A 3NVWA 4YTNB 5CHVC 1MVKA 4ASWC 2AL6A 4KDLB 4WWOA 2O6VA 2MBBB 3PLUA 3PS6A 2BYTA 3M95A 2M0AA 1ZDVA 4MGYE 3W1SA 3GB1A 2NPTB 3APCA 3UGBB 3U4EG 1GC7A 2KAJA 1WGYA 2K5PA 2KJRA 3AE6B 3L4PA 2DWQA 4CQNA 2DAJA 4FJVB 4YSXB 2OHFA 2ZVNA 2KTRB 1ESFA 3VFKA 2JQRB 1VRAB 3WA0A 3VR8B 1XO3A 1H8CA 4FJZA 2PVOD 1HXYD 4A3PA 1F52A 4JGHB 2YLMA 4PS8A 4OHJA 4XZ4A 2IO3B 4W9EA 1E10A 5HFYA 3CMMB 4LDTD 5CTRC 1JWAD 2K6DB 3VH3B 2K25A 4UDUC 3EECA 2WGSA 5DPSA 2BWFA 2H89B 2LGDA 3U30A 2K8HA 3MC0B 2FCSA 1D5MC 1ENFA 3A9JA 2CS4A 1TT5B 3NHEB 3BVZA 3OWEB 2W55A 1D5XC 3U7DA 2KWDA 2G4DB 1SF0A 4KIKB 2VH1A 4ANVA 1WYWB 3QHTA 4MGKE 2DLBA 1JMLA 2KK8A 3B1LX 3R3MA 2ZW0A 2L00B 3OJ4B 4N59A 2FCNA 3I3TB 4EOYA 3H7PA 2BF8B 1DOXA 1WJUA 3O13A 4DDGD 2MEKA 3P2BA 4XWWA 3GE3C 3ZJTA 2HE7A 3RNEC 3KH0A 4TQ0A 2I38A 3W1YA 4IM2A 3TJPA 1RM6C 2JYEA 2JWZA 1SJED 3ML8A 2PE9A 4P16A 3AE5B 4RMAA 4HDOA 2JZZA 2BS3B 2LJ5A 2DYMA 2PLPA 2K8BA 3DVNU 3Q2AC 3R2TA 2LZ6A 1WE6A 4B0EA 3A9JB 3Q3JA 2LI5A 1VDVA 5AZFA 2N1VA 2X8XX 1VZ6A 2AQ1B 3ZTCA 2KLCA 3WANA 2WXOA 1LFDA 3X0WA 1V2YA 3EGRA 2KACA 4ZRJA 2IDYA 2NBVB 1Q0WB 3AU4A 1SBBB 3AECB 5G5GA 4C56C 1NVID 3H7PB 3AE2B 1HZ6A 3EC8A 3DBLI 4YT0B 1AWDA 3M63B 4LJPB 3EFUA 4BZAA 4I6LB 1STEA 1ZGUB 3EHVA 1LXDA 4NQKE 4HPMB 3AEFB 2INNE 1C3TA 1UUPA 1D5ZC 4DWFA 2O6VB 4BFRA 3SD5A 4YSZB 1IGCA 2BYVE 4L2YA 3A4SC 5D6JB 4TQ1A 1V80A 2KOXA 2V3NA 1UWXA 3DHHC 1L2NA 3FKYA 2I1KA 2NTTA 3ZLZA 2DYOA 3PHWB 3AV8A 1SE9A 3BYYB 4RM9A 2KFKB 3ETRA 3PZ8A 2ZVOA 2ON8A 2RSUA 4YTMB 3A9KA 2CJOA 4ZOHC 5G55A 2O2VB 1S3SG 3IAM1 3IT4B 5TSSA 4A9AA 1K52A 3N9YC 3KWVA 1I4PA 4WQOB 2FNJB 3P4SB 4BKSA 3IHPC 3VRBB 5LLIA 1P9DU 3RNFC 4RGNA 3MC9A 4RFBA 2IBIB 2HTHA 3QX1A 1DOIA 2N4FA 4NZLB 1ZUD2 1EUVB 3CSTA 2DHZA 1CQVA 4J6IA 4W9DA 1WX9A 1ZDXA 2K8CA 4KGSA 2CR5A 2H88B 4BBNC 1GB1A 2WDRB
chains in the Genus database with same CATH topology
1DGJA 3VQIA 3CIRB 4GDLB 3BZDB 3Q8EA 3SFEB 3IXSA 2MJ3A 3W9CB 1JWSD 1SE2A 2M19A 5BYRA 1P7EA 1V1PB 2KMMA 1HQRD 1N62A 2L1AA 1AYFA 1QILA 4ARIA 1JROA 1NENB 1TY0A 1QQRA 3AE4B 1E0ZA 4OZCA 1FO4A 1C4PA 1EM7A 2W3RA 3HVZA 4HROA 1VR9A 4O1NA 2MJDA 5I4DA 2KDMA 2ACZB 2J4XA 2G1EA 2RDHA 4P6VF 5AUKA 3Q8CA 2N9LA 2BB6A 2Q5WD 3UI3A 1VZ7A 4XE0A 1L4ZB 3P4RB 3RPFC 5BYSA 1KF6B 3AEDB 3Q8AA 2QMTA 1WWTA 1C78A 3DWMA 2WDVB 1I7HA 4IOIE 4N6EB 2SAKA 1C4AA 3AE3B 1RYJA 4TSSA 5D7GA 3FILA 2TSSA 2V0GA 2LUMA 1TS2A 5G5HA 1WSPA 2PKOA 2J52A 4USAA 3E56A 1YN5A 1IBXB 1SIJA 1A70A 3TEZA 1NI3A 2JZPA 2YEPB 2JXTA 4ITKA 5FKAC 3KLSX 5BMGA 3SFDB 2LFIA 4MT5A 1I4RA 4RH6A 4YXDB 4US8A 2LHDA 1QF6A 1JCKB 4LK0M 1KLGD 2WU2B 2G9HD 1NYQA 3ZGZA 5C3JB 3MFGA 2IJ0A 3AE1B 1GOZA 3NRZA 2QEJC 4HKZE 1JWMD 1T3QA 1J7BA 2LJIA 3P4PB 2E6XA 3TEXA 1L6UA 1RWSA 3I9V1 1N5WA 4KX6B 2JWUA 4EE2A 1MI0A 1YQ3B 3ZYYX 3PO0A 5BMHA 2QILA 1NYRA 2JSVX 2XNAC 3BYTB 3NZ3A 3PZ7A 3Q69A 1VJKA 1ET6A 4AS1A 4YTPB 1MPEA 2KN4A 4C80A 1XLNA 2LEKA 1OQRA 1K51A 2ZW1A 4H2AA 3ZJVA 2WXRA 1V1OA 2ONQA 3CWIA 1YNTE 1FRDA 1QOAA 1YMHE 1PGXA 3R8BA 2XN9C 5MPOA 2Y5CA 1TKYA 4TMAB 5HG2A 3BWUD 1QKZA 3Q8FA 4KKIA 2WXQA 2INPE 1J7CA 5FR3A 1C9FA 2WXKA 4A55A 1SXTA 2WXNA 5JXVA 1P7FA 2EKIA 4RF0A 1DYQA 1N5XA 1F77A 1N60A 5FK9C 2R61A 5T8IA 5BYQA 3ZQ4A 2Z8LA 4LLGM 1XLQA 4L1BA 1ET9A 4HJGE 1T6BX 4DXFA 1E7PB 4DXGA 5E6JA 3V05A 1KRHA 1EU3A 1JRPA 2HTME 2LGIA 2LMCA 4OVZA 4L23A 1XCQL 2EELA 3AH7A 3LYYA 2WNMA 1UNSA 1QOFA 1PUTA 4GLSC 3NUHB 1J7AA 1MHHE 4YWGG 5C2TB 4RGMA 1OQQA 5HI1A 1FXAA 1YJJA 1BMLC 2WLBA 4XDCA 3P42A 3NVWA 3Q8BA 4MACA 2WXJA 4YTNB 1FFUA 1MVKA 2PW9A 5EE1A 3FC4A 1FD6A 3VRAB 1KTKA 1XLPA 5HHDG 1FNUA 1N63A 1DOYA 1HEZE 2BS2B 5AUIA 2CJNA 3NVVA 1EU4A 4RNAA 2BYTA 1QLBB 2M0AA 1ZDVA 2WXGA 2GI9A 3P1MA 3W1SA 4J3OD 3GB1A 3AE9B 4WWMA 1TS3A 5H8YE 1SE3A 3MJ5A 3U4EG 3URYA 3NVZA 4MM3B 2KAJA 4N58A 3AB5A 3EA6A 1FXIA 1WGKA 2K5PA 3AE6B 3L4PA 2DWQA 1YN4A 1N61A 2WDRB 4WURA 4CQNA 3IT6B 1KFYB 4D2KA 4YSXB 1WXQA 2L52A 3C8YA 1ROEA 2OHFA 1ESFA 1WYGA 3U7ZA 2JQRB 1EWCA 2JU6X 2L32A 1VRAB 4US9A 3VR8B 2IGHA 1XO3A 4C7YA 4YSYB 4JX1C 3GP7A 3AEBB 1L4DB 2AQ2B 2PVOD 3TEWA 1HXYD 2KQ4X 3W5UB 4HRSA 1CJEA 2NTSA 1PGAA 2WQYB 4A6QA 2HDEA 1UWMA 1Q10A 1ZP0B 2AQ3B 4DQOC 4OHJA 1JALA 1C76A 2WDQB 1E10A 5HFYA 4RGTA 2V3PA 2Y5PA 1JWAD 3KQ4A 5LNK1 3WCQA 2NMQA 4UDUC 1UGJA 2JYTA 1Y56A 4WH4A 1F2RC 2H89B 1IUEA 3AEEB 1FIQA 3AEGB 3MC0B 1YN3A 1D5MC 1ENFA 4B0MA 1SJHD 3BVZA 1SSNA 2BBCA 4HKQA 2RMMA 1FEHA 3OWEB 1ZXIA 2W55A 3BK1A 1GPXA 1D5XC 3AN1A 1TS4A 3SR6A 2BS4B 1TKEA 2KWDA 2CU3A 2N9KA 1SF0A 1ZPSA 2D5GA 2RPVA 4KGRA 3DWGC 1ACCA 1K50A 4LTUA 2DLBA 1JWBD 1JQ4A 2BTEA 1JMLA 1JWUD 1ZOYB 2FE8A 4ZHOA 1TJEA 1BUIC 2ZW0A 1QT9A 1XCTL 4N59A 3W5VB 1EWYC 2YEPF 1I4XA 2I2YA 4OZAA 2MH7A 5BMIA 1DOXA 1FMAD 2BW2A 3O13A 2MEKA 3KWLA 2BB5A 4XWWA 5D3DA 1E6EB 3GS2A 3ZJTA 1V1PA 4AQ7A 1AW7A 4JWUC 4NJCA 1IBXA 3W2DA 4TQ0A 2I38A 1RM6C 1KLUD 3P63A 2W3SA 4ZRQA 1T5XD 2JYEA 1PGBA 1LO5D 4A90A 1M4VA 1SJED 3AEAB 1YJIA 4P16A 1K53A 3AE5B 4ZHPA 1CZPA 1E9MA 2GB1A 2Y3AA 2DBYA 2VZKD 1FCLA 1SB3C 5EE0A 2BS3B 3BVGA 1V97A 2QIEB 1C77A 1FNVA 1PDXA 2DYMA 4MH8A 4OZBA 2PLPA 1TS5A 1HZ5A 2PTLA 3HVDA 1YQ4B 3P4QB 3AE8B 3R2TA 3U52E 3FILB 1GB4A 3HUIA 2WXFA 1ZE3D 2WXHA 4B0EA 2IGGA 2FUG1 2WXMA 3MP9A 1WRIA 3U2SC 1VDVA 4M0WA 3IAS1 1SE4A 1VZ6A 3I57A 2AQ1B 2WS3B 3HRDD 1F0ZA 2N7JA 1SEBD 1XXGA 1I4GA 2WXOA 1QOBA 1FM0D 1L0XB 2PVGC 1D6EC 3EGRA 2KACA 2IGDA 3ZJUA 1L0YB 2IDYA 1FRRA 3H8HA 1SBBB 3AECB 1TY2A 2K22A 5D3IB 3RFZB 2FBWB 5G5GA 1MHXA 4C56C 2RDGA 3R2IA 3T3NA 1OFFA 1R7SA 2WP9B 1NVID 2N0SB 4C7ZA 2WXLA 4OW0A 2JX5A 3TSSA 3NVYA 3AE2B 1HZ6A 3B2GA 4YT0B 1AWDA 1V8CA 3TUOA 1L5PA 1VLBA 2IPKD 4PT5A 1D4BA 2BT6A 4WQMA 2K9XA 4Q2JA 3SEBA 4ZYSA 1HA5A 3NS1A 2QJLA 1VZ8A 1STEA 1QOGA 1RFKA 4ARCA 2K3UA 1JW9D 1I4HA 3AE7B 1L6VA 3V3XA 3AEFB 3E9SA 2INNE 1UUPA 1PFDA 1D5ZC 3AMZA 3B9JA 4YSZB 1IGCA 3AM9A 3FAHA 3EUB2 4L2YA 2WU5B 2AX5A 2M56B 2WXPA 4TQ1A 4NAMA 2OEDA 4ZRPA 4JWSC 1C79A 2V3NA 2VZKB 4RF1A 1UWXA 3BIID 2QSDA 2E3TA 1TZOA 2NTTA 2DYOA 3AV8A 2GRIA 2WXIA 3BYYB 4RGOS 4GDKB 3B2FA 2L83A 1IGDA 3ETRA 2MJEA 3TEYA 1C4CA 3BVMA 3PZ8A 2ON8A 1CK1A 1KH0A 4YTMB 2W82A 2CJOA 4ZOHC 3VR9B 4JE3B 1I4QA 1B1ZA 1ZXHA 1TYGB 4REZA 3IAM1 3J9CA 1XEEA 3IT4B 5TSSA 3BK2A 3MHZA 4A9AA 1K52A 3N9YC 4RCOA 5EE3A 3KWVA 4NAWB 3LXFA 1I4PA 2ICIA 1XLOA 1L0VB 2SEBD 3P4SB 4A8XC 3VRBB 4R3DA 5H92C 4XDDA 2PMVA 3LB8C 2X38A 1AN8A 1FNWA 4KKJA 2J42A 4RGNA 2J53A 4FXCA 4RFBA 4WIPA 2V4IB 1F2RI 1BXTA 1DOIA 3T3OA 4JPSA 4NZLB 1GAQB 2W54A 4KGTA 1PYWD 5GXGB 1ZUD2 2K0PA 1FCCC 2LHEA 1CQVA 3ABVB 4WAFA 1XF5L 1B9RA 4XWTA 1FFVA 4HEA1 5EE9A 4IDIA 1ZDXA 2B76B 4KGSA 2H88B 1GB1A 1TKGA 2PIAA 1NEKB 4IKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFI A;  3I57 A;  4MT5 A;  3NZ3 A;  3Q69 A;  3LYY A; 
#chains in the Genus database with same CATH topology
 1DGJ A;  2GBM A;  5IAA C;  3BZD B;  3Q8E A;  4GU2 A;  2FCQ A;  3IXS A;  1JWS D;  4KSL C;  4CHK A;  2M19 A;  1P7E A;  2KMM A;  5FR6 A;  1HQR D;  3K9P B;  1QZE A;  3N30 A;  5J17 A;  4ZRI A;  1QIL A;  2PE6 B;  1NEN B;  4FN2 A;  3VXW A;  2GOW A;  1Z5S B;  2KDM A;  3Q6B A;  4FHJ A;  1WX7 A;  2ASQ A;  3ZDM C;  1L4Z B;  4IWO A;  1U4A A;  1NI2 A;  3NZU A;  3Q8A A;  3RT3 B;  2QMT A;  4LNN A;  1I7H A;  4IOI E;  3DOW A;  4N6E B;  3NOB A;  5D7G A;  4WWN A;  4QAY A;  2TSS A;  2V0G A;  2PKO A;  4XGA B;  1SIJ A;  4DHZ E;  1A70 A;  3TEZ A;  1NI3 A;  2JZP A;  4TUU A;  4WJQ A;  2KVZ A;  1WGG A;  4MDK E;  2G9H D;  3ZGZ A;  5C3J B;  3AE1 B;  1MG8 A;  3KUC B;  5J18 A;  4HKZ E;  3K9O B;  1HTO A;  2DAF A;  2LJI A;  2KLG A;  1KOT A;  2MQJ A;  4NQL B;  1RWS A;  3I9V 1;  4KX6 B;  2JWU A;  3QA8 A;  2OJW A;  1GUA B;  3H9D A;  3PSE B;  4DDI D;  3TBL D;  3ZYY X;  3PO0 A;  5BMH A;  1UEL A;  2XNA C;  3BYT B;  3Q69 A;  1OQR A;  2WXR A;  4M0W B;  1XQQ A;  4PYU A;  1YNT E;  3KYC D;  4C4V A;  2Y5C A;  2EMS A;  2INP E;  2ZPN A;  3KW5 B;  2WXK A;  3RNA C;  4B6W A;  1DYQ A;  1N5X A;  1F77 A;  1GG3 A;  3Q3N C;  1N60 A;  5FK9 C;  2R61 A;  5T8I A;  4AWJ A;  2V4L A;  1E7P B;  2LVQ A;  1RRB A;  4PK1 A;  2HTM E;  3WAO A;  2KXJ A;  3M62 B;  2WNM A;  4URK A;  1QOF A;  1PUT A;  2AYO B;  1OGW A;  4FUL A;  4RGM A;  1OQQ A;  5HI1 A;  1FXA A;  1YX6 B;  2LXC A;  4XDC A;  1UGM A;  3L08 A;  3Q8B A;  1TTN A;  5IN7 A;  2D3B A;  2RR9 A;  4KVG B;  2PW9 A;  1FD6 A;  1KTK A;  1N63 A;  1HEZ E;  3UQB A;  2CJN A;  3ZNG C;  1QLB B;  2WXG A;  4N9F 4;  3N1Y C;  2MP2 A;  4J3O D;  1TS3 A;  3PTF C;  1SE3 A;  3MJ5 A;  2ZNV B;  4N58 A;  1FXI A;  4WWP A;  2LRU A;  4I6N B;  1N61 A;  4WUR A;  2NCN A;  1UZX B;  4D2K A;  2M1M A;  1WYG A;  3U7Z A;  4MSQ B;  3PRP B;  4MM3 A;  5GMV A;  2DYB A;  1I42 A;  2IGH A;  3APF A;  2EKE C;  4YSY B;  4JX1 C;  3L16 A;  3W5U B;  4HRS A;  1MG4 A;  1RLF A;  4HWI B;  1NBF C;  1UWM A;  3L54 A;  1C76 A;  3I5J C;  4RGT A;  2Y5P A;  3KQ4 A;  3OJ3 A;  2BVC A;  3ZVV A;  3WCQ A;  5LNK 1;  3UIP B;  1Y56 A;  3KVF B;  3AEE B;  4TV3 A;  1YN3 A;  2JPH A;  2UU7 A;  1WF9 A;  2L0T A;  2BBC A;  2HJ1 A;  2RMM A;  4HKQ A;  3NS8 A;  2NBU A;  4I6P A;  3AN1 A;  3SR6 A;  2XBB C;  1TKE A;  4M02 A;  4K3C A;  2MW5 A;  4KGR A;  2XK5 B;  2IO2 B;  4BKS D;  4KV2 A;  1JQ4 A;  4HCP B;  2QHO A;  2MLB A;  3DCG A;  1WFY A;  3W5V B;  1EWY C;  2KDF B;  2L0F A;  4OZA A;  2MH7 A;  2M8S A;  5IP4 D;  3ZO5 B;  3SDL C;  3B08 A;  2BGF A;  2M0X A;  4BKG A;  3GE8 C;  1E6E B;  3GS2 A;  1V1P A;  4JWU C;  4NJC A;  3DHI C;  5KHO A;  1IBX A;  3P63 A;  4LNF A;  2W3S A;  4ZRQ A;  1LO5 D;  4G3X B;  1M4V A;  3ALB A;  1YJI A;  1K53 A;  4ZHP A;  4JLC A;  1M94 A;  3ZTD A;  2GB1 A;  2Y3A A;  2G45 B;  2JXX A;  2XK5 A;  3X23 A;  1SB3 C;  4FAD A;  1V97 A;  1FNV A;  4OZB A;  2JRH A;  1YD8 U;  2FIF A;  4NJ6 A;  1GNU A;  4DHJ D;  3RZF A;  2OJR A;  1Q5W B;  2FUG 1;  2IGG A;  4KSK C;  1E8W A;  3MP9 A;  1V5O A;  2KJH B;  2WS3 B;  2HJ8 A;  3RN9 C;  1Z2M A;  1FM0 D;  4W9K A;  1L0X B;  1D6E C;  2IGD A;  4NAW A;  1TZ1 A;  3ZJU A;  1L0Y B;  2PPH A;  2KTR A;  3M3J A;  1D3Z A;  4G11 A;  2WP9 B;  2N0S B;  4P7I A;  3QAR A;  3TSS A;  1OTR B;  3B2G A;  2J0K A;  1N6Z A;  1V8C A;  3ZRC A;  4LNI A;  1D4B A;  3HIZ A;  5AZG A;  4ZDV A;  1HA5 A;  3NS1 A;  3A1Q B;  1VZ8 A;  2K3U A;  5LXI B;  2L8J A;  1I4H A;  1L6V A;  1UBI A;  3E9S A;  3RUI B;  2IY1 B;  3ONS A;  1JRU A;  1WY8 A;  3AMZ A;  4HXD A;  3DDC B;  1WMH A;  5C23 A;  4M8M A;  4CO7 A;  4NAM A;  4JWS C;  2VZK B;  2QSD A;  2E3T A;  4BVU C;  1TZO A;  1WXA A;  3H1U A;  3S2A A;  4RGO S;  2WHI A;  3B2F A;  1ISN A;  2L83 A;  2L76 A;  1C4C A;  3BVM A;  1S1Q B;  2UYZ B;  3V61 A;  4K7U A;  4YL8 A;  3VR9 B;  4HVB A;  2KHW B;  4JE3 B;  1I4Q A;  1HTQ A;  1TYG B;  4REZ A;  2NR2 A;  3J9C A;  3DPD A;  4LJO B;  2XEW A;  4IM0 A;  5JHA A;  1XLO A;  2SEB D;  2KDE B;  4C4V B;  4S17 A;  5IO9 A;  2PMV A;  2KQ7 A;  2V1Y A;  4KKJ A;  2J42 A;  1V86 A;  2V4I B;  1F9J A;  3T3O A;  3WAM A;  4JPS A;  1V5T A;  4XC2 A;  3VUY A;  4TKN A;  2K0P A;  2LHE A;  4WAF A;  4MJS A;  1KM7 A;  4HEA 1;  4IDI A;  2B76 B;  4GMV A;  4LNO A;  4M00 A;  3NVY A;  4FLH A;  1OQY A;  4IKG A;  1WXM A;  3VQI A;  4GDL B;  2FID A;  4KZC A;  2D3A A;  3BIN A;  3TL5 A;  4II2 B;  1SE2 A;  4GIV A;  2L3Z A;  5BYR A;  1V1P B;  3ZXV A;  1TGZ B;  1H4R A;  2OOB B;  3OLM D;  1GJZ A;  5IKC M;  1E0Z A;  2MBE A;  1FO4 A;  2V3S A;  4HRO A;  4O1N A;  1T0R C;  2MJD A;  2LWP A;  5I4D A;  4P6V F;  3TIX A;  4IG7 B;  3DBR I;  2BB6 A;  2Q5W D;  1VZ7 A;  3A4R A;  5BYS A;  1KF6 B;  3AED B;  3VH4 B;  1C78 A;  2WDV B;  4RM8 A;  2GBR A;  3AE3 B;  2LUM A;  4X57 B;  1WSP A;  2J52 A;  4G50 A;  4XX5 A;  1IBX B;  2FAZ A;  5IOI A;  3APD A;  2YEP B;  3SFD B;  3KLS X;  5BMG A;  2WDT B;  2R2Q A;  4MT5 A;  1I4R A;  4RH6 A;  4YXD B;  4US8 A;  4NNJ B;  3GOE A;  1J8C A;  4LK0 M;  1KLG D;  1WI0 A;  3MJW A;  2DZM A;  4IW0 A;  2IJ0 A;  1GOZ A;  2L05 A;  3NRZ A;  1JWM D;  3JW0 X;  4K7W A;  1J7B A;  4GN1 A;  2VRR B;  2E6X A;  3TEX A;  3VHT C;  4BAX A;  4EKU A;  2N1W A;  2C5L C;  4AS1 A;  1V81 A;  4KZ0 A;  3PHX B;  2LEK A;  2A5U A;  3NG0 A;  4W9L A;  3CWI A;  1FRD A;  1YMH E;  1PGX A;  5MPO A;  2XN9 C;  4TMA B;  3N3K B;  5HG2 A;  1IP9 A;  2O6V D;  5JXV A;  1P7F A;  4RF0 A;  3T8M A;  3L10 B;  1FXT B;  4GXB A;  3L0W B;  3A33 B;  1WJ4 A;  4L1B A;  1WJ6 A;  4HJG E;  4DXF A;  5E6J A;  1EU3 A;  2LGI A;  4OVZ A;  4II3 B;  1XCQ L;  4EZL A;  1TIF A;  1MHH E;  2MBH A;  1BML C;  3P42 A;  3AXC A;  4MAC A;  3VUW A;  2KMC A;  1FFU A;  5EE1 A;  3FC4 A;  2D10 A;  4HDQ A;  3U8Z A;  4IUM B;  2DNF A;  3VRA B;  1WMH B;  1XLP A;  5HHD G;  1E8X A;  1EU4 A;  4RNA A;  1RFA A;  3AE9 B;  3OG5 A;  3HM3 A;  5H8Y E;  1P3Q U;  3URY A;  4MGZ E;  3NVZ A;  4MM3 B;  3EA6 A;  1YN4 A;  4PS7 A;  1WJN A;  2VH2 A;  2CKH B;  1R4M B;  2JU6 X;  5J2R A;  4W9C A;  4US9 A;  4AJY B;  3AEB B;  2AQ2 B;  3DBH B;  4GOC A;  2KQ4 X;  2JRI B;  2WQY B;  4IWP A;  3JVZ X;  1ZP0 B;  1JAL A;  2WDQ B;  3PRM B;  2GLS A;  3Q14 C;  2V3P A;  2NMQ A;  3EFC A;  1UGJ A;  2JYT A;  3A9K B;  1R4N I;  3SU8 X;  4C00 A;  2DZK A;  3ENE A;  3N32 A;  4B0M A;  1SJH D;  1SSN A;  4E71 A;  1FEH A;  5D2M B;  1LGR A;  3DBH I;  2JZ3 B;  1TS4 A;  3CSF A;  3PGE A;  1HE8 A;  1ZPS A;  2D5G A;  2RPV A;  4F8C B;  3PLV A;  3DWG C;  4BBN F;  1K50 A;  2KWU B;  2KVR A;  2BTE A;  1T0Q C;  1JWU D;  4ZHO A;  1TJE A;  1BUI C;  1QT9 A;  1XCT L;  1SGH A;  4HPP A;  4EEW A;  2IY0 B;  1I4X A;  2I2Y A;  1XD3 B;  2IND C;  3PVL A;  5D94 A;  4EFO A;  3DVG X;  2BB5 A;  2C7M B;  5D3D A;  2K1F A;  1AW7 A;  2JVC A;  3TCA A;  3W2D A;  1KLU D;  1PGB A;  1WM3 A;  1YIW A;  1OEY A;  4AP4 C;  1LM8 B;  4IC7 B;  3AEA B;  2DX5 B;  1R4M I;  2DBY A;  2VZK D;  3DBS A;  4IM3 A;  4EZJ A;  3BVG A;  2QIE B;  4MH8 A;  1PDX A;  3LJ3 A;  1YQB A;  3PZD A;  1TS5 A;  2PTL A;  3HVD A;  1YQ4 B;  3P4Q B;  3U52 E;  4F1S A;  3NY5 A;  4EZK A;  1WGH A;  1V49 A;  1ZE3 D;  4B95 A;  3U2S C;  1WRI A;  3LDZ E;  2KX0 A;  4FJY A;  3GZN I;  1MJD A;  3IAS 1;  1SE4 A;  2MWS B;  2KQS A;  3B0A A;  2N7D A;  1F0Z A;  2N7J A;  3I63 C;  1AAR A;  1EF5 A;  2CHZ A;  2KWV B;  1SIF A;  2WX0 A;  1QOB A;  2PVG C;  2PJH A;  2PEA A;  1P0R A;  4K3B A;  3VTV A;  3SHQ A;  3H8H A;  3IFW B;  2BYE A;  5IA7 A;  1UF0 A;  1MHX A;  2RDG A;  3R2I A;  2LVO A;  2N9P C;  4C7Z A;  2WXL A;  2Z0D B;  3JYU A;  4OW0 A;  1TBE A;  2JX5 A;  1WRD B;  4A20 A;  3QK0 A;  2ZCC A;  2NPT A;  4NPN A;  1WXV A;  3KYD D;  2JT4 B;  1R4N B;  2IPK D;  4PT5 A;  2BT6 A;  2K9X A;  3SEB A;  4ZYS A;  2QJL A;  5AEK B;  1YJ1 A;  3H6N A;  1RFK A;  2WX1 A;  1JW9 D;  4FHK A;  3V3X A;  4M8N A;  2KJ6 A;  4JL9 A;  4DHJ B;  3W1S C;  3B9J A;  3MHS D;  3AM9 A;  3FAH A;  3EUB 2;  2WYQ A;  1RAX A;  1I35 A;  2AX5 A;  2OED A;  1GC6 A;  2DZJ A;  3BII D;  3GZN B;  3WAP A;  4W9I A;  2C7H A;  4ANU A;  1YOV B;  1ZKH A;  2GRI A;  3DBR B;  5KHQ A;  1C1Y B;  2MJE A;  1CK1 A;  1KH0 A;  3O65 B;  4NY0 A;  5E6P A;  2W82 A;  2Z59 B;  1IYF A;  1B1Z A;  3ZW3 A;  1ZXH A;  3RZW C;  4K81 A;  4JQW C;  2ZNV C;  1Q1O A;  3BK2 A;  3MHZ A;  5G2N A;  5EE3 A;  3LXF A;  3RNC C;  2C7N B;  2ICI A;  2LD9 A;  4A8X C;  4R3D A;  5H92 C;  2CHW A;  1V6E A;  4AJW A;  4MJS B;  2LGX A;  4FXC A;  2C9W B;  2G3Q B;  1BXT A;  4BOS C;  1GAQ B;  2W54 A;  4KGT A;  1PYW D;  3L17 A;  5GXG B;  2CU1 A;  2GMI C;  1Y8R C;  3ABV B;  3IVF A;  2GBK A;  1B9R A;  5DPT A;  2BQQ A;  1TKG A;  3UQA A;  4A3O A;  1NEK B;  3RD2 A;  3RI7 C;  2M17 A;  3SFE B;  3DVG Y;  3W9C B;  4KIK A;  1P1A A;  3RNB C;  2LXA A;  1EF1 A;  1VCB A;  2J0J A;  4WJN A;  4G0N B;  3AE4 B;  1C4P A;  2AEH A;  5TR5 A;  1VR9 A;  3IBE A;  1J0G A;  2J4X A;  2G1E A;  2RDH A;  5AUK A;  3Q8C A;  2ZCB A;  2D11 A;  3CF6 E;  2KTF A;  3UI3 A;  2A4Z A;  3RPF C;  1WWT A;  3DWM A;  2LRW A;  3ZKJ C;  4ZRK A;  1RYJ A;  3QAQ A;  1TS2 A;  3AU5 A;  5G5H A;  3E56 A;  2LAS A;  5FKA C;  2JXT A;  3VAW A;  2LVP A;  5JZE B;  3N20 C;  4XYC A;  2GBN A;  3Q3O C;  2WU2 B;  1WXS A;  3A1Q A;  3MFG A;  4GDK A;  1T3Q A;  1WH3 A;  3AI5 A;  2N9X A;  3RYT A;  1VD2 A;  1G6J A;  5LXH A;  4BOZ B;  1N5W A;  3V6E B;  3MTN B;  2QIL A;  4W9J A;  4W9G A;  2JSV X;  1A5R A;  3NZ3 A;  4K7S A;  3PZ7 A;  2QC8 A;  4HK2 A;  5JH5 C;  1MPE A;  3V60 A;  1XLN A;  2ZW1 A;  3ZJV A;  2LUE A;  1V1O A;  3HK0 A;  3C0R B;  3UF8 A;  3R8B A;  2MHJ A;  1TKY A;  4M01 A;  3BWU D;  1QKZ A;  1EO6 A;  3V62 A;  1SXT A;  2KFK A;  2WXN A;  1WZ0 A;  5BYQ A;  3ZQ4 A;  2J7Q B;  2Z8L A;  4LLG M;  3UIN B;  3VTW A;  1ET9 A;  4WAA A;  3H7S A;  4DXG A;  1KRH A;  4F7Z A;  4EUT A;  1JRP A;  4DK5 A;  3N1X C;  2EEL A;  3LYY A;  2ZPY A;  4ANW A;  2KMA A;  2D2Q A;  5L83 A;  4OVV A;  4S0R A;  5AZH A;  2WXJ A;  2DZI A;  2ZJD A;  5DPR A;  2K39 A;  3NZS A;  2MSE D;  2FCM A;  2KWC A;  1FNU A;  1DOY A;  2BS2 B;  5AUI A;  3NVV A;  3P1M A;  2GI9 A;  4WWM A;  2V9H A;  5CHF A;  4AOF A;  3AB5 A;  1WGK A;  2NVU I;  4B9K A;  3IT6 B;  1V9J A;  2IYD B;  1KFY B;  1WXQ A;  2L52 A;  3C8Y A;  1ROE A;  2KFJ A;  2R2O A;  2AL3 A;  1EWC A;  2CHX A;  4W9H A;  5DCN A;  2D3G A;  2MBQ A;  2K6Q A;  2L32 A;  2KDB A;  4NJ7 A;  4C7Y A;  3QCA A;  3GP7 A;  1L4D B;  3TEW A;  1CJE A;  2MA9 B;  2NTS A;  1PGA A;  4A6Q A;  1E7U A;  2HDE A;  1FPY A;  1Q10 A;  2AQ3 B;  4DQO C;  3WAL A;  5CX3 A;  1WZ3 A;  3HHM A;  3NJT A;  2IO0 B;  4WH4 A;  4MSM B;  1F2R C;  3IG3 A;  1IUE A;  2MX2 A;  3N1Z C;  4OVU A;  1FIQ A;  3AEG B;  2LGS A;  3RUL A;  3QWZ B;  3RMK C;  1KJT A;  1ZXI A;  3BK1 A;  2RDB C;  1GPX A;  2AWT A;  2BS4 B;  2IO1 B;  3R7R A;  2CU3 A;  2N9K A;  3T9L A;  2KZR A;  3MC8 A;  3TMP B;  1ACC A;  4LTU A;  1JWB D;  1ZOY B;  2QDF A;  2FE8 A;  2KYW A;  5C1Z A;  4BKT A;  4LCD E;  2HD5 B;  4MGI E;  2KT7 A;  1E90 A;  2YEP F;  3ML9 A;  2KKC A;  5BMI A;  3ECI A;  1FMA D;  3PRE A;  2BW2 A;  1NDD A;  4AUQ C;  4GDL A;  2EMT A;  1WM2 A;  3KWL A;  3JSV B;  2INC C;  2IZV B;  2KDI A;  4K1R B;  5CHW A;  3ZXR A;  4AQ7 A;  2KAN A;  1L7Y A;  4PYZ A;  4PS3 A;  1UD7 A;  1PQS A;  1T5X D;  3VVW B;  1WIA A;  4A90 A;  1X1M A;  2Y5B B;  2N9E B;  2O2V A;  2KC1 A;  1LQB A;  1F1H A;  2YVC A;  3PRZ A;  1CZP A;  4ICU A;  1E9M A;  1WX8 A;  2J0M A;  3UIO B;  1FCL A;  3DBL B;  1T0S C;  5EE0 A;  2W9N A;  3RCZ A;  1E8Z A;  1C77 A;  5E6O A;  1HZ5 A;  3AE8 B;  3FIL B;  1GB4 A;  1UBQ A;  3HUI A;  2WXF A;  2WXH A;  2M4N A;  2NS5 A;  2WXM A;  3KUZ A;  2BPS A;  3VTU A;  3AUL A;  4M0W A;  3I57 A;  3HRD D;  1SEB D;  1XXG A;  1I4G A;  2N7E A;  4WJO A;  3C19 A;  2ZEQ A;  3ZNI D;  5E6N A;  3ZNH B;  3WIM A;  1FRR A;  1TY2 A;  2K22 A;  5D3I B;  3RFZ B;  3PT2 B;  2FBW B;  2BWE S;  3T3N A;  3ZRF A;  1OFF A;  3D32 A;  1R7S A;  4E3C A;  3QJZ A;  2FUH B;  2C60 A;  1T0Y A;  4GSW A;  3TUO A;  1L5P A;  3VUX A;  1VLB A;  4WQM A;  4GB9 A;  4Q2J A;  4DXA B;  1QOG A;  4ARC A;  1MFW A;  1ZW7 A;  3V6C B;  4E74 A;  3AE7 B;  1K8R B;  2KX3 A;  4ICV A;  1PFD A;  2KD0 A;  4IWQ A;  3R66 C;  2WU5 B;  2M56 B;  2WXP A;  4ZRP A;  1C79 A;  4RF1 A;  4MH0 E;  1WR6 E;  2WXI A;  2KNB A;  2REX A;  4GDK B;  2KN5 A;  1E7V A;  1IGD A;  3TEY A;  1J19 A;  1YX5 B;  4W9F A;  1OEY J;  2GBJ A;  1UH6 A;  1XEE A;  4CYE A;  2LGY A;  4RCO A;  1P98 A;  4NAW B;  1XT9 B;  3Q3F A;  3DHG C;  2RD0 A;  1L0V B;  4ZYN A;  3QQ8 B;  4GGQ A;  4KDI C;  4XDD A;  3LB8 C;  2X38 A;  1AN8 A;  1FNW A;  4HJK A;  2G4S A;  1E5W A;  2J53 A;  4WIP A;  1F2R I;  3DVN V;  4DHZ B;  2KO3 A;  4P1B C;  3PPA A;  1FCC C;  3OAW A;  1XF5 L;  4XWT A;  1FFV A;  1WE7 A;  5EE9 A;  3RNG C;  2JF5 A;  4MEL A;  1WR1 A;  3Q3M C;  2PIA A;  2NBW B;  3CIR B;  4HPL B;  2KC2 A;  2MJ3 A;  3JSV A;  1WGD A;  4HCN B;  1N62 A;  4DBG A;  2RGF A;  2L1A A;  1E8Y A;  1AYF A;  3KUD B;  4ARI A;  1JRO A;  1TY0 A;  1QQR A;  2MRP A;  4OZC A;  1EM7 A;  2W3R A;  3HVZ A;  4JIO U;  2ACZ B;  4LDT B;  2BYF A;  4P1C C;  2N9L A;  3DQV A;  3R7Q A;  1KLV A;  2WWZ A;  4XE0 A;  3P4R B;  2JY6 A;  2MP2 B;  2SAK A;  1C4A A;  4FBJ B;  4TSS A;  3FIL A;  4ACF A;  2ZZP B;  2BKF A;  4USA A;  1YN5 A;  4ITK A;  3PV1 A;  2RPQ A;  2LFI A;  2LHD A;  1QF6 A;  5DPW A;  2I1J A;  1JCK B;  1NYQ A;  1WGR A;  2QEJ C;  2BKR B;  4HLE A;  3ZDT A;  3P4P B;  3VDZ A;  2Z0E B;  1L6U A;  4ANX A;  4EE2 A;  4LNK A;  3BY4 B;  1MI0 A;  1YQ3 B;  2D3C A;  1NYR A;  3ZUN A;  1CMX B;  1VJK A;  1ET6 A;  4YTP B;  2KN4 A;  4C80 A;  1K51 A;  5JHB A;  4H2A A;  2UWQ A;  2JUO A;  2ONQ A;  1QOA A;  4KKI A;  3Q8F A;  1IPG A;  2WXQ A;  1J7C A;  5FR3 A;  2D07 B;  1C9F A;  4A55 A;  2MCN B;  4MEM A;  2L7R A;  2EKI A;  3ZNZ B;  5L95 C;  5EDS A;  3ZIM A;  3QC8 B;  1XLQ A;  2B3A A;  1T6B X;  2MBO A;  4WJP A;  3V05 A;  1BT0 A;  5HKH A;  2LMC A;  4L23 A;  3HM6 X;  3AH7 A;  5BO4 B;  4FA6 A;  1UNS A;  4GLS C;  3NUH B;  1J7A A;  5C2T B;  3QIJ A;  4YWG G;  2DEN B;  1YJJ A;  2QCZ A;  2WLB A;  3L13 A;  3NVW A;  4YTN B;  5CHV C;  1MVK A;  4ASW C;  2AL6 A;  4KDL B;  4WWO A;  2O6V A;  2MBB B;  3PLU A;  3PS6 A;  2BYT A;  3M95 A;  2M0A A;  1ZDV A;  4MGY E;  3W1S A;  3GB1 A;  2NPT B;  3APC A;  3UGB B;  3U4E G;  1GC7 A;  2KAJ A;  1WGY A;  2K5P A;  2KJR A;  3AE6 B;  3L4P A;  2DWQ A;  4CQN A;  2DAJ A;  4FJV B;  4YSX B;  2OHF A;  2ZVN A;  2KTR B;  1ESF A;  3VFK A;  2JQR B;  1VRA B;  3WA0 A;  3VR8 B;  1XO3 A;  1H8C A;  4FJZ A;  2PVO D;  1HXY D;  4A3P A;  1F52 A;  4JGH B;  2YLM A;  4PS8 A;  4OHJ A;  4XZ4 A;  2IO3 B;  4W9E A;  1E10 A;  5HFY A;  3CMM B;  4LDT D;  5CTR C;  1JWA D;  2K6D B;  3VH3 B;  2K25 A;  4UDU C;  3EEC A;  2WGS A;  5DPS A;  2BWF A;  2H89 B;  2LGD A;  3U30 A;  2K8H A;  3MC0 B;  2FCS A;  1D5M C;  1ENF A;  3A9J A;  2CS4 A;  1TT5 B;  3NHE B;  3BVZ A;  3OWE B;  2W55 A;  1D5X C;  3U7D A;  2KWD A;  2G4D B;  1SF0 A;  4KIK B;  2VH1 A;  4ANV A;  1WYW B;  3QHT A;  4MGK E;  2DLB A;  1JML A;  2KK8 A;  3B1L X;  3R3M A;  2ZW0 A;  2L00 B;  3OJ4 B;  4N59 A;  2FCN A;  3I3T B;  4EOY A;  3H7P A;  2BF8 B;  1DOX A;  1WJU A;  3O13 A;  4DDG D;  2MEK A;  3P2B A;  4XWW A;  3GE3 C;  3ZJT A;  2HE7 A;  3RNE C;  3KH0 A;  4TQ0 A;  2I38 A;  3W1Y A;  4IM2 A;  3TJP A;  1RM6 C;  2JYE A;  2JWZ A;  1SJE D;  3ML8 A;  2PE9 A;  4P16 A;  3AE5 B;  4RMA A;  4HDO A;  2JZZ A;  2BS3 B;  2LJ5 A;  2DYM A;  2PLP A;  2K8B A;  3DVN U;  3Q2A C;  3R2T A;  2LZ6 A;  1WE6 A;  4B0E A;  3A9J B;  3Q3J A;  2LI5 A;  1VDV A;  5AZF A;  2N1V A;  2X8X X;  1VZ6 A;  2AQ1 B;  3ZTC A;  2KLC A;  3WAN A;  2WXO A;  1LFD A;  3X0W A;  1V2Y A;  3EGR A;  2KAC A;  4ZRJ A;  2IDY A;  2NBV B;  1Q0W B;  3AU4 A;  1SBB B;  3AEC B;  5G5G A;  4C56 C;  1NVI D;  3H7P B;  3AE2 B;  1HZ6 A;  3EC8 A;  3DBL I;  4YT0 B;  1AWD A;  3M63 B;  4LJP B;  3EFU A;  4BZA A;  4I6L B;  1STE A;  1ZGU B;  3EHV A;  1LXD A;  4NQK E;  4HPM B;  3AEF B;  2INN E;  1C3T A;  1UUP A;  1D5Z C;  4DWF A;  2O6V B;  4BFR A;  3SD5 A;  4YSZ B;  1IGC A;  2BYV E;  4L2Y A;  3A4S C;  5D6J B;  4TQ1 A;  1V80 A;  2KOX A;  2V3N A;  1UWX A;  3DHH C;  1L2N A;  3FKY A;  2I1K A;  2NTT A;  3ZLZ A;  2DYO A;  3PHW B;  3AV8 A;  1SE9 A;  3BYY B;  4RM9 A;  2KFK B;  3ETR A;  3PZ8 A;  2ZVO A;  2ON8 A;  2RSU A;  4YTM B;  3A9K A;  2CJO A;  4ZOH C;  5G55 A;  2O2V B;  1S3S G;  3IAM 1;  3IT4 B;  5TSS A;  4A9A A;  1K52 A;  3N9Y C;  3KWV A;  1I4P A;  4WQO B;  2FNJ B;  3P4S B;  4BKS A;  3IHP C;  3VRB B;  5LLI A;  1P9D U;  3RNF C;  4RGN A;  3MC9 A;  4RFB A;  2IBI B;  2HTH A;  3QX1 A;  1DOI A;  2N4F A;  4NZL B;  1ZUD 2;  1EUV B;  3CST A;  2DHZ A;  1CQV A;  4J6I A;  4W9D A;  1WX9 A;  1ZDX A;  2K8C A;  4KGS A;  2CR5 A;  2H88 B;  4BBN C;  1GB1 A;  2WDR B; 
#chains in the Genus database with same CATH homology
 1DGJ A;  3VQI A;  3CIR B;  4GDL B;  3BZD B;  3Q8E A;  3SFE B;  3IXS A;  2MJ3 A;  3W9C B;  1JWS D;  1SE2 A;  2M19 A;  5BYR A;  1P7E A;  1V1P B;  2KMM A;  1HQR D;  1N62 A;  2L1A A;  1AYF A;  1QIL A;  4ARI A;  1JRO A;  1NEN B;  1TY0 A;  1QQR A;  3AE4 B;  1E0Z A;  4OZC A;  1FO4 A;  1C4P A;  1EM7 A;  2W3R A;  3HVZ A;  4HRO A;  1VR9 A;  4O1N A;  2MJD A;  5I4D A;  2KDM A;  2ACZ B;  2J4X A;  2G1E A;  2RDH A;  4P6V F;  5AUK A;  3Q8C A;  2N9L A;  2BB6 A;  2Q5W D;  3UI3 A;  1VZ7 A;  4XE0 A;  1L4Z B;  3P4R B;  3RPF C;  5BYS A;  1KF6 B;  3AED B;  3Q8A A;  2QMT A;  1WWT A;  1C78 A;  3DWM A;  2WDV B;  1I7H A;  4IOI E;  4N6E B;  2SAK A;  1C4A A;  3AE3 B;  1RYJ A;  4TSS A;  5D7G A;  3FIL A;  2TSS A;  2V0G A;  2LUM A;  1TS2 A;  5G5H A;  1WSP A;  2PKO A;  2J52 A;  4USA A;  3E56 A;  1YN5 A;  1IBX B;  1SIJ A;  1A70 A;  3TEZ A;  1NI3 A;  2JZP A;  2YEP B;  2JXT A;  4ITK A;  5FKA C;  3KLS X;  5BMG A;  3SFD B;  2LFI A;  4MT5 A;  1I4R A;  4RH6 A;  4YXD B;  4US8 A;  2LHD A;  1QF6 A;  1JCK B;  4LK0 M;  1KLG D;  2WU2 B;  2G9H D;  1NYQ A;  3ZGZ A;  5C3J B;  3MFG A;  2IJ0 A;  3AE1 B;  1GOZ A;  3NRZ A;  2QEJ C;  4HKZ E;  1JWM D;  1T3Q A;  1J7B A;  2LJI A;  3P4P B;  2E6X A;  3TEX A;  1L6U A;  1RWS A;  3I9V 1;  1N5W A;  4KX6 B;  2JWU A;  4EE2 A;  1MI0 A;  1YQ3 B;  3ZYY X;  3PO0 A;  5BMH A;  2QIL A;  1NYR A;  2JSV X;  2XNA C;  3BYT B;  3NZ3 A;  3PZ7 A;  3Q69 A;  1VJK A;  1ET6 A;  4AS1 A;  4YTP B;  1MPE A;  2KN4 A;  4C80 A;  1XLN A;  2LEK A;  1OQR A;  1K51 A;  2ZW1 A;  4H2A A;  3ZJV A;  2WXR A;  1V1O A;  2ONQ A;  3CWI A;  1YNT E;  1FRD A;  1QOA A;  1YMH E;  1PGX A;  3R8B A;  2XN9 C;  5MPO A;  2Y5C A;  1TKY A;  4TMA B;  5HG2 A;  3BWU D;  1QKZ A;  3Q8F A;  4KKI A;  2WXQ A;  2INP E;  1J7C A;  5FR3 A;  1C9F A;  2WXK A;  4A55 A;  1SXT A;  2WXN A;  5JXV A;  1P7F A;  2EKI A;  4RF0 A;  1DYQ A;  1N5X A;  1F77 A;  1N60 A;  5FK9 C;  2R61 A;  5T8I A;  5BYQ A;  3ZQ4 A;  2Z8L A;  4LLG M;  1XLQ A;  4L1B A;  1ET9 A;  4HJG E;  1T6B X;  4DXF A;  1E7P B;  4DXG A;  5E6J A;  3V05 A;  1KRH A;  1EU3 A;  1JRP A;  2HTM E;  2LGI A;  2LMC A;  4OVZ A;  4L23 A;  1XCQ L;  2EEL A;  3AH7 A;  3LYY A;  2WNM A;  1UNS A;  1QOF A;  1PUT A;  4GLS C;  3NUH B;  1J7A A;  1MHH E;  4YWG G;  5C2T B;  4RGM A;  1OQQ A;  5HI1 A;  1FXA A;  1YJJ A;  1BML C;  2WLB A;  4XDC A;  3P42 A;  3NVW A;  3Q8B A;  4MAC A;  2WXJ A;  4YTN B;  1FFU A;  1MVK A;  2PW9 A;  5EE1 A;  3FC4 A;  1FD6 A;  3VRA B;  1KTK A;  1XLP A;  5HHD G;  1FNU A;  1N63 A;  1DOY A;  1HEZ E;  2BS2 B;  5AUI A;  2CJN A;  3NVV A;  1EU4 A;  4RNA A;  2BYT A;  1QLB B;  2M0A A;  1ZDV A;  2WXG A;  2GI9 A;  3P1M A;  3W1S A;  4J3O D;  3GB1 A;  3AE9 B;  4WWM A;  1TS3 A;  5H8Y E;  1SE3 A;  3MJ5 A;  3U4E G;  3URY A;  3NVZ A;  4MM3 B;  2KAJ A;  4N58 A;  3AB5 A;  3EA6 A;  1FXI A;  1WGK A;  2K5P A;  3AE6 B;  3L4P A;  2DWQ A;  1YN4 A;  1N61 A;  2WDR B;  4WUR A;  4CQN A;  3IT6 B;  1KFY B;  4D2K A;  4YSX B;  1WXQ A;  2L52 A;  3C8Y A;  1ROE A;  2OHF A;  1ESF A;  1WYG A;  3U7Z A;  2JQR B;  1EWC A;  2JU6 X;  2L32 A;  1VRA B;  4US9 A;  3VR8 B;  2IGH A;  1XO3 A;  4C7Y A;  4YSY B;  4JX1 C;  3GP7 A;  3AEB B;  1L4D B;  2AQ2 B;  2PVO D;  3TEW A;  1HXY D;  2KQ4 X;  3W5U B;  4HRS A;  1CJE A;  2NTS A;  1PGA A;  2WQY B;  4A6Q A;  2HDE A;  1UWM A;  1Q10 A;  1ZP0 B;  2AQ3 B;  4DQO C;  4OHJ A;  1JAL A;  1C76 A;  2WDQ B;  1E10 A;  5HFY A;  4RGT A;  2V3P A;  2Y5P A;  1JWA D;  3KQ4 A;  5LNK 1;  3WCQ A;  2NMQ A;  4UDU C;  1UGJ A;  2JYT A;  1Y56 A;  4WH4 A;  1F2R C;  2H89 B;  1IUE A;  3AEE B;  1FIQ A;  3AEG B;  3MC0 B;  1YN3 A;  1D5M C;  1ENF A;  4B0M A;  1SJH D;  3BVZ A;  1SSN A;  2BBC A;  4HKQ A;  2RMM A;  1FEH A;  3OWE B;  1ZXI A;  2W55 A;  3BK1 A;  1GPX A;  1D5X C;  3AN1 A;  1TS4 A;  3SR6 A;  2BS4 B;  1TKE A;  2KWD A;  2CU3 A;  2N9K A;  1SF0 A;  1ZPS A;  2D5G A;  2RPV A;  4KGR A;  3DWG C;  1ACC A;  1K50 A;  4LTU A;  2DLB A;  1JWB D;  1JQ4 A;  2BTE A;  1JML A;  1JWU D;  1ZOY B;  2FE8 A;  4ZHO A;  1TJE A;  1BUI C;  2ZW0 A;  1QT9 A;  1XCT L;  4N59 A;  3W5V B;  1EWY C;  2YEP F;  1I4X A;  2I2Y A;  4OZA A;  2MH7 A;  5BMI A;  1DOX A;  1FMA D;  2BW2 A;  3O13 A;  2MEK A;  3KWL A;  2BB5 A;  4XWW A;  5D3D A;  1E6E B;  3GS2 A;  3ZJT A;  1V1P A;  4AQ7 A;  1AW7 A;  4JWU C;  4NJC A;  1IBX A;  3W2D A;  4TQ0 A;  2I38 A;  1RM6 C;  1KLU D;  3P63 A;  2W3S A;  4ZRQ A;  1T5X D;  2JYE A;  1PGB A;  1LO5 D;  4A90 A;  1M4V A;  1SJE D;  3AEA B;  1YJI A;  4P16 A;  1K53 A;  3AE5 B;  4ZHP A;  1CZP A;  1E9M A;  2GB1 A;  2Y3A A;  2DBY A;  2VZK D;  1FCL A;  1SB3 C;  5EE0 A;  2BS3 B;  3BVG A;  1V97 A;  2QIE B;  1C77 A;  1FNV A;  1PDX A;  2DYM A;  4MH8 A;  4OZB A;  2PLP A;  1TS5 A;  1HZ5 A;  2PTL A;  3HVD A;  1YQ4 B;  3P4Q B;  3AE8 B;  3R2T A;  3U52 E;  3FIL B;  1GB4 A;  3HUI A;  2WXF A;  1ZE3 D;  2WXH A;  4B0E A;  2IGG A;  2FUG 1;  2WXM A;  3MP9 A;  1WRI A;  3U2S C;  1VDV A;  4M0W A;  3IAS 1;  1SE4 A;  1VZ6 A;  3I57 A;  2AQ1 B;  2WS3 B;  3HRD D;  1F0Z A;  2N7J A;  1SEB D;  1XXG A;  1I4G A;  2WXO A;  1QOB A;  1FM0 D;  1L0X B;  2PVG C;  1D6E C;  3EGR A;  2KAC A;  2IGD A;  3ZJU A;  1L0Y B;  2IDY A;  1FRR A;  3H8H A;  1SBB B;  3AEC B;  1TY2 A;  2K22 A;  5D3I B;  3RFZ B;  2FBW B;  5G5G A;  1MHX A;  4C56 C;  2RDG A;  3R2I A;  3T3N A;  1OFF A;  1R7S A;  2WP9 B;  1NVI D;  2N0S B;  4C7Z A;  2WXL A;  4OW0 A;  2JX5 A;  3TSS A;  3NVY A;  3AE2 B;  1HZ6 A;  3B2G A;  4YT0 B;  1AWD A;  1V8C A;  3TUO A;  1L5P A;  1VLB A;  2IPK D;  4PT5 A;  1D4B A;  2BT6 A;  4WQM A;  2K9X A;  4Q2J A;  3SEB A;  4ZYS A;  1HA5 A;  3NS1 A;  2QJL A;  1VZ8 A;  1STE A;  1QOG A;  1RFK A;  4ARC A;  2K3U A;  1JW9 D;  1I4H A;  3AE7 B;  1L6V A;  3V3X A;  3AEF B;  3E9S A;  2INN E;  1UUP A;  1PFD A;  1D5Z C;  3AMZ A;  3B9J A;  4YSZ B;  1IGC A;  3AM9 A;  3FAH A;  3EUB 2;  4L2Y A;  2WU5 B;  2AX5 A;  2M56 B;  2WXP A;  4TQ1 A;  4NAM A;  2OED A;  4ZRP A;  4JWS C;  1C79 A;  2V3N A;  2VZK B;  4RF1 A;  1UWX A;  3BII D;  2QSD A;  2E3T A;  1TZO A;  2NTT A;  2DYO A;  3AV8 A;  2GRI A;  2WXI A;  3BYY B;  4RGO S;  4GDK B;  3B2F A;  2L83 A;  1IGD A;  3ETR A;  2MJE A;  3TEY A;  1C4C A;  3BVM A;  3PZ8 A;  2ON8 A;  1CK1 A;  1KH0 A;  4YTM B;  2W82 A;  2CJO A;  4ZOH C;  3VR9 B;  4JE3 B;  1I4Q A;  1B1Z A;  1ZXH A;  1TYG B;  4REZ A;  3IAM 1;  3J9C A;  1XEE A;  3IT4 B;  5TSS A;  3BK2 A;  3MHZ A;  4A9A A;  1K52 A;  3N9Y C;  4RCO A;  5EE3 A;  3KWV A;  4NAW B;  3LXF A;  1I4P A;  2ICI A;  1XLO A;  1L0V B;  2SEB D;  3P4S B;  4A8X C;  3VRB B;  4R3D A;  5H92 C;  4XDD A;  2PMV A;  3LB8 C;  2X38 A;  1AN8 A;  1FNW A;  4KKJ A;  2J42 A;  4RGN A;  2J53 A;  4FXC A;  4RFB A;  4WIP A;  2V4I B;  1F2R I;  1BXT A;  1DOI A;  3T3O A;  4JPS A;  4NZL B;  1GAQ B;  2W54 A;  4KGT A;  1PYW D;  5GXG B;  1ZUD 2;  2K0P A;  1FCC C;  2LHE A;  1CQV A;  3ABV B;  4WAF A;  1XF5 L;  1B9R A;  4XWT A;  1FFV A;  4HEA 1;  5EE9 A;  4IDI A;  1ZDX A;  2B76 B;  4KGS A;  2H88 B;  1GB1 A;  1TKG A;  2PIA A;  1NEK B;  4IKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...