4MU9A

Crystal structure of a putative glycosylhydrolase (bt_3782) from bacteroides thetaiotaomicron vpi-5482 at 1.89 a resolution
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
364
structure length
360
Chain Sequence
GHPFVSIADSILDNVLNLYQTEDGLLTETYPVNPDQKITYLAGNGTLKASFLWPYSGMMSGCVAMYQATGDKKYKTILEKRILPGLEQYWDGERLPACYQSYPVKYGQHGRYYDDNIWIALDYCDYYRLTKKADYLKKAIALYEYIYSGWSDELGGGIFWCEQQKEAKHTCSNAPSTVLGVKLYRLTKDKKYLNKAKETYAWTRKHLCDPDDFLYWDNINLKGKVSKDKYAYNSGQMIQAGVLLYEETGDKDYLRDAQKTAAGTDAFFRSKADKKDPSVKVHKDMSWFNVILFRGFKALEKIDHNPTYVRAMAENALHAWRNYRDANGLLGRDWSGHNEEPYKWLLDNACLIELFAEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 73
publication title Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 145
structure length 360
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4mu9A00
1KZPB 2I07B 4KKJA 3E34B 2XQWA 1TN8B 3Q7AB 2BBCA 4C1SA 4LNGB 4GTVB 1TNZB 3Q7FB 2BB6A 4MU9A 1H3AA 4D4AA 2XWBB 1HZFA 2V8IA 3C72B 3D5RA 1GXOA 1W6JA 3Q75B 3KQ4A 1UMPA 1N4RB 1QSJA 1TN7B 4GTQB 1TNOB 2H6FB 3OXUA 1NL4B 4ONTA 1LTXB 1O1RB 1FT1B 2BB5A 1N95B 1QBQB 1W6KA 2H6GB 3HXBB 1JCRB 3HXDB 1SA4B 4M76A 4FXKB 3K7XA 1H35A 4D4BA 4BOKA 3Q79B 1O6QA 4GTPB 1FT2B 1C3DA 1LD7B 1O1TB 1O6HA 2A73B 4GTMB 3E32B 1H3CA 4GTTB 1H39A 1S64B 2H6HB 3PZ2B 2V3NA 5FO9B 3DSSB 2GOXA 2ZISB 4D4DA 1O1SB 3DPYB 1GXNA 5JPNB 3HXFB 1LD8B 1SA5B 3E30B 1H36A 4EHMB 3Q78B 4YDEB 1N4QB 1JCSB 3DSTB 1O79A 4ZRPA 3PZ3B 1X81B 3DRAB 4GTRB 1FPPB 4YDOB 4ZH1A 1R76A 3EU5B 4LNBB 3DSVB 1GHQA 2PMVA 2V8JA 5FOBB 3CU7A 4D94A 4GTSB 1NI1B 2WY8A 4L9PB 2WY7A 3PZ1B 2IEJB 3SFYB 2NOJA 3DSUB 2ZIRB 4BOJA 4D4CA 2WINB 3KLSA 3PZ4B 1N4PB 1D8DB 1GSZA 2WIIB 3HXEB 3Q73B 2H6IB 2PN5A 1S63B 3DSWB 5JPMB 1TNYB 1O5MB 1GXMA 1TN6B 3G6JB 3SQCA 4V1RA 1DCEB 4V1SA 3KSLB 2SQCA 4KKIA 2V3PA 4GTOB 2R2LB 2V8KA 1H3BA 3KSQB 2G02A 1QQFA 1N4SB 3EUVB 1TNBB 3RJ3A 5FO8B 2B39A 3D5SA 3DSXB 3E37B 4MBGB 1JCQB 1MZCB 1KZOB 1D8EB 5FO7B 5AGDA 2BEDB 1O6RA 1TNUB 1N9AB 4LNVA 3E33B 3OEDA 1N94B 3HXCB 2XWJB 4FXGB 2F0YB 1SQCA 4ZRQA 3SFXB 2G0DA 1H37A
chains in the Genus database with same CATH superfamily
3E34B 2JJBA 4QT9A 2RGKA 5MEHA 2EADA 2ONHA 3RSYA 3Q7AB 2BBCA 3GLYA 3W7UA 3W5MA 1TNZB 3Q7FB 2BB6A 3M72A 3GZKA 1HZFA 3D5RA 1W6JA 3M78A 1FMIA 1C82A 1HXCA 1N4RB 3EZ8A 3WUXA 3M02A 1NL4B 3E6UA 1O1RB 1N95B 1QBQB 3M7EA 1N7NA 1JCRB 1G87A 4M76A 1JS4A 2CQTA 3RRSA 5ILYA 5IM1A 2AHGA 5IK9A 1LD7B 1N7PA 2A73B 4LIXA 1CB8A 1F9OA 3WIRA 1N7QA 2E22A 2H6HB 3DSSB 1EGUA 1O1SB 3SDRA 1GXNA 5JPNB 2FBAA 4Z4JA 3M77A 3S9VA 2FUZA 2BRWA 3SDQA 3E30B 1G6IA 1H36A 3Q78B 4EHMB 1N4QB 2WYNA 1V7WA 1O79A 4AYQA 2DROA 3PZ3B 3S4DA 1IA7A 3DRAB 4ZH1A 4YCRA 5ILJA 2WY8A 3ANJA 3PZ1B 4L9PB 3SFYB 2ZIRB 1LXKA 3KLSA 1GSZA 2FV0A 3N0GA 3QT9A 3VSMA 3WKHA 4J5TA 1WU5A 1VD5A 1TF4A 1N23A 4TF4A 5JMDA 3G6JB 4AYRA 5CA3A 2NVPA 4GTOB 4DI5A 2R2LB 4MMHA 5IK6A 3NNBA 2B4FA 1J0NA 1FAEA 1L1YA 1TNBB 2B39A 3SDTA 1MZCB 1NC5A 5CZLA 4FNVA 1KSDA 3M74A 1O6RA 3SAEA 2DRSA 3E33B 5ILDA 3ACSA 1N20A 1N94B 3HXCB 2XWJB 4GAXA 2G0DA 1OJNA 1G9GA 1H37A 2I07B 3RX8A 1TN8B 3E80A 1FO2A 1H12A 4C1SA 2WCOA 4LNGB 3W5NA 4GL3A 1WZZA 3EQAA 1H3AA 1HMUA 3M76A 2XWBB 2EABA 5ILIA 2RI9A 5M7IA 2Q1FA 3M71A 3TF4A 1GA2A 1UMPA 1HV6A 1QSJA 4GTQB 3WKFA 1HXGA 1TNOB 2H6FB 3ANIA 3QFYA 3A0OA 4KTRA 1FT1B 2BB5A 1W6KA 2H6GB 1FP3A 1XWQA 3HXDB 4D4BA 1SA4B 4NEIA 5IKAA 3Q79B 1FT2B 1IS9A 4WVAA 1AYXA 1C3DA 2OKXA 1H14A 3E32B 1H3CA 1X1IA 4KTPA 1H39A 2EAEA 5DGQA 4OK4A 4Z4LA 1RW9A 2GOXA 5FO9B 2QNOA 2CQSA 3HXFB 3M7LA 2DRQA 5ILZA 1SA5B 5EAUA 1FO3A 4AYPA 4Q2BA 5DHIA 4YDEB 3E73A 1RWHA 4ZRPA 1X81B 4GTRB 1FPPB 4YDOB 4F13A 3QDEA 4AYOA 2PMVA 2EACA 5IL3A 4CJ1A 2FUQA 3W7SA 5JMFA 2GH4A 4GTSB 1WU4A 2WY7A 4FUSA 3SDVA 2NOJA 3DSUB 3QPFA 4D4CA 3X17A 2WIIB 1H54A 1V7XA 2H6IB 4F10A 2VN7A 1KKTA 1KRFA 3H2WA 3N0FA 1O5MB 1GXMA 3PYAA 4OZWA 3S4BA 1KREA 1F9GA 5IL8A 2V3PA 1HM2A 1LXMA 1F9DA 3A3VA 5ILHA 1QQFA 1N4SB 3QXQA 1X1HA 3M00A 3RJ3A 3E37B 4OZVA 3VW5A 5EATA 1ULVA 1D8EB 5FO7B 2VN4A 5AGDA 2BEDB 5E2JA 1RWAA 3G4FA 1N24A 1XWTA 5DGRA 3SFXB 3RX5A 2A8ZA 3QRYA 1N7OA 2XQWA 1RWGA 3WKGA 4MU9A 4D4AA 3M75A 4CE7A 3PYBA 3C72B 2V8IA 4E1YA 3Q75B 3ACTA 3VXDA 2XFGA 4WVBA 3LZ9A 4L6XA 4TXTA 1V5CA 2P0VA 4CJ0A 1OJOA 3OXUA 3QFZA 4ONTA 3WIQA 2D8LA 1F1SA 3HXBB 4L0GA 4OK2A 4BOKA 3P2CA 4GTPB 1QAZA 1O6HA 4GTTB 2GZ6A 1S64B 3PZ2B 3DPYB 1LD8B 2YIKA 2BRPA 3AFLA 1HXAA 3D3IA 3M7BA 3M7CA 1JCSB 2AHFA 5C05A 2FUTA 5GZKA 1HN0A 1R76A 3ANKA 3EU5B 4LNBB 3G4DA 2Z07A 1GAHA 1GHQA 2V8JA 3NFVA 5M7YA 3CU7A 3QG0A 4D94A 1X1JA 1K72A 1L2AA 5GW7A 1NI1B 4RNQA 2IEJB 1FCEA 3WC3A 4BOJA 1J0MA 2WINB 3PZ4B 1N4PB 5CD2A 3HXEB 3WKIA 1OJMA 4XUVA 3SDUA 1UG9A 3Q73B 3ON6A 1S63B 5JPMB 1TNYB 3W7WA 2BRVX 1H13A 4V1RA 2ZZRA 4V1SA 1KWFA 1LOHA 3KSLB 1V7VA 1I8QA 2SQCA 4KKIA 3H7LA 3KSQB 1H3BA 1LF6A 2G02A 3P5RA 4EL8A 5FO8B 3D5SA 3DSXB 4MBGB 1IA6A 3QSPA 1JCQB 1KSCA 1CLCA 3S4AA 5IKHA 1G9JA 5EASA 3QWTA 2RI8A 4OJZA 1FBOA 3QXFA 4LNVA 3H3KA 1N22A 1KFGA 2WDAA 3S4CA 4FXGB 1SQCA 1GAIA 1N1BA 1KZPB 4KKJA 3EU8A 1HM3A 1X9DA 1W3YA 4WVCA 3VSNA 2F6DA 4GTVB 3W7TA 4MMIA 1GXOA 1RQ5A 3KQ4A 3P5PA 1NXCA 1TN7B 1OJPA 3T33A 3GT5A 1LTXB 1WU6A 3RENA 4FXKB 3K7XA 1H35A 1O6QA 5GY3A 2JF4A 2E24A 1O1TB 4GTMB 4ZG8A 1CEMA 5DHKA 1GLMA 2AFAA 2V3NA 1N7RA 2ZISB 4D4DA 3PMMA 1DL2A 1XW2A 1N1ZA 5ILKA 1DOGA 3DSTB 1N21A 3W7XA 5KKBA 3K11A 3RX7A 2ONGA 1RWFA 2DRRA 2J5CA 1AGMA 3M73A 4DODA 3DSVB 1FBWA 1UT9A 2D5JA 3QT3A 5FOBB 2FV1A 3E7JA 1RWCA 3WIWA 1KS8A 1D8DB 2JG0A 2PN5A 4Q88A 4WU0A 3DSWB 1TN6B 3SQCA 5IK0A 1DCEB 1LF9A 1V5DA 4ZH5A 1HX9A 2V8KA 2ZBLA 3CIHA 3EUVB 1HMWA 1HCUA 4DOEA 1KZOB 3M01A 4JJJA 1TNUB 1N9AB 3OEDA 2X03A 2F0YB 4ZRQA 4FJQA 3AFJA
chains in the Genus database with same CATH topology
3E34B 2JJBA 4QT9A 2RGKA 5MEHA 2EADA 3RSYA 3Q7AB 2BBCA 3GLYA 3W7UA 3W5MA 1TNZB 3Q7FB 2BB6A 3M72A 3GZKA 1HZFA 3D5RA 1W6JA 3M78A 1FMIA 1N4RB 3EZ8A 3WUXA 1NL4B 3E6UA 1O1RB 1N95B 1QBQB 3M7EA 1JCRB 1G87A 4M76A 1JS4A 2CQTA 3RRSA 2AHGA 1LD7B 2A73B 4LIXA 1F9OA 3WIRA 2H6HB 3DSSB 1O1SB 3SDRA 1GXNA 5JPNB 2FBAA 4Z4JA 3M77A 3S9VA 2FUZA 3SDQA 3E30B 1G6IA 1H36A 3Q78B 4EHMB 1N4QB 2WYNA 1V7WA 1O79A 4AYQA 2DROA 3PZ3B 3S4DA 1IA7A 3DRAB 4ZH1A 4YCRA 2WY8A 3ANJA 3PZ1B 4L9PB 3SFYB 2ZIRB 3KLSA 1GSZA 2FV0A 3QT9A 3WKHA 4J5TA 1WU5A 1VD5A 1TF4A 4TF4A 3G6JB 4AYRA 5CA3A 2NVPA 4GTOB 2R2LB 2B4FA 1FAEA 1L1YA 1TNBB 2B39A 3SDTA 1MZCB 1NC5A 5CZLA 1KSDA 3M74A 1O6RA 3SAEA 2DRSA 3E33B 3ACSA 1N94B 3HXCB 2XWJB 2G0DA 1G9GA 1H37A 2I07B 3RX8A 1TN8B 1FO2A 1H12A 4C1SA 4LNGB 3W5NA 4GL3A 1WZZA 3EQAA 1H3AA 3M76A 2XWBB 2EABA 2RI9A 5M7IA 3M71A 3TF4A 1GA2A 1UMPA 1QSJA 4GTQB 3WKFA 1TNOB 2H6FB 3ANIA 3QFYA 4KTRA 1FT1B 2BB5A 1W6KA 2H6GB 1FP3A 1XWQA 3HXDB 4D4BA 1SA4B 3Q79B 1FT2B 1IS9A 4WVAA 1AYXA 1C3DA 2OKXA 1H14A 3E32B 1H3CA 4KTPA 1H39A 2EAEA 5DGQA 4Z4LA 5FO9B 2GOXA 2QNOA 2CQSA 3HXFB 3M7LA 2DRQA 1SA5B 1FO3A 4AYPA 4Q2BA 4YDEB 3E73A 4ZRPA 1X81B 4GTRB 1FPPB 4YDOB 3QDEA 4AYOA 2PMVA 2EACA 4CJ1A 3W7SA 2GH4A 4GTSB 1WU4A 2WY7A 4FUSA 3SDVA 2NOJA 3DSUB 3QPFA 4D4CA 3X17A 2WIIB 1H54A 1V7XA 2H6IB 2VN7A 1KKTA 1KRFA 3H2WA 3PYAA 1O5MB 1GXMA 3S4BA 1KREA 2V3PA 1F9DA 3A3VA 1QQFA 1N4SB 3QXQA 3RJ3A 3E37B 3VW5A 1ULVA 1D8EB 5FO7B 2VN4A 5AGDA 2BEDB 5E2JA 1XWTA 5DGRA 3SFXB 3RX5A 2A8ZA 3QRYA 2XQWA 3WKGA 4MU9A 4D4AA 3M75A 4CE7A 3PYBA 3C72B 2V8IA 3Q75B 3ACTA 3VXDA 2XFGA 4WVBA 4L6XA 4TXTA 1V5CA 2P0VA 4CJ0A 3OXUA 3QFZA 4ONTA 3WIQA 2D8LA 3HXBB 4L0GA 4BOKA 3P2CA 4GTPB 1O6HA 4GTTB 2GZ6A 1S64B 3PZ2B 3DPYB 1LD8B 2YIKA 3D3IA 3M7BA 3M7CA 1JCSB 2AHFA 5GZKA 1R76A 3ANKA 3EU5B 4LNBB 2Z07A 1GAHA 1GHQA 2V8JA 1L2AA 5M7YA 3CU7A 3QG0A 4D94A 1K72A 5GW7A 1NI1B 2IEJB 1FCEA 3WC3A 4BOJA 2WINB 3PZ4B 1N4PB 5CD2A 3HXEB 3WKIA 4XUVA 3SDUA 1UG9A 3Q73B 3ON6A 1S63B 5JPMB 1TNYB 3W7WA 1H13A 4V1RA 2ZZRA 4V1SA 1KWFA 3KSLB 1V7VA 2SQCA 4KKIA 3H7LA 3KSQB 1H3BA 1LF6A 2G02A 3P5RA 4EL8A 5FO8B 3D5SA 3DSXB 4MBGB 1IA6A 3QSPA 1JCQB 1KSCA 1CLCA 3S4AA 1G9JA 3QWTA 2RI8A 1FBOA 3QXFA 4LNVA 3H3KA 1KFGA 3S4CA 4FXGB 1SQCA 1GAIA 1KZPB 4KKJA 3EU8A 1X9DA 4WVCA 2F6DA 4GTVB 3W7TA 1GXOA 1RQ5A 3KQ4A 3P5PA 1NXCA 1TN7B 3T33A 3GT5A 1LTXB 1WU6A 3RENA 4FXKB 3K7XA 1H35A 1O6QA 5GY3A 2JF4A 1O1TB 4GTMB 4ZG8A 1CEMA 1GLMA 2AFAA 2V3NA 2ZISB 4D4DA 3PMMA 1DL2A 1XW2A 1DOGA 3DSTB 3W7XA 5KKBA 3K11A 3RX7A 2DRRA 3M73A 1AGMA 4DODA 3DSVB 1FBWA 1UT9A 2D5JA 3QT3A 5FOBB 2FV1A 3WIWA 1KS8A 1D8DB 2JG0A 2PN5A 4Q88A 4WU0A 3DSWB 1TN6B 3SQCA 1DCEB 1LF9A 1V5DA 4ZH5A 2V8KA 2ZBLA 3CIHA 3EUVB 1HCUA 4DOEA 1KZOB 4JJJA 1TNUB 1N9AB 3OEDA 2F0YB 4ZRQA 3AFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZP B;  2I07 B;  4KKJ A;  3E34 B;  2XQW A;  1TN8 B;  3Q7A B;  2BBC A;  4C1S A;  4LNG B;  4GTV B;  1TNZ B;  3Q7F B;  2BB6 A;  4MU9 A;  1H3A A;  4D4A A;  2XWB B;  1HZF A;  2V8I A;  3C72 B;  3D5R A;  1GXO A;  1W6J A;  3Q75 B;  3KQ4 A;  1UMP A;  1N4R B;  1QSJ A;  1TN7 B;  4GTQ B;  1TNO B;  2H6F B;  3OXU A;  1NL4 B;  4ONT A;  1LTX B;  1O1R B;  1FT1 B;  2BB5 A;  1N95 B;  1QBQ B;  1W6K A;  2H6G B;  3HXB B;  1JCR B;  3HXD B;  1SA4 B;  4M76 A;  4FXK B;  3K7X A;  1H35 A;  4D4B A;  4BOK A;  3Q79 B;  1O6Q A;  4GTP B;  1FT2 B;  1C3D A;  1LD7 B;  1O1T B;  1O6H A;  2A73 B;  4GTM B;  3E32 B;  1H3C A;  4GTT B;  1H39 A;  1S64 B;  2H6H B;  3PZ2 B;  2V3N A;  5FO9 B;  3DSS B;  2GOX A;  2ZIS B;  4D4D A;  1O1S B;  3DPY B;  1GXN A;  5JPN B;  3HXF B;  1LD8 B;  1SA5 B;  3E30 B;  1H36 A;  4EHM B;  3Q78 B;  4YDE B;  1N4Q B;  1JCS B;  3DST B;  1O79 A;  4ZRP A;  3PZ3 B;  1X81 B;  3DRA B;  4GTR B;  1FPP B;  4YDO B;  4ZH1 A;  1R76 A;  3EU5 B;  4LNB B;  3DSV B;  1GHQ A;  2PMV A;  2V8J A;  5FOB B;  3CU7 A;  4D94 A;  4GTS B;  1NI1 B;  2WY8 A;  4L9P B;  2WY7 A;  3PZ1 B;  2IEJ B;  3SFY B;  2NOJ A;  3DSU B;  2ZIR B;  4BOJ A;  4D4C A;  2WIN B;  3KLS A;  3PZ4 B;  1N4P B;  1D8D B;  1GSZ A;  2WII B;  3HXE B;  3Q73 B;  2H6I B;  2PN5 A;  1S63 B;  3DSW B;  5JPM B;  1TNY B;  1O5M B;  1GXM A;  1TN6 B;  3G6J B;  3SQC A;  4V1R A;  1DCE B;  4V1S A;  3KSL B;  2SQC A;  4KKI A;  2V3P A;  4GTO B;  2R2L B;  2V8K A;  1H3B A;  3KSQ B;  2G02 A;  1QQF A;  1N4S B;  3EUV B;  1TNB B;  3RJ3 A;  5FO8 B;  2B39 A;  3D5S A;  3DSX B;  3E37 B;  4MBG B;  1JCQ B;  1MZC B;  1KZO B;  1D8E B;  5FO7 B;  5AGD A;  2BED B;  1O6R A;  1TNU B;  1N9A B;  4LNV A;  3E33 B;  3OED A;  1N94 B;  3HXC B;  2XWJ B;  4FXG B;  2F0Y B;  1SQC A;  4ZRQ A;  3SFX B;  2G0D A;  1H37 A; 
#chains in the Genus database with same CATH topology
 3E34 B;  2JJB A;  4QT9 A;  2RGK A;  5MEH A;  2EAD A;  2ONH A;  3RSY A;  3Q7A B;  2BBC A;  3GLY A;  3W7U A;  3W5M A;  1TNZ B;  3Q7F B;  2BB6 A;  3M72 A;  3GZK A;  1HZF A;  3D5R A;  1W6J A;  3M78 A;  1FMI A;  1C82 A;  1HXC A;  1N4R B;  3EZ8 A;  3WUX A;  3M02 A;  1NL4 B;  3E6U A;  1O1R B;  1N95 B;  1QBQ B;  3M7E A;  1N7N A;  1JCR B;  1G87 A;  4M76 A;  1JS4 A;  2CQT A;  3RRS A;  5ILY A;  5IM1 A;  2AHG A;  5IK9 A;  1LD7 B;  1N7P A;  2A73 B;  4LIX A;  1CB8 A;  1F9O A;  3WIR A;  1N7Q A;  2E22 A;  2H6H B;  3DSS B;  1EGU A;  1O1S B;  3SDR A;  1GXN A;  5JPN B;  2FBA A;  4Z4J A;  3M77 A;  3S9V A;  2FUZ A;  2BRW A;  3SDQ A;  3E30 B;  1G6I A;  1H36 A;  3Q78 B;  4EHM B;  1N4Q B;  2WYN A;  1V7W A;  1O79 A;  4AYQ A;  2DRO A;  3PZ3 B;  3S4D A;  1IA7 A;  3DRA B;  4ZH1 A;  4YCR A;  5ILJ A;  2WY8 A;  3ANJ A;  3PZ1 B;  4L9P B;  3SFY B;  2ZIR B;  1LXK A;  3KLS A;  1GSZ A;  2FV0 A;  3N0G A;  3QT9 A;  3VSM A;  3WKH A;  4J5T A;  1WU5 A;  1VD5 A;  1TF4 A;  1N23 A;  4TF4 A;  5JMD A;  3G6J B;  4AYR A;  5CA3 A;  2NVP A;  4GTO B;  4DI5 A;  2R2L B;  4MMH A;  5IK6 A;  3NNB A;  2B4F A;  1J0N A;  1FAE A;  1L1Y A;  1TNB B;  2B39 A;  3SDT A;  1MZC B;  1NC5 A;  5CZL A;  4FNV A;  1KSD A;  3M74 A;  1O6R A;  3SAE A;  2DRS A;  3E33 B;  5ILD A;  3ACS A;  1N20 A;  1N94 B;  3HXC B;  2XWJ B;  4GAX A;  2G0D A;  1OJN A;  1G9G A;  1H37 A;  2I07 B;  3RX8 A;  1TN8 B;  3E80 A;  1FO2 A;  1H12 A;  4C1S A;  2WCO A;  4LNG B;  3W5N A;  4GL3 A;  1WZZ A;  3EQA A;  1H3A A;  1HMU A;  3M76 A;  2XWB B;  2EAB A;  5ILI A;  2RI9 A;  5M7I A;  2Q1F A;  3M71 A;  3TF4 A;  1GA2 A;  1UMP A;  1HV6 A;  1QSJ A;  4GTQ B;  3WKF A;  1HXG A;  1TNO B;  2H6F B;  3ANI A;  3QFY A;  3A0O A;  4KTR A;  1FT1 B;  2BB5 A;  1W6K A;  2H6G B;  1FP3 A;  1XWQ A;  3HXD B;  4D4B A;  1SA4 B;  4NEI A;  5IKA A;  3Q79 B;  1FT2 B;  1IS9 A;  4WVA A;  1AYX A;  1C3D A;  2OKX A;  1H14 A;  3E32 B;  1H3C A;  1X1I A;  4KTP A;  1H39 A;  2EAE A;  5DGQ A;  4OK4 A;  4Z4L A;  1RW9 A;  2GOX A;  5FO9 B;  2QNO A;  2CQS A;  3HXF B;  3M7L A;  2DRQ A;  5ILZ A;  1SA5 B;  5EAU A;  1FO3 A;  4AYP A;  4Q2B A;  5DHI A;  4YDE B;  3E73 A;  1RWH A;  4ZRP A;  1X81 B;  4GTR B;  1FPP B;  4YDO B;  4F13 A;  3QDE A;  4AYO A;  2PMV A;  2EAC A;  5IL3 A;  4CJ1 A;  2FUQ A;  3W7S A;  5JMF A;  2GH4 A;  4GTS B;  1WU4 A;  2WY7 A;  4FUS A;  3SDV A;  2NOJ A;  3DSU B;  3QPF A;  4D4C A;  3X17 A;  2WII B;  1H54 A;  1V7X A;  2H6I B;  4F10 A;  2VN7 A;  1KKT A;  1KRF A;  3H2W A;  3N0F A;  1O5M B;  1GXM A;  3PYA A;  4OZW A;  3S4B A;  1KRE A;  1F9G A;  5IL8 A;  2V3P A;  1HM2 A;  1LXM A;  1F9D A;  3A3V A;  5ILH A;  1QQF A;  1N4S B;  3QXQ A;  1X1H A;  3M00 A;  3RJ3 A;  3E37 B;  4OZV A;  3VW5 A;  5EAT A;  1ULV A;  1D8E B;  5FO7 B;  2VN4 A;  5AGD A;  2BED B;  5E2J A;  1RWA A;  3G4F A;  1N24 A;  1XWT A;  5DGR A;  3SFX B;  3RX5 A;  2A8Z A;  3QRY A;  1N7O A;  2XQW A;  1RWG A;  3WKG A;  4MU9 A;  4D4A A;  3M75 A;  4CE7 A;  3PYB A;  3C72 B;  2V8I A;  4E1Y A;  3Q75 B;  3ACT A;  3VXD A;  2XFG A;  4WVB A;  3LZ9 A;  4L6X A;  4TXT A;  1V5C A;  2P0V A;  4CJ0 A;  1OJO A;  3OXU A;  3QFZ A;  4ONT A;  3WIQ A;  2D8L A;  1F1S A;  3HXB B;  4L0G A;  4OK2 A;  4BOK A;  3P2C A;  4GTP B;  1QAZ A;  1O6H A;  4GTT B;  2GZ6 A;  1S64 B;  3PZ2 B;  3DPY B;  1LD8 B;  2YIK A;  2BRP A;  3AFL A;  1HXA A;  3D3I A;  3M7B A;  3M7C A;  1JCS B;  2AHF A;  5C05 A;  2FUT A;  5GZK A;  1HN0 A;  1R76 A;  3ANK A;  3EU5 B;  4LNB B;  3G4D A;  2Z07 A;  1GAH A;  1GHQ A;  2V8J A;  3NFV A;  5M7Y A;  3CU7 A;  3QG0 A;  4D94 A;  1X1J A;  1K72 A;  1L2A A;  5GW7 A;  1NI1 B;  4RNQ A;  2IEJ B;  1FCE A;  3WC3 A;  4BOJ A;  1J0M A;  2WIN B;  3PZ4 B;  1N4P B;  5CD2 A;  3HXE B;  3WKI A;  1OJM A;  4XUV A;  3SDU A;  1UG9 A;  3Q73 B;  3ON6 A;  1S63 B;  5JPM B;  1TNY B;  3W7W A;  2BRV X;  1H13 A;  4V1R A;  2ZZR A;  4V1S A;  1KWF A;  1LOH A;  3KSL B;  1V7V A;  1I8Q A;  2SQC A;  4KKI A;  3H7L A;  3KSQ B;  1H3B A;  1LF6 A;  2G02 A;  3P5R A;  4EL8 A;  5FO8 B;  3D5S A;  3DSX B;  4MBG B;  1IA6 A;  3QSP A;  1JCQ B;  1KSC A;  1CLC A;  3S4A A;  5IKH A;  1G9J A;  5EAS A;  3QWT A;  2RI8 A;  4OJZ A;  1FBO A;  3QXF A;  4LNV A;  3H3K A;  1N22 A;  1KFG A;  2WDA A;  3S4C A;  4FXG B;  1SQC A;  1GAI A;  1N1B A;  1KZP B;  4KKJ A;  3EU8 A;  1HM3 A;  1X9D A;  1W3Y A;  4WVC A;  3VSN A;  2F6D A;  4GTV B;  3W7T A;  4MMI A;  1GXO A;  1RQ5 A;  3KQ4 A;  3P5P A;  1NXC A;  1TN7 B;  1OJP A;  3T33 A;  3GT5 A;  1LTX B;  1WU6 A;  3REN A;  4FXK B;  3K7X A;  1H35 A;  1O6Q A;  5GY3 A;  2JF4 A;  2E24 A;  1O1T B;  4GTM B;  4ZG8 A;  1CEM A;  5DHK A;  1GLM A;  2AFA A;  2V3N A;  1N7R A;  2ZIS B;  4D4D A;  3PMM A;  1DL2 A;  1XW2 A;  1N1Z A;  5ILK A;  1DOG A;  3DST B;  1N21 A;  3W7X A;  5KKB A;  3K11 A;  3RX7 A;  2ONG A;  1RWF A;  2DRR A;  2J5C A;  1AGM A;  3M73 A;  4DOD A;  3DSV B;  1FBW A;  1UT9 A;  2D5J A;  3QT3 A;  5FOB B;  2FV1 A;  3E7J A;  1RWC A;  3WIW A;  1KS8 A;  1D8D B;  2JG0 A;  2PN5 A;  4Q88 A;  4WU0 A;  3DSW B;  1TN6 B;  3SQC A;  5IK0 A;  1DCE B;  1LF9 A;  1V5D A;  4ZH5 A;  1HX9 A;  2V8K A;  2ZBL A;  3CIH A;  3EUV B;  1HMW A;  1HCU A;  4DOE A;  1KZO B;  3M01 A;  4JJJ A;  1TNU B;  1N9A B;  3OED A;  2X03 A;  2F0Y B;  4ZRQ A;  4FJQ A;  3AFJ A; 
#chains in the Genus database with same CATH homology
 3E34 B;  2JJB A;  4QT9 A;  2RGK A;  5MEH A;  2EAD A;  3RSY A;  3Q7A B;  2BBC A;  3GLY A;  3W7U A;  3W5M A;  1TNZ B;  3Q7F B;  2BB6 A;  3M72 A;  3GZK A;  1HZF A;  3D5R A;  1W6J A;  3M78 A;  1FMI A;  1N4R B;  3EZ8 A;  3WUX A;  1NL4 B;  3E6U A;  1O1R B;  1N95 B;  1QBQ B;  3M7E A;  1JCR B;  1G87 A;  4M76 A;  1JS4 A;  2CQT A;  3RRS A;  2AHG A;  1LD7 B;  2A73 B;  4LIX A;  1F9O A;  3WIR A;  2H6H B;  3DSS B;  1O1S B;  3SDR A;  1GXN A;  5JPN B;  2FBA A;  4Z4J A;  3M77 A;  3S9V A;  2FUZ A;  3SDQ A;  3E30 B;  1G6I A;  1H36 A;  3Q78 B;  4EHM B;  1N4Q B;  2WYN A;  1V7W A;  1O79 A;  4AYQ A;  2DRO A;  3PZ3 B;  3S4D A;  1IA7 A;  3DRA B;  4ZH1 A;  4YCR A;  2WY8 A;  3ANJ A;  3PZ1 B;  4L9P B;  3SFY B;  2ZIR B;  3KLS A;  1GSZ A;  2FV0 A;  3QT9 A;  3WKH A;  4J5T A;  1WU5 A;  1VD5 A;  1TF4 A;  4TF4 A;  3G6J B;  4AYR A;  5CA3 A;  2NVP A;  4GTO B;  2R2L B;  2B4F A;  1FAE A;  1L1Y A;  1TNB B;  2B39 A;  3SDT A;  1MZC B;  1NC5 A;  5CZL A;  1KSD A;  3M74 A;  1O6R A;  3SAE A;  2DRS A;  3E33 B;  3ACS A;  1N94 B;  3HXC B;  2XWJ B;  2G0D A;  1G9G A;  1H37 A;  2I07 B;  3RX8 A;  1TN8 B;  1FO2 A;  1H12 A;  4C1S A;  4LNG B;  3W5N A;  4GL3 A;  1WZZ A;  3EQA A;  1H3A A;  3M76 A;  2XWB B;  2EAB A;  2RI9 A;  5M7I A;  3M71 A;  3TF4 A;  1GA2 A;  1UMP A;  1QSJ A;  4GTQ B;  3WKF A;  1TNO B;  2H6F B;  3ANI A;  3QFY A;  4KTR A;  1FT1 B;  2BB5 A;  1W6K A;  2H6G B;  1FP3 A;  1XWQ A;  3HXD B;  4D4B A;  1SA4 B;  3Q79 B;  1FT2 B;  1IS9 A;  4WVA A;  1AYX A;  1C3D A;  2OKX A;  1H14 A;  3E32 B;  1H3C A;  4KTP A;  1H39 A;  2EAE A;  5DGQ A;  4Z4L A;  5FO9 B;  2GOX A;  2QNO A;  2CQS A;  3HXF B;  3M7L A;  2DRQ A;  1SA5 B;  1FO3 A;  4AYP A;  4Q2B A;  4YDE B;  3E73 A;  4ZRP A;  1X81 B;  4GTR B;  1FPP B;  4YDO B;  3QDE A;  4AYO A;  2PMV A;  2EAC A;  4CJ1 A;  3W7S A;  2GH4 A;  4GTS B;  1WU4 A;  2WY7 A;  4FUS A;  3SDV A;  2NOJ A;  3DSU B;  3QPF A;  4D4C A;  3X17 A;  2WII B;  1H54 A;  1V7X A;  2H6I B;  2VN7 A;  1KKT A;  1KRF A;  3H2W A;  3PYA A;  1O5M B;  1GXM A;  3S4B A;  1KRE A;  2V3P A;  1F9D A;  3A3V A;  1QQF A;  1N4S B;  3QXQ A;  3RJ3 A;  3E37 B;  3VW5 A;  1ULV A;  1D8E B;  5FO7 B;  2VN4 A;  5AGD A;  2BED B;  5E2J A;  1XWT A;  5DGR A;  3SFX B;  3RX5 A;  2A8Z A;  3QRY A;  2XQW A;  3WKG A;  4MU9 A;  4D4A A;  3M75 A;  4CE7 A;  3PYB A;  3C72 B;  2V8I A;  3Q75 B;  3ACT A;  3VXD A;  2XFG A;  4WVB A;  4L6X A;  4TXT A;  1V5C A;  2P0V A;  4CJ0 A;  3OXU A;  3QFZ A;  4ONT A;  3WIQ A;  2D8L A;  3HXB B;  4L0G A;  4BOK A;  3P2C A;  4GTP B;  1O6H A;  4GTT B;  2GZ6 A;  1S64 B;  3PZ2 B;  3DPY B;  1LD8 B;  2YIK A;  3D3I A;  3M7B A;  3M7C A;  1JCS B;  2AHF A;  5GZK A;  1R76 A;  3ANK A;  3EU5 B;  4LNB B;  2Z07 A;  1GAH A;  1GHQ A;  2V8J A;  1L2A A;  5M7Y A;  3CU7 A;  3QG0 A;  4D94 A;  1K72 A;  5GW7 A;  1NI1 B;  2IEJ B;  1FCE A;  3WC3 A;  4BOJ A;  2WIN B;  3PZ4 B;  1N4P B;  5CD2 A;  3HXE B;  3WKI A;  4XUV A;  3SDU A;  1UG9 A;  3Q73 B;  3ON6 A;  1S63 B;  5JPM B;  1TNY B;  3W7W A;  1H13 A;  4V1R A;  2ZZR A;  4V1S A;  1KWF A;  3KSL B;  1V7V A;  2SQC A;  4KKI A;  3H7L A;  3KSQ B;  1H3B A;  1LF6 A;  2G02 A;  3P5R A;  4EL8 A;  5FO8 B;  3D5S A;  3DSX B;  4MBG B;  1IA6 A;  3QSP A;  1JCQ B;  1KSC A;  1CLC A;  3S4A A;  1G9J A;  3QWT A;  2RI8 A;  1FBO A;  3QXF A;  4LNV A;  3H3K A;  1KFG A;  3S4C A;  4FXG B;  1SQC A;  1GAI A;  1KZP B;  4KKJ A;  3EU8 A;  1X9D A;  4WVC A;  2F6D A;  4GTV B;  3W7T A;  1GXO A;  1RQ5 A;  3KQ4 A;  3P5P A;  1NXC A;  1TN7 B;  3T33 A;  3GT5 A;  1LTX B;  1WU6 A;  3REN A;  4FXK B;  3K7X A;  1H35 A;  1O6Q A;  5GY3 A;  2JF4 A;  1O1T B;  4GTM B;  4ZG8 A;  1CEM A;  1GLM A;  2AFA A;  2V3N A;  2ZIS B;  4D4D A;  3PMM A;  1DL2 A;  1XW2 A;  1DOG A;  3DST B;  3W7X A;  5KKB A;  3K11 A;  3RX7 A;  2DRR A;  3M73 A;  1AGM A;  4DOD A;  3DSV B;  1FBW A;  1UT9 A;  2D5J A;  3QT3 A;  5FOB B;  2FV1 A;  3WIW A;  1KS8 A;  1D8D B;  2JG0 A;  2PN5 A;  4Q88 A;  4WU0 A;  3DSW B;  1TN6 B;  3SQC A;  1DCE B;  1LF9 A;  1V5D A;  4ZH5 A;  2V8K A;  2ZBL A;  3CIH A;  3EUV B;  1HCU A;  4DOE A;  1KZO B;  4JJJ A;  1TNU B;  1N9A B;  3OED A;  2F0Y B;  4ZRQ A;  3AFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...