4MU9A

Crystal structure of a putative glycosylhydrolase (bt_3782) from bacteroides thetaiotaomicron vpi-5482 at 1.89 a resolution
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
364
structure length
360
Chain Sequence
b'GHPFVSIADSILDNVLNLYQTEDGLLTETYPVNPDQKITYLAGNGTLKASFLWPYSGMMSGCVAMYQATGDKKYKTILEKRILPGLEQYWDGERLPACYQSYPVKYGQHGRYYDDNIWIALDYCDYYRLTKKADYLKKAIALYEYIYSGWSDELGGGIFWCEQQKEAKHTCSNAPSTVLGVKLYRLTKDKKYLNKAKETYAWTRKHLCDPDDFLYWDNINLKGKVSKDKYAYNSGQMIQAGVLLYEETGDKDYLRDAQKTAAGTDAFFRSKADKKDPSVKVHKDMSWFNVILFRGFKALEKIDHNPTYVRAMAENALHAWRNYRDANGLLGRDWSGHNEEPYKWLLDNACLIELFAEIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoside hydrolase family 73
publication title Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 145
structure length 360
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4mu9A00
1JCQB 3DSWB 2A73B 1H35A 4D4AA 4D94A 1TNOB 5FO8B 1QSJA 2XWBB 3DSTB 3HXCB 4FXGB 3PZ2B 4YDEB 1SA5B 1GHQA 2GOXA 3OXUA 4V1SA 4D4CA 2H6HB 2IEJB 4BOJA 1MZCB 3Q79B 2B39A 1H39A 1O1TB 1D8EB 2R2LB 4FXKB 2G0DA 4YDOB 5FO7B 1N4QB 3E34B 1N4RB 3PZ3B 3KQ4A 1NL4B 1O6HA 1LD7B 2H6GB 4GTOB 1H3BA 2V8KA 2V3NA 3Q7AB 2WY7A 1O79A 1O6QA 1N95B 5AGDA 5JPNB 3DPYB 2ZIRB 3OEDA 1N94B 2SQCA 1FT2B 4C1SA 1LD8B 4ZRQA 3E33B 3KSLB 3Q7FB 3DSUB 4GTVB 2H6IB 2H6FB 1DCEB 1H3CA 1KZOB 4GTTB 4KKJA 1TNUB 4BOKA 2I07B 3Q75B 1NI1B 1W6JA 3K7XA 1FPPB 1GSZA 1O6RA 1QBQB 3RJ3A 2WINB 1JCSB 3DSXB 4GTQB 3D5RA 3E37B 1D8DB 2XQWA 4EHMB 1GXOA 3HXBB 2BB5A 4MU9A 4ZRPA 3E30B 1TNZB 1H37A 3SFXB 1H36A 1SQCA 3DRAB 3CU7A 3SQCA 1TN8B 1O1RB 4LNVA 4D4DA 3KLSA 1UMPA 1X81B 2ZISB 3DSVB 1N4SB 3E32B 3HXEB 1S63B 2BB6A 3DSSB 1GXMA 3SFYB 2V8IA 1TNYB 3C72B 3D5SA 2BBCA 3EU5B 1FT1B 2XWJB 3Q78B 4M76A 1N9AB 1S64B 3HXFB 1C3DA 1TNBB 1TN6B 4LNBB 1GXNA 4ZH1A 4LNGB 2V3PA 1KZPB 2WY8A 2V8JA 4MBGB 4GTRB 2WIIB 2F0YB 4KKIA 2BEDB 3HXDB 4GTMB 4ONTA 5JPMB 1N4PB 1O5MB 2PMVA 3Q73B 4D4BA 1JCRB 1H3AA 1QQFA 3KSQB 1HZFA 2PN5A 3PZ1B 4GTSB 2NOJA 1O1SB 5FO9B 1W6KA 1R76A 1SA4B 3PZ4B 1LTXB 4GTPB 4V1RA 3EUVB 5FOBB 4L9PB 1TN7B 3G6JB 2G02A
chains in the Genus database with same CATH superfamily
5C05A 5EATA 1K72A 4FUSA 4D4AA 3RENA 5IM1A 3E80A 2ONGA 3P2CA 1SA5B 3M77A 3E6UA 3SAEA 1GLMA 2GOXA 1H54A 3QWTA 1VD5A 3SDTA 2DRRA 1W3YA 1HM2A 5FO7B 4YDOB 2B4FA 3QXFA 1N4QB 3PZ3B 1N4RB 3KQ4A 1FP3A 4TXTA 1H3BA 1LF6A 1GAHA 3WKIA 3SDRA 4E1YA 4RNQA 3E33B 5GW7A 3W7WA 3NNBA 3DSUB 1NC5A 3LZ9A 1FCEA 1TNUB 2I07B 2BRWA 1J0MA 1WU4A 2RI8A 4YCRA 3QT9A 1FO3A 1FPPB 4WU0A 1G6IA 5EASA 4JJJA 2XFGA 3D5RA 1X1JA 4WVAA 4OZVA 2J5CA 1HN0A 2EABA 1HM3A 3WUXA 4ZRPA 1H37A 3SFXB 4AYQA 2FBAA 5EAUA 1XWTA 4D4DA 3KLSA 3ANIA 1TF4A 1X81B 5M7YA 1UT9A 3E32B 1HMUA 4Q2BA 3M7LA 3HXEB 3PYBA 2V8IA 4CJ0A 1XW2A 3D5SA 3EU5B 3QRYA 2XWJB 3G4FA 3K11A 3E73A 5CZLA 1TN6B 1KSDA 4LNBB 5GZKA 4ZH1A 2Q1FA 4ONTA 3M78A 1UG9A 5E2JA 3M01A 1RQ5A 3KSQB 1RWCA 4GTSB 3S4AA 2A8ZA 1O1SB 1LXMA 1LTXB 3X17A 3S9VA 3EUVB 5FOBB 1HMWA 1TN7B 2ZZRA 3W7XA 2WCOA 1H35A 1OJOA 3QG0A 3WIRA 4AYOA 3W5NA 4YDEB 2P0VA 1V5DA 3RRSA 1F1SA 3A0OA 2CQTA 5IKAA 5CA3A 4D4CA 1QAZA 1N1BA 2H6HB 3E7JA 4AYPA 3ACSA 4LIXA 1MZCB 3Q79B 1OJNA 2B39A 5ILHA 1D8EB 4FXKB 2G0DA 3AFLA 3W5MA 1NL4B 4GL3A 1LD7B 2H6GB 5IL8A 1H14A 1XWQA 1LF9A 1O6QA 1FO2A 1N94B 2SQCA 4C1SA 1FMIA 3WIWA 1I8QA 1N7OA 2FV0A 3GLYA 3Q7FB 4GTVB 5IK9A 1DCEB 1KZOB 4Q88A 4KKJA 1IA7A 1H12A 3VSNA 2EADA 2E22A 1GSZA 1QBQB 1JCSB 4GTQB 2X03A 1D8DB 2XQWA 1DOGA 1FAEA 4J5TA 4OK4A 3WC3A 3VXDA 5ILKA 3HXBB 2DRQA 3EQAA 4MU9A 3P5RA 3QDEA 4KTPA 4DOEA 3N0FA 2WYNA 1KRFA 1KWFA 2ZISB 3DSVB 1N4SB 1G87A 1L1YA 3W7UA 3M7EA 2FUQA 1TNYB 3C72B 3H3KA 3VW5A 2BBCA 1S64B 3HXFB 1X1HA 4ZG8A 1GXNA 3WKFA 4LNGB 1KZPB 3M72A 3QFYA 2V8JA 4GTRB 1J0NA 4KKIA 2YIKA 3HXDB 3SDUA 1V7WA 1N4PB 4FJQA 1O5MB 3Q73B 2AFAA 1HX9A 1JCRB 1NXCA 4GAXA 4L0GA 3M74A 4QT9A 2Z07A 2NOJA 3NFVA 1F9OA 1W6KA 2DROA 1FBOA 3M00A 1DL2A 2VN4A 2G02A 1V5CA 5ILYA 2A73B 2CQSA 3EU8A 4D94A 1IS9A 1TNOB 5FO8B 1QSJA 2XWBB 3DSTB 4FXGB 3PZ2B 2WDAA 3M7CA 1HXAA 3PMMA 1N7QA 5DHKA 3RX8A 1FBWA 4L6XA 4CE7A 5KKBA 2JJBA 1ULVA 2FUTA 3RSYA 2IEJB 4BOJA 1G9GA 1HXCA 1H39A 3N0GA 1O1TB 2D8LA 4OK2A 1F9DA 2EACA 1N20A 3E34B 3WKHA 5CD2A 4CJ1A 3RX5A 2D5JA 2V8KA 3ANJA 1RW9A 2WY7A 4WVBA 1N7RA 5IKHA 3DPYB 3OEDA 4Z4LA 1WZZA 1LD8B 1CLCA 4ZRQA 3KSLB 2ONHA 3H7LA 2H6IB 4GTTB 1H3CA 4BOKA 4FNVA 3K7XA 1CB8A 4WVCA 1O6RA 3M71A 3DSXB 1N7PA 2FUZA 5ILDA 1GXOA 3ANKA 3M73A 1LXKA 1C82A 2BB5A 3M76A 3G4DA 3CU7A 3DRAB 1TN8B 5IK6A 1N22A 1N1ZA 1O1RB 1KS8A 1N24A 1RWFA 4OJZA 2BB6A 3DSSB 3EZ8A 1GXMA 4AYRA 3S4DA 4NEIA 2DRSA 4M76A 3QSPA 4XUVA 1KSCA 3A3VA 1C3DA 1HCUA 1EGUA 1HV6A 1TNBB 4F10A 4MMHA 5ILJA 2RGKA 2V3PA 2VN7A 4MBGB 2QNOA 2BRVX 2F0YB 4GTMB 3VSMA 1RWAA 1CEMA 5ILZA 1F9GA 1RWGA 1WU6A 5FO9B 1SA4B 4GTPB 4DI5A 4TF4A 4ZH5A 4L9PB 1LOHA 3G6JB 1OJMA 2JG0A 4Z4JA 3H2WA 1JCQB 3DSWB 3GZKA 3GT5A 2FV1A 1AGMA 3W7TA 3HXCB 2NVPA 1HXGA 2OKXA 1KREA 3QPFA 1GHQA 2F6DA 5GY3A 5ILIA 5DGRA 3S4BA 3OXUA 1AYXA 4V1SA 3P5PA 1JS4A 2R2LB 3D3IA 3W7SA 5IL3A 5DGQA 1O6HA 1WU5A 2E24A 4GTOB 5DHIA 1X9DA 2V3NA 3Q7AB 1O79A 4KTRA 3ON6A 3S4CA 1N95B 5AGDA 3SDQA 5JPNB 2ZIRB 1FT2B 1GA2A 5JMFA 2AHFA 3M02A 2H6FB 3AFJA 3Q75B 2ZBLA 1KKTA 1NI1B 3SDVA 1W6JA 4EL8A 2JF4A 3TF4A 3RJ3A 4F13A 1V7XA 5IK0A 2WINB 2GH4A 3E37B 1RWHA 2GZ6A 4EHMB 1L2AA 5MEHA 3QFZA 1KFGA 3E30B 1TNZB 5M7IA 1H36A 1SQCA 3QT3A 3SQCA 1GAIA 3WKGA 1H13A 4LNVA 1UMPA 3M75A 1G9JA 1X1IA 3QXQA 1S63B 3T33A 3SFYB 1N23A 3WIQA 1FT1B 3Q78B 1N9AB 4MMIA 1N7NA 1V7VA 1N21A 2WY8A 3CIHA 2WIIB 5JPMB 2BEDB 2AHGA 2RI9A 2PMVA 1OJPA 4DODA 4D4BA 1H3AA 1QQFA 3M7BA 4OZWA 1HZFA 2PN5A 3PZ1B 5JMDA 3PZ4B 1R76A 3ACTA 4V1RA 2EAEA 3RX7A 1IA6A 2BRPA 3PYAA
chains in the Genus database with same CATH topology
1K72A 4FUSA 4D4AA 3RENA 3P2CA 1SA5B 3M77A 3E6UA 3SAEA 1GLMA 2GOXA 1H54A 3QWTA 1VD5A 3SDTA 2DRRA 5FO7B 4YDOB 2B4FA 3QXFA 1N4QB 3PZ3B 1N4RB 3KQ4A 1FP3A 4TXTA 1H3BA 1LF6A 1GAHA 3WKIA 3SDRA 3E33B 5GW7A 3W7WA 3DSUB 1NC5A 1FCEA 1TNUB 2I07B 1WU4A 2RI8A 4YCRA 3QT9A 1FO3A 1FPPB 4WU0A 1G6IA 4JJJA 2XFGA 3D5RA 4WVAA 2EABA 3WUXA 4ZRPA 1H37A 3SFXB 4AYQA 2FBAA 1XWTA 4D4DA 3KLSA 1TF4A 1X81B 3ANIA 5M7YA 1UT9A 3E32B 4Q2BA 3M7LA 3HXEB 3PYBA 2V8IA 4CJ0A 1XW2A 3D5SA 3EU5B 3QRYA 2XWJB 3K11A 3E73A 5CZLA 1TN6B 1KSDA 4LNBB 5GZKA 4ZH1A 4ONTA 3M78A 1UG9A 5E2JA 1RQ5A 3KSQB 4GTSB 3S4AA 2A8ZA 1O1SB 1LTXB 3X17A 3S9VA 3EUVB 5FOBB 1TN7B 2ZZRA 3W7XA 1H35A 3QG0A 3WIRA 4AYOA 3W5NA 4YDEB 2P0VA 1V5DA 3RRSA 2CQTA 5CA3A 4D4CA 2H6HB 4AYPA 3ACSA 4LIXA 1MZCB 3Q79B 2B39A 1D8EB 4FXKB 2G0DA 3W5MA 1NL4B 4GL3A 1LD7B 2H6GB 1H14A 1XWQA 1LF9A 1O6QA 1FO2A 1N94B 2SQCA 4C1SA 1FMIA 3WIWA 2FV0A 3Q7FB 3GLYA 4GTVB 1DCEB 1KZOB 4Q88A 4KKJA 1IA7A 1H12A 2EADA 1GSZA 1QBQB 1JCSB 4GTQB 1D8DB 2XQWA 1DOGA 1FAEA 4J5TA 3WC3A 3VXDA 3HXBB 2DRQA 3EQAA 4MU9A 3P5RA 3QDEA 4KTPA 4DOEA 2WYNA 1KRFA 1KWFA 2ZISB 3DSVB 1N4SB 1G87A 1L1YA 3W7UA 3M7EA 1TNYB 3C72B 3H3KA 3VW5A 2BBCA 1S64B 3HXFB 4ZG8A 1GXNA 3WKFA 4LNGB 1KZPB 3M72A 3QFYA 2V8JA 4GTRB 4KKIA 2YIKA 3HXDB 3SDUA 1V7WA 1N4PB 1O5MB 3Q73B 2AFAA 1JCRB 1NXCA 4L0GA 3M74A 4QT9A 2Z07A 2NOJA 1F9OA 1W6KA 2DROA 1FBOA 1DL2A 2VN4A 2G02A 1V5CA 2A73B 2CQSA 3EU8A 4D94A 1IS9A 1TNOB 5FO8B 1QSJA 2XWBB 3DSTB 4FXGB 3PZ2B 3M7CA 3PMMA 3RX8A 1FBWA 4L6XA 4CE7A 5KKBA 2JJBA 1ULVA 3RSYA 2IEJB 4BOJA 1G9GA 1H39A 1O1TB 2D8LA 1F9DA 2EACA 3E34B 3WKHA 5CD2A 4CJ1A 3RX5A 2D5JA 2V8KA 3ANJA 2WY7A 4WVBA 3DPYB 3OEDA 4Z4LA 1WZZA 1LD8B 1CLCA 4ZRQA 3KSLB 3H7LA 2H6IB 4GTTB 1H3CA 4BOKA 3K7XA 4WVCA 1O6RA 3M71A 3DSXB 2FUZA 1GXOA 3ANKA 3M73A 2BB5A 3M76A 3CU7A 3DRAB 1TN8B 1O1RB 1KS8A 2BB6A 3DSSB 3EZ8A 1GXMA 4AYRA 3S4DA 2DRSA 4M76A 3QSPA 4XUVA 1KSCA 3A3VA 1C3DA 1HCUA 1TNBB 2RGKA 2V3PA 2VN7A 4MBGB 2QNOA 2F0YB 4GTMB 1CEMA 1WU6A 5FO9B 1SA4B 4GTPB 4TF4A 4ZH5A 4L9PB 3G6JB 2JG0A 4Z4JA 3H2WA 1JCQB 3DSWB 3GZKA 3GT5A 2FV1A 1AGMA 3W7TA 3HXCB 2NVPA 2OKXA 1KREA 3QPFA 1GHQA 2F6DA 5GY3A 5DGRA 3S4BA 3OXUA 1AYXA 4V1SA 3P5PA 1JS4A 2R2LB 3D3IA 3W7SA 5DGQA 1O6HA 1WU5A 4GTOB 1X9DA 2V3NA 3Q7AB 1O79A 4KTRA 3ON6A 3S4CA 1N95B 5AGDA 3SDQA 5JPNB 2ZIRB 1FT2B 1GA2A 2AHFA 2H6FB 3AFJA 3Q75B 2ZBLA 1KKTA 1NI1B 3SDVA 1W6JA 4EL8A 2JF4A 3TF4A 3RJ3A 1V7XA 2WINB 2GH4A 3E37B 2GZ6A 4EHMB 1L2AA 5MEHA 3QFZA 1KFGA 3E30B 1TNZB 5M7IA 1H36A 1SQCA 3QT3A 3SQCA 1GAIA 3WKGA 1H13A 4LNVA 1UMPA 3M75A 1G9JA 3QXQA 1S63B 3T33A 3SFYB 3WIQA 1FT1B 3Q78B 1N9AB 1V7VA 2WY8A 3CIHA 2WIIB 5JPMB 2BEDB 2AHGA 2RI9A 2PMVA 4DODA 4D4BA 1H3AA 1QQFA 3M7BA 1HZFA 2PN5A 3PZ1B 3PZ4B 1R76A 3ACTA 4V1RA 2EAEA 3RX7A 1IA6A 3PYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCQ B;  3DSW B;  2A73 B;  1H35 A;  4D4A A;  4D94 A;  1TNO B;  5FO8 B;  1QSJ A;  2XWB B;  3DST B;  3HXC B;  4FXG B;  3PZ2 B;  4YDE B;  1SA5 B;  1GHQ A;  2GOX A;  3OXU A;  4V1S A;  4D4C A;  2H6H B;  2IEJ B;  4BOJ A;  1MZC B;  3Q79 B;  2B39 A;  1H39 A;  1O1T B;  1D8E B;  2R2L B;  4FXK B;  2G0D A;  4YDO B;  5FO7 B;  1N4Q B;  3E34 B;  1N4R B;  3PZ3 B;  3KQ4 A;  1NL4 B;  1O6H A;  1LD7 B;  2H6G B;  4GTO B;  1H3B A;  2V8K A;  2V3N A;  3Q7A B;  2WY7 A;  1O79 A;  1O6Q A;  1N95 B;  5AGD A;  5JPN B;  3DPY B;  2ZIR B;  3OED A;  1N94 B;  2SQC A;  1FT2 B;  4C1S A;  1LD8 B;  4ZRQ A;  3E33 B;  3KSL B;  3Q7F B;  3DSU B;  4GTV B;  2H6I B;  2H6F B;  1DCE B;  1H3C A;  1KZO B;  4GTT B;  4KKJ A;  1TNU B;  4BOK A;  2I07 B;  3Q75 B;  1NI1 B;  1W6J A;  3K7X A;  1FPP B;  1GSZ A;  1O6R A;  1QBQ B;  3RJ3 A;  2WIN B;  1JCS B;  3DSX B;  4GTQ B;  3D5R A;  3E37 B;  1D8D B;  2XQW A;  4EHM B;  1GXO A;  3HXB B;  2BB5 A;  4MU9 A;  4ZRP A;  3E30 B;  1TNZ B;  1H37 A;  3SFX B;  1H36 A;  1SQC A;  3DRA B;  3CU7 A;  3SQC A;  1TN8 B;  1O1R B;  4LNV A;  4D4D A;  3KLS A;  1UMP A;  1X81 B;  2ZIS B;  3DSV B;  1N4S B;  3E32 B;  3HXE B;  1S63 B;  2BB6 A;  3DSS B;  1GXM A;  3SFY B;  2V8I A;  1TNY B;  3C72 B;  3D5S A;  2BBC A;  3EU5 B;  1FT1 B;  2XWJ B;  3Q78 B;  4M76 A;  1N9A B;  1S64 B;  3HXF B;  1C3D A;  1TNB B;  1TN6 B;  4LNB B;  1GXN A;  4ZH1 A;  4LNG B;  2V3P A;  1KZP B;  2WY8 A;  2V8J A;  4MBG B;  4GTR B;  2WII B;  2F0Y B;  4KKI A;  2BED B;  3HXD B;  4GTM B;  4ONT A;  5JPM B;  1N4P B;  1O5M B;  2PMV A;  3Q73 B;  4D4B A;  1JCR B;  1H3A A;  1QQF A;  3KSQ B;  1HZF A;  2PN5 A;  3PZ1 B;  4GTS B;  2NOJ A;  1O1S B;  5FO9 B;  1W6K A;  1R76 A;  1SA4 B;  3PZ4 B;  1LTX B;  4GTP B;  4V1R A;  3EUV B;  5FOB B;  4L9P B;  1TN7 B;  3G6J B;  2G02 A; 
#chains in the Genus database with same CATH topology
 5C05 A;  5EAT A;  1K72 A;  4FUS A;  4D4A A;  3REN A;  5IM1 A;  3E80 A;  2ONG A;  3P2C A;  1SA5 B;  3M77 A;  3E6U A;  3SAE A;  1GLM A;  2GOX A;  1H54 A;  3QWT A;  1VD5 A;  3SDT A;  2DRR A;  1W3Y A;  1HM2 A;  5FO7 B;  4YDO B;  2B4F A;  3QXF A;  1N4Q B;  3PZ3 B;  1N4R B;  3KQ4 A;  1FP3 A;  4TXT A;  1H3B A;  1LF6 A;  1GAH A;  3WKI A;  3SDR A;  4E1Y A;  4RNQ A;  3E33 B;  5GW7 A;  3W7W A;  3NNB A;  3DSU B;  1NC5 A;  3LZ9 A;  1FCE A;  1TNU B;  2I07 B;  2BRW A;  1J0M A;  1WU4 A;  2RI8 A;  4YCR A;  3QT9 A;  1FO3 A;  1FPP B;  4WU0 A;  1G6I A;  5EAS A;  4JJJ A;  2XFG A;  3D5R A;  1X1J A;  4WVA A;  4OZV A;  2J5C A;  1HN0 A;  2EAB A;  1HM3 A;  3WUX A;  4ZRP A;  1H37 A;  3SFX B;  4AYQ A;  2FBA A;  5EAU A;  1XWT A;  4D4D A;  3KLS A;  3ANI A;  1TF4 A;  1X81 B;  5M7Y A;  1UT9 A;  3E32 B;  1HMU A;  4Q2B A;  3M7L A;  3HXE B;  3PYB A;  2V8I A;  4CJ0 A;  1XW2 A;  3D5S A;  3EU5 B;  3QRY A;  2XWJ B;  3G4F A;  3K11 A;  3E73 A;  5CZL A;  1TN6 B;  1KSD A;  4LNB B;  5GZK A;  4ZH1 A;  2Q1F A;  4ONT A;  3M78 A;  1UG9 A;  5E2J A;  3M01 A;  1RQ5 A;  3KSQ B;  1RWC A;  4GTS B;  3S4A A;  2A8Z A;  1O1S B;  1LXM A;  1LTX B;  3X17 A;  3S9V A;  3EUV B;  5FOB B;  1HMW A;  1TN7 B;  2ZZR A;  3W7X A;  2WCO A;  1H35 A;  1OJO A;  3QG0 A;  3WIR A;  4AYO A;  3W5N A;  4YDE B;  2P0V A;  1V5D A;  3RRS A;  1F1S A;  3A0O A;  2CQT A;  5IKA A;  5CA3 A;  4D4C A;  1QAZ A;  1N1B A;  2H6H B;  3E7J A;  4AYP A;  3ACS A;  4LIX A;  1MZC B;  3Q79 B;  1OJN A;  2B39 A;  5ILH A;  1D8E B;  4FXK B;  2G0D A;  3AFL A;  3W5M A;  1NL4 B;  4GL3 A;  1LD7 B;  2H6G B;  5IL8 A;  1H14 A;  1XWQ A;  1LF9 A;  1O6Q A;  1FO2 A;  1N94 B;  2SQC A;  4C1S A;  1FMI A;  3WIW A;  1I8Q A;  1N7O A;  2FV0 A;  3GLY A;  3Q7F B;  4GTV B;  5IK9 A;  1DCE B;  1KZO B;  4Q88 A;  4KKJ A;  1IA7 A;  1H12 A;  3VSN A;  2EAD A;  2E22 A;  1GSZ A;  1QBQ B;  1JCS B;  4GTQ B;  2X03 A;  1D8D B;  2XQW A;  1DOG A;  1FAE A;  4J5T A;  4OK4 A;  3WC3 A;  3VXD A;  5ILK A;  3HXB B;  2DRQ A;  3EQA A;  4MU9 A;  3P5R A;  3QDE A;  4KTP A;  4DOE A;  3N0F A;  2WYN A;  1KRF A;  1KWF A;  2ZIS B;  3DSV B;  1N4S B;  1G87 A;  1L1Y A;  3W7U A;  3M7E A;  2FUQ A;  1TNY B;  3C72 B;  3H3K A;  3VW5 A;  2BBC A;  1S64 B;  3HXF B;  1X1H A;  4ZG8 A;  1GXN A;  3WKF A;  4LNG B;  1KZP B;  3M72 A;  3QFY A;  2V8J A;  4GTR B;  1J0N A;  4KKI A;  2YIK A;  3HXD B;  3SDU A;  1V7W A;  1N4P B;  4FJQ A;  1O5M B;  3Q73 B;  2AFA A;  1HX9 A;  1JCR B;  1NXC A;  4GAX A;  4L0G A;  3M74 A;  4QT9 A;  2Z07 A;  2NOJ A;  3NFV A;  1F9O A;  1W6K A;  2DRO A;  1FBO A;  3M00 A;  1DL2 A;  2VN4 A;  2G02 A;  1V5C A;  5ILY A;  2A73 B;  2CQS A;  3EU8 A;  4D94 A;  1IS9 A;  1TNO B;  5FO8 B;  1QSJ A;  2XWB B;  3DST B;  4FXG B;  3PZ2 B;  2WDA A;  3M7C A;  1HXA A;  3PMM A;  1N7Q A;  5DHK A;  3RX8 A;  1FBW A;  4L6X A;  4CE7 A;  5KKB A;  2JJB A;  1ULV A;  2FUT A;  3RSY A;  2IEJ B;  4BOJ A;  1G9G A;  1HXC A;  1H39 A;  3N0G A;  1O1T B;  2D8L A;  4OK2 A;  1F9D A;  2EAC A;  1N20 A;  3E34 B;  3WKH A;  5CD2 A;  4CJ1 A;  3RX5 A;  2D5J A;  2V8K A;  3ANJ A;  1RW9 A;  2WY7 A;  4WVB A;  1N7R A;  5IKH A;  3DPY B;  3OED A;  4Z4L A;  1WZZ A;  1LD8 B;  1CLC A;  4ZRQ A;  3KSL B;  2ONH A;  3H7L A;  2H6I B;  4GTT B;  1H3C A;  4BOK A;  4FNV A;  3K7X A;  1CB8 A;  4WVC A;  1O6R A;  3M71 A;  3DSX B;  1N7P A;  2FUZ A;  5ILD A;  1GXO A;  3ANK A;  3M73 A;  1LXK A;  1C82 A;  2BB5 A;  3M76 A;  3G4D A;  3CU7 A;  3DRA B;  1TN8 B;  5IK6 A;  1N22 A;  1N1Z A;  1O1R B;  1KS8 A;  1N24 A;  1RWF A;  4OJZ A;  2BB6 A;  3DSS B;  3EZ8 A;  1GXM A;  4AYR A;  3S4D A;  4NEI A;  2DRS A;  4M76 A;  3QSP A;  4XUV A;  1KSC A;  3A3V A;  1C3D A;  1HCU A;  1EGU A;  1HV6 A;  1TNB B;  4F10 A;  4MMH A;  5ILJ A;  2RGK A;  2V3P A;  2VN7 A;  4MBG B;  2QNO A;  2BRV X;  2F0Y B;  4GTM B;  3VSM A;  1RWA A;  1CEM A;  5ILZ A;  1F9G A;  1RWG A;  1WU6 A;  5FO9 B;  1SA4 B;  4GTP B;  4DI5 A;  4TF4 A;  4ZH5 A;  4L9P B;  1LOH A;  3G6J B;  1OJM A;  2JG0 A;  4Z4J A;  3H2W A;  1JCQ B;  3DSW B;  3GZK A;  3GT5 A;  2FV1 A;  1AGM A;  3W7T A;  3HXC B;  2NVP A;  1HXG A;  2OKX A;  1KRE A;  3QPF A;  1GHQ A;  2F6D A;  5GY3 A;  5ILI A;  5DGR A;  3S4B A;  3OXU A;  1AYX A;  4V1S A;  3P5P A;  1JS4 A;  2R2L B;  3D3I A;  3W7S A;  5IL3 A;  5DGQ A;  1O6H A;  1WU5 A;  2E24 A;  4GTO B;  5DHI A;  1X9D A;  2V3N A;  3Q7A B;  1O79 A;  4KTR A;  3ON6 A;  3S4C A;  1N95 B;  5AGD A;  3SDQ A;  5JPN B;  2ZIR B;  1FT2 B;  1GA2 A;  5JMF A;  2AHF A;  3M02 A;  2H6F B;  3AFJ A;  3Q75 B;  2ZBL A;  1KKT A;  1NI1 B;  3SDV A;  1W6J A;  4EL8 A;  2JF4 A;  3TF4 A;  3RJ3 A;  4F13 A;  1V7X A;  5IK0 A;  2WIN B;  2GH4 A;  3E37 B;  1RWH A;  2GZ6 A;  4EHM B;  1L2A A;  5MEH A;  3QFZ A;  1KFG A;  3E30 B;  1TNZ B;  5M7I A;  1H36 A;  1SQC A;  3QT3 A;  3SQC A;  1GAI A;  3WKG A;  1H13 A;  4LNV A;  1UMP A;  3M75 A;  1G9J A;  1X1I A;  3QXQ A;  1S63 B;  3T33 A;  3SFY B;  1N23 A;  3WIQ A;  1FT1 B;  3Q78 B;  1N9A B;  4MMI A;  1N7N A;  1V7V A;  1N21 A;  2WY8 A;  3CIH A;  2WII B;  5JPM B;  2BED B;  2AHG A;  2RI9 A;  2PMV A;  1OJP A;  4DOD A;  4D4B A;  1H3A A;  1QQF A;  3M7B A;  4OZW A;  1HZF A;  2PN5 A;  3PZ1 B;  5JMD A;  3PZ4 B;  1R76 A;  3ACT A;  4V1R A;  2EAE A;  3RX7 A;  1IA6 A;  2BRP A;  3PYA A; 
#chains in the Genus database with same CATH homology
 1K72 A;  4FUS A;  4D4A A;  3REN A;  3P2C A;  1SA5 B;  3M77 A;  3E6U A;  3SAE A;  1GLM A;  2GOX A;  1H54 A;  3QWT A;  1VD5 A;  3SDT A;  2DRR A;  5FO7 B;  4YDO B;  2B4F A;  3QXF A;  1N4Q B;  3PZ3 B;  1N4R B;  3KQ4 A;  1FP3 A;  4TXT A;  1H3B A;  1LF6 A;  1GAH A;  3WKI A;  3SDR A;  3E33 B;  5GW7 A;  3W7W A;  3DSU B;  1NC5 A;  1FCE A;  1TNU B;  2I07 B;  1WU4 A;  2RI8 A;  4YCR A;  3QT9 A;  1FO3 A;  1FPP B;  4WU0 A;  1G6I A;  4JJJ A;  2XFG A;  3D5R A;  4WVA A;  2EAB A;  3WUX A;  4ZRP A;  1H37 A;  3SFX B;  4AYQ A;  2FBA A;  1XWT A;  4D4D A;  3KLS A;  1TF4 A;  1X81 B;  3ANI A;  5M7Y A;  1UT9 A;  3E32 B;  4Q2B A;  3M7L A;  3HXE B;  3PYB A;  2V8I A;  4CJ0 A;  1XW2 A;  3D5S A;  3EU5 B;  3QRY A;  2XWJ B;  3K11 A;  3E73 A;  5CZL A;  1TN6 B;  1KSD A;  4LNB B;  5GZK A;  4ZH1 A;  4ONT A;  3M78 A;  1UG9 A;  5E2J A;  1RQ5 A;  3KSQ B;  4GTS B;  3S4A A;  2A8Z A;  1O1S B;  1LTX B;  3X17 A;  3S9V A;  3EUV B;  5FOB B;  1TN7 B;  2ZZR A;  3W7X A;  1H35 A;  3QG0 A;  3WIR A;  4AYO A;  3W5N A;  4YDE B;  2P0V A;  1V5D A;  3RRS A;  2CQT A;  5CA3 A;  4D4C A;  2H6H B;  4AYP A;  3ACS A;  4LIX A;  1MZC B;  3Q79 B;  2B39 A;  1D8E B;  4FXK B;  2G0D A;  3W5M A;  1NL4 B;  4GL3 A;  1LD7 B;  2H6G B;  1H14 A;  1XWQ A;  1LF9 A;  1O6Q A;  1FO2 A;  1N94 B;  2SQC A;  4C1S A;  1FMI A;  3WIW A;  2FV0 A;  3Q7F B;  3GLY A;  4GTV B;  1DCE B;  1KZO B;  4Q88 A;  4KKJ A;  1IA7 A;  1H12 A;  2EAD A;  1GSZ A;  1QBQ B;  1JCS B;  4GTQ B;  1D8D B;  2XQW A;  1DOG A;  1FAE A;  4J5T A;  3WC3 A;  3VXD A;  3HXB B;  2DRQ A;  3EQA A;  4MU9 A;  3P5R A;  3QDE A;  4KTP A;  4DOE A;  2WYN A;  1KRF A;  1KWF A;  2ZIS B;  3DSV B;  1N4S B;  1G87 A;  1L1Y A;  3W7U A;  3M7E A;  1TNY B;  3C72 B;  3H3K A;  3VW5 A;  2BBC A;  1S64 B;  3HXF B;  4ZG8 A;  1GXN A;  3WKF A;  4LNG B;  1KZP B;  3M72 A;  3QFY A;  2V8J A;  4GTR B;  4KKI A;  2YIK A;  3HXD B;  3SDU A;  1V7W A;  1N4P B;  1O5M B;  3Q73 B;  2AFA A;  1JCR B;  1NXC A;  4L0G A;  3M74 A;  4QT9 A;  2Z07 A;  2NOJ A;  1F9O A;  1W6K A;  2DRO A;  1FBO A;  1DL2 A;  2VN4 A;  2G02 A;  1V5C A;  2A73 B;  2CQS A;  3EU8 A;  4D94 A;  1IS9 A;  1TNO B;  5FO8 B;  1QSJ A;  2XWB B;  3DST B;  4FXG B;  3PZ2 B;  3M7C A;  3PMM A;  3RX8 A;  1FBW A;  4L6X A;  4CE7 A;  5KKB A;  2JJB A;  1ULV A;  3RSY A;  2IEJ B;  4BOJ A;  1G9G A;  1H39 A;  1O1T B;  2D8L A;  1F9D A;  2EAC A;  3E34 B;  3WKH A;  5CD2 A;  4CJ1 A;  3RX5 A;  2D5J A;  2V8K A;  3ANJ A;  2WY7 A;  4WVB A;  3DPY B;  3OED A;  4Z4L A;  1WZZ A;  1LD8 B;  1CLC A;  4ZRQ A;  3KSL B;  3H7L A;  2H6I B;  4GTT B;  1H3C A;  4BOK A;  3K7X A;  4WVC A;  1O6R A;  3M71 A;  3DSX B;  2FUZ A;  1GXO A;  3ANK A;  3M73 A;  2BB5 A;  3M76 A;  3CU7 A;  3DRA B;  1TN8 B;  1O1R B;  1KS8 A;  2BB6 A;  3DSS B;  3EZ8 A;  1GXM A;  4AYR A;  3S4D A;  2DRS A;  4M76 A;  3QSP A;  4XUV A;  1KSC A;  3A3V A;  1C3D A;  1HCU A;  1TNB B;  2RGK A;  2V3P A;  2VN7 A;  4MBG B;  2QNO A;  2F0Y B;  4GTM B;  1CEM A;  1WU6 A;  5FO9 B;  1SA4 B;  4GTP B;  4TF4 A;  4ZH5 A;  4L9P B;  3G6J B;  2JG0 A;  4Z4J A;  3H2W A;  1JCQ B;  3DSW B;  3GZK A;  3GT5 A;  2FV1 A;  1AGM A;  3W7T A;  3HXC B;  2NVP A;  2OKX A;  1KRE A;  3QPF A;  1GHQ A;  2F6D A;  5GY3 A;  5DGR A;  3S4B A;  3OXU A;  1AYX A;  4V1S A;  3P5P A;  1JS4 A;  2R2L B;  3D3I A;  3W7S A;  5DGQ A;  1O6H A;  1WU5 A;  4GTO B;  1X9D A;  2V3N A;  3Q7A B;  1O79 A;  4KTR A;  3ON6 A;  3S4C A;  1N95 B;  5AGD A;  3SDQ A;  5JPN B;  2ZIR B;  1FT2 B;  1GA2 A;  2AHF A;  2H6F B;  3AFJ A;  3Q75 B;  2ZBL A;  1KKT A;  1NI1 B;  3SDV A;  1W6J A;  4EL8 A;  2JF4 A;  3TF4 A;  3RJ3 A;  1V7X A;  2WIN B;  2GH4 A;  3E37 B;  2GZ6 A;  4EHM B;  1L2A A;  5MEH A;  3QFZ A;  1KFG A;  3E30 B;  1TNZ B;  5M7I A;  1H36 A;  1SQC A;  3QT3 A;  3SQC A;  1GAI A;  3WKG A;  1H13 A;  4LNV A;  1UMP A;  3M75 A;  1G9J A;  3QXQ A;  1S63 B;  3T33 A;  3SFY B;  3WIQ A;  1FT1 B;  3Q78 B;  1N9A B;  1V7V A;  2WY8 A;  3CIH A;  2WII B;  5JPM B;  2BED B;  2AHG A;  2RI9 A;  2PMV A;  4DOD A;  4D4B A;  1H3A A;  1QQF A;  3M7B A;  1HZF A;  2PN5 A;  3PZ1 B;  3PZ4 B;  1R76 A;  3ACT A;  4V1R A;  2EAE A;  3RX7 A;  1IA6 A;  3PYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...