4MUFA

Crystal structure of pantothenate synthetase in complex with 2-(2-(4-tert-butylphenylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
278
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 89
structure length 278
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mufA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mufA01
1Y42X 1J21A 3ELBA 1YIDA 4ZT6A 4K0RA 2J09A 4OUDA 3U1VA 4I6EA 2DETA 2CV2A 1F9AA 3SEZA 1JEEA 2E89A 2GKSA 1M8JA 3IDFA 4H3SA 3CLRD 4MW9A 2A84A 3CLUC 2OV4A 3AIIA 2BYTA 4MQ6A 3KT8A 4MW2A 3MUEA 1X6VA 1I6MA 4MWCA 3ZUGA 4FZJA 3S3TA 2VTBA 2V0GA 2YWCA 4EG4A 1X8XA 1KQNA 1ZJWA 2PFSA 4MVWA 3NV7A 3VGJA 1VBKA 1MC1A 2V0CA 4HJRA 1OBHA 4R2LA 5FO0A 3A05A 5LFAA 2VXOA 2IELA 3MLBA 2WB2A 2DUMA 4G5YA 2YY5A 3IVCA 3HGMA 4R2MA 3UY4A 4GRIA 2A1TS 1YI8A 5J59A 3AL0C 1N2OA 2A4MA 3HZRA 2A1TR 2IP1A 3H05A 4MWEA 4A91A 1TQ8A 1DNPA 5HUJA 1N2HA 1NURA 1JZQA 1IVSA 3H9CA 1NI5A 3ZJVA 2A7XA 5BNZA 2ZUEA 4MUKA 2OQ2A 3G5AA 4MW7A 1TYDE 2E21A 1F7VA 1U3CA 4NDAA 3RK1A 1EXDA 4F4HA 2CYAA 3L92A 3PNBA 3PNVA 3RJZA 1JZSA 4EG5A 3CLTC 1M8GA 4RPIA 4DNXA 1EFPA 1O95D 4KR6A 2IJGX 1OWPA 1N2EA 3CLSD 2WQ6A 3K32A 2X1LA 3FWKA 2J4DA 4MWDA 2C5SA 1J70A 4KR7A 2X3FA 4MUNA 3FNRA 4ZT2A 2QTMA 1WXHA 3CVVA 1QQTA 3IUEA 3A4IA 3PNYA 1H3NA 4MW5A 2J5BA 2NSYA 4QBTA 1OD6A 4K03A 2PG3A 3H9BA 1LW7A 1NP7A 1IH8A 1IQ0A 1COZA 3TS1A 1Q77A 1PFWA 2X1MA 4MUEA 3IMCA 2E0IA 2QJFA 1KH2A 1I2DA 1MJHA 1WY5A 4Q16A 5IHXA 3FOCA 2BTEA 3COWA 1N77A 3UMVA 3QTBA 2WSIA 2DLCX 4ND7A 4OJMX 1NSYA 2HGZA 1TYBE 1TYCA 3KT0A 5J58A 5TEWA 1JIJA 3CVYA 1T6YA 1V47A 1ZUNA 3CA8A 2CT8A 4MLPA 2HMAA 1O94C 1LI7A 1BS2A 4UZFA 4ARCA 1T9GS 2QTNA 1D2RA 3SZGA 2O8VA 1T6ZA 4UZEA 1N78A 2QJTA 4MVCA 1ULHA 1QNFA 3ZIUA 1T9GR 3GLVA 3FI0A 1MOPA 1JILA 1VBMA 3FDXA 3AFHA 1B6TA 2GM3A 3COZA 1MBZA 1IQUA 5HG0A 1GN8A 1O97C 3CLSC 2RE8A 1QRSA 3PXUA 3SYTA 2DEUA 1HYBA 4Q93A 4YP5A 3TNJA 1GLNA 4EG1A 4E1AA 1KQPA 3Q12A 3DO8A 3DV2A 1NUTA 1N2BA 5EKDA 1U0BB 4YMIA 3UC5A 4JYZA 2I1LA 5K0SA 3LE8A 1GTSA 1M1ZA 3IVXA 1K4KA 1M83A 3AKZA 3LOQA 1Q19A 4HK4A 3ZJTA 2H2AA 4I6JA 4CDNA 3LCJA 1NUQA 1Q15A 4MAFA 1YUNA 1V8FA 4CDMA 1XNJA 4DLPA 1FFYA 4J75A 1K97A 3A04A 4F3RA 3QE4A 2Z08A 2ZUFA 3FG9A 4MW1A 5DB4A 3HFJA 3H97A 4EFKA 5F23A 5DASA 4PBTA 1WXGA 4ZCRA 3H99A 4EG8A 3SZ3A 1PFUA 2A88A 2PXHA 1N1DA 5KCMA 4I6GA 4ZCPA 1JIIA 5HUHA 1UFVA 2PZ8A 3VU8A 1R6TA 4MWBA 4YP6A 3MMXA 1N2GA 1H1TA 4ZCTA 4NX2A 3JXEA 3UK2A 3A2KA 1G8FA 3IODA 1T6XA 3RHSA 1WZ2A 3ISJA 2QJOA 2QTRA 1XNHA 1RQGA 2JAXA 4HJXA 3IUBA 2E18A 5KWVA 2NZ2A 3CLRC 1KH1A 4RUKA 5DEOA 1WXEA 4ZT3A 1P7PA 1XJQA 1QJCA 4KKVA 1KKUA 1OWLA 1VBNA 2A86A 1JEDA 1GAXA 3IMEA 3INNA 1JHDA 1ZH0A 3KFLA 2WQ7A 3CVWA 4KPUB 2QUKA 3FY4A 1J1ZA 3N9IA 1PFVA 1QTQA 2ZP1A 2X0KA 1WXFA 3P0IA 4L2IB 3COYA 2PZAA 1WOYA 4S1OA 1WXIA 3KT6A 1IQRA 2JANA 4P2BA 4NAUA 3HL4A 3FETA 1PG0A 4MUHA 2A1UB 5K0TA 4NAHA 3RBAA 3CLUD 4TS1A 5DK4A 4KR9A 4GU5A 4MULA 1J1UA 3P52A 3N2YA 5FNZA 4R0NA 1WQ3A 1JGTA 4NZPA 3TQIA 2J07A 3ZXIA 1MAWA 1VL2A 2H29A 3ZGZA 4ND6A 1OBCA 4JZYA 1NUUA 3IOBA 2J08A 3BL5A 4WSOA 3FH0A 2O5RA 4XFJA 5TEVA 2DR2A 2EL7A 1G59A 4PBRA 3I05A 4PY2A 3IMGA 1IFXA 3F3MA 3FIUA 3DLAA 4DDKA 1R6XA 1O95C 1KP3A 4G5FA 3P0JA 1MAUA 2B7LA 3KT3A 4CT0A 3MXTA 4YBRA 4DE5A 5KHAA 4G6ZA 4EGAA 4OUDB 5LLTA 1OWNA 3AG5A 2TS1A 3GMIA 5TGTA 3ZXSA 4DDHA 2CUZA 4ZCQA 5FO1A 1M8PA 1FYDA 1SURA 5J5AA 4JFAA 1PG2A 3NBAA 1EUQA 1GZUA 2PZBA 3D6UA 3G6KA 4J76A 4EG6A 2QUIA 3CLTD 2VTBB 1K92A 1OWOA 3CR8A 3IVGA 1F7UA 5JBNA 1Q11A 2D5BA 3DPIA 2G36A 3IOEA 1KAQA 3HMQA 4U63A 1EE1A 1MRZA 1YUMA 1GTRA 1H3EA 1YULA 4YP7A 2D54A 1QRUA 1KQOA 3G59A 1WKBA 1GPMA 4U8HA 3D6VA 1R6UA 4ZCSA 1EUYA 2QUJA 2JA2A 2EJCA 3X1JA 3TZEA 1K4MA 1KP2A 3OP1A 2XRZA 1JMVA 3MLAA 4EG7A 2DPLA 3SP1A 1O0CA 1A8HA 5AHWA 5IJXA 5TS2A 2DXIA 1KAMA 1LI5A 4DDMA 1VLHA 2YXNA 3CVXA 1U3DA 4QRDA 4X0EA 3E27A 2GOYA 2AKEA 1O0BA 4DJAA 2Z3VA 1JIKA 1QU2A 2CYCA 1MB9A 3UOWA 4MVYA 2CV1A 1TEZA 2DERA 4MW0A 1ZH6A 1G8GA 4ZT7A 1EFPB 3SDBA 3C8ZA 1G8HA 1H3FA 1M8KA 3ND5A 3TZLA 1U7DA 1S4MA 4EF6A 1O94D 4ZT5A 2R5WA 3P0HA 2CSXA 2Z09A 2AG6A 1O96B 1QRTA 3IOCA 4MVXA 2XRYA 3M5WA 1WQ4A 1I6KA 2D13A 1N2IA 4WNYA 3RFFA 3TQOA 3X1KA 3AG6A 3ND6A 4CQNA 1O97D 3GUZA 4AQ7A 4MW4A 1XNGA 1CT9A 2PIDA 3L93A 1F4LA 4MUGA 1IRXA 2CFOA 1I6LA 4MUIA 4EG3A 1O96A 4ZT4A 3ND7A 4U7JA 2CV0A 3SEQA 2RD2A 4KPUA 4MUJA 1U7XA 5H7XA 3FHJA 3N05A 3ILVA 4ARIA 3PRHA 4QREA 4JXZA 3IH5A 1TYAE 4JXXA 1NUPA 1TFUA 2CYBA 3Q4GA 3COVA 3Q10A 1OWMA 1JECA 4L2IA 1O5TA 4PBSA 1EFVB 1NUSA 1MB2A 1N75A 2A1UA 1N3LA 4MUFA 3NBKA 1O6BA 1ILEA 1YIAA 1KORA 1NZJA 2HZ7A 4AS1A 2AZXA 3K9WA 1WJGA 3VRHA 1N2JA 3HV0A 2QUHA 1IHOA 4XSVA 1EJ2A 3CVUA 3N8HA 1KH3A 1KR2A 5H16A 3X1MA 3RK0A 3QTTA 4HPWA 1M8FA 1EFVA 4NATA 4BWVA 1PFYA 1QU3A 2YWBA 1NYLA 1J20A 4MW6A 3ZJUA 3OTWA 4XFDA 1J09A 5LM3A
chains in the Genus database with same CATH superfamily
2RMKA 5FOUA 4AP9A 1USGA 4ALNA 1Y42X 1Y1SA 2MR6A 2VRBA 3HCFA 4RVOA 2GKGA 4JEHA 4KFUA 1UWVA 1YBVA 4DV7B 3RAFC 1M1XB 3W9SA 3DD1A 1Z4IA 5AWFC 3M1YA 3ZNOA 3ZWVA 3IX7A 1WIWA 1XB2A 5CNMA 2A9QA 2CV2A 1WUIS 5CW2A 1ZM4A 2QROA 4OGFA 1ZJ5A 4N03A 2GBFA 2O8DB 2FEPA 1NQUA 3EC2A 4JLOA 1QK3A 4X00A 3TZ6A 1NOJA 4C1NA 1QFJA 1U6KA 1KERA 3TAXA 1FFWA 3I8OA 3V1UA 4Y0AA 6GPBA 1A2KC 1WXDA 1D1SA 3QEOA 5B1HA 5THKA 3GFVA 3CO5A 3HB9A 5T57A 5L3QB 3OP4A 3TLBA 2I3DA 5TMBA 2AOTA 4GM1A 3W7VA 4J6EA 4DSTA 2CSUA 4MP6A 2ZYWX 4D9NA 3NV7A 2XF2A 3U1TA 1J2EA 1TW2A 4BV2A 1XUOA 2AOWA 1NRIA 1W34A 3NRJA 1NY6A 2QT9A 3A05A 1KQFA 2CL5A 5I8ZA 2ECQA 3MWJA 1NKTA 4G8JA 5KQPA 3ZDEA 3EQ2A 4TKVA 4BLRA 2F8LA 4F5DA 1Y8QB 3GZNB 4GRIA 3GLFE 1YI8A 3PWTA 4XVCA 3O9ZA 2D74A 4IXMA 4CMAA 4ZJYA 3GEBA 1GCIA 3VTZA 1MAAA 5T4BA 5ADUS 1TQ8A 5B4VA 5K03A 1ACMA 4AJNA 4ENSA 1N2HA 4ON9A 5AVWA 4LZAA 4MKGA 3KC2A 4M2LA 4FQ7A 5ERXA 5F1PA 4F9FA 3U61B 4F97A 1IVSA 1E6MA 5JAOA 3ZJVA 1W94A 3OFKA 2GXAA 1A82A 2GLUA 1CHNA 1XWFA 2WICA 3E4DA 3I09A 1TYDE 5DYTA 1ZM7A 3BMQB 2WJ4A 4LWZA 4UNIA 3TOCA 3KPJA 5KREA 1GQYA 1QIEA 1RVDA 2CXQA 4X1YB 4UW9A 5HPYB 1U0LA 2WJ6A 4CV3A 2I2FA 3E3OA 5E0OA 4LMRA 3KYCA 3F9RA 1AV7A 3ZY5A 4IJVA 3VKGA 4CU2A 1EFPA 1R8SA 3LWZA 1Q3KA 4PICA 2Y3IA 5LB4A 3T7SA 4M8KA 1KJYA 2XNKA 3MERA 4HEA1 2D5LA 3AHGA 4J4TA 4G2TA 2VHTA 1FTNA 4FYPA 5SY6A 3UGQA 2DLDA 4AJ9A 4DNPA 2YBEA 1SRQA 2C9MA 1FP7A 1T29A 4IYJA 1R15A 2CFCA 4HTAA 2NUBA 5A9TA 1RQRA 2C95A 2NAFA 4HOYA 3ZCSA 3MBIA 1AA9A 4BJ1A 4RANA 2Q5HA 3LIPA 3NVDA 4GWGA 2DH6A 2VQDA 1UIMA 2O23A 1Q0ZA 2JJ2D 3IUEA 1SVSA 3A4IA 3NANA 4NEGA 2XNDD 3I0MA 4DUGA 2FPSA 1NVAA 2GAIA 4MRAA 5T6BA 4QBTA 2ZVPX 1LBQA 3ETEA 1OLXB 4NU8X 3U0VA 2JD0A 4MQ5A 5JV5A 2HSEA 1XCBA 4DLWA 3GXBA 4HFJA 4MVJF 5CCDA 2QLBA 2GPAA 3UMGA 4JP2A 2OKGA 3MWKA 4HYTA 1QDUA 1UZMA 5M2QA 2R97A 3DFIA 1V3UA 1G2OA 1JFFB 1Q2XA 3TPZA 1RAFA 3RVLA 1FP6A 2PK3A 3CUUA 1UAAA 4DCTA 3FD8A 3RBZA 1WDKA 5LA6F 5CK5A 5BWMA 1TYCA 1E1CB 1WKVA 1XBTA 1GT6A 2CW5A 2HD4A 4YB8A 3O4JA 1ZZGA 3EDCA 3IS3A 3QENA 3F1KA 1ZUNA 2X3YA 2I66A 3FUTA 1EVQA 3SMQA 1R6AA 4AIRA 3PGMA 3CF4G 4KQFA 4CNBA 3EFOB 4N0DA 2D1FA 1FXWA 2CHGA 5FOXA 3QX8A 3PFHA 4ARCA 4C6SA 3OPNA 5G02A 1JJBA 3NR2A 1WUKS 3II6X 2QTVB 4KRFA 2RIPA 1CNFA 4BASA 4MWOA 1DEXA 3SIRA 1FY2A 3RS5A 1E4VA 2KMLA 2VG8A 2DX7A 2M9MA 3FI0A 4WECA 2O2YA 3P26A 4UD2A 2WM9B 2WM3A 4YJ2F 5JJ5A 4K28A 2LV8A 4NYJQ 4U2KA 2GZRA 4YJ3F 1MO5A 3K1TA 2ZQYA 3K05A 3A6KA 1H5UA 1SD1A 3CPSA 4KNWA 1ZM2A 4HI0E 5AW0A 3OCXA 3FPHA 1IUNA 1GN8A 3ZY3A 2VQEB 2F00A 5EJ5A 5LLDA 4ZMSA 4ZEVA 1FOEB 1QRSA 2RCYA 4ZRNA 1QGOA 3GX1A 2ST1A 4HFNA 2ZIFA 1KFCB 2IDMA 4FWBA 4CKEB 2G76A 1L4YA 4FGWA 4ZANA 3JZIA 2GN8A 1W7AA 3GIDA 3HACA 1TXGA 1IHXA 4MV1A 4X6XA 1T9HA 1U3GA 3L8MA 2HJGA 3T5DA 2GTPA 5T4FA 4CQMB 3COPA 3M6IA 4KVGA 4WK6A 4X6UA 4BP8A 4QU9A 3DF9A 2BJHA 4QVKA 3D8UA 4GICA 1RW4A 5ICMA 1WUYA 2R6GA 4MKRA 1FBTA 1VL6A 1XRPA 4RVNA 3DV0B 5CA0F 5IVPA 3O6VA 1YB1A 3EFEA 1RE1A 2H7XA 3GFGA 3D3WA 4YRJA 4REOA 3ZEIA 2SICE 4GXTA 4MCIA 1UT6A 3T94A 3ZBQA 4NQZA 1IAVA 1UOOA 1DJLA 2AR0A 5D3QA 4HGNA 5AW6A 4G5GA 1I80A 5AK4A 2VEOA 2IU4A 2G2SA 1C9JA 2EJUA 3AIMA 4LI3X 1DRWA 3X1DA 4Z7NB 3I30X 3INYA 4HQOA 1POWA 4RORA 5JD3A 5LKAA 3OQ1A 1FNCA 1I5EA 1TM7E 3K1AB 2HXYA 3ER6A 4PG7A 3WGVA 2JJ1D 1VLVA 3QNMA 4JSYA 4KIJA 3F5QA 2JBWA 1ZAYA 1UQRA 1WXGA 4K2HA 4ZI7B 2XUZA 5CJJA 2VHQA 3WVNA 2CDNA 4HBGA 4IJKA 1YMVA 4EGQA 4UREA 1GQ2A 2BKXA 5DSXA 4E5DA 4A2QA 3SIXA 4RHYA 3FMPB 2I4OA 3I9JA 4PHHA 4R8LA 2YYAA 2JVKA 5SY9A 2P6OA 2FR8A 4UE3S 4UU8A 3WB2A 1MJNA 1T9AA 1Z2DA 1YB4A 2HK8A 4QU8A 5DTQA 3RTBA 4L72A 5DT9A 4TV8B 1YWGO 3G0OA 4S3MA 1C0LA 1E94E 4MR9B 1SBHA 1F20A 1D9ZA 5KTRA 2WHEA 4KGVA 2OV3A 1QANA 2I52A 3AONB 4Q9HA 2D3WA 1UBEA 1GILA 1FB5A 4HAUA 1XTUA 1DEHA 1W0JA 1XTZA 2DHRA 2EWMA 3A58B 3DMTC 3TVDA 5GVSA 1SD5A 1PVVA 2PGLA 1GZ7A 1G7CA 4LPKA 4M9RA 3VPBA 4FT4A 4P7KA 1L3IA 4P4LA 1YVPA 1GV1A 4RIHA 1XJQA 3T7CA 3TLCA 4CKWA 4BV9A 1R16A 3ELWA 1N6LA 2BFCB 1YDHA 1Q0RA 2Z9DA 3CZ5A 2VI5A 4HPXB 1KETA 2G25A 3FY4A 2P65A 3GNSA 5EMJA 1E2EA 5JD5A 2R5NA 2B7CA 4BX9A 5DCLA 1XKQA 2VQFB 1W5EA 4MKHA 3N9IA 2VAWA 1OXUA 1GRNA 1K4YA 3HFGA 3V1MA 3WHIA 4DCNA 2YJTD 2NVBA 1KI3A 3ECCA 1G8KA 4ZVQA 3PC7A 1K5DA 2VUSA 4UQPA 3ZI7A 4IH1A 2PS1A 2Y1XA 1ISIA 1J2UA 4HXFB 3QA9A 1N0UA 4YAFA 4F3TA 5A0FA 3I5XA 5K0TA 3PC3A 4CF5A 1L4BA 2QL5A 2AMJA 2GK7A 4XM2A 4KR9A 3VR5A 4YIKA 1W5FA 4A8PA 1MQ9A 1J1UA 3MGGA 2B37A 3R1IA 2Q4DA 1WD5A 3EF3A 3H8SA 4XGIA 2UYCA 1EIWA 5LA6A 3OLQA 3OC0A 4ETIA 2WEKA 2NT4A 3E8XA 3L6UA 1FP4A 4KIUA 3S8YA 3HYLA 3OFNA 3U4DA 2QMZA 1UJ2A 1ZL0A 2B2CA 4ZICA 2MDTA 2W37A 4PTZA 2GFHA 1A5SB 1BD4A 2HMWA 2VHWA 2QTBA 4AJLA 1LH0A 2ZBVA 2EU8A 5KYWB 2FEMA 1DOAA 2V6JA 1AN9A 1VGQA 3ZIAD 5AOVA 2WYVA 2GYUA 3OCWA 2ZIXB 1U5AA 1R6XA 3QVKA 4TVOA 3UK6A 3W2IA 4C0SA 4NYJR 4TZ6A 3ZQUA 2QP3A 3JWGA 3VC7A 3O8CA 3A2MA 3QVLA 2P91A 1XMQB 3ND9A 2OFWA 1LBIA 4RE6A 2FMXA 3TOSA 1WPXA 4YJ2A 1RBYA 1SR8A 1QVWA 4XKJA 2JLYA 2ZT6A 4TSFD 9ATCA 1Z29A 2A3NA 3EQZA 4NZMA 1NI4A 2VYND 5G3YA 4LFCB 2W98A 4EUNA 3NONA 3SN6A 2PE5A 1NVXQ 2FF5A 1XVAA 3ODPA 4HWGA 4QM6A 1VMDA 2H7VA 4YTEA 3TNDA 3ESBA 1C4XA 4DMFA 1RI5A 3NBAA 2FMIA 1I4LD 3BUSA 4RMIA 1EUQA 1PAUA 2C3YA 2PZBA 3G2LA 4FLFA 5EJAA 5EY5B 3WLPA 4YC7A 5KUTA 1PF7E 3CR8A 2AOTB 1E5QA 5HBGA 2XKKA 2HF7A 4OFZA 3RO7A 2WMNB 1J8YF 2Q1UA 4D3DA 5AW2A 4CLEA 4U63A 4NS4A 1VPDA 3U26A 4W5QA 2P3OA 3O1JC 4GP9A 3DDHA 4DSNA 1EAYA 3KLBA 4R1QA 5CA0A 1GKYA 3E0QA 4ND3A 1LDYA 2DBVO 2HCTA 2Z04A 3W6OA 4CEIA 4C4YA 4TKVB 1NZFA 3L43A 4W9NA 1CG6A 2JVIA 1E9SA 2POCA 5LC1A 2DPHA 5GTDA 3RYTC 1K0UA 4RZXA 3C4QA 4JN6B 2ZZNA 1A0OA 1IY8A 3DFFA 2HEGA 2VL7A 4UM7A 4XLTA 2R48A 3ZJYA 4GP7A 4ZV4A 3KJFA 4OA8A 4K8OA 3PV0A 5K8VA 1QP0A 1L4GA 1N3IA 1ZN8A 1USWA 3MOGA 1TLLA 3B1XA 5FT9A 4JLMA 2WAYA 1VRWA 3TZEA 5KX5F 4EVQA 5IAOA 5C1OA 1JMVA 1NSFA 4FXOA 1N5IA 2ASEA 4MYTA 1K98A 1CDZA 4CIXA 1AZTA 3FSEA 4UBNA 4CLRA 3CUWA 5F2NA 1YFKA 1VLHA 2HJVA 5FORA 3WMRA 3PXXA 4UUNA 2VAMA 3LX5A 2IEBA 2XRFA 4EJSC 3EXHA 2KX7A 2B1RA 2WFMA 4JR1A 3ZTTA 2MCFA 3RREA 1XZHA 1QGAA 1P81A 2UZ1A 4Y98A 3N6XA 1JTEA 2I34A 3ESDA 5JEEA 1I4TD 1DXYA 3A27A 4DVGA 1SZDA 1OQAA 3ITKA 3ABSB 1A69A 4WNAA 3VJRA 2PUAA 3BORA 521PA 2O05A 2NN3C 1EFPB 2FZGA 3AVQA 3EDOA 3P0RA 3B1YA 5EZSA 4B6FA 1O57A 4WDRA 4GLFA 3TMAA 4TL8A 2EC5A 1XQXA 4NCJA 1HT3A 2DSTA 5HFJA 3Q2IA 3WYEA 2BTOA 1WUHS 2IVZA 1COWD 2FMHA 2BKLA 1GM5A 1N6RA 3DO6A 3FPLA 3PJDA 4JYBA 4TT8A 2W6QA 4A0FA 2W7TA 1L5LA 2EQ5A 4GGMX 4IOLA 1KYZA 3EIHA 4FZRA 3TBFA 1P3JA 3DVRX 3NC0C 5DE3A 3IOCA 3WLJA 5A9RA 3FVVA 4RTOA 1PLJA 1Y1RA 3M5WA 5DHFA 4PX2A 1Z6GA 4MAMA 3L7KA 2PZGA 4DT1A 1AY0A 3LRPA 4RPGA 1N2IA 5FNVF 1ULBA 2HN9A 3KELA 4C6RA 2HSZA 4RTKA 3U4HA 2PN1A 5HYVA 3LC1O 2CD9A 5JWHA 3PB3A 1O8CA 1M34E 1NPDA 3H1FA 3DMGA 2X6TA 2ZYTX 3F7TA 1SC3A 3IQXA 4FBMA 2F17A 4FYVA 2DTEA 4X1IA 4Z53A 2FLWA 3OD1A 2ZRGA 1U1GA 5AUQA 2WA2A 4D81A 1NXTA 1QO7A 3M6LA 3PA6A 3VZPA 1G4UR 4EZBA 1IVNA 4ZHQF 4JGIA 3LM8A 2PUTA 3PC2A 3OZEA 4KXNA 4YCSA 3INRA 2WIBA 1UJNA 2HT6A 2PQMA 3G88A 2RAPA 4BUZA 3AF6A 1OXTA 3JYQA 1H6BA 4O5OA 1RWWA 3BC1A 3Q1LA 1NGSA 4MHOA 5H5JA 3ITNA 2VLBA 3DEHA 1UT5A 3IE1A 2X2EA 2H85A 2B4TO 3S2GA 3TTUA 2CYBA 3B1WA 2FZVA 2N75A 2OO5A 1MGOA 4H18A 4LX0A 1I1QB 3DTVA 2PDAA 5C5DA 1EWTA 1KJJA 1G64A 4OYYA 3NBKA 4HN9A 3L4EA 1A1VA 3A1CA 4Z1MD 1XDBA 3WV4A 1Q84A 1R88A 3K73O 4B0PA 3PFGA 2X0DA 5C8YF 2LIPA 4X3PA 4QU5A 2AZXA 4ZGBA 5AMXA 3BBPA 2W6ZA 1CVIA 2ZUTA 3DTTA 4H15A 1YE8A 5EZ6B 1PR3A 2VPTA 4LEIA 4LRQA 4X8HA 3EVCA 3QVGA 2O57A 2PH3A 3COSA 1H8HD 5FADA 2GBLA 1HSOA 4BLTA 2DQZA 1N8KA 3EWSA 3RNLA 4C4PA 4F8EA 2I2AA 4WN9B 3IHWA 4NATA 2Z3ZA 4Y3UA 5K8LA 2MINB 1GUYA 3SICE 2EHDA 2O14A 4EGCB 1B1AA 1HORA 3PEEA 5HQTA 1QH1A 3VOSA 3H5IA 2HHHB 1E96A 3VAYA 4DPKA 4DCGA 4EKGA 3OLWA 4IKOA 2BFOA 2PQ0A 1KTIA 1PW7A 1YDWA 1NXQA 1HDYA 3IBGA 3KQVA 4OXIA 5ESRA 1JDSA 1LQUA 1B8NA 3N2LA 3RRMA 3AEZA 4EB6A 2HJWA 3UV6A 2ZAIA 3MTAA 2VDKB 4QNMA 1MQ8B 4Y6LA 1XWIA 2WINI 3QPVA 4F46A 1RAAA 2JGIA 1P4SA 1YTLA 1G5IA 3JQFA 1ONNA 2PRYA 3NWPA 5T5QA 5JXIA 2GD0A 1E66A 4IXTA 2WFLA 3Q2KA 5DMHA 5AW7A 3W05A 2A84A 1ZRSA 3Q41A 4OQMA 1F51E 1QHIA 4RQTA 2WD7A 3KT8A 1F2DA 1ZG3A 1XTKA 4B4OA 3CV3A 1I6MA 2PWAA 4WUTA 3DEKA 5TJHA 1AKWA 4JP8A 2Q6TA 5CDFA 1Z5UA 3R3HA 4OSEA 3TGWA 1KK3A 4URYR 1NIPA 2WWHA 3KOXA 3GYBA 4J0CA 3DDZX 4LX8A 1B0PA 3LBHA 1IWPB 1SBNE 1T5TA 4HJRA 1OBHA 3A1UA 2R7KA 3KEFA 4MICA 3BBLA 1FRNA 1W6RA 3A1VA 5JYBA 3VR6D 2AG0A 4R2MA 4EPVA 4XJTA 1MRSA 5DI3A 4EVRA 5KX5A 5SZJA 2UZ3A 3B6KA 3RCBA 1XVIA 4AP5A 4BJ3A 2YHUA 2W42A 3CFYA 5EKTA 5AVQA 3T5AA 5HUJA 3T4EA 4IRMA 2H5EA 1K88A 4CKZA 1GY8A 2FSVA 4BMYA 1Z0ZA 3QITA 5BW8A 2VHXA 1K7SN 1PN3A 2A92A 2C5LA 2BUBA 3C16C 4WZAE 4XTCS 3RT7A 3RVQA 3T35A 1FPMA 1ZVQA 4U9UA 2E1RA 3VO9A 2LCIA 1DL5A 5JCOC 4G0WA 1NT4A 3SX4A 2ZAGA 2CMKA 4IL5A 2CYAA 1P5ZB 2PZLA 4RK4A 1O7JA 5F64A 4EATA 2JZCA 3H84A 3Q88A 5F2EA 4CKWB 3EPRA 1QK4A 4WCVA 3K8ZA 1XHLA 2DE0X 1U11A 1I8TA 4KXYA 2WUEA 3DR5A 4OQEA 4QHSA 3ABIA 4NEQA 4HNVA 5LQDA 2WYHA 4M22A 1AQLA 2F1KA 3WJ1A 1L7XA 2GPTA 4YUAA 1Y5IA 1A97A 1CSEE 1P1CA 2PWZA 1YQ9A 1ZK1A 2X1LA 3B82A 5FNVA 3A11A 2Z2KA 3I5UA 3K31A 2PUBA 1MOSA 1X0XA 1FDIA 1KF0A 1WU8A 2H2WA 1U2RA 1B0UA 2DYKA 5EJMA 1A77A 3EVFA 1M1NA 2HV8A 4KOEC 3W7BA 4MRPA 4NV3A 3WRYC 1J0CA 1W5AA 3IUYA 1L7EA 2BGIA 3M4XA 4X91A 1Q1EA 2B1IA 3X2EA 3KEMA 1S7GA 1YV9A 5KTNA 3P20A 3GOQA 4M8IA 2PSFA 4ZHQA 3J80A 2NADA 5DZSA 1B3RA 1TQDA 1WNFA 2IUEA 2N47A 2QD5A 2XODA 1SXJD 3K3PA 3TN7A 1A9TA 3ZWWA 4B7XA 4D9BA 4KGDA 2Y93A 1FP4B 2CHQA 3BXFA 2CY0A 4EJSB 1WOMA 1I2DA 1Q22A 2I71A 4I9NA 5IHXA 1WPGA 3FOCA 3WWCA 1NP6A 2COKA 4L0DA 2Q29A 5IDVA 2F3UA 4TUYA 1R0KA 1Y1PA 3TQCA 3KT0A 3NUZA 1MIOA 3DBHA 5KQRA 1VL5A 1ODKA 1AMOA 3KVNA 5DM2A 4MYSA 1B8UA 1Y48E 2Z95A 3HGQA 3KDPA 5FI5A 4MIKA 5AK6A 3UG6A 3ZWCA 2EW8A 2Q99A 2KJQA 3R23A 4G41A 4KYUA 3WO0A 2YH2A 3JYHA 5C8YA 2QTNA 4CT5A 4YJ2B 3NAMA 5BSFA 1UEJA 4ARUA 4AQYB 1I0LA 3E03A 3T4XA 3KL4A 2AT1A 1ZNZA 2FQ1A 1NI4B 2QJTA 3ZV7A 3CINA 3MSCA 1Z6AA 4ZXFA 3ZVKA 1C4KA 2IZ5A 1VBMA 4IHJF 4E2WA 4YV2A 3MTDA 4AJHA 1KI9A 2WBLC 3C5EA 2GM3A 2P9YA 5EIWA 1NMYA 3EIUA 2GA9A 1QIMA 4MVJG 3EEOA 1P4HA 3RG8A 5HG0A 3K70B 3H7IA 4Y2UA 4OBWA 3QIAA 2KBFA 3EIOA 4C0KA 4DLTA 3KJXA 1HYBA 2XKAA 4YUWA 2EW1A 5ES4B 1P61B 1MC4A 1JAYA 2XVZA 4B6OA 2Q3BA 2D1TA 4FOTA 3PE3A 3I32A 4HX9A 4KO2S 4WCDA 5MN5A 1E77A 1ZD2P 1AB5A 1ST3A 2AV6A 2G8NA 3OKFA 4Q03A 1PUIA 5CA0B 1OC2A 3MJVA 3PD7A 4MS1A 1XTBA 1RKBA 5TPWB 4WKBA 5UKDA 3C6KA 3W8RA 3CXUA 4UEQA 1PL7A 2QE7D 2REXB 3A6PC 2UUBB 3V7YA 3DE5X 3NBMA 3I3OA 1TAUA 1I1NA 2OLKA 1V71A 1EPUA 2YW2A 1F4VA 3D2LA 2AQKA 4KVFA 2LNDA 1DOZA 2VFAA 3AK4A 2MYPA 5IYZF 5C53B 5ITWA 2FDXA 4LRTB 4DABA 1H5QA 2JJQA 3TEFA 3DLHA 1DG9A 1LBSA 2EATA 2L17A 4Q3EA 1B14A 1HQDA 3GHHA 1M66A 2BEUA 3C0KA 3CI0I 5E1BA 1PKXA 4QTTB 3IEMA 3PUHA 1DKPA 2RGBA 4GLBA 5DLEA 4WXHA 3WK5A 4A5SA 3CTPA 4B3FX 3N2GA 3G89A 2G06A 4CLRB 2QMEA 1W8IA 4F3RA 4RM2A 4GM4A 2XA9A 3BE4A 1P3DA 2QT0A 1EGVB 1YRWA 1JVBA 2AYYA 3D6JA 2IHJA 3QMWA 3UUFA 4BVKA 3ICWA 4JQCA 5BN1A 2JIPA 4S1PA 3WIUA 4L5IA 2CLOB 1AX9A 2QSYA 4XVHA 2ID7A 4WNAB 3UKOA 3X3HA 1PR6A 3DCNA 2NPFA 1OH7A 2BFBA 4A26A 3I9LA 3BSFA 4M0MA 3PFKA 4HWRA 1Z2PX 3G2OA 4QPDA 1JQBA 2FRDA 1U1IA 2REBA 2V5AA 2ZQZA 2XUAA 2PD3A 1UFVA 1MDBA 3NHZA 1VCHA 4LF9B 2AJDA 2OBXA 2ZBFA 4Q7MB 3AUKA 4R1UA 1NPTO 2P2NA 4BMOB 1I7SB 5F1KA 5A4IS 3WGYA 3W7AA 5EMMA 4XW2A 4ZGWA 3H9UA 1UK6A 2Q8QA 4C4OA 2B5VA 4DT1B 1G8FA 1GPAA 2QDKA 2QB5A 1R0ZA 2JFHA 1C1DA 1YK1A 1S01A 4TTIA 3EODA 1MRNA 1RJ9B 3IUJA 1KOJA 1LVHA 3VX3A 1QNLA 4AY5A 5IF9A 5C8VA 6CHYA 2YJ6A 2EFHB 2OZVA 1M3SA 1WV0A 4CF6A 4JB0A 4X1IB 3S55A 5CX1A 1ND6A 2ZUCA 3MGAA 4PYKA 5KDLA 4I08A 1LPNA 1V1RB 3EMKA 4BGEA 4B2YA 2VQSA 3RC7A 4RV9A 2GVDC 3OZXA 1JEDA 1M2FA 1NJ2A 4GIBA 4NU5A 4G0VA 2WQ7A 3JX9A 2D6FA 3BEDA 5F98A 5L4LA 2C4MA 1J90A 1QF7A 2I33A 3ASVA 3CM0A 1WF3A 5L95A 3AC0A 3PT5A 3V55A 3DTVB 4ZQCB 1DAFA 5JISA 4DBLC 3HSYA 3KT6A 2Y0BA 4IXNA 1X70A 4C5CA 1D2GA 3T4PA 2C8LA 4MUHA 5ELLA 1LS6A 3D8HA 2FX2A 2QMHA 4DCUA 4GMDA 1C4OA 2GK4A 4YUZA 4A6XA 3GIWA 2WSSD 3QW4B 1YSCA 1SIOA 4P98A 1UZLA 1H9CA 3K8QA 1FIUA 4OHKA 4DR6B 3BTVA 4S2UA 1TGVA 1MJGA 2EFEB 1ODTC 3O84A 3QVGB 821PA 5HIAA 2G1PA 3F97A 3URKA 3H8VA 1MAWA 2YRXA 1U65A 4L5YA 2R6JA 1IUPA 1OBCA 1R5BA 3BIXA 3KNZA 3O3CA 3STHA 1AS2A 3DL0A 3STXA 4EH1A 2H7YA 3PEWA 1JQEA 4JNKA 1E7QA 4QASA 4OI1A 1O6GA 1US8A 1X2EA 1BWSA 1JQ5A 1QH1B 4OQNA 5AVVA 3UM9A 3ICVA 3P0JA 4UBOA 3EIWA 2B7LA 3O9MA 3KKQA 1V43A 1VPWA 1FZTA 3AKDA 2OYRA 5JG7A 1H2FA 2H4XA 2Q62A 2TECE 4IHJA 2Q6IA 5DYYA 4G0MA 4RXTA 1IN6A 2QLMA 4RZ3A 3WYGA 4G97A 4U0KA 2HNKA 4C30A 4KE7A 3KLMX 4RADA 4DDHA 2GKOA 3K2BA 2C2YA 2CHUA 1Z5VA 2XE7A 2CF6A 3IXLA 2GF2A 4J0DA 5DOVA 2Q5EA 1FJ2A 1R0SA 4JA2A 1KZ4A 2AG1A 1XEXA 2IUFA 2O2GA 2WD7B 3IV6A 1O4VA 3GCDA 4ZARA 3ANNA 5FA6A 3MT7A 4CCAA 5A5GA 1TOAA 4DGQA 3H0KA 3WGLA 5DN9A 4CQLA 4LTNA 4U0JA 1Z22A 1R6BX 3ASUA 3CZMA 2VDVE 3SFTA 1EG2A 4ETMA 3K6JA 3ET4A 3HBFA 5AVUA 3NDJA 4KWIA 3ZLBA 1RQLA 1B8PA 1EE1A 2FETA 2WMOB 5DW0A 2IHTA 1NU8A 3KEQA 1JKMA 4ZV9A 3EGOA 1ZLYA 4KMSA 4YGXB 4PIMA 4XYGA 2PL9A 4AZ3A 5K2OA 5IYZA 1WUTA 3CKLA 2IZ7A 5KX5B 4BP3A 4RQUA 4NJEA 5LQKA 2PUFA 1JA0A 3DOJA 1T3LA 2A14A 1ORTA 1ZCAA 3C6QA 5E4JA 5KOHA 4QGHA 1JKXA 1CW2B 2QRPA 2BH2A 2ETVA 5CH3A 1U7WA 1OX6A 1HR0B 3F6EX 3H19A 3JQ6A 1KOFA 1JSZA 5A9SB 1IG3A 4R2JA 4IDQA 2JAWA 1PDOA 1J9ZA 3QLVC 3FSRA 1SKAA 3WISA 3ZV4A 2ONJA 4D6YA 2XRZA 4JBHA 3SG0A 1F0YA 3QUBA 2DFNA 5AUNB 4MVJH 1QMGA 4B5KA 4DQKA 4YS6A 1RLIA 3AP3A 3ESCA 4XD7A 3RGGA 5LZ7A 2CVOA 4KRYA 3UOAB 4GGPA 5L40A 4OQZA 3HM9A 1Q3TA 5IKEA 4BNVA 1IZZA 1XXHA 1K8ZB 1G9SA 1H2YA 2CMGA 1WTCA 5I51A 4Q4CA 4QFBA 4WY2A 3R7AA 1JDVA 2VYFA 4WCFA 4UBJA 3SYRA 2FSUA 1P1JA 2WJPA 3FHCB 3A9UA 1WMDA 3CWQA 3GJ7A 2ZUDA 3SS9X 3WK4A 5A6VA 2F55A 1B1CA 1OUMA 4XVQA 2ODNA 4BAGA 4AZ0A 4EF6A 2G67A 3L04A 3C3YA 2O8NA 1UXHA 1OZAA 4EGSA 3HA2A 3QVXA 2CSXA 1QLJA 4URZR 5E1OA 3GP8A 1AB6A 3LT0A 4OOEA 3VHQA 4B7AA 3WGHA 2NPOA 3MPUA 1EP1B 1QV6A 3NX4A 5K3SA 4ZYLA 1M1NB 3GLGE 1QONA 2FSGA 3HLTA 5BQ5A 3MFQA 1WXWA 4HDCA 3L1HA 1ZC4A 2PGAA 1F0NA 3OBBA 1E9CA 1U81A 2B8WA 4ZHQB 1BC5A 4CQNA 2QYSA 4EX6A 4H7IA 4S1VA 3R6DA 4AQ7A 4K9KA 3BX1A 5AKLA 2RKWA 2YY7A 1HOTA 2CFOA 1I6LA 2G70A 1GPH1 1YHZA 2ZJ3A 3FFAA 5EHQA 2A57A 1X92A 3W5CA 2MIIA 3WHLA 4TUYB 5SZKB 1TECE 2F3RA 4FHGA 4NULA 4BRSA 3ODGA 1MIOB 3NDRA 5CCBA 5MFZA 2BCGY 2WKPA 4K6HA 16PKA 2HLHA 3ILVA 1HDEA 4BKQA 4PX3A 3IH5A 2ZM5A 2V7QA 4JXXA 4UVIA 4HXGA 4ALJA 2VWQA 4EYSA 1I4EB 5C8YB 4ZYZA 1DIBA 2V1XA 5B37A 5JAZA 4HS4A 1T2FA 3KR0A 3AI7A 4BQOA 4Q1EA 2OGWA 4RTPA 4PSDA 4NCAA 4JDPA 2UV8A 1XV5A 1VJ1A 3GDWA 1Z5WA 3DE4X 1J8MF 4LC9A 4FT2A 1FLVA 2JFWA 2WWFA 4KUGA 4BY9E 1GYRA 2ZPUA 1SCJA 4YCDA 2ID8A 4HZUA 2J6IA 2GN9A 3OZ7A 1FF9A 4A23A 4F3CA 1NRJB 5LVAA 1JW9B 2QUHA 1O3YA 2AYXA 2D5CA 4HQLA 1YCDA 3H65A 1KH3A 1TUBB 4LZPA 4LBYA 5FUBA 2Q9UA 1G42A 3FSGD 3UJBA 4RV5A 1VKHA 4Y30A 1UBRS 5EXEA 2SCUA 3NATA 5DIZA 4CEHA 1YJ8A 4V1CI 2DJIA 2IHNA 1G4AE 3C41J 3NDIA 1S8OA 3CB2A 3QELA 3VDMA 4BFZA 2GERA 2O3TA 4B35A 2FN8A 5CHYA 2XOXA 1XZMA 3RRXA 3ZGVA 4EITA 5LWQA 1PQPA 2HADA 4MS1B 2BM0A 5A1JA 3NYWA 5LMNB 1V3VA 2RBEA 4FONA 2FPWA 3I2HA 1JDBB 3HI4A 4HGPA 1KI1A 1UINA 3B7WA 2GCIA 2IYLD 2R4QA 5JROA 1GQOA 4FB4A 1S3SA 1S4QA 2C83A 4UCWA 3KUUA 5ALSA 4ZRDA 1JEEA 5KSPA 3P71T 3C70A 2PRSA 1Q2UA 5KO2A 5FUVA 1I0ZA 2VVTA 4BVHA 5CU7A 2BE7A 1FTSA 2BEUB 2VZ0A 2GSDA 4FDVA 3F5MA 4O59O 2LW7A 4RKWA 3R9XB 2PUJA 1E0KA 4PNHA 5D6NA 3N2GB 1FTYA 1QHFA 1PTJA 1K3UB 1A9OA 1ZNWA 2QR5A 2Y1WA 5BUSA 4KBGA 2TMDA 2ZULA 2IKSA 2OAP1 1CQZA 1NT2A 2O2HA 1GZSA 4Q3KA 1ISRA 4HTFA 5ALDA 4BKUA 1IVYA 1DV2A 1UK7A 2ZS7A 1RCTE 4IIFA 2H2HA 3I2FA 5DMXA 4BNZA 5BSGA 4R2LA 2BFDA 4HO1X 1UEXC 5JNRA 5IVKA 2BFBB 1ENZA 1JTVA 3CSDA 3W8DA 3GD5A 2J3KA 3A7DA 3E05A 3DH0A 1RP7A 2FPRA 2JCGA 3FKJA 3I01A 3NI2A 3B8HA 1QYDA 4D3XA 3TSWA 3ONVA 1OBFO 2VP3A 1THZA 4IIBA 4LY9A 3L6OO 2IHUA 2I4NA 2ZBUA 3UMRA 5LD2C 4ZEOA 3C7CB 4FI3F 4V38A 2ENUA 5HRUA 2ZDQA 5MFPA 1N2CE 4FUQA 3MYRA 3KZXA 1TPZA 1P72A 5HOQA 1TLFA 4YV1A 5CYGA 1GGJA 2HF8A 3BRWA 2B6NA 5LBTA 5BVHA 4X71A 1PLKA 2ZYRA 3KP1A 1B76A 1T9KA 4QPCA 3BWEA 5IEJA 3VC1A 1XAJA 3R6WA 2O20A 5IZCA 3TGLA 1OROA 2ZJOA 2GO1A 4TLEA 3W1EA 4DIOA 4EW1A 5CX1B 1L4FA 1GL9B 1BH2A 1D6NA 1LGYA 4M8LA 3RBXA 4XOUA 3TI9A 4DCJA 2XD9A 4B3CA 3AXSA 2AZMA 2EOAA 2XAAA 1BD3A 1QM5A 2YJZA 4TVKA 1RBMA 5FI3A 3T41A 1XAHA 3ZX5A 1AQJA 3QEBZ 2C7PA 2UYOA 3FRJA 5AKIA 2WDZA 2C1XA 3AT1A 1F06A 2P9QA 2ZATA 3CCCA 2HPAA 4TWJA 3KSZO 2W6JA 5EZYB 1MENA 3RUDA 1FUUA 1WHSA 2C92A 2XLCA 3NBZC 3SXPA 3ZK7A 4A6EA 2HI0A 1UP6A 1AM4D 3Q3JB 4KJXA 4DQLA 1JEQB 2VQ3A 1THTA 3ZZUA 5CB4F 2MT9A 1SWVA 2X3FA 1II8A 4IJMA 4QOGA 4GBJA 1D6SA 2WF5A 1HE5A 1JQ3A 4UEWA 4PLGA 4IJQA 4TROA 2JEOA 2H63A 3EB9A 4MW5A 3LG2A 1J9GA 5DM70 3EAQA 2NSYA 4QXQA 2NT3A 3UAOA 3BCHA 1JG2A 3DEFA 4MYUA 1NP7A 1Z2EA 3GCWA 5CAEA 1IQ0A 4RTRA 1MQAA 2PGXA 2M6RA 3TRJA 4F4FA 2VJDA 2XYVA 5A3VA 2X1MA 3HQ4O 1FMFA 1C4WA 3BGWA 4YREA 3BB3A 1MJHA 3KL2A 1QZXA 3TRHA 5KB3A 3TSYA 1UR5A 1XKLA 3FPFA 3V9AA 1QAOA 4L74A 1DMRA 1H94A 4UCQA 2I7VA 4P7GA 1PNTA 1Y9AA 1XK6A 5CGQB 3AM5A 5HTOA 4AI6A 1US8B 4HNSA 5J58A 1FRVA 3NDPA 4G1BA 4JODA 1PD1A 2P90A 3LXXA 1W59A 1V47A 1MQSA 2IUUA 3FLBA 3DA8A 3MS4A 4QUKA 5DHSA 3ZY6A 3QKWA 4CG1A 4UZFA 4IHJB 2FSFA 1XCLA 4CV0A 1G9TA 3U13A 4FKMA 1M0EA 2VF8A 4GMHA 5HZKA 1VJDA 2YNMA 5HP4A 4IXJA 3A3KA 2JGAA 1L7MA 2Q50A 3DEIA 1ISSA 3H17A 5FYQA 5NLLA 5TPZD 4J16A 4DR7B 2VBIA 3ZTYA 1IJKA 2X40A 3MB5A 2GLTA 2YZKA 1SQ6A 2CMDA 5C5IA 5EFZA 1YVUA 1XEXB 3AFHA 1YZHA 3SZRA 3K9QO 3COZA 2XADA 1XD2A 3AJ9A 4P4SA 3TWOA 3IDOA 1E1KA 1P60A 4Q3DA 3EDRA 4KB5A 1NVEA 4CQLB 1LK7A 5GWXA 4YMHA 1XQ6A 3LHDA 2JFOA 2YS6A 1RC8A 1KDOA 4N5MA 3L1JA 4OHVA 1RP1A 4RQAA 1LBHA 4YT8A 2IDZA 1SVWA 4KE8A 3FOAA 3HJBA 1EWQA 2JFPA 3WYAA 2V6BA 5EZQA 3UATA 1NQXA 1GSIA 4AZ3B 4DUPA 1U0BB 1ZI9A 3OM0A 4TPKA 1V7ZA 3WC4A 4LWQA 2B9EA 4NU6A 2PVCA 1E79D 4NJEB 4KFTA 4Q3AA 4JJZA 5T6MA 4W1PA 3TPFA 1Y8ZA 4G8BA 1ONOA 3PHLA 4AJIA 3ETNA 3T5TA 4LDPA 3S2EA 1LPBB 2VAVA 2IY9A 1NW5A 2B2NA 2GH1A 2ISSD 3NWEA 4NARA 2RK6A 5DGTA 5ENDA 5BWLA 1FFAA 1JSLA 1W9MA 1BN7A 2JKVA 3EARA 2GRUA 3KQOA 1UBSB 5DLPA 2YUTA 1MAHA 2DKNA 4LZLA 1NFRA 5ER6A 4JMLA 5LQSA 2YVQA 1ZBDA 2QGZA 3GW8A 1G55A 1I9CA 1GWNA 2YIMA 1EFLA 3BA6A 2E1PA 1E3EA 5CLIA 2UVPB 3ZD9A 1XXHB 2OO3A 2G9NA 5D1HA 1G3RA 4DCVA 5CDTA 1Y4AE 4AFNA 1EXVA 3IAHA 1SBIA 3JQRA 2OY0A 1DBPA 2Z5VA 1CDOA 2DT5A 2Z6AA 4B82A 4EG8A 3IBCA 3K0CA 4RXMA 4JLVA 3I53A 2BOVA 1NM5A 4BXOA 1SQ5A 2JIRA 3GBSA 1RT9A 1XZLA 1KFBB 3ASZA 2OBBA 1BJTA 4AZ0B 4AYTA 4DA8A 3LBIA 1QGZA 3G8CA 3JQGA 4O1MA 5EXTA 1Q95A 1O08A 4FYXA 4AROA 4BGIA 2NV2B 3IQHX 1VJGA 1JMKC 4UHHA 1AK1A 4B17A 3BL8A 2QSZA 2HF2A 3QJ5A 1CZNA 3R9WA 3HDHA 2I62A 4LXTA 3TG8A 3VPFA 3T3OA 1EFKA 3AR8A 3TQSA 1RXSA 4AUMA 4X63A 3SOPA 3SS7X 1MIHA 3NEAA 2QSJA 1EP9A 3LZ6A 2DM6A 4P4GA 3ZX4A 1K5HA 4QDOA 3DB2A 2PS3A 2ZT7A 4B3MB 3F9CA 3UUEA 3AVWA 5LQJA 4RE5A 3MM4A 5JO9A 3WI7A 4LSGA 2IQIA 5SYAA 3HFSA 3BFJA 5DM4A 4DADA 1R9MA 5BN5A 3O4RA 2ZCJA 1BNCA 4HNUA 3TDNA 3UICA 5CB4A 3R8FA 5JJKA 1WSBA 2IQ5A 1Y7TA 3LT2A 3ZW7A 2RKBA 1ECBA 2AEEA 2G40A 2FLVA 3H6KA 1AXEA 4KO4S 1E61A 5HQ3A 1Z73A 3JQAD 2NO0A 3RS4A 1E2KA 2ZJ8A 4WERA 5AUOB 4MGYR 2FLKA 1L5FA 5C9ZA 2HDWA 2JLUA 2G80A 3L0DA 4FGJA 4RWEA 1Q0HA 5IXSA 5KAMA 4H7JA 3IQWA 2VIIA 5I7RA 3R5XA 5U1PA 3AOEC 4IV8A 4XR4A 1OY1A 5DK4A 2CXOA 2HU5A 1NOKA 4C7BA 1VI2A 3BD9A 3I42A 3RV3A 2J5QA 1XPUA 4HZUB 4LJ5A 3CISA 3B6JA 2PUEA 1D3AA 4G9EA 3BGOS 4A3SA 3WA7A 4K5QA 3KWJA 4POAA 5JRDS 4ZTZB 1JAHA 1R4ZA 3MJFA 3S40A 2JGRA 1G6Q1 1GSHA 4PG5A 2BMJA 3B3JA 2SCUB 4CEHB 4UPVA 5A5FA 3AP2A 2JJMA 2PLRA 4QLBA 2WMYA 3M1LA 4R1SA 3RJ5A 3TUJC 1NRWA 3EH2A 1GVNB 4IIGA 2PZJA 1PEAA 1QFXA 2WT4A 4MITA 4N5IX 5DTEA 1Y1LA 4BFLA 4R8SA 4AMBA 1Z88A 4CT0A 1USUA 2XMBA 3NHBA 4PSCA 5K6TA 4DYHA 3GDFA 4ZCLA 4YY3B 4KREA 4MLDA 3BWCA 4I55F 1NUAA 1GPWB 5LUBA 5JWOA 4Q1DA 4RYDA 4JI6B 4IBOA 3JD3A 1C1XA 1U0GA 2DUJA 1Z17A 3AW9A 3KLPX 4V0NA 2CUZA 1GPLA 4PS0A 2QL9A 5FR1A 3VBEA 8AT1A 3P9QA 4RACA 4ZQHA 4J0FA 3OJXA 5J9FA 5DV9A 1QBKC 3GXOA 1TADA 3N75A 2XTNA 2VKTA 3RSCA 4DC1A 5HF5A 2Y9MB 3AR6A 4MVJP 2DPMA 2NQ8A 1PEYA 1NRXA 2EFGA 3Q8WA 4P92A 2OVFA 1QUFA 3OE1A 3JAKA 3LKDA 1KJZA 4W4TA 1O2DA 1QR6A 2CHFA 4MRMA 2N1MA 3I12A 3QFHA 4MYDA 3GAZA 3QFSA 4L57A 1V7CA 1XE3A 3D7KA 4HTFB 1ACJA 4UVEA 3E1GA 4M46A 5JASA 1VC2A 1NVUQ 4PLFA 1VMAA 1FUEA 4JUCA 4S1TA 2I03A 1KVUA 1U6JA 2F4NA 3OPMA 4B8WA 4I5DA 4D97A 3HRKA 5IM4F 4KLZA 2FF7A 1H3EA 3HS3A 2QKYA 3V8MA 3VKVA 1YULA 4D56A 2YZNA 10MHA 1BN6A 3P2EA 4AD8A 2WVHA 2B92A 2V9PA 4B79A 1NF2A 4HNQA 4FN4A 1TD9A 3HXQA 5KJCA 1R5JA 1GRQA 3EZYA 3TX2A 3WGIA 4BNMA 1EZ4A 1MV5A 2R3SA 3MQFA 4BTEA 3D6MA 5T3YA 2EBUA 3GEPA 3KHKA 5EWMB 3ZDXB 5ALIA 3LA6A 3LP6A 1YQEA 1V9CA 5HIIA 1IEQA 3FMOB 1YZNA 2CMFA 2QN3A 3CZCA 3NB0A 4L3VA 2FPLA 2Q5CA 4AXXA 1N5LA 4G25A 4ZV7A 2C61A 1A8HA 1DZ3A 1E7WA 1R8QA 1VZ3A 3ETLA 4LYFA 4CJXA 3SWWA 3GPIA 1XTSA 3LLMA 3F7OA 4GKAA 2X42A 4PZYA 4ETWA 4YASA 2ZB2A 2V4ZA 1USVA 3C39A 3CVJA 4QRDA 2VF2A 3C97A 4RMJA 2A5LA 2Z3VA 4CR7A 4F38A 5EJ6A 5HM6A 2Z8ZA 3RYCA 1F3LA 4OL0A 1PFGA 1EX9A 1N8NA 1P0FA 3MOIA 3SEAA 1BX1A 1CUEA 3UOWA 5EIBD 3E2PA 3IDAA 1QZZA 3K5IA 4I99A 1NXSA 3TNLA 3BCUA 1ZYUA 1ZMRA 3BAZA 1XA4A 1D8TA 1QCZA 2XQVA 2W22A 3EZNA 3B48A 3OJLA 2V7WA 1YRHA 5HE9A 1PQYA 4ZT5A 5I7UA 3AUUA 2NX2A 1WHSB 4R98A 3PXDA 1Z74A 5G1OA 2FVXA 4UXIA 3F6RA 1RYBA 4Q1FA 3B36A 4KQ1A 5BP7A 2CNWD 3WMXA 1JIUA 3RJMA 1II8B 3K72B 1U90A 4CEIB 4GYJA 2QTAA 4QFDA 4WDQA 5HCIA 4K86A 4WA7A 4INJA 4L0QA 3U3JA 1J0AA 2GF9A 3OLXA 1FLAA 3PHIA 4KR3A 3A4NA 2H8GA 3I52A 4GOJA 1T8YA 3O3OB 4P3KA 3BICA 5EE1A 3TL6A 2XQFA 4XQ0A 5CAEB 1U8ZA 3BWVA 1EEHA 2P6NA 4KRXA 3L93A 2YC2C 4M76B 1Z35A 1F4LA 2J4FA 4KJZA 1L4MA 4IX1A 2YX1A 3QE0A 3T9DA 4DWVA 1A27A 1RXCA 4DYDA 3E9CA 1JSCA 4DHWA 4R1OA 1VHTA 2AMYA 2OCXA 4Y18A 3N1UA 3PC4A 1L5QA 2Q6OA 2VT2A 3MJDA 2IYNA 1NA5A 4HNHA 3SU8A 3U39A 3D4PA 3FJ1A 4Y2RA 5WRFA 1DS6A 5JLAA 3ZPXA 3KQKA 3KKOA 2QQ0A 2Y1FA 2OM6A 2REQA 3ZCRA 4K26A 5KCZA 4RZSA 4G0XA 4H77A 2PRKA 4ZI5A 2Z5GA 4U00A 3ZD7A 3AFGA 5DW3A 1WABA 1N75A 1F9EA 5DKFA 1KWGA 1MG0A 1XAIA 1CVLA 2FXIA 3JZDA 5HS4A 5E4TA 4X8LA 1ILEA 2GW4A 5D7BA 4J9UE 1KK2A 1IEXA 2P0AA 1P5RA 1LD3A 2OD7A 2GETA 4BAZA 4YMVA 1DBRA 3HV0A 4XSVA 2XCSB 1XD2B 4RL6A 3LOUA 2QMUA 3H9GA 4EY5A 3NRBA 3SZLA 4TV9A 1OFUA 4JDUA 4OKIA 2C4NA 5JFTA 2OZEA 1K68A 3JS5A 4QKQA 4LS3A 1Y5RA 1XN4A 3G9TA 3I37X 2C4KA 3N8KA 2NVUA 4I55A 3S7TA 4YRAA 1BMFD 3ICEA 1U2TA 2B30A 2O2ZA 1XN1A 3FNQA 2OBFA 3MAGA 3Q3CA 3DO5A 3WOVA 2MTBA 5NULA 2NVOA 3LUGA 1FNNA 1ZRMA 2XWSA 4G4SO 3TX6A 3I1IA 2CKMA 4NMXB 3VR4D 4HDAA 4JLSA 5CJPA 3LHKA 2XH8A 1JIQA 1W47A 2JGLA 3NBXX 5FA8A 5FCDA 4KFSA 3UYKA 2VP9A 3UJ3X 2VPXA 2BF4A 2CE2X 3CSSA 4LJRA 4KH1A 1N2ZA 1VSQA 1X74A 1QYVA 5ILOA 2CLFB 3OA2A 4DLKA 2H1SA 1OYOA 1RJFA 2J0VA 3A7EA 3CC8A 3D2BA 3TL3A 2C2ZA 1ZRNA 2H65A 2XNCA 2ZYVX 5JHHB 2H0RA 3K30A 3IIKA 1T35A 2IXEA 2QN6A 4MW9A 3V8VA 2XWBF 1OPRA 2X41A 4AUKA 2Z2JA 3RF6A 4Q4HA 2FN3A 3P2MA 4MW2A 4R4JA 3CIOA 3NEYA 1QWSA 1ZXBA 4A82A 4G07A 4MP3A 5A04A 1Z2AA 3PENA 3S27A 5AR1A 1Z37A 2WPDA 3OTQA 5K8IA 4C5AA 2D4AA 2WTNA 3ZNNA 4JP5A 4N0EA 4XEHA 5K3CA 3I4CA 3DFMA 3IMKA 2IPOA 3AM3A 3SOZA 3T0GA 1U63A 2BMAA 5G40A 5C32A 1HV8A 2JFZA 2ZEJA 3CYFA 1M33A 2K7FA 3HDYA 3K0AA 4ZMRA 4IDGA 4IIEA 1AHIA 4I4CA 4YDQA 5KINB 5L4NA 4JJKA 1K7EB 4QXAA 1WLYA 4QTYA 2P3LA 3LFUA 3FVRA 3ENNA 5TSDA 2I1VB 2W83A 2XUOA 5THXA 3GAFA 4RZIA 1ISMA 1FVXA 1P0IA 2R2GA 2V3VA 2ZXFA 3A4TA 3SXJA 1DNPA 1NONA 2BV3A 2IK8A 1ZI6A 3OKPA 4MGIR 1N1MA 4V39A 1JHQA 2XHZA 1N1GA 4D4KA 3TBHA 4EMTA 3PVSA 2HMVA 4QATA 3G5AA 3PXCX 1L8QA 1CX9B 1CUGA 4HQFA 4RK5A 4CKYA 1E6CA 5LQNA 2FTKE 3B20A 4N9WA 1T9BA 4CPDA 4QLAA 4JLDA 2D3TA 1XELA 4TSRA 2HDOA 3RFXA 2IYVA 3FDFA 3VHXA 1E2PA 1OU4A 4ILEA 1MTZA 1L6IA 3GCGA 1CRZA 2XUHA 5BRAA 4Y6GB 5JS8A 3WGNA 3ZU6A 4CYMA 5BN5B 1LSJA 1SMKA 2W2VA 3M5CA 4G1UC 5DNVA 5L7WA 3N2NA 5B6IA 3ZJTA 4JC8A 1Q1NA 4XM0A 2IYRA 5JFGA 1NBHA 3QX9A 4NYMR 1U1FA 1J4AA 1A96A 2BR4A 3B9RA 4ALMA 2X7HA 5HQ3B 5GAJA 1N8TA 2X6RA 3L18A 1WW3A 2L82A 4HAOA 1AGYA 4CMBA 4LY0A 3GJ0A 3OAAA 4MV0A 4WY8A 3TXXA 1WXHA 4HQRA 1S2GA 4XQCA 4L50A 3SC2B 1QG6A 2GNOA 3AY7A 5GM2A 1HEYA 2BBTA 4BNIA 4PU0A 1J2RA 1T91A 4FGLA 3GLUA 2P0EA 4P0PB 4RLQA 2X7JA 2DWPA 3F6YA 2XCTB 3JD1A 3MINA 4B7CA 2QZJA 5BW6B 3A6JA 4HXYA 2YVUA 2IDKA 3IMCA 2AMFA 2IXDA 13PKA 1DIRA 5DGCA 3MHTA 4LJ9A 3OEYA 5ABPA 1I3LA 3BDIA 4J0GA 4X9XA 1KJIA 1MH1A 1IAQA 2RH9B 3HUDA 1S5PA 4JH0A 3WGGA 2C5BA 4F2DA 2VBFA 1MV8A 4N3CA 4XWTA 1AQUA 3SHTA 1JIJA 2CB9A 4LXIA 1CQIB 2FR8C 4U7TB 3CS3A 5ER9A 4FM9A 1VE9A 3HDQA 3RVPA 1M6WA 3RV4A 2JHCA 1E2MA 2ZRLA 3CW9A 5BN3A 1JLSA 4MLPA 4EJ6A 1IXZA 3JQBC 2YFHA 3ZWMA 3I2KA 4HWSA 2JLVA 3PS9A 2XUFA 2ZI4A 3RG2A 3LVRE 1PV4A 2RH8A 3TZQA 1UXJA 3PUVA 1VIAA 1B6RA 1KEVA 1RAEA 2EBFX 2FPIA 2HQOA 5EWJA 3NU1A 1WPRA 3AV3A 1UIRA 3MA0A 4KPFC 1BX0A 2A67A 1W35A 2EEZA 2R751 3AY3A 1WBDA 2WY2D 1IXSB 3DC7A 3STVA 3G9UA 4BMNA 2P67A 4R5HA 1CVRA 3LIIA 4H1WA 5L3SB 4BNYA 3B7GA 3C3BA 4LV6A 5KNCH 1ZMTA 1YBAA 3E23A 1Z08A 4YAJA 3VZDA 4MRMB 3Q9UA 1OB2A 3CLSC 2B4AA 3GDOA 4REMA 2J9FB 3P1JA 4KQGA 1K6EA 5CH5A 1ZSYA 4C7KA 3R6LA 4LZZA 1AC5A 1SUWA 1XXLA 3VR2D 1AE1A 1YL5A 3L0CA 5IH3A 4BATA 4WNCA 2VTEA 2JAQA 3H86A 4G5OA 4D8VA 2ZIEA 2RG7A 2YN2A 1J8FA 5BO5A 3K5WA 4B81A 1MT3A 3TW8A 5A5EA 1DX6A 1PJQA 3QEJA 3GG9A 2CUNA 3E1KA 1TZJA 5K0SA 2H17A 1UMDA 2XB4A 3LRTA 1M83A 4MSUA 2FEOA 1SCDA 1DPGA 1SK8A 4HK4A 3QBJA 2CUKA 1NQOA 4UULA 4CDNA 4UBKA 2XUKA 3GLHA 3UXEA 5AW4A 4JT2A 3JQQA 3UGKA 1Y4SA 2DFTA 4O3FA 1V4NA 4DZZA 1YB2A 3DM5A 3OFVA 3O95A 2KI5A 3TLGA 3WLEA 2PBFA 3H1TA 4QQKA 3PDJA 5C1DA 1K97A 3T8YA 4OGLA 4HB4A 1GCUA 1LFAA 2WU4A 1C1YA 1WCV1 3L7JA 3N7TA 2HUNA 3D5QA 1GZ5A 1C80A 1IONA 2AN5A 1CR6A 2WJJA 3HEAA 4C14A 5JNLA 1K1EA 1N2SA 3FVQA 2H2IA 2YJ5A 2HU8A 2HHAA 3MG9A 4O4IF 3EPLA 3T4UA 2GZMA 5CEFA 1IK6A 5K3OA 3AHFA 4C0LA 2W2KA 1MTOA 4Y6PA 2BGUA 3JPYA 3LF4A 4RFVA 3T7JA 2QW8A 5IJ9A 3WMGA 4A8TA 1U04A 3LI2A 1XTIA 5LOVA 3W2GA 4PC6A 3VO2A 5LUAA 2FJ0A 3K4HA 2VJOA 2AXQA 1UWKA 2QIOA 3KU4A 3ONNA 2ATVA 2IV2X 3F6PA 5FRDA 3UJCA 1K6MA 3Q7SA 1GN9A 3O3MB 3V80A 1YGPA 3W06A 5AXAA 1W73A 3S4YA 4LE2A 1BMQA 3QFFA 1K8QA 1B41A 4BFSA 3HR8A 3GEDA 2AFIE 5IZ4A 5B53A 4TWAA 1LLCA 3A2KA 2FHSA 1AKUA 3JD2A 1B8OA 1UKYA 2DCMA 4AAYA 4CT4B 1Q7RA 4FDTA 1LK0A 1UBTS 1Y6ZA 3HVJA 1UDAA 5KAPA 3DPUA 7MDHA 4B34A 2PMDA 3BZUA 5CA1F 2ZWVA 4J43A 2GEJA 3LF1A 1PWHA 1FX1A 2Q5QA 4JJ6A 1ZWLA 3ENZA 3KIPA 1TO2E 2RH5A 2BMDA 4A0GA 3E53A 3JTMA 3LX8A 2C97A 3ZDAA 1KVSA 4K40A 2L18A 4KXVA 1G20A 3GRAA 5JTTA 3WZ2A 1ZEJA 1VP3A 4HQNA 1HT0A 1QIIA 1CWUA 4GL4A 3KFLA 3UJ8A 3WBFA 5BQFA 9GPBA 2DCUA 1ZIYA 3HBAA 5A4JA 3JAMA 2AN4A 3L06A 1F60A 4D9EA 2QHXA 3HM2A 3AYXB 3LCUA 1YJQA 1ORDA 3KFVA 4TLBA 1IM5A 2VYVD 2VP2A 2FOXA 3NQ41 3R5HA 1E7RA 2B5OA 3DWEX 4U9IS 4B4VA 5IKPA 1BVYF 2JANA 1VSUA 2OCYC 3NAQA 3PPXA 3PUXA 4OXXA 4NAUA 5EG5A 5HCUA 3RQIA 1T3TA 3BMCA 3R0XA 3ZS9A 1J07A 1UDCA 4B2IA 2DTDA 3STTA 1G5HA 1DQRA 2H1FA 3HY3A 4RY9A 4AZSA 4CM7A 4MULA 3JTEA 2GJSA 4LHYA 4O1IA 3AVPA 2XKJE 3FI9A 5D5QA 4RD3A 3OETA 1G6OA 2OORA 1UXGA 5CNIA 4W9MC 1HFWA 1OFVA 3M33A 4U6QA 2QN7A 1XRLA 4CM4A 1SOAA 4PM4A 1DC4A 3FYUA 1Z36A 2J07A 5DP1A 4Y0NA 1WMFA 3CNNA 1D2AA 3NIFB 4TV9B 1XEFA 1I7DA 1G7SA 1A88A 3OHMA 2HEIA 1VRCA 1T43A 1G291 3R8XA 2UUAB 2JVJA 1AG9A 1JG3A 2YFKA 2NVUB 5AJWA 3SJ7A 3IAM6 4PBRA 4V24A 4QSMA 1IFXA 1JJIA 1ZIXA 3RVJA 3MUNA 5KPDA 2H1RA 1QDEA 5ALEA 4YUYA 1E1QD 3HSSA 3ROGA 2XWPA 1RHUA 3U4GA 5ALFA 5IJAA 1K3TA 2C00A 1KFJB 2HQRA 4N6GA 4NLLA 2AR9A 2ZETA 2RGNC 3WB0A 5B4UA 4JUFA 4MV8A 3NFRA 3P0FA 4TRNA 1M9NA 3C3CA 3ENQA 4KNVA 1GU1A 3ZDFA 1U7UA 2PH1A 1H0RA 1U2EA 3F8TA 1C9MA 5FO1A 3B13B 4DAOA 5CDFE 4RFLA 1UKEA 1FSGA 3KXDA 2X8JB 3KYBA 4V0RA 1SEPA 4HUQB 4C7OB 3EGXA 4Q4HB 2QRUA 2OCAA 3LRXA 1W0KD 5BSUA 2OHJA 3IJPA 3OTIA 4Q9IA 4PAMA 3VZSA 4I46A 4S0ZA 4F45A 3KLOA 1CUYA 3DS8A 2NO4A 3QUAA 4M1YA 4DC9A 1ADCA 3ORRA 3A1WA 2PSEA 4DJTA 3DPIA 3KPYA 1Y5LA 4GI2A 5E7IA 4DEXA 1FNBA 5ICSA 4QUEA 2P7IA 4AN4A 4X41A 5LQMA 1IQPA 1Y3AA 4FWTA 1V45E 1ZX1A 2GZSA 3K0AB 3QP9A 4RW0A 4ZGGA 4KXMA 4KQMA 4QUJA 4B6SA 5IEBA 1D1QA 4JBIA 4DMHA 5ERGB 4DANA 4Q48A 4KYVA 1A7KA 1MJ5A 3K09C 2IIPA 1FQKA 4GKVA 3MWGA 4R05A 2CUTA 5KZMB 4FCCA 5GGXA 3REGA 4UVDA 3UKJA 2F59A 1K4MA 4K1LA 1OSNA 4EKDA 1KP2A 4M38A 5D6OA 2KLBA 3OP1A 5LNK6 5P21A 2IS1A 2DPLA 5EVCA 4BNDB 1A5BB 3MELA 5A7GA 4EI9A 3E9DA 1BDHA 3OEED 3PR2B 4GBMA 4X20A 2UUCB 2QEQA 1BE1A 3AI3A 2SKEA 4Q3NA 4DC0A 4RHXA 3RDPA 3K8YA 1KP9A 1Z56C 1C3OA 2I80A 4D9FA 5KS2A 2Y0EA 1NKSA 2VRCD 2ZJ0A 4O08A 1KNXA 5LXTF 3VHXB 1QO9A 4IQ8A 4R9SA 3USES 4AO6A 4MVYA 2CJFA 2VYQA 1F2TA 1TA4A 1WZEA 1OJLA 1TEVA 3U60B 3HZOA 2FZCA 1G8HA 2OESA 5EMHA 3OOYA 1SBTA 1N4AA 4OI0A 1OI4A 4CBVA 1KTVA 4FVTA 721PA 1BU8A 4RVCA 1KO1A 2M1ZA 4M7RA 4P36A 2GUWA 1LDEA 3RARA 3W5JA 4B4UA 1QOZA 1U0NA 5K6AA 4KXXA 1L5KA 1DDOA 4JHXA 2IPXA 1LW6E 3E3MA 3FGNA 3PWZA 4D9HA 5JQWA 3QV1A 1FFDA 1L5WA 1XR3A 2NVWA 2DR3A 2ZPTX 4Y9TA 3P9NA 4ZAXA 3TB4A 3LC2O 3DKKA 1UPXA 4L9AA 5CLGA 3D3KA 3NP7A 2X23A 3D6AA 1BS1A 2AEJA 4MQ4A 1UXOA 5DXJA 3G9QA 4NJMA 1X7ZA 1WEHA 4RIGA 5BSVA 3L77A 2R8BA 5JDCA 4Z4HA 4OAQA 3S1SA 1ZUWA 4DNQA 3ND6A 2DZDA 3KZCA 3U1BA 2C2XA 1ZGZA 1RJDA 3MINB 1K7YA 2C58A 1U5BA 4WIAA 4WHMA 3KSRA 2ZB8A 2YN0A 4BZQA 3VGPA 2OP1A 4X7RA 3G0BA 4G0ZA 4DR4B 1OX4A 4B6PA 3WSVA 1O6ZA 3CIFA 3UKDA 2B61A 1LU9A 2QM0A 4QOIA 4JLPA 3MRXA 1AGXA 2BPOA 2CJYA 3GGSA 5C7YA 1CIPA 5ITSA 1XIVA 2F8TA 2EKQA 4NIMA 3QKSA 3AB3A 2GM5A 4O33A 3VTAA 1Y6GA 3WNVA 4OGKA 1QX4A 1JU4A 4NBSA 3PD1A 3UAXA 1X7DA 3TTVA 3BTSA 2C7QA 4YRNA 3Q10A 1E1NA 2ZI9A 1JECA 1RYEA 7MHTA 5CFPA 4YX9A 2W11A 2GM4A 1PHPA 2X1VA 3C1TA 4PBSA 4JI4B 3RB8A 4EDHA 3KJZA 1I1OA 3L5KA 4L07A 4BMPB 5AQEA 5EWJB 3T3HA 4MUFA 5H02A 1CU1A 5I5GA 4BBZA 2D62A 1YIAA 1ESZA 4QECA 1F5SA 4WGFA 3V9PA 4EMBA 1RQXA 2WJWA 1PR2A 2ODPA 3EZLA 2VK8A 5FTKA 1D2HA 1XLTC 3QPAA 4BNNA 4H08A 1CJTC 3IPXA 2LDBA 1N9KA 1WMBA 4JLNA 5ED4A 4ZXPA 1E9DA 1KSHA 1NVWQ 3LO5A 3A06A 2Z58A 4DBVO 2F1RA 3ZXUB 4DA0A 3STUA 5JJCA 4ZP1A 4D98A 1EFVA 2UKDA 1Q6ZA 2RSLA 2WU8A 3M6VA 4JJIA 5CM2Z 1EE9A 2J3HA 1D09A 4RK1A 4CKXA 2QP9X 1M67A 3I64A 1L8LA 2R00A 3BERA 4O4HA 3TW8B 1PSWA 4E5YA 3DOIA 4DUYB 5EOVA 5FKJA 4M0DA 5D86A 2G16A 4ZN6A 1PKEA 1W36B 1YIDA 2Q21A 2PGDA 2DRIA 5FAXA 1UMDB 2AHOA 2DT8A 1MVOA 1IY0A 3BDAA 5DXFA 3LVQE 3EOAI 3W9UA 3RSGA 3S7ZA 3GEGA 4FMCF 4B32A 4BB9A 3GLHB 1JDJA 3DE0X 2HA2A 3DLIA 2BDUA 4GPD1 2NO9A 3LQ4A 4KYIB 4OATA 3UMBA 1NJ1A 4BS9A 3IDFA 4ZAWA 4D96A 1VE3A 3WWPA 5IW8A 4RF3A 3TLGB 2IZ0A 4O2LA 3RFCA 1QP4A 4N0MA 1CY0A 3IB3A 3FTEA 1R8XA 2EDAA 3TR5A 2HJ9A 5JBIA 3LQQA 5DWQA 3S3TA 2PBZA 1K75A 2A0UA 4MGHA 2V0GA 1JKFA 1PG5A 3MAJA 3U37A 1AKNA 2W2KB 2XCOA 2O3JA 4YAKA 1XD9A 4YMLA 2VXOA 1E2FA 1M2EA 3P7MA 4FFRA 4PO3X 3RRZA 5HKBA 5IJ9B 3RRJA 1U9YA 1XTTA 3X2FA 1ZW6A 5EJ9A 4XWGA 5LOVB 3DZGA 2LDXA 3EBOA 1PR4A 4GEKA 1PZXA 3DMNA 1FCJA 1SNYA 1SOMA 2O1SA 1TJ5A 2YXEA 3R41A 3WGJA 2A78A 1N92A 1Y7IA 2OXTA 5J1SB 4H9GA 1G5PA 1IMJA 4CV2A 4MR8A 1QKKA 3Q98A 3QY9A 3TSCA 3EDQA 1TCCA 4WBXC 3FPGA 3THXA 1PBTA 5BSEA 3PE6A 3I6YA 2PO5A 2NZUG 1X9IA 2DKOA 3UAVA 4CCWA 5JATA 2CFIA 2OQ2A 2OV8A 2W6PA 1N5DA 4QT4A 2LP4Y 4JFRA 1KKLA 4FX5A 1DEKA 3Q7PA 1W96A 2HA4A 4U1RA 4US0R 3AILA 4P80A 5AHOA 1T10A 3E58A 1SHLA 1IHDA 3I2JA 4R68A 4C0XA 3QPUA 4QQNA 1EQUA 3KOZA 4RHTA 3NYQA 4OQXA 1ZGAA 3IAS6 4FE3A 1TZ2A 4JKIA 4A6PA 5FUXA 1J8QA 2BT4A 3M0EA 3OC6A 3L0SA 3IBSA 4YEDA 4RY0A 1XZQA 3ENVA 2COUA 4FHFA 1MJGM 3I04A 1YDMA 3CKMA 4MV3A 3DGEC 3F78A 3H4VA 1DBSA 4OXKA 2WQ6A 5ECYA 2QW1A 4QTUB 4O4LB 2V6GA 2XGOA 1JT9A 1UF9A 4GGOA 4A9AA 4NZYA 2C5SA 3RU2A 1OB5A 1KMCA 1OAOC 2RJNA 1Y80A 2R6DA 1QSGA 5JO0A 3EYWA 3BMCB 1S2LA 2Q6VA 3TR0A 1HTBA 4DCOA 4EFNA 1U2DC 4IINA 1XPOA 2W48A 1TO1E 2YYYA 5HZHA 3HN2A 1S8FA 1M7GA 3PIDA 4K03A 1RJEA 1YI1A 4PGGA 3N87A 3U7FB 1GLVA 4CM4B 1GDTA 1OA1A 1PFWA 4Z9AA 3DBLA 3RUAA 3MT0A 2P2YA 5GONF 5BWCA 1KH2A 5KYKA 2QN2A 3PPVA 1OI7A 2P4UA 1JKIA 4L16A 4JI7B 3GJQA 1U1CA 1V5WA 3T1HB 4GAEA 1DCMA 1NPYA 1FDWA 1Q6YA 2LE0A 2PYZA 5J47A 1TZBA 2JFGA 3VYVA 2V1UA 2OT3B 4HLUC 2ZUWA 1DC3A 3HVUA 2ZKLA 3K94A 3K2IA 1NW3A 1T6YA 2AR7A 2LR0A 4FYKA 4WV3A 1RZ3A 3HVIA 4CKCA 4BZZA 1QFSA 2FPXA 3OZCA 4KZPA 1PT6A 3IEIA 1D2RA 1U02A 4H0CA 1U8XX 3D6FA 3STWA 1SCQA 2WA1A 3R44A 4ODIA 5LBIA 2Z8YM 1Q1AA 4D4IA 1X39A 2YYZA 2HM7A 3IR6A 4D7AA 4P1ZA 4PYLA 4OQYA 1B16A 4C87A 3DDWA 4NKRA 1J97A 4AVYA 3FDXA 2R65A 3E3NA 3ZWNA 1O9HA 9LDBA 4N48A 1P2UA 3JVVA 3OOWA 5K0NA 3R7DA 3FGZA 4CCYB 4D42A 1ZS9A 4D0LB 1U99A 4F1JA 1KDRA 2A35A 2GSWA 5DBHX 3RT1A 2H06A 1RFLA 3P4XA 2JZNA 2RHTA 3TQQA 3IP8A 2GPNA 3NHPA 3LT1A 5DGIA 1D07A 4NAVA 4D8XA 1T2AA 4RTJA 1IIBA 4K9PA 1ZHHA 4OFBA 1DKMA 1HRKA 1NAIA 1DC8A 5FOVA 5A62A 5ALHA 5EUQB 5B6PA 1KRWA 4GX1A 2NUAB 3MSXA 3Q5EA 1DIHA 2IYFA 2D1YA 3M6WA 3N6RA 4TWBA 4QYXA 5E9QA 1KYQA 1P33A 5GP1A 3S1LA 4B44A 2J9XB 1CZUA 2QXTA 1J39A 3KB6A 4F2GA 1ZVMA 3H1BA 3BD6A 1ZIPA 3OLVA 4ABYA 4UHKA 5IF3A 4G86A 1UC4B 2ZRCA 3PR3A 4JBNA 1D2MA 4I9FA 5GZ1A 5DYIA 3SC3A 4ALIA 4PLWA 2ETXA 5FULA 5BOSA 5JYCA 4XDYA 2ZYIA 2JIMA 4OFXA 3ZEAA 1BZYA 1XXHE 3ZHBA 1PS0A 1HL3A 3PNMA 5CPBA 4EPTA 4KRGA 4HUTA 2A9JA 3B9PA 1IEVA 4HHEA 2NUPA 3JYPA 1CFJA 2Y1DA 1Y3BE 4P3PA 4X20B 1MX9A 3IKTA 4MR7B 1Z6ZA 2XZTA 1IULA 2HHJA 3A9TA 2B9VA 3MMPA 2RAFA 3UT0A 4BO3A 1U2QA 2HIMA 1W44A 1V1MA 2CVFA 2JHAA 3IUMA 1WDWB 5TMDA 2FFJA 2HRDA 3GJSA 3O90A 1F2TB 4KE6A 4EGFA 3C43A 1OOEA 4D74A 1RXWA 3RC8A 3NBYC 2GEKA 1R3UA 2GBPA 3BH6A 3BULA 3EGDA 2YIDA 4NOLA 5K4AA 3OU2A 5HUHA 1GGMA 1R6TA 1U98A 1SK9A 4D45A 3U7IA 4XR9A 4IIJA 3D7RA 5EMNA 1N2GA 5CVUA 3R76A 2C4TA 1KWKA 2ZQ5A 5CCEA 121PA 3MQ2A 3SMVA 1KO4A 2DSNA 1DKNA 2HU7A 4HVAA 3QWBA 1B73A 4HXEB 4IOMA 5ARDA 2WYIA 3KZVA 4N0QA 1VJ0A 2ZREA 2RGWA 3GWGA 2PCLA 5D7NA 4NJMB 3MW8A 1EBBA 3T1OA 5L6MB 1CQWA 3P0EA 3DG9A 4JGBA 1U8FO 1NNSA 3OM1A 4R41A 2BFPA 4ENVA 5DBFA 1DRUA 1L4HA 2JCYA 2Y8EA 2Z3WA 3OIDA 4BN4A 2UZ4A 1B23P 5C5EA 2QMQA 1PGOA 1U5BB 3T0IA 1OE0A 4LHVA 1XJCA 2G1UA 3IALA 4C29A 1OX4B 1UOQA 3CPJB 3ZHTA 5AM2A 1OXMA 4XGNA 4XIIA 1C2YA 2EQAA 1PK9A 1C3JA 2FG5A 3IMFA 3LCCA 4DM3A 4FBLA 5LQCA 4CF3A 3HKDA 3FYSA 1TK2A 3D5TA 3KKZA 4JENA 3M49A 1J1ZA 2G28A 5C46F 2K2WA 1XZJA 2NLOA 4EYKA 2W6MA 3ELUA 1TM5E 2Q9BA 3AF2A 4M0CA 4AULA 5KPJA 1JPUA 3IQZA 4QFCA 5DI9A 4DIFA 4E30A 4DUGD 2AC2A 3TDMA 1LNSA 2IEYA 5EWLA 3H2GA 1MB3A 3GWZA 2FUG1 4FNMA 9LDTA 2WIJA 1G6KA 1PG0A 2BCJQ 2PXAA 3TJZA 4BQIA 4M9QA 4P34A 5ANRB 3CMCO 1DO8A 4B6JA 4ZVVA 4FR0A 1NG1A 4JL5A 3U7QA 5BV7A 1TM3E 3QFRA 5DX8A 1OFUX 3P52A 5TT1A 2R0QC 3R0ZA 4COOA 2MJLA 1ULZA 4IFBA 3LBFA 4AURA 5CB0A 2VK1A 1TJ3A 1EGMB 5D00A 5LJIA 4IDAA 3DDOA 3TLYA 3NTQA 3M4YA 1J0EA 4Z1OA 1IOZA 1T2CA 1M2OB 1E62A 5LP1A 3Q8LA 3VU1A 1LUAA 4Z3DA 2ZTSA 2V0NA 1FDUA 4PV7A 4JXJA 4CKEA 2F3SA 2AF3C 2BGKA 4K88A 4AN0A 2W6ID 3F3MA 3DLAA 3VR6H 4QJBA 3FAZA 4O4HB 1KP3A 2XQKA 4GYYA 1ZHOA 4YR9A 3EWAA 3KT3A 5BR7A 4OLBA 1GA1A 3T9AA 5G1NA 1N0WA 1RXIA 5ISMA 1AQIA 4F85A 1KDZA 3VPCA 2QTWB 5L9AA 4NCIA 4BE9A 3X44A 2HC9A 3WDLA 1GSOA 4H0NA 3RSSA 1YKGA 4YUXA 2JDID 2ONZA 3FMFA 5DTMA 1UAYA 1XQ1A 4YP1A 5HMLA 1BHO1 3SAJA 2FK8A 3EXG2 1IBRA 2JASA 1F12A 2CLDX 1C29B 2CDCA 1WR8A 2JD2A 3KJGA 3U9TA 5AVJA 1CUAA 1LSUA 4RZ2A 3UJ9A 1JV2B 3JZFA 3RVRA 3FNFA 1IIRA 4F7WA 1DC5A 3B70A 4EG6A 3RE1A 5IBCA 1TUEA 1CQJA 2FGKA 1Z5OA 3OECA 1PJZA 1GQFA 2VZLA 3HC7A 2QRZA 4LOHA 3DHVA 4LKRA 4PAQA 1CE8B 4RCZA 1W87A 1GTJ1 1X1AA 3DVQX 3K0KA 3KU1A 4IGIA 3CEAA 1QH0A 3HMQA 3I6BA 4X92A 3FWYA 2QE6A 5KOIA 1U6IA 1IBMB 4Q4LA 4YP7A 2NU6A 3OCYA 1VE1A 4II2A 3RR2A 1ODSA 3TD9A 3KWLA 4DV3B 4CM9A 1OREA 1UFOA 3BIOA 3P9YA 5TGDA 1DCKA 1UBUS 2G3YA 4JT4A 2YASA 5ALYA 2I7DA 3UWMA 3WL7A 2QGFA 3GVHA 2I2DA 3GPCA 2FA9A 3FMIA 5EE9A 3HA5A 5DVZA 3HJFA 2R8OA 1EUYA 4MR8B 1GP2A 1MKYA 1RKXA 3QLEA 4OM7A 3ZUPA 3GAMA 1K5GA 4IP0A 4TN1A 3THXB 1Y6FA 1BEEA 5ALQA 4M60A 2NTYC 3WLMA 2IS4A 3ZE6A 4CLXA 4UM5A 1S2IA 2EGHA 3AP1A 1E3LA 3GLIA 2WZBA 3NHFA 4HYQA 3TTYA 4DBZA 4Q7JB 5HMMA 2DOKA 2J4CA