4MUIA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-methoxyphenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
283
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muiA01
1GPMA 1U7XA 5LFAA 3IMGA 2OV4A 3RK1A 4EG7A 3A2KA 4CQNA 1EFPB 1T9GR 2AG6A 1ZH0A 4EF6A 1K4KA 1WXEA 2R5WA 1MOPA 1N2EA 5HUJA 1Y42X 1JMVA 4EFKA 2A4MA 3N8HA 3SEQA 3CVVA 5J5AA 4NZPA 3K9WA 4MVXA 1KH2A 3LOQA 3NBAA 1TYBE 1G59A 2BTEA 1M1ZA 1U7DA 4RUKA 1WXIA 4PY2A 1RQGA 3PNBA 1CT9A 1M8JA 2YWCA 1TQ8A 2PIDA 1WJGA 1N2JA 1NUPA 1UFVA 3RJZA 3Q12A 2PZ8A 3ISJA 2DETA 1U0BB 3P0HA 3L92A 4YP5A 3Q4GA 3H9CA 5FNZA 3CLRC 2J09A 4DJAA 1GTRA 1QU3A 4DDKA 1J20A 4MW5A 4ZCQA 1PFYA 4NX2A 4RPIA 1R6TA 1XNJA 2QTMA 5EKDA 1KP3A 2HZ7A 3FDXA 3IODA 1QNFA 1IVSA 4YBRA 3IUEA 1O95D 1T6ZA 2BYTA 1JEEA 1M83A 4F4HA 3P52A 4NATA 4FZJA 1X6VA 1OD6A 5FO0A 3IOCA 3DPIA 1G8HA 4U8HA 2A84A 3QTBA 1JEDA 2DEUA 4JXXA 1PG2A 1MAUA 2G36A 3PNVA 1ZH6A 2E0IA 4ZT5A 2CV0A 3QE4A 1FYDA 4ZCTA 3CLTC 1N2HA 3A4IA 2ZUEA 1VL2A 4L2IB 3UC5A 3G5AA 1NURA 2J5BA 4ARCA 4ZCPA 1K4MA 1JZSA 1I2DA 3ELBA 4DLPA 5HG0A 1G8FA 1K92A 4JYZA 5KWVA 3RBAA 4KR9A 4J75A 4MUIA 1M8FA 1EFVA 1QRSA 3KT8A 3FI0A 3ZXIA 1NSYA 1N78A 1SURA 2IP1A 1OWOA 5DB4A 4KPUA 2DUMA 4WSOA 1PFVA 3VU8A 2JAXA 1T6YA 3TZLA 3ZJUA 1H3EA 1LI5A 1OBHA 3SZGA 3IMCA 4CT0A 4Q16A 3KT0A 1O96A 1X8XA 2QUJA 2QTNA 3DO8A 4QBTA 1IQUA 4EG6A 2PZBA 1K97A 2GM3A 5TS2A 2EJCA 1NUQA 3IDFA 4I6JA 1QTQA 1XNHA 4ZT2A 2QUHA 4ZCRA 5FO1A 4MUNA 3ILVA 4R0NA 4MWDA 1MJHA 2J07A 5DK4A 1KR2A 1OBCA 3JXEA 1KQOA 4HPWA 1U3DA 1N2BA 3AG6A 5IHXA 4JZYA 1ZUNA 1T6XA 2H29A 2X3FA 2Z09A 3AKZA 4KR7A 1DNPA 3ZXSA 2CV1A 3CVUA 4EG5A 1MBZA 1XJQA 2DERA 3TNJA 3FETA 1O94C 2A86A 2D54A 4MVCA 3F3MA 4A91A 1IFXA 5J59A 4GU5A 2AKEA 3MUEA 1Q77A 4MW4A 4MUFA 1KAQA 1EXDA 1WZ2A 3FG9A 3RFFA 4KR6A 1JECA 1PG0A 2I1LA 3L93A 2CYBA 4OUDB 2PXHA 4PBRA 1WXGA 1IRXA 2QJTA 3ZJTA 4S1OA 4YP7A 2YWBA 2WQ7A 1JILA 3RHSA 2WSIA 4KPUB 4MLPA 2QUIA 2D5BA 1NUTA 3IUBA 1O0CA 4X0EA 1B6TA 3SYTA 2XRYA 2A1TR 4TS1A 1KAMA 3MMXA 3AG5A 3INNA 3CLTD 4U63A 1I6KA 3S3TA 2H2AA 4EG1A 5KCMA 2A88A 4CDMA 3H99A 3NBKA 1H3FA 2E21A 3H97A 3SP1A 1OWNA 3H05A 4PBSA 3MLAA 4Q93A 1M8GA 4R2LA 1I6MA 4MAFA 2CUZA 1M8KA 1MAWA 2Z3VA 1N2IA 4HK4A 3FOCA 1NYLA 4R2MA 3CLUC 2QTRA 1OWMA 3H9BA 3IMEA 1JIKA 2QUKA 3HZRA 3ZUGA 1GTSA 2O8VA 3CR8A 4ZT3A 1O5TA 1JZQA 3CLSC 4MW1A 4EG3A 3I05A 1D2RA 4QREA 4I6GA 1H1TA 5LM3A 5TGTA 4H3SA 1KORA 1IQRA 1WXHA 3COZA 3DV2A 2CYCA 3RK0A 1O0BA 1KP2A 3COVA 1IHOA 4EG8A 4MUEA 1BS2A 1MB2A 1PFWA 3IVGA 3COWA 4U7JA 4QRDA 2Z08A 1J09A 1KQPA 2NSYA 3HMQA 1WKBA 2V0GA 3A05A 1TYCA 4UZEA 1PFUA 4MW0A 1EFPA 4GRIA 1O95C 1TYDE 3DLAA 2CT8A 3AFHA 3GLVA 3UK2A 3ZJVA 2DLCX 3IOBA 2HGZA 3KFLA 2PFSA 2X0KA 1LW7A 3ZGZA 4K03A 3LE8A 4K0RA 1WY5A 1YUNA 4ZT6A 4DDMA 3D6VA 3PRHA 3TQIA 5KHAA 4HJXA 1O94D 3U1VA 3KT3A 4ND7A 1NP7A 3ND7A 3A04A 1TFUA 2CYAA 4ND6A 3D6UA 1S4MA 5AHWA 1O97C 2IELA 2NZ2A 4YMIA 2DPLA 4ARIA 4EG4A 3PXUA 3X1KA 1J1UA 4EGAA 4MW7A 1G8GA 2V0CA 3C8ZA 1N3LA 4JFAA 3HGMA 1F4LA 4MULA 4MW2A 4HJRA 2GOYA 1O6BA 3GUZA 4G5YA 1Q11A 3P0IA 4MUKA 1R6XA 4DNXA 5K0SA 3CLRD 1GN8A 1GLNA 4MWEA 1MC1A 2CV2A 5HUHA 2X1LA 1QRTA 2WB2A 3VGJA 1EJ2A 3COYA 5H7XA 1YUMA 2DXIA 3FNRA 1Q15A 1TYAE 2PG3A 1Q19A 3BL5A 1EFVB 4PBTA 2B7LA 1KQNA 1IH8A 1ULHA 5DASA 3SZ3A 1EE1A 3IOEA 1WQ3A 3ND6A 4XFJA 1OWLA 1NUUA 2A1TS 3CLUD 3CA8A 2VXOA 4G5FA 4DE5A 4I6EA 1P7PA 2A7XA 1V8FA 5BNZA 3CVWA 2GKSA 1JHDA 2JANA 1GAXA 3IH5A 4J76A 3CLSD 1QU2A 4XFDA 1KH1A 1J70A 1TEZA 3MXTA 1N2GA 1O96B 3N9IA 4MVYA 3UOWA 1J21A 3TQOA 5JBNA 2VTBA 1HYBA 1WXFA 2QJFA 2AZXA 4MWBA 2A1UA 2RE8A 1NZJA 2C5SA 4P2BA 1QJCA 3FWKA 4AS1A 4NDAA 4OJMX 3KT6A 2EL7A 3FH0A 3UMVA 1YULA 4G6ZA 3HL4A 3FHJA 1ILEA 4MUJA 2PZAA 1N2OA 4MUGA 1VBMA 1KKUA 3OP1A 5J58A 3SEZA 3G59A 1F7UA 1LI7A 1MRZA 3HV0A 3PNYA 3HFJA 1QRUA 4MW6A 5TEVA 5H16A 3MLBA 1VLHA 2X1MA 1M8PA 3SDBA 4NAHA 1YI8A 1OWPA 3G6KA 3ZIUA 3FY4A 1N75A 4WNYA 5DEOA 3AL0C 3AIIA 2CSXA 3IVXA 4F3RA 1WQ4A 2DR2A 1J1ZA 1N1DA 3UY4A 4MWCA 4UZFA 3M5WA 1O97D 1U3CA 3TS1A 5LLTA 4E1AA 2ZUFA 4MUHA 1XNGA 2IJGX 3X1MA 3ND5A 1V47A 1VBNA 5F23A 2ZP1A 2XRZA 3QTTA 2E18A 4ZT4A 1NI5A 1COZA 2J08A 2QJOA 4ZT7A 2O5RA 3K32A 1H3NA 4OUDA 1A8HA 5TEWA 4KKVA 3Q10A 3VRHA 1EUYA 2J4DA 2VTBB 3CVXA 3X1JA 4MQ6A 1MB9A 1QQTA 2HMAA 2A1UB 2TS1A 2JA2A 1WOYA 3TZEA 4MW9A 1IQ0A 1EUQA 4JXZA 3FIUA 3N2YA 1N77A 1JIJA 4CDNA 3IVCA 2RD2A 1VBKA 3P0JA 4YP6A 4BWVA 1F7VA 1JGTA 2CFOA 5K0TA 4DDHA 2E89A 2YY5A 1YIDA 1ZJWA 1NUSA 1FFYA 4XSVA 3CVYA 2YXNA 1I6LA 1F9AA 3LCJA 1YIAA 3E27A 4ZCSA 2D13A 4AQ7A 3GMIA 5IJXA 1R6UA 3OTWA 2OQ2A 1GZUA 4NAUA 1KH3A 4L2IA 1T9GS 4MVWA 3NV7A 1JIIA 3N05A 2WQ6A
chains in the Genus database with same CATH superfamily
1CX9B 1E32A 4ECEA 1YMQA 3G2LA 2IHUA 4PFQA 4URFA 2HL6A 4XTRA 3PJDA 1V2GA 2R5WA 1J2YA 2GF9A 3PR1A 3QH4A 4LOJA 4X7PA 1X9GA 2IDZA 1SCUA 4C2UA 1P5JA 4KQEA 1NVEA 1UBUS 3U9LA 1PJBA 3N8HA 2EEZA 5FPTA 2VOJA 1ICIA 1X8KA 2ZW9A 4RS4A 3W1EA 3ZDZB 1ISHA 3ZQUA 4MVJP 4YDRA 5KX5B 4IQ8A 4GHWA 1U2SA 2WWVD 4CCSA 2W6IA 2YOHA 3H5RA 3OZGA 4HAUA 4TTJA 4JBIA 4RUKA 5D2CA 4JX8A 4BBPA 4HQFA 4JC0A 3U3MA 1YHZA 4GOMD 4FX5A 3N70A 4MJXA 1TMKA 4XVHA 3O4IA 2F90A 3BREA 1O9HA 5CCEA 4KRYA 3OCCA 2IV3A 1JR3A 2XJ4A 3L92A 2W5UA 2BTQA 3D4NA 1RQ2A 1U2RA 2WUGA 4YP5A 4DDVA 2HF7A 3EFOA 4HBGA 4IPTA 4WZBE 1J42A 3G0CA 3U2QA 3IQDB 1FX0A 3DT9A 4MPRA 1W35A 4QBIA 2OEPA 4PO1A 2OORC 3ZDXB 1OFIA 4FUQA 4Z7QB 5KNCA 4DDUA 4CRWB 5IZ4A 2W2LA 3D8SA 5DSZA 1YZNA 2QV0A 2W6ID 1F9EA 2CD7A 2X0NA 4DREA 4KHZA 4OJTA 3FYTA 4TSFD 2BZ1A 2NP7A 1D2HA 1II0A 2GJAA 1L5RA 2GKGA 1OYYA 1OH5A 3COJA 5FFFA 3WDSA 3A10A 2E4XA 3GJZA 5FV4A 2YIVX 4KPFC 3F4BA 2ZRNA 1RMTA 5F5XA 4JXXA 5SYAA 5H81A 3T7JA 4CR6A 4UUQA 4LWPA 4NRDA 4E5UA 4NECA 2JI6A 4XQEA 5SYMA 4H7EA 1PZHA 4P4SB 3I5AA 3QE4A 2VTKA 4XGNA 4O2BA 3EK2A 1SXHA 5EJGA 2HC9A 1G5HA 5J5VA 5KNCD 2BTEA 1U8TA 4FDLA 3LIIA 5HWSA 1ZVVA 1RLTA 2VUUA 3NGLA 1K86A 1KVRA 4EWLA 4RTMA 2PJUA 3BIXA 2RK3A 3A3PA 4JP2A 1U6IA 1OT5A 2J5BA 5AESA 4JL8A 4ZDIA 2X1HA 4WNIA 4Q3CA 4CWAA 1KJIA 3ED1A 1GKYA 1PEAA 1Z73A 2QJWA 3O7MA 1H9CA 3W2HA 3KLOA 3WMRA 3LC0A 2ZTSA 2WSSD 3CM0A 5B3JC 3UB2A 3UT5A 3ZX5A 4M9RA 4GXTA 4L3VA 2HOQA 3CNNA 4JR2A 5F1KA 1B16A 3A6EA 3INGA 3UMSA 1RQRA 1W5AA 5C1OA 2FX3A 1YRBA 5DXJA 1N78A 2BFBA 2CD9A 2QPOA 4V2UA 3GUYA 4GPAA 1GRQA 4ZU3A 5GPBA 3NOQA 4YMGA 2E6UX 4Q6WA 2NSLA 3QZUA 1C7FA 3HYLA 1TO2E 1YJBA 4IIDA 4LHWA 3IBFA 3TEFA 3NJ4A 1U6KA 2BW0A 4FYIA 4QUGA 5DHPA 3HO1A 4LQ4A 3PDJA 4C03A 4GXNA 2F1IA 3A27A 1V1JA 4C22A 4XX0A 3GG2A 3U40A 4E6PA 2PL9A 3R5FA 3WLAA 3F8WA 2QB5A 4RVSA 4PYOA 1RHMA 4I55A 4I5DA 4EG6A 2PZBA 5JBIA 4Z5XA 4L8WB 2FSHA 5F21A 1G5RA 1JFSA 2G9VA 2ZG6A 1N1GA 3G0BA 3M1AA 4KJZA 2HHJA 2LWIA 3JAWA 3P19A 4ZHQA 4BNLA 3D3EA 1G17A 3NWBA 3I01A 4JLPA 5LQKA 4NCJA 1TW2A 2QPAA 1DZ3A 1KJNA 3H2ZA 3ZUPA 3MJRA 3I4LA 2V7TA 3KB2A 1DKOA 1E9BA 1JL3A 1OA1A 1TZ2A 3D81A 1VYTA 3IVAA 2IY8A 5KCZA 4US2R 1X2BA 1RP1A 3X44A 4JZYA 2ID7A 1W2HA 2O1XA 4QOHA 3KTOA 5L8VA 4DF3A 1BDIA 2DPGA 1Q74A 3EMVA 4OXIA 1DNPA 2AC7A 2AWOA 4OUKX 3ZW7A 2Z4SA 3SXUA 5KMGB 4Z9AA 2C54A 4YPVA 2JGLA 3KP1A 2CV1A 4GX2A 4EG5A 4ZDJA 3ET4A 2JD0A 4YPOA 2VK8A 4R2JA 2MHCA 2YHUA 4K6GA 2Q5JA 5GONA 1X0XA 4E5MA 4EB6B 2F4VB 1GILA 5HCNA 1WB9A 2FUG1 1ES9A 2HHHB 1IZ9A 4MUAA 4QDOA 3QVGB 4MVCA 3A6PC 5AK3A 1JW9B 2V96A 1RXEA 4F12A 4FR0A 2ZJYA 4Y3UA 2A14A 1CE8A 3AERB 3IEMA 2OCAA 4L4ZA 5DHUA 2JARA 4X7RA 5SYNA 4L78A 4AMZA 2OV8A 4KAJA 5JO0A 1QCDA 2Q41A 2WJGA 4ALJA 1YK0A 1NXQA 3CH4B 1SPXA 3TTVA 1U8EA 3AZQA 3ZWWA 1T34A 3VX3A 5F35A 4KPUB 1KY2A 4KFSA 1EDEA 4YRNA 1P39A 5EZYA 2PH7A 4UE2A 2EHJA 4IDDA 3AP2A 3T7IA 3PPWA 4OLJA 4WZBA 4HDAA 3BZUA 2ZWIA 4LV8B 3EA5A 2XOKD 3KXIA 3DOCA 4IKOA 1NATA 1IM5A 3JVUA 4M1KA 2G3DA 1W19A 5AVKA 5FL7D 1IEXA 5TJHA 1WUTA 3LHFA 4XVQA 1QIMA 2QN3A 3F6EX 4OIMA 5JCZA 4LXQA 5KAMA 2G9UA 1GPJA 1WABA 4E07A 1U8XX 3CUSA 3G9ZA 5CIYA 3P45A 2ZCUA 3AJ9A 3B12A 2X0FA 4L8YA 4IMPA 3S2SA 3EZ7A 3I73A 1YR8A 1I6MA 2O2GA 1TB4A 3V97A 3A4YA 4E12A 1KXZA 1QHHA 3G85A 1EVEA 1N7GA 4ZALA 5IASA 3G23A 2OQVA 5IMSA 5DGIA 1EYZA 2WC1A 2WAYA 1HLPA 2CJWB 1OWMA 1C9MA 1I5OA 1Z6ZA 2HLPA 2QTRA 4UJ3A 5TARA 4CEIB 2VDOB 3DB1A 4JVLA 3G8YA 1QAQA 4G2TA 5KSZA 3D4IA 4N65A 3JQFC 3GRCA 3JASB 4HDSB 1TX4B 2QQFA 4BRWA 1DO2A 1RNLA 1XD8A 3IEKA 3G6WA 4RMJA 3GARA 4V1CB 4F8YA 1P3JA 1IQRA 2H1VA 3CH7A 2QU7A 1ID1A 3DL2A 3L0OA 5EOVA 4AXBA 4G0PA 4ZCMA 1Y8ZA 2X4IA 1PGOA 2VUHB 3I8OA 5JXWA 4O2BF 2PMCA 5CU7A 2HRRA 2W42A 4RLSA 5ECWA 5FNVA 1K75A 2XECA 5DRYA 3BHJA 1Q3HA 1BMTA 3GLKA 5FFNA 3W2TA 3WG9A 4XTCS 5AI9A 3EDMA 1IONA 2BEUB 1Y1RA 2GEDA 3IRUA 3IL2A 5AI5A 2FUEA 1J09A 1ZIOA 1ULBA 4NHOA 4RY9A 2HA6A 3E2IA 2VK2A 2BMFA 1N2CE 4RF3A 3T5CA 1MB4A 3VO1A 1DC4A 1WMEA 2Q5LA 1JMYA 2RHBA 1W6RA 2WMNB 5AI6A 2P2NA 3V3KA 1QWSA 1NVAA 3W2FA 4YRMA 1XHEA 4WKCA 4DA7A 5GQSA 4E7OA 5CX1B 4NMXB 2GPAA 2X0KA 4JS0A 4M53A 4Y9RA 1MAAA 3WWOA 4RVNA 3DR3A 4AF8A 1LW7A 2F8MA 4U7PB 5MDHA 3AVYA 4YMSA 3RTBA 4EELA 2W8ZA 4XOIA 3OZXA 5H9WA 1L5NA 2CJYA 2PR2A 4G5XA 4CV0A 1KS9A 4G1FA 2PX4A 1LF5A 1Q0QA 3IAHA 4KIGA 4I55F 5KSOA 3ZZ1A 3FTFA 5C5CA 4IX1A 4AUEA 5CA1A 3ZU6A 3EMOA 1JXMA 1SRQA 1IXRC 3N1UA 2AOUB 2R4TA 3PFCA 5SY9A 2ZJ7A 1S4MA 3QOYA 2H8KA 1KU6A 1B2RA 2BCJQ 5PGMA 4ZHQF 1SHUX 5KQMA 1Z36A 4EHBA 4ARIA 2OT3B 4PQEA 1W1WA 3DZ8A 1SM4A 1XLWA 3U4QB 1PRYA 3UMFA 3L8YA 3SHWA 4WCFC 2PUGA 2V0CA 3K7EA 4OQLA 4Q3EA 4EUFA 2QSYA 2R1UA 4YWJA 3RIEA 4GR4A 4F7WA 3NBFA 4WOBA 1C0IA 3DVAB 2CXQA 3M89A 3NATA 2G7MC 2CHUA 3TQTA 1HF3A 2QMQA 2F1RA 5K7SA 3H9JA 2XT6A 1IZZA 1GLNA 1GN8A 3DEYX 5P8WA 5CDFE 2Z9DA 1P19A 1GZ3A 3RQIA 4FN5A 2X1LA 1QRTA 3ROQA 4DB2A 1MGPA 4A0QA 1RPTA 4RPKA 4C20A 3WLTA 5BWBA 2QRHA 3O93A 4K6KA 1BGXT 2KBFA 2C2OA 2BZSA 1A96A 1UKAA 2CNNA 3BJIC 4M0CA 5BNWA 1EFVB 5JDIC 1RWWA 1TUBB 2ZXUA 1GZ5A 3LGXA 4YWHA 4YECA 4HMPA 3U7QA 2HNAA 4MRSA 3PRJA 3OPNA 3FB1A 2GYWA 3U9SA 5F52A 5IC6A 3COSA 3SJBA 2P2LA 2QMZA 2QUZA 1WBJB 3I9LA 2XB2A 3I9V1 2DHEA 3CA8A 4GRAA 1TJPB 2OHXA 2O8DA 2MSEB 3GEIA 1P7PA 4RDHA 5FTWA 5FRDA 1JHDA 1ZN7A 3O75A 3W9YA 3ABOB 3X2FA 3PBKA 1PT5A 2Z5VA 1UMKA 1FNBA 2VPIA 1SXJE 3L7OA 5EZYF 2YV2A 3ZHQA 1O96B 5A6VA 5JAHA 2FFJA 4YAOA 2EFJA 4JZKA 4KVAA 2XMSA 2IYQA 1PWZA 1ANKA 4HB0A 1F2VA 3KQMA 4O1MA 1FSFA 1ELOA 1SUBA 3AESA 3BD8A 4RZUA 2JIDA 1ZPDA 4MWBA 3W06A 2WIBA 3V2GA 5INTA 5REQA 2WJZB 2YV5A 1PLJA 3UQZA 2GAJA 1PL7A 1AQIA 2NU6A 2Z3WA 1THZA 1WY7A 1YR3A 2PD4A 3JQGA 2FPGB 2P2DA 2GN8A 2YNMC 2Z95A 4MGZR 4UXIA 3EXHC 4WKBA 1FDSA 5FJIA 4NOKA 5JO9A 4TMYA 4HGRA 3KT6A 1V8PA 4CLHA 5FF9A 4J16C 4MICA 4QAJA 4JVMA 4DIEA 1HEYA 3AR7A 4A0GA 3VR2D 1ISPA 4YV2A 3GN2A 4X45A 1WSAA 3KEMA 3K1JA 3NAMA 3A6HA 5F1YA 1RQNA 3DBLA 4OHFA 2HH9A 5ALFA 4O2AB 1XRNA 5A5GA 3B1XA 2HJHA 2EZTA 3QW4B 1KXJA 2AK3A 3SJZA 2J3DA 3OWOA 3EF3A 1HE2A 1GR0A 2Y9MB 1KERA 2FG5A 2OWEA 5E6SA 3NDJA 4WKNA 1MA3A 4LTMA 3ZK7A 1YRWA 1OX5A 4FGUA 1U4OA 4KNYA 1VFPA 3GD7A 2ZUSA 1RMYA 3JQBC 3WHLA 2ZPTX 2QW1A 3CFIA 4RHYA 4REQB 1NTOA 1TI7A 4MW6A 2DQ4A 1QV9A 5C52B 1ZD4A 1VLHA 1UBJS 1VYHA 1QF6A 3L0IB 3O1HB 1EM8A 3BFXA 4B3BA 1THGA 1E9DA 3FGPA 5C7LO 3GDFA 5DCLA 4G4IA 4XIGS 1JLHA 1F60A 1U2QA 2PGLA 2Y0PA 3ZIUA 5C4IA 1A5ZA 1TVEA 2EKLA 2JEZA 4XCVA 4HEQA 3CBQA 1JNXX 4HLUC 4ZYUA 1N2CA 3B8EA 1UXHA 2AG8A 5IN4A 4OMCA 3TKAA 1J1ZA 1ECLA 1G6HA 2V7UA 5J43A 1RRKA 1RJ9A 3N6VA 3OLWA 2D7DA 1JHZA 1K6IA 1YF3A 4HRAA 3A6LA 3ESQA 3IT0A 1WCXA 5G41A 3ZE2B 1O97D 2QTZA 3HI4A 3CKKA 2WF6A 4JI3B 4IL5A 4OHWA 4E6EA 1H2AS 4E46A 2ZUFA 3PDHA 3MQFA 3PXEA 3R0VA 1XMJA 2MT9A 1SULA 4YP9A 5IAEA 1JH9A 2OD9A 1Q7CA 1DJNA 2XKKA 2GZ1A 3G2KA 1C0KA 1GRRA 4MV4A 2GN6A 2J08A 4C0XA 1CF4A 1E66A 3H4MA 3KQQA 1ZK1A 2XVYA 5JFGA 3TOVA 1A8HA 1LPNA 2JGDB 5BWLA 4P86A 1I7DA 2ACWA 1EUCB 4GBMA 2H8GA 1CB7A 1QOQB 4JVOA 4I4NA 4DB4A 1VI6A 2R2GA 4RAQA 4QULA 1U04A 4RK6A 5ICSA 2PT7A 2EYUA 2RH4A 1SUDA 4NU6A 3VMFA 3LQYA 3W3AH 4RHXA 2AL7A 2Q4EA 2OFWA 4H1UA 2ECOA 4XM0A 4I1PA 1LEHA 2OBXA 1YB5A 3B3AA 4HDNB 1W7AA 3R6WA 2KB0A 1W47A 1SEVA 4LJKA 4C6TB 2C8VA 3RCBA 1J4AA 2NUPB 4OMDA 4BEWA 3OQ6A 2O4UX 3KJHA 5BVHB 1NXXA 4TZ0A 4JB3A 4CLOB 4PNEA 1SK9A 2ODNA 3D6FA 1HDRA 4HQRA 3I52A 5JAMA 4PPFA 5KB3A 4H27A 1L5FA 2VBGA 3NAGA 2XGJA 1P5RA 1UDAA 2GK6A 3NHPA 4L95C 5DLYA 4ZVPA 4ZZ2A 5B3KA 3TLMA 2C82A 5CDFA 1M2WA 1I3CA 1R8YA 1XPRA 4IRMA 2PGAA 1ZK3A 3QIVA 3LT0A 4A16A 4CM6A 1ZJWA 4IXWA 2V58A 3KLPX 5LZ7A 5TGDA 1OREA 1UPUA 1RAAA 3LS2A 2AIRA 1AD2A 2FZKA 4ENVA 3PQ2A 1MUUA 2RGYA 2X40A 2LPMA 4QGAA 4FSDA 2WTBA 3KCNA 1U4NA 3N8KA 3VMMA 5JPDA 3E27A 4RE6A 4UEJA 1I7SB 4HNAA 5B6JA 3LWZA 4Y9DA 2YMPA 3BKWA 5CCXA 3OPQA 4KWHA 4UHJA 4QU8A 1H2XA 5IJXA 4AXXA 5K0FA 2IW3A 4X9XA 1B14A 3QU4A 3VC2A 3PXXA 3ZW8A 4BJ6A 4N8SA 4IQGA 1AKMA 1T9GS 4TTRA 5A7GA 3PD1A 2H59A 3D64A 2HA4A 2VAXA 4W1PA 5D3KA 2O3UA 2IYRA 1JAXA 1JDBB 2PT6A 1V48A 2F1JA 1DCKA 2RJNA 2AN1A 3H42B 1N5DA 4LXGA 4M1MA 2D1FA 5CGZA 2G67A 4CIBA 1SXJA 4AF6A 3C8UA 4AUMA 4P4GA 3RVQA 1BHO1 5FFMA 1YH3A 2JDIA 2NO5A 2RG7A 3LQRA 4NBRA 1GTVA 4OQXA 4PYQA 2XQIA 4D6YA 1XTBA 1ZIDA 3AGPA 1Z5OA 3FHLA 2O06A 2CHGA 4WA7A 521PA 1RBZA 4WRRA 4DQ0A 1M2FA 1XZJA 4U7HA 4BVBA 1YWGO 1LQUA 4LWOA 3QA9A 3KD2A 5JPIA 1RTKA 5CFLA 2UXDB 1JBKA 1X8JA 1Y8RB 3BGOS 2BEVA 4JN6B 4L0DA 2E1RA 3WIUA 1XD9A 2VH5R 2AOTA 4BEBA 1CUEA 1I1NA 4IVPA 5EWMA 4LIPD 1LFDB 1OH8A 4UDOA 4KRGA 1N25A 2I4RA 1TK2A 4XB2A 5CIWA 5KWSA 1WR8A 3C3XA 1U2GA 3C3DA 1V1MA 4QDTA 2PSDA 3R7AA 3TLYA 1PQUA 2A9JA 2DETA 3A06A 1I4WA 2C99A 4CL2A 5KKCA 1NX6A 1D4FA 3GLRA 1AMOA 1SXJD 1Z0KA 3K5HA 1A9XB 5DDIP 5T8KA 1OR8A 2JDID 2RHHA 3FWNA 1VMDA 1JG1A 3AF5A 4H15A 1DTWB 4CI0B 5LNK1 1BCRA 1YHNA 3W0LB 5DW0A 3T99A 1QNFA 3PGLA 4DLAA 4FCWA 4YREA 4JQZA 3A0RB 3BERA 3BD9A 1S7GA 1ZLXA 4J3NA 2Y1OA 2ZBPA 3GRPA 4CM4A 5JASA 4GNRA 1QR2A 4XPIB 2H65A 1R0WA 3DPIA 2WG2A 4ND5A 4P22A 4NZOA 4U7TB 1L3CA 1Y9DA 4G25A 2GZ2A 4G41A 2Z5GA 3ECSA 2IZ1A 1RKUA 3JAKA 3JU3A 4C4YA 1TA9A 1Y7HA 3HKEB 5KTRA 3FPHA 4ZJPA 3R8CA 3KSRA 2G6TA 1YOVB 4MKXA 3R76A 1A9RA 2WU1A 2GWHA 3KCQA 3BRQA 4D96A 5JJIA 1T0UA 2XNSA 3R75A 6ADHA 3LYUA 2DH6A 5EUCA 1FP6A 2C29D 2OL4A 2Y4OA 4NBLA 3N2LA 2PLRA 5JSYA 3TSAA 5AW3A 5JEDA 1FFXB 3AB8A 1I2DA 1KPIA 2VZLA 1OGJA 4TXLA 3OTGA 1K92A 2EX1A 2XLCA 2ZJ1A 4IHKA 3KSBC 3U60B 2A5GA 2FSIA 2V03A 4MITA 2R7MA 2VDWA 4PYJA 5BXYA 5K3OA 2J4CA 5KX5A 1Q0LA 2LDBA 2YVAA 4U4AA 3CR7A 1YVEI 3RJMA 1CUHA 4PRZA 4URHA 3V1UA 2H11A 4Y6PA 1OWOA 3G0IA 4IFIA 4JJKA 4EYOA 1IIBA 1PFVA 3FUXA 1DO8A 2J7PD 4FLMA 3OCXA 5COAA 2JAXA 2PGIA 1WG8A 3F90A 1Y3IA 3I2YX 2ZUUA 1LDBA 1R16A 2JGJA 4TRMA 5KVAA 3EE6A 5T57A 1E9FA 4R7GA 1M2NA 3PITA 1Z5ZA 3OBIA 4OB7A 4R1LA 4FOOA 2H48A 2TSYB 1JDTA 4PTYA 4ZWNA 3H86A 1I2MA 1MAHA 1PF7E 1X8XA 3WL7A 3ZGLA 1PJ3A 1E9AA 4KC0A 5BSEA 4MJ7A 2PJDA 1TTQB 2BDEA 2X8JB 3A14A 3K5PA 4PANA 4KQ2A 5D01A 1NUQA 4I6JA 3WISA 4PZDA 2MR5A 4TWZA 4OATA 5I9LA 4HWSA 1HO3A 3WWDA 2VQ3A 4GKVA 1B0UA 2D2VA 3DDCA 4ZVMA 3CX7A 1C7ZA 3E1SA 5FOTA 1FJXA 2Z3ZA 4GKJB 4ENUA 4HDRB 5EA2A 3BQNB 4RSHA 2HDNB 1SO8A 4M4SA 2R62A 3KUUA 3GJQA 4K28A 2O8CA 1MT3A 1U3DA 3T7CA 1CKEA 2RHRA 2IYPA 1ZUNA 5IAGA 3K09A 3RS9A 5C8ZA 2F6RA 1DV2A 1RAIA 1H65A 3DTNA 3HCBA 1A2QA 1JKJA 4J9UE 5L3ZA 5SZIA 4CPDA 1GZ6A 4GI5A 2VPTA 3O9VA 1VPVA 5DLEA 4HPJB 4UTRA 3AILA 2DTXA 1VLLA 4YALA 1K63A 4FCVA 2VLBA 1O94C 3ACCA 4BMZA 1E2BA 2BKUA 3R7NA 2PMFA 5AKIA 2BJVA 2HDHA 2Z98A 4G2NA 3DWIA 3VYRB 4BFSA 1IN4A 1Z17A 3WQBA 2ZIXB 1DP4A 2VP6A 4ESOA 4MI1A 5F5NA 2PXHA 1T4MA 4LJSA 2YIJA 4OL0A 1DTEA 4JQSA 4UEOA 4V2IA 5DI9A 3P20A 1G0OA 2Q2VA 2YVLA 2ODTX 3O4FA 5C18A 3ORHA 3VDXA 1BKSB 3CUUA 3K6JA 1E5TA 3OOEA 1EGMB 4F2DA 3BE8A 4B75A 1Q83A 3LDHA 4IMIB 1NUTA 1CJBA 2KQUA 4INZA 4ARZB 3KJQA 5T8KC 2IL1A 3K9HA 2WG1A 4ZJYA 1A1VA 4WNAA 3UJAA 2PWBA 1U4SA 1A9QA 1I30A 1KFEB 1YQ9A 2MSLA 3ID6C 1QX3A 3MMXA 4AMUA 4GR9A 3UHPA 3M4YA 3AINA 5KS2A 3D6HA 4EW2A 5K09A 4XIYA 2A5YB 2Q3HA 1HGXA 4L4UA 3ZCXA 1PQ4A 3O2QB 5BWOA 3DO6A 5I9NA 2PE5A 3HGQA 1C0PA 1E6WA 5KWEA 1ADYA 3LUDA 5JZ9A 1JDPA 3LXRA 1M7BA 1ZO8A 2BBWA 2XAAA 2FCRA 5A6SB 3A6KA 3RADC 4FNGA 1ZY2A 1XXHE 3RTCA 3VH3A 4BVJA 2FW0A 1M1XB 1TLTA 1KI8A 3NOXA 4MUXA 4KLZA 1AKUA 1M8KA 1RADA 3S2UA 3IUPA 1JLRA 1YFKA 1ZKDA 3SQOA 1TCAA 5JNUA 2F64A 3OLXA 1ORTA 1GEEA 4QC2A 3BRWA 4R9RA 2C7VA 2QG9A 3GFBA 1M0WA 1YO6A 1HDEA 4NJOA 4KFUA 3F73A 2GPBA 1ZHHA 1M1NB 3I05A 5A3SA 3V7UA 4RYLA 3E9QA 3WQRA 1JS1X 4BL5A 2YWXA 1RR6A 3L8MA 2ZR7A 2NW6A 4CL3A 2J5KA 3LECA 1M2VA 1BVYF 3FZQA 2VO1A 4B8YA 4PZCA 3C5VA 2X0IA 1FFCA 2XVXA 4H7IA 4JC8A 4EYKA 3COVA 3S8YA 4YXWA 3HWSA 2JLSA 5EMHA 3R4VA 3IVGA 3DUFA 2BMAA 3WV5A 1LPMA 4FE3A 1VL6A 3R24A 3WSVA 4RPCA 1NMYA 2PK3A 4JXKA 4PPYA 2C9MA 3IKVA 1GCUA 1E7SA 1M72A 4Q01A 3OU6A 3VU3A 4XSGA 4C0QC 4C87A 3N2GA 4Q3OA 2FHSA 1NPYA 1XCJA 2NSYA 2OFXA 2WMYA 3E3MA 4GL4A 5KX5F 3G82C 1ZXLA 2ERCA 5L7TA 3A70A 2H9AA 3VPGA 5AW4A 5EHQA 2B78A 4BN5A 2OCBA 4GRIA 2RJ3A 5EVJA 5BSFA 1CEYA 4GMXA 3OHMA 5HUQA 2DQSA 9LDBA 3DQQA 2HGZA 4MAAA 3DOFA 5T5QA 5ULLA 4TVBA 2BTQB 2OGTA 3KJXA 3PUJA 2EZ4A 3REGA 3SQNA 3U3OA 5IAAA 4PNPA 1N34B 2LD4A 4QNMA 1WZEA 4R69A 2P9GA 1ABBA 5MGBA 2J4FA 4JXJA 4MCIA 3D2BA 3TDKA 1AUVA 1IY2A 1ZP6A 3AEYA 3DC7A 1GKUB 3TL6A 1A69A 1TQ2A 1H22A 4D0LB 1XKXA 1E77A 4I2VA 1UFQA 5EINA 2NAPA 3PEVA 4YAFA 2W6QA 1NP7A 4BP9A 5BYJA 3G0GA 3SIXA 1FNMA 3WRVA 4X97A 2OORA 2CYAA 1CV2A 5CLGA 3G9XA 3TE6A 1DXHA 3HUUA 5E7MA 4ETWA 5LP6F 1SVUA 2YJ6A 3IBSA 3LT5A 5K8UA 2VC2B 4U0KA 5DBFA 3LQKA 5JNVA 2FWPA 3B9BA 3M4JA 3KAKA 4FTWA 5F4ZA 3KZ1E 4EM6A 5CDGA 3H1TA 2D1YA 1GKKA 3B3FA 3FUWA 1AKWA 1G8GA 4M0UA 5LMCA 3HEMA 4L02A 2HU5A 1NU8A 5BO5A 4CKXA 1NQWA 2HBZA 1UANA 4F86A 3CZ9A 3WFZA 1R0KA 2E5LB 4ZGGA 1B6SA 2IT1A 2ZYVX 3FPGA 1TUGA 2VQDA 2YMQA 4PLVA 4QHSA 5EE0A 3DMYA 3BHIA 2NXCA 4U2FA 4WK0B 2IYFA 4YJ2B 4F8JA 1Z8DA 2WJ6A 1CLUA 1YI0A 3QJGA 3DAFA 4FJ0A 3R7SA 5IPFA 1C0LA 1E62A 3GNQA 1CF9A 1ONPA 4KO4S 1ACLA 3D0QA 4AFNA 1CQIA 1K8QA 5ELMA 4DHEA 2WB2A 3P9IA 3H6HA 4EK9A 3RDPA 4EA9A 1RRFA 1ULUA 4L5JA 4K2AA 2A59A 1Z4NA 1Q7GA 4QBGB 1U1CA 2ASVA 4LVCA 3HDTA 4XD7D 3OI7A 1L7PA 5C7OO 2VPZA 3IOEA 1A8UA 4HNGA 2BWJA 2G1UA 4M36A 5ILQA 3TX2A 3A2NA 3WLEA 1TGYA 4A92A 1FMCA 3WYDA 3THWA 2B98A 2FF5A 1II8B 1KYQA 5G0WA 3ERCA 1SZCA 2EKQA 2UZ0A 3FROA 3L7YA 4CF3A 1NAIA 2XYHA 3R9XB 2WDZA 3HKDA 1G7SA 4KBFA 4XX0B 2X5NA 4HEHA 4XH9B 5JQGF 3MHPA 1XTJA 1ZQ9A 3PCRB 4Y2YA 3GN1A 1GEGA 3GRUA 5DCUA 1WXFA 1XXHA 2QJFA 4GLBA 2B1GA 3LF1A 4YDHB 2XD4A 3HDYA 2A1UA 1DX4A 4TS4A 1TZCA 5EQDA 3VNAA 3WICA 4P2BA 1J8FA 3PC4A 5JXJA 3ZBPA 3JAWB 4IBOA 5JBQA 5KHLB 4JCCA 1GPUA 2Q4OA 2QRJA 3I1YA 3AH8A 2J87A 4NDAA 4GQAA 3ZHVA 1KOGA 2W6CX 3UMVA 2XLBA 3JWPA 3BCRA 2VHUA 2LKCA 1UKVY 2EX0A 2GWRA 1ZX1A 3HL4A 3N8NA 5EKTA 2EWMA 2O2EA 2HBQA 2ZI7A 3MT7A 3R5XA 5FTJA 2FZWA 1R6DA 3T5MA 3IAAA 1SQGA 2UVQA 1KKUA 3E9ZA 3KSZO 3QXHA 2WZQA 3V4FA 2V1UA 2I4TA 3JALA 3OP1A 3SEZA 2QTVA 3AY7A 3EWNA 3TNYA 4E2XA 1GSHA 3H5IA 4EA7A 2QX9A 3EZNA 1XEXA 3JQ6A 2NYRA 2D00A 5T6BA 2H4HA 1ODTC 3D7RA 4I8DA 5CA0B 3WKAA 2AMYA 3DOUA 4YQFA 2FEPA 1I24A 2OXCA 5H16A 1FFAA 2F9FA 5GONB 3UZUA 5THXA 5KNDD 4GD3Q 1IWOA 5JSQA 4PS0A 3DV0B 1SIOA 4NEGA 2JLYA 4IUYA 2PM8A 1WMFA 2QRPA 4CKBB 4OH1A 1GAJA 1M2JA 4IDBA 4MGIR 1EXNA 1N1DA 1CVLA 4GOND 4JI6B 3UK0A 2PMEA 4LGCA 1LV8A 4CKEA 5A3QA 5DHSA 5MN6A 4DBLC 1MRNA 3E48A 2LP4Y 1PZMA 4WDRA 4BDTA 1NXPA 2ISSD 2WU3A 6NULA 1XG5A 3OJFA 3L1KA 2IJGX 1ZJJA 1ESMA 3T7SA 1IUNA 1IEWA 1NHWA 1W30A 2X5KO 3AJDA 3PYLA 2JHFA 3RD5A 1J99A 3EOZA 4AULA 3PP8A 1XO1A 2X9NA 4UBNA 4WZBB 4IJKA 4N12A 4PG4A 1W5SA 4YHHB 3QPBA 3VNBA 2GH1A 4LGVA 4LI0A 3EIXA 1DMSA 5CD9A 4C05A 3E03A 1P7YA 2WZBA 4ALLA 1NQTA 3C6BA 1KJ8A 2HWXA 2GR8A 1G8AA 2VR1A 1A1SA 1G1AA 2N75A 1GPBA 1MO6A 2CFCA 3L1HA 3T4PA 2Q5EA 3MWKA 5A4KA 4MO2A 1MP0A 2G0NA 4MW9A 4CTJA 4PV7A 3QVMA 4Q47A 3HV2A 1BVRA 3H3XA 3CG4A 3GUCA 3TI9A 1TE2A 4JNKA 4XW2A 4PN7A 3O92A 3MIZA 4KO3S 4HDOB 4AS3A 4CDNA 4TVSA 2ZCJA 3FWPA 1HXHA 1CW2B 4M88A 3K72B 3STWA 1SB9A 5CT4A 3ZBQA 3ZZ0A 4BWVA 4N4AA 4QM7A 1VLQA 4EA8A 1F7VA 2OYCA 2RBGA 3OURA 3H0KA 2PUAA 1VI5A 1XDWA 2FJPA 2QMUA 3MRXA 4MS1A 3T7RA 3OUUA 4ENRA 1F6WA 2B30A 4NVRA 3CVYA 2EG9A 3ZK8A 2JGFA 1UF9A 2AJLI 4I9HA 3JQFA 5AI4A 2F9LA 2XMQA 3FWHA 1MIOB 5FNVB 1GV1A 1JFVA 1E3DA 4G67A 1H94A 4ARVA 1KMHB 4IV0A 4AQ7A 4H2DA 3A28A 1H8ED 3HVUA 4PHHA 1F20A 3FPKA 1GQ2A 2FK7A 2XD9A 4NAUA 4X54A 1H2HA 1E2NA 4OKNA 4BVGA 1O0SA 2B1JA 3O84A 3ZOZA 1AGPA 1ZFNA 3BG5A 5C2JB 1PR0A 3LT1A 3ER9A 3NWOA 2PSJA 1BAPA 3V4PB 2W11A 3I64A 3HRKA 1FTWA 1GPMA 1DBPA 1ADJA 2WWIA 3PQ6A 4QEKA 4FEYA 4CEHA 3IBGA 5HJ2A 3DZDA 3EPJA 2ZRHA 3O5AA 1TUIA 2CSUA 2C4TA 3ND8A 2GX6A 1BYIA 4Q37A 2H85A 3OMXA 4GZ3A 4N3BA 4CIWA 2JIBA 2MJLA 2QS9A 9ABPA 1DBQA 5L40A 4H6XA 5F9MA 4U9UA 3DFFA 5DNWA 2UVPB 2JAWA 1N6OA 3LOQA 4RK0A 2A5LA 3BRCA 2WWGA 1VTKA 3PNMA 1LBEA 4JH0A 2F67A 4D8TA 3CLKA 2AR7A 4KEAA 2WT4A 2QLBA 3IAXA 1SBHA 1L4BA 5A1JA 1XVVA 3FRIA 4B35A 4RF2A 4N9WA 2ABWA 5CA1B 3AYXB 2ODEA 3U4GA 1HOXA 2MSKA 4KDFA 2I6TA 4Z2YA 4GKKB 4MQFA 2IHYA 5E38A 4LHEA 4B6FA 3NHFA 3SF8A 4DDKA 1J20A 1OXUA 4ZYWA 3N7AA 3AB7A 1GGFA 1OFUA 4MYRA 5B4UA 1P6QA 4XGQA 1EDDA 1RFLA 2XF8A 3IYLW 4XR4A 5EKDA 1X15A 1ITZA 3UAZA 1RVV1 4WLNA 3AF3A 1QX4A 2BYTA 2VYVD 1G41A 2WIFA 3WK6A 4BLQA 4M1QA 5E9WA 3KXLA 1N7IA 2C42A 1AM4D 3ZG6A 4XRGA 1EESA 1HDCA 2VF2A 1RI5A 3NIWA 4WCFA 1ETHA 3EZXA 3S1LA 4JT9A 6ABPA 2QZPA 4I66A 3AP1A 1OI4A 4DEYA 4ZVQA 3BWEA 3D6TB 3DAGA 3NDIA 5KDOA 3CT4A 3U44A 3M6FA 1YRLA 1O6ZA 1RS0A 2G08A 1J0AA 3EGXA 4Q3DA 3TMYA 1MJNA 2BLLA 3DEFA 4ZT5A 2G0TA 3UPDA 1Z4PX 1GNQA 1FYDA 1QZ3A 1TCUA 1UBKS 2O50A 3N3AC 4FMBB 4HS4A 4J0IA 4NP6A 4PC1A 4RZXA 3ZYCA 1IBLB 5HZHA 4RZHA 4WY5A 2ZBRA 1QGDA 2C1XA 3GEHA 1O77A 5LIRA 2AJTA 2YHIA 5ELXA 5JDIA 1Z74A 2GNPA 1AGYA 1GNPA 2VTVA 4JBGA 4HDMA 2B20A 4WDQA 2QR3A 4DLBA 4GMDA 1U11A 1ISJA 1CU1A 4N0MA 3SDSA 3WLSA 4KR9A 3VM6A 4Z9YA 5KOIA 3LBAA 4MEAA 2JL1A 4MUIA 4U00A 4TLEA 1WPGA 5ESWA 4FYXA 4BVKA 2EEPA 1FLNA 2L82A 4GBJA 4EI7A 1ONOA 2H2DA 1GQYA 4KXYA 2XCIA 4YRLA 4AJEA 3FYSA 4V38A 5CNJA 2FZ4A 5ARCA 5T4FA 3ZHOA 5BMVF 4FFRA 3ZXXA 2JAPA 1P2DA 4RV5A 1TM2A 3TZ6A 1ORWA 1XDGA 4QXPA 1G7CA 5REQB 2ZSHA 2SICE 3H1BA 5LD2B 3JQGB 2VVTA 2QGZA 1AKVA 3RF7A 1RABA 2ZSDA 2DQZA 2NO7A 4J1NA 3PC8A 3TQFA 3S5UA 5K0EA 3OIWA 4CGZA 4MKGA 1S4QA 3HCDA 3DFUA 4GECA 1W9MA 1Q1NA 1T9HA 1SRRA 1IOZA 1X7GA 1ZM7A 2YNMA 3HJNA 3EXHA 4BO4A 2WPNA 3PCTA 4BQNA 5KSWB 3SNKA 1QORA 3I09A 5DTRA 1EUDA 1BKYA 1V8BA 2PS9A 1LWNA 1X92A 1THTA 4YMLA 4GXQA 1FUEA 3QMMA 2QK4A 3HVHA 4J9VA 4Y2HA 2ZWVA 1YZFA 1GUZA 3ABSB 3GEDA 5FO1A 4CUJA 3MIIA 2J7KA 2IU3A 4R0NA 2E4ZA 3G2MA 4PX2A 3U7EB 4ABYA 3ZQJA 1PSDA 5I7FA 1NOIA 2HA3A 1KQOA 4HZUB 3QPVA 4LWZA 3JQBA 5GJWC 3V4RA 1E5QA 1FPMA 4ML3A 2VRCD 1ZXXA 1E60A 2AEEA 2YX1A 1GNSA 2HV9A 3AR3A 1V4NA 3CF6R 5FQOA 1QH0A 4EGQA 4R2KA 1N2CB 4LXYA 2PLWA 2C07A 2JGNA 2K2WA 2X1VA 3B6JA 3C7DB 3BB1A 1WPRA 3R2JA 4UD6A 3UXHA 2G70A 1V6SA 1NXOA 3JZAA 3P5BA 5TMEA 2XUIA 1U7ZA 3TNJA 2D62A 3VJKA 4HLUA 4ZK2A 3NH6A 1UAAA 1RAEA 1XLTC 3TLJA 4NBSA 1SC9A 1DJPA 2ZE7A 4C6SA 2AKEA 4CUKA 3KQLA 3PCXA 4YAUA 3T6KA 4XWYA 2P41A 3FVWA 1JQLB 2Q8QA 4C4XA 1UOQA 3AEQA 2V8BA 2A56A 4IJMA 3FSEA 3OFVA 2XBMA 2IITA 2QJTA 2AK2A 3KOMA 3NYIA 4WZZA 4XQ0A 1U5BA 1ZK4A 2D1QA 3ZGVA 5FOQA 5L51A 3EAQA 2ZYSA 5EJFA 3MCTA 4DLVA 2JCYA 1HYEA 3ANSA 1DX9A 4IKEA 3WYNA 4RQBA 5LQSA 4DR4B 4QHYA 3QUBA 2W43A 3B1YA 1U8UA 2FWMX 3BCSA 4XDZA 1MA0A 4R71A 2OCIA 1UM8A 2YJGA 2QYHA 3KV3O 3A9SA 4I3FA 5FJJA 9MHTA 1KE2A 2YCBA 1XFDA 1T2UA 3IERA 4BLSA 2PUDA 3PPIA 2FGJA 3QYJA 2VDQB 4QYWA 2JLRA 4LYDA 3AG5A 4AP5A 2PZKA 4I4TB 3EVZA 1EIWA 1VXRA 1YDGA 1L5YA 1VHJA 1EDOA 1QS0A 2Z8YM 3MLEA 2I67A 3SDZA 2ATXA 1HRKA 5CTAA 4LS3A 4OBWA 4ZVLA 1Z13A 4ATNA 3MQ2A 3GRFA 3NBKA 5GM2A 1UJMA 3SHOA 3NKLA 1QGZA 2IH5A 2XZLA 1NNLA 2EW8A 2DHCA 5EKSA 3L1IA 3HG7A 3T9AA 1U1FA 2DLDA 1XCGB 4MEJA 4QASA 3T52A 5FCDA 2HJSA 5JYEA 1KVUA 2R8BA 1B3BA 1RLOA 1V3VA 5ALEA 5HA5A 1P2BA 1NQVA 3LL4A 4IQ4A 1PYDA 4X71A 4LPKA 3T7AA 3H9BA 3MJFA 2O3QA 3IMEA 4GWGA 3HZRA 3QW2A 3CNBA 4X3CA 3HCWA 3F7OA 4PGAA 1Y5IA 1E9CA 1QRAA 4O5OA 1ZD1A 4BNUA 1X87A 4MW1A 5JS2A 1MO2A 1GL6A 1OZ0A 3PL5A 4CMHA 3FVRA 2GLTA 1FJGB 3AIMA 1ONBA 2BFFA 2AFIE 2O2YA 3DZBA 1RZUA 3BXOA 2PV0A 1TADA 2C98A 3F49S 3TH5A 4B85A 3K70C 2G9QA 1EK0A 4TT3D 5AXCA 1MJGM 1X7XA 3RHFA 3YASA 1BRMA 4CFSA 1YZUA 3V8QA 1KP2A 4OXRA 5AQ1A 4IVRA 4Q7EA 3LW8A 3PXAA 5AVVA 2P27A 5CYGA 4U6SA 3FUCA 5JDCC 2QORA 2IPOA 2W2TA 4ZO6A 5DZSA 3FR7A 4ZI5A 3SYRA 3CINA 4WLVA 1MVLA 4A7PA 2GAFA 4UU0A 4IICA 1QIFA 3RYTC 1E99A 2PMWB 2CWDA 4MYDA 2ZYUX 2R11A 5AK5A 3HNRA 4YI3A 3U44B 2JGIA 2VJBA 1U2EA 1F6DA 1CNEA 1YS7A 4M3NA 5HK8A 1PV2A 2JG3A 3KZVA 3SC2A 3G89A 2B8TA 1L6RA 1SU4A 2VT3A 2WVAA 1M1UA 2J45A 3GG9A 1V1MB 1T0HB 3ZE0B 3KFLA 1RRPA 2OAQ1 3HMKA 5K3SA 3S0JA 5KBYA 1I4DD 4MRAA 1RYNA 3IIIA 3TNFA 5EJIA 4XSHA 4BO7A 3GI1A 4YJFA 3F5MA 2J33A 1OJLA 5J40A 2PX5A 3HN7A 3UAOA 4MNTA 3PDIA 2ZQYA 4DR1B 1E7WA 4JI8B 3D6VA 3PE6A 4LYJA 2Z9CA 4GLJA 2OILA 4W6ZA 5KYVA 5DTJA 3QV1A 2PRYA 4DUGA 3VTKA 5IT4A 5KC9A 1F4PA 1U2ZA 4IO1A 1X0VA 2QAJA 2NQ8A 2GPSA 4BMNA 4N0DA 3E8SA 3BBPA 5F7JA 4I0WB 4CM4B 4B45A 2V6MA 4IR7A 4Q19A 1E98A 1FSZA 3AHCA 1V95A 2OHOA 5GIPE 2NXWA 4QBKA 3U39A 3JAKB 4YNBA 4L8VA 3HJAA 1JG2A 1POWA 4WN9B 5DF1A 4L4RA 4JMPA 3HGMA 3WDKA 1OX6A 5E6RA 1X94A 1H2RS 3ZNQA 2GOYA 1MO4A 4V1CI 2HX1A 4E94A 1Q11A 1HNWB 1YJ5A 2KS6A 3OD5A 4LJ7A 3THSA 3EA0A 3KXKA 5HNKA 5CW2A 1ZOSA 5HUHA 1BDHA 1RBYA 3OOYA 2XE6A 4UM7A 1WSDA 3PNLA 2DZDA 4H60A 3UWOA 5DW3A 5GADl 1ZN2A 1YUMA 1VBFA 2I80A 3B6ZA 3TXAA 4RHEA 2VDWB 1HBJA 1WPQA 3AJEA 3AR9A 4CLXA 4J2TA 1XSEA 1E61A 2PMDA 4PR3A 3DDWA 1AU9A 1Y4AE 5LZ2A 4TGLA 3ZNOA 1C50A 2XX3A 1EGHA 2WKQA 3VC1A 4MV7A 3M2TA 4MGHA 1A5AB 2ZR9A 3A58B 3QU9A 1LTKA 1X3LA 4XWKA 3CVWA 2FRVA 1NM5C 1RM0A 1S2NA 4G1CA 1PGPA 3CLSD 4RVFA 3UMBA 3X43A 1OE0A 2FMKA 2II6A 1Y3FE 3UICA 1LI4A 1G6KA 5KKNB 5D1HA 4D9GA 1G5IA 1ZD3A 2EJWA 2PXXA 4KR0A 3RYFA 3BDAA 5JI3E 5BW8A 3EH1A 4OI0A 1EEXB 2OB1A 4J4HA 5J5CA 1H69A 1UK9A 1DWQA 3DTYA 3MCWA 2EWVA 2QE7A 2IVZA 3GJSA 1WWKA 1GT91 1QUEA 4J2HA 3SHQA 1Y3CE 2QSZA 3T38A 4TM8A 4ZI7B 2H7VA 3L6RA 4LBYA 4FUTA 3SQDA 3KRTA 1WCV1 2O3TA 2FWIA 3CRMA 2H9YA 1JEYB 1B1CA 1NNSA 1KF0A 4TUYB 1D6NA 1EX9A 2FVYA 2OMEA 5C8YB 3RK4A 1ECGA 2YRFA 3D6AA 4YIKA 4IYRA 5DGTA 3S1AB 4EQ6B 1MCZA 2IWRA 4EUKA 4ZMSA 4GPD1 1Z06A 1JHOA 1WSBA 1C3OB 1DO0A 1UADA 3NUZA 4GOJA 4RGBA 3CIFA 2AFIA 4O63O 1ZUNB 4EEKA 3OSZA 5C5DA 1ESEA 4KXFB 5DRTA 4CHTA 5I45A 1NYRA 2I2WA 2QN2A 2BM0A 2XCOA 1P2VA 3Q88A 3ZXYA 1AXRA 4FNOA 1Z6PA 1KYZA 4UHHA 4AJOA 1PVOA 3EEQA 2IEAA 4L6AA 4B6EA 1DAOA 1EQAA 2YVUA 2YWRA 3I8SA 3FYCA 3VKWA 3K4PA 4Q66C 2YBEA 3R40A 1L4EA 3FVVA 4LX0A 2P65A 3HDVA 3R6GA 3PF8A 3FHOA 1VE5A 2LVBA 2HPHA 3H2YA 2WOJA 1TKCA 1W0KD 4S04A 3IVXA 1O94A 1TMGE 3IP7A 1OTYA 5EJEA 1C7IA 1H5NA 1IG0A 2F1OA 2IF0A 4FHZA 1EU1A 5TQJA 3S28A 4OLAA 1MHPA 1U3CA 4LOLA 1P31A 1MFPA 1B93A 5K3FB 4AY4A 4KBYA 5ABPA 3TVTA 2P11A 2NUBA 5JY6A 3E18A 3BCHA 5JAQA 2E18A 2R6JA 4DYHA 4RELA 1SC1A 2EJTA 5I7WA 1V37A 1XTUA 3UUGA 1SB8A 3PDCA 5A4MS 1CQXA 2ZYIA 3CRW1 3EASA 4NKRA 4O2LA 1G42A 4GEKA 5A7HA 721PA 1VGRA 4G1VA 4X65B 3PUZA 4ZHSA 3K0CC 3GRVA 1BG6A 4O2RA 3CG0A 4G07A 2R86A 2F7SA 3RUCA 4A5SA 4YV1A 3L7BA 1QQTA 1T1GA 2FU5C 2HMAA 1MXFA 3QMWA 5KYUA 2TS1A 3ZU4A 2JA2A 1V3UA 1Z2NX 4A2QA 2QL7A 2WHPA 2J46A 1WHTA 2H1WA 5CLHA 2GXSA 1HT3A 1YTUA 4U2DA 1QVRA 2O0MA 1ZINA 2A5FA 3QEJA 4A03A 5KYKA 4LRQA 1AHIA 3OIYA 3Q15C 2Q28A 4AAYA 4IHJA 4O3MA 5F2OA 3LJKA 3I92A 3ZU5A 3ASUA 5DGDA 3WWEA 4IJ6A 4UHEA 1MPTA 1K08A 2FFQA 2YXPX 1RWNA 2ZANA 5DYTA 3ZE7A 5A71A 1QJ4A 3UT6A 2HRBA 3MOGA 4LK3A 3C0KA 1ODSA 3F96A 5HMLA 3TECE 1XTVA 4R8KA 4F6CA 1UOEA 2ES4A 1YI1A 1RYEA 2J9XB 1MC5A 3ZV6A 4Z7JA 1ZL0A 1DJQA 1XTQA 1RM3A 5JSKA 3F5DA 4DKJA 1YOBA 1XAIA 1GPNA 2R7KA 2H1CA 4A0RA 2Z6AA 3NP9A 3W8FA 2ZJ3A 3C24A 4IGFA 3WWZA 1GD1O 6REQB 4WCVA 1KH3A 1UP6A 3TQHA 3W3AA 3WIEA 4NBUA 1AKNA 2YN0A 4J7CA 3N2GB 1PQPA 1USUA 3VBEA 4LJRA 2OV3A 1RCTE 2CE2X 2FXVA 3GH1A 1OU4A 1G8JA 1E3SA 5DM1A 5FYQA 4KVGA 1FVHA 4WNCA 2OPHA 1E5DA 3KSMA 1DOAA 3DPUA 3WTBA 1X42A 3JWGA 1Z35A 1Z5PA 4BRZA 4UVEA 3T54A 3ONFA 5HP4A 3WFIA 3DFKA 1RYBA 2J5QA 1SCDA 4YRQA 2FV8A 5BT9A 4BMCA 2VI5A 4WXRA 4KGZA 4DBLE 4DMKA 3F6SA 4AUNA 2QLFA 2Z2ZA 3H17A 1TYBE 3K96A 3NBAA 1XWWA 3NC4A 3R1IA 1GVNB 1RQGA 1O8BA 3PD7A 5IF3A 5H80A 1EIZA 1UC5B 4CZ2A 3EBPA 4GAEA 3FYUB 4MCAA 5B7PA 4DCJA 5AOAA 1K66A 1Z18A 2ONYA 1CERA 1S8NA 1U8YA 3ENQA 2PQ2A 3HP4A 1TF5A 2ZIGA 4RETA 4YJ3B 1GTRA 4HTFA 3UYKA 4RH0A 2SECE 4DS3A 4ZCQA 1R9GA 1KEVA 3DTTA 3R23A 3VOTA 2FPPB 1WP9A 2WUEA 4LOHA 5F1OA 3E3AA 3IP5A 3UEOA 4TYPA 3ZKWB 4JLSA 4LY6A 2VIIA 4JI1B 4CKCA 4UU7A 1CIPA 3LO8A 1VHWA 2WV7A 2ZYHA 4FYVA 1F2TA 1LLCA 5AI0A 3ZEIA 5JAIA 2IIBA 4M54A 4PYLA 3OOJA 4F97A 3LL7A 1Z26A 4ZAVA 2W37A 4FN4A 1X7YA 2W2KB 4AG3A 2QLMA 4OJYA 3MTJA 2INGX 3PUIA 3WHKA 4M9UA 1TYEB 4Z8XA 4UBIA 1CQIB 5JZMA 4X8MA 5DP1A 2P1DA 2I4IA 4R9SA 1Y9AA 2R1ZA 2W6JA 4LV5B 1R0ZA 1DDGA 3NBYC 1Z15A 3AR6A 1HDOA 4OXYA 2OV1A 4BMDA 1WLYA 2VEOA 4O4LA 3VPCA 2P9JA 2JJMA 2J30A 1RJEA 2NU7A 4LNHA 2B35A 4XLZA 1EP2B 1WEHA 5TMDA 1OBVA 2AOVA 4QTYA 1W75A 4G4JA 3U3JA 4ARCA 1JB9A 4MR7A 5JZOA 1NW4A 4EZEA 4IGIA 2H1IA 1E79A 1K4MA 3ZWNA 1NBEA 4TQGA 4KX3A 3EZFA 1JXQA 1IN7A 3RVRA 3SHFA 4FFMA 4G86A 2DAPA 2NYAA 2RCYA 1XA0A 5EC8A 1RJFA 5IC5A 2XHEA 2ILTA 4DXHA 3DULA 1B2LA 3NDPA 4LKOA 3FBWA 3Q7PA 3DS8A 1AXEA 3GW8A 5GVSA 4WESA 5DB4A 3HNPA 2W6JD 4BHTA 1SCBA 4FT2A 4EUSA 1XXHB 3ZWQA 5BUZA 2G25A 5BORA 2WR8A 1SHZA 5JS6A 4R5MA 4B3HA 3FW1A 2CFTA 3WAKA 3BPSA 2BUCA 3VR0A 1UMBA 2V7XA 3R0QA 3LHKA 2OLEA 5CB8A 1UBOS 3SIRA 5J1TB 5DHAA 1N5JA 2IEIA 5E7JA 4QECA 4WKPA 2BKAA 3UQYS 2FG6C 2QUJA 3PA8A 2JAOA 1UT5A 4ZYTA 1KMNA 3ST7A 1A82A 2PKYX 4G0NA 4I46A 1U3WA 4RFVA 3CRQA 2YMMA 2F59A 3JALB 4JEIA 3IDFA 2IBTA 4DIKA 4GYYA 2P4UA 1QNLA 4J7XA 5FBKA 1W34A 1XEXB 3FTNA 3MRTA 1IUOA 4ENQA 5BSGA 3ZS8A 3GT4A 5J4LA 4QGBA 1E6CA 1FDIA 3CNHA 4FD2A 3NFRA 3FM9A 4WIAA 1MJHA 1DG9A 2R1TA 1AQLA 5F1PA 5DBHX 4YRBA 1UUFA 3OKFA 2C7BA 5G3ZA 2JAQA 1OYVA 1A04A 1FEZA 4RFSA 5C46F 2HEGA 1RRGA 2YKGA 5M34A 1TU4A 3KPVA 1N8TA 2YXLA 2Z09A 4BE7B 1IAQA 2QG4A 2QPTA 3NIFB 1GNTA 1VP3A 5F2KA 3H9GA 3P9CA 4QEZA 3S2GA 3PFHA 3OA0A 3PXGA 2W6MA 4FGZA 4H08A 5D5QA 3ROZA 1OW3B 4CKEB 2R8OA 2Q5OA 1BVUA 1XJQA 2OFOA 3N0WA 1A72A 4IWXA 4JLJA 4L4XA 3PQ3A 4WXPA 1TD1A 1ABFA 4CT5A 4LMAA 3LY7A 5AKKA 4BX9A 4FK8A 1EA5A 1ZYUA 2Q9CA 2R6DA 4A91A 4G1UC 5IJ0A 3VPHA 2BUAA 2O3JA 3O2SB 2IDJA 2YCLA 4MI6A 2PAFA 1K8ZB 2QQEA 3QFRA 3LRTA 1USKA 2XNDD 5DVZA 4C76A 2Y71A 1S3GA 3C8MA 1E1KA 2EIHA 2G1AA 2D0IA 2O48X 3WP1B 4M1ZA 4NDNE 2V4UA 2ZRCA 4LC9A 1G8KA 1DV1A 2F3SA 2DULA 2WKWA 4IDPA 1IZ8A 1G98A 1OI2A 3LGAA 4JL5A 5F3DA 3UG7A 4BLPA 5CFOA 5JHGB 5KYYA 5JU6A 3VKGA 3ZZMA 2D5BA 4IH4A 3E6AA 4MRPA 1D2EA 1U9CA 3PYXA 4N6NA 4D4JA 4O08A 5K3EA 2C7PA 2ZUVA 4RVHA 2GI4A 1DBSA 1ODJA 3DFMA 3FMFA 1E2MA 1F12A 3WB9A 3C8DA 5C51B 2VNJA 2H4JA 2I99A 2JFNA 1XA3A 3KTAB 5ALTA 4F3TA 3C3PA 4I4IA 4EG1A 3KZMA 1Z0SA 3ROEA 4RMIA 1BX3A 2IUTA 2IUFA 3HU2A 1TAGA 3OLZA 2P3QA 4FW8A 4P7BA 4FZ5A 4MVJI 4Y1RB 2QP4A 4LYGA 3MLAA 3VR4D 4MS1B 5IN5A 3TCXB 4G81A 1L6IA 4DNPA 5L7WA 2AEFA 1N2IA 1DXOA 3OQ1A 5EY5B 2Y6UA 1P9NA 4KIJA 1KAOA 2Q6KA 3G1WA 2VSFA 1G3QA 1G21E 1DKLA 3RH0A 2VDLB 2VF7A 2OBMA 3QWFA 4DBVO 1GCIA 3CZAA 5B58C 1O5TA 1ZRHA 3NP7A 4D8VA 3UPUA 4F1JA 5DBIA 3C6QA 4D7AA 4FGLA 3T0GA 4BZQA 1KOFA 3GAZA 2H4ZA 3EQ9A 3R0JA 2HLDD 4R8VA 1R37A 5IFKA 3K73O 3ILXA 4BLOA 1PEKE 1N5RA 1DAPA 4TPKA 4O4LF 3PUVA 4JOCA 1SBQA 4I1VA 4NONA 4EATA 4CEHB 4C3UA 4A0FA 4M6WA 1KNXA 2JGEA 2P6OA 4U8GA 1DJOA 2REOA 3COWA 1VSVA 3IUSA 2ZTMA 4EH1A 4CM8A 4TMKA 3FMGA 3ONVA 1ENZA 5BWCA 3MFQA 4ZK6A 4M9QA 3AMVA 2ZAOA 3CUKA 4G4SP 4W8HA 5EWLA 1E9RA 1D2AA 4R8SA 2PFGA 2Q4RA 1NRWA 3F3SA 3GNSA 2PUBA 3S2IA 1XBTA 4DJ5X 2OO7A 2EG5A 1GM5A 4M0MA 2Y1CA 1YQWA 3DZJA 4JJFA 1OIVA 1DQRA 4DQLA 5B7NA 3HY3A 4X8HA 3ECCA 4FOTA 3GVIA 2Q5IA 4L5CA 5A9RA 2PL5A 5ESXA 4XYMA 4KLRA 3SF8B 3SMQA 3K0AA 4LZLA 2NYVA 2I2DA 3E22A 4HH0A 4YO8A 3ZW9A 4QM6A 5G4KA 1W88B 1MHTA 2E4UA 3BDIA 1YUNA 2CNOA 3OZDA 4FOLA 2HWUA 4RABA 3TQIA 2R8ZA 1FSSA 3ZNNA 2VTEA 4D98A 5KHAA 4QRHA 4HJXA 1FC0A 4MHOA 3U1VA 1FMFA 2MTBA 4ZGWA 2O1WA 3A04A 4EJ6A 2WJJA 5A0VA 3AVTA 3PGKA 5JWOA 2RHWA 1QDUA 3D6UA 4KOAA 5K8VA 3UMCA 1SC3A 2ZWPA 4TM7A 3LD9A 3VO2A 4CQMA 4DXAA 2WT9A 4Q34A 4KO8A 5BV0A 4L7QA 4NFSA 5E7IA 4MROA 3RUPA 3O7WA 1IHXA 4FT4A 1PNQA 5J47A 5K03A 1YD7A 1REQA 3LUGA 2C5LA 2TYSB 3EGXB 3NETA 4RLQA 5AUNB 3BEDA 3HJCA 2V7BA 4MW2A 4FBGA 4KN6A 3VVMA 4DIBA 3NTVA 4IIHA 4YAJA 2X41A 1QZZA 2CJXA 2Y2VA 2H5LA 3M6WA 2I9PA 1CUVA 4KPEC 3UGTA 1CY0A 1U3FA 2G07A 1UDRA 1LW6E 3PG5A 4DNXA 4N3CA 4YCSA 5LOVA 3K16A 2YQ4A 3DZIA 3OZIA 4N7BA 4LSGA 2ZZMA 1CS0A 2YHIB 4TTTS 5TE9A 3D6NB 3LFUA 2Q3LA 3L05A 1NL3A 3CW9A 3D0RA 3I53A 2ZAIA 4HDMB 4IF4A 5GMOA 1CZRA 3QJ5A 3REOA 4CQMD 4KR3A 1B8VA 2OCPA 4Q00A 3D4BA 4L07A 1NMQA 2VYQA 3GJ4A 1RWOA 2PG3A 4F96A 5KU7A 4KQWA 3HVJA 5KYXA 5FUQA 1G7TA 1PJQA 3L6EA 4NENB 4WJKB 4WOJA 4UQPA 1V0JA 4P33A 1UWVA 1YB1A 3IAS1 3MD0A 3RVKA 2XT0A 1RWMA 2GTPA 3ZVNA 3D02A 4C30A 5K5EA 2A9KA 1JJIA 2NTJA 2J32A 1FUYB 3ISVA 4BUJA 4DNFA 1SNYA 3L7LA 1ILWA 1WW2A 2BI7A 1P1HA 2OUIA 2GRJA 1NIPA 1AF4A 3BL8A 2Y1DA 1NVXQ 2NUAA 3UOWA 3RR2A 2XZTA 3F1KA 5AJUA 8GPBA 5IJZA 4UCQA 3DXFA 4K86A 1Z33A 3OLVA 2QVLA 2N47A 3KUXA 2XYQA 1N1EA 4RIGA 4W1QA 2XB6A 1EUDB 1SQFA 4ILEA 3RREA 3TXXA 2NADA 2Z2XA 3L6CA 3L77A 5AOCA 1FLAA 5H59A 1O9BA 1TMYA 2HMWA 2JFFA 3SM3A 5I8WA 4BO8A 4IIEA 4AB1A 3CRZA 1E7QA 1G21A 1HL7A 4OFWA 4WLFA 1DAMA 1DKRA 1PJRA 1HKHA 1YULA 1OV4A 3QG1A 3EHEA 3PGJA 2E2WA 4G6ZA 4UBKA 2XW6A 3B7WA 3R77A 4NK4A 1I3MA 2Q5CA 3KFVA 1T9CA 3OJOA 3HA7A 3S4YA 4YRRA 1KMQA 3M6LA 2GBLC 1HLGA 3CEAA 2RHOA 4RGYA 1IHDA 3BGDA 2EBWA 3DP7A 3LNCA 2V6IA 1U7WA 1B0ZA 1X77A 2B5VA 1R3DA 3BSYA 4GKBA 1Y3HA 3TLXA 1XZNA 5TEVA 4Q4LA 1PBNA 3AHGA 3K2QA 1XMOB 4A4DA 5MN4A 1KYYA 1BU8A 1H6BA 4Z4FA 1DRUA 1TM1E 2W48A 4X20B 1IBKB 1C1XA 3TL2A 3LT4A 2WYOA 4DWJA 1CB0A 3UV6A 1E89A 3ZD7A 2ZIZA 2ZVPX 5AXDA 2IIQA 2DJ5A 1W1UA 4BVEA 2QROA 2ZU6A 3K1TA 3AEQB 3AEKB 3UB4A 2YV4A 4KQIA 3BRSA 4QZVA 5HQ3B 3AL0C 2DR2A 4ZVNA 4LZPA 1XLTA 2BR5A 1G5TA 4KK3A 2NT4A 1ZC4A 1VMKA 4PICA 3EB9A 5M29A 4E1AA 1NFQA 2F4NA 1CUBA 1OVMA 3R0IA 4TX1A 5DMXA 3DVSX 5JCJA 1Y48E 2NGRA 4W8GA 3C98A 3DEZA 3L8CA 4M9ZA 5F23A 1DIAA 1ZNYA 5BSWA 3VUFA 1GTG1 1NDUA 3OU2A 4DDTA 1KDTA 3ZPXA 1HG1A 2E37A 2V7QA 1CEQA 1Q6YA 2ZSFA 4UMVA 1D0IA 3ZE6A 3E5MA 3FPSA 4BTLA 2YV1A 2WVJA 1U99A 4LC0A 3Q10A 2Y3IA 1U5AA 3Q9NA 2WM2A 4C43A 2K7FA 5TVGA 2DUWA 4D4KA 1MX3A 2R8RA 2VTBB 4RZQA 4I4TF 2G6BA 4MVJG 3L18A 5IVKA 4CUZA 3IJRA 2RHDA 5EMJA 3R5KA 1GQOA 2GT1A 3A6FA 4D8WA 1JHMA 3ME5A 4DC0A 4RO0A 5JCJD 1F3LA 2NUTA 2QAGB 2PKQP 4X00A 3N0XA 1GZHB 2DY0A 4UTOA 4C0BA 1U94A 3RSFA 4X94A 2V7QD 3MN1A 5KVVA 2Q45A 2R44A 3OTHA 1TQDA 5K2MA 1T6BY 3P0JA 3A4TA 1H8HA 5IKXA 3CWCA 1M76A 2ZRDA 1KEZA 2JLZA 4WY2A 3OJ0A 1Y34E 4DT1A 5FDFA 1RKBA 2J0VA 4PIVA 4DG8A 4YDQA 3NC1C 3Q3IA 1IN5A 4KYUA 4N0EA 4IS2A 4O02B 5EXXA 2QTAA 2P0AA 5JATA 2ANBA 1L7VC 4W4TA 1FCJA 1D2CA 1W581 1X7XB 2JRLA 4QYTA 4D41A 1GRNA 5BQ3A 1R6BX 4ZV9A 4GYWA 5K3BA 2D13A 1E2HA 5A04A 3BF7A 5G1PA 5BP7A 3FWYA 5HILA 4AURA 4YCAA 3U49A 2VJCA 4LYHA 5TR9A 4WUVA 1ICEA 2EAUA 3WMFA 3ZE9A 1N7HA 3HXPA 5GVRA 1Z68A 1PZFA 3EGOA 3N05A 3NV7A 5JDCA 1WO8A 2FJ0A 3FNQA 4D74A 3NPAA 3HB1A 3GLIE 3PJFA 1YHYA 1B8UA 2QI9C 4CQNA 1QVZA 3FKSD 1ZH0A 3KFXA 3SC2B 4H0CA 2IU4A 4D57A 1A5TA 4P31A 1RXCA 3EFHA 3WP0A 1T5IA 1M33A 5IWCA 2DWCA 2B2NA 1K7XB 4B6PA 2OVBA 2GXQA 3ESBA 4JYCA 3LX6A 4C06A 3NJRA 5EJ4A 5ALQA 4JSYA 2EWWA 2O7SA 4JOBA 4MAMA 4Q9JA 3CVVA 1VJ0A 2GPNA 2TMYA 4KQ1A 1ID8A 5DBEX 1P45A 2XUPA 4HNSA 5ER6A 2C3PA 1NWCA 3PDIB 5FWNA 2XTNA 2WP8J 5HKKD 3WIDA 1H5UA 3A4LA 3PPYA 3R3SA 3A6ZA 2DPXA 1W85A 5J2UF 1N2JA 1KO1A 3IKMB 5FD8A 4CL0A 2HJGA 1K3UB 5FHQA 1K7FB 1BE6A 1L5HB 3HBJA 5EMNA 5KOJB 2DHDA 1J2TA 2V7WA 3SG0A 1AUXA 1JEOA 2PUVA 2C3UA 3ZI0A 4P2GA 4EKIA 3JD1A 4INOA 1YS2X 3L79A 5DNCA 1WB5A 4QQRA 1P62B 4NX2A 4W63A 4DV6B 4KV7A 1HYGA 5ADHA 3GP5A 2B25A 1UBGA 1ACMA 4RMGA 2F55A 2CMKA 3C8HA 1IMOA 1Z7YA 5D3MA 2Z2KA 5KQLA 1N36B 1GZSA 1W44A 3DMGA 3NBQA 1R5NA 1T5SA 1NP6A 5F77A 4F9GA 1KDPA 3P52A 1A4IA 2OCLA 3GPCA 3HCRA 3FNGA 4EX7A 3PD0A 3IOCA 3KWLA 3D3NA 1YTLA 1G8HA 3AEUA 3D2CA 3VYWA 1P7WA 2C2HA 2UYOA 1JEDA 2C31A 4QFMA 1V5IA 5ALNA 3M34A 4B5LA 5MHTA 1BQ3A 2BFWA 3NV9A 5AHRA 4YUZA 4D25A 1P5ZB 1QE0A 2VWQA 3OTIA 4MKHA 1LBSA 1PYGA 1Z38A 3N3BC 4P3YA 4ZAYA 4A6XA 4FWTA 4WZAE 3NRBA 3GPBA 3DAPA 5CLLA 3EVAA 3F7MA 4HEJA 1P2SA 2JI7A 1N5IA 3TRIA 2ACVA 4H7KA 1N2HA 2ZUEA 3MAJA 4QYMA 2GESA 2XYPA 4LF6B 2FPLA 1O7JA 2DHQA 2V55B 3W04A 3NMUF 3DKIA 4FGJA 1MFZA 4GOOD 3MMPA 1J2JA 1JEQA 2WD7A 5AM4A 3OY2A 3RS0A 5C7IO 2WHEA 1RKVA 4BGEA 4S0ZA 1G8FA 2FOLA 5KWVA 3W34A 2R87A 3GJXC 3M5DA 3PKIA 4J94A 4FBLA 2XMBA 2QZ4A 2VK4A 1ECPA 3CF0A 4HI0E 4XR9A 4D4LA 1SURA 5AKHA 4D9NA 4MCJA 4NNJA 1KYTA 5DJ5A 2CKDA 3QU2A 4DQVA 1NM5A 3IEUA 3UH0A 4IMJB 4L73A 2OM6A 1KGSA 1KWKA 1JWAB 3QUCA 2Z6UA 5IKOA 3WNZA 3I76A 3BIWA 5BT8A 3FGNA 3R5HA 5L6MB 1SVMA 3OQNA 2C84A 5JNWA 5IXJA 1QO7A 4DCNA 3T9FA 1SA0A 4DSZA 3L8ZA 2XAUA 3BWDD 4JLMA 3QUSA 4N8EA 2FN8A 4EECA 1I1QB 3MQ4A 3CX4A 1ZD8A 2ONZA 1K98A 3ROFA 2C4UA 2DPYA 3OECA 3E5HA 1PYOA 1TUEA 2IHBA 4JR1A 4TV9A 2QN8A 1QO9A 2H0AA 2BGJA 2C2MA 2WIAA 3FCOA 4EYQA 1JG3A 4M1OA 4WECA 4F06A 4ARSA 4ZIRB 1H1DA 1HEIA 3CZQA 3CFFL 4MUNA 3EEOA 5EXCA 3TQSA 1QH1A 3NRJA 1BMFA 2HADA 3RJTA 2ZM6B 5CDUA 3GRKA 1UKYA 2B2CA 3L7IA 3BHNA 4UQOA 2ODQA 2Y27A 4BEVA 5IHXA 1RC8A 1QPZA 2JS7A 3E7FA 1IJKA 2BF7A 4UHBA 3CC8A 2BBOA 5I8PA 1JR4A 1ST2A 3GLIA 3K92A 2YXEA 4KLAA 1E6UA 3S1SA 3C5WP 4LSMA 3EULA 4KUGA 3O8DA 2HNBA 3R5TA 4LRXA 3UUEA 3EG5A 3H2GA 1KDZA 3A6GA 4V24A 1IVNA 2EFHB 2JLQA 4TYNA 1F8XA 4JKOA 1SHJA 4ZYVA 1OIWA 2HCBA 1MJ5A 2K4MA 3HPQA 1NRJB 1XF9A 3HJTA 1AOXA 3MAGA 4NY1A 1X1BA 4WACA 4V3BA 4GU5A 4Z0HO 3LOUA 4MQBA 2WU4A 2C7OA 3JPYA 1I7QB 5BQXA 1GZVA 1W93A 1WDWB 2VAWA 3NEJA 4BE9A 2DQKA 3ZHBA 1XZQA 4O1HA 1EAYA 3UMRA 3WYEA 3ISTA 1A4XA 1IRXA 3FZNA 5L7YA 4HYYA 1A8SA 1E1YA 2O0LA 3ENZA 3HBFA 3JYPA 4G9EA 5AJTA 4EL0A 3HH8A 3GOHA 1HYQA 3T1YB 4TLCA 4R40A 3T15A 5F2NA 3PQEA 5HZGA 2VAVA 2Q4BA 3IA2A 1X13A 1W48A 1E69A 1HORA 2XWSA 3Q5DA 4GGOA 4ZI3A 2ZATA 4A2PA 1H85A 1LZKA 3F8SA 2WM9B 4GM0A 3GYBA 2JFUA 5IH7A 4US1R 2ZI6A 1B6TA 1K7CA 3MTBA 1N9GB 3AUKA 3K0CA 4JYBA 5E6UB 3DMPA 5AW8A 1CUYA 1KAMA 2PPLA 5G53C 3VFDA 4ACAA 4MMZB 5IG2A 1C1DB 3OZRA 1KJ9A 2H2AA 1UL1X 3KJGA 5KCMA 5A62A 3AM1A 2VUIB 2GD1O 3OTQA 1PVVA 2C9ZA 5AUPB 4JP5A 4RL6A 1DKUA 3W5VA 3MJTA 2JA1A 4A9AA 2O8BB 5AJYA 3WGVA 4RTNA 4NK5A 2GEJA 3U81A 1SD5A 3D7LA 1R4MA 1JSZA 4KGDA 4D8YA 4MWSA 3DEJA 1Z5GA 3FF1A 4HFMA 1GPKA 4O4JA 1D2NA 1PSZA 8MHTA 1PNOA 4WZAA 5IDVA 3AR8A 4DR6B 2I7TA 3U37A 1Z8HA 2CCJA 3JPWA 3QMPA 1XEAA 1VLMA 2KSQA 2RSLA 4QOGA 1IXSB 1ZDMA 4KMOA 4JP8A 2ZWOA 2D5AA 5LXTA 3GZNA 1VC2A 2PEZA 2Q5QA 3BUSA 4OKSA 4FBMA 5LN1A 4IQFA 2CEKA 4OM8A 1SCKA 4XDYA 3D54D 1SCAA 3PI7A 2ORED 1XEFA 4DCCA 3R3JA 3ICPA 4MYHA 1L8LA 1GPYA 4FVTA 4MUYA 4B4UA 4C7BA 3BXEA 3CXRA 1DAGA 1CUZA 3F5SA 1Z6XA 2XODA 4X3PA 4UOQA 1PL6A 3FPCA 4XX1A 4EFDA 1PFWA 4YUWA 4EHNA 5FWYB 4IDGA 1EFLA 3CUWA 1MMFB 3HY4A 1GITA 1XPJA 4IRUB 3WLPA 1ZH4A 4IDQA 1QV7A 4CIDA 1ZVJA 4B5KA 621PA 4C4AA 4DCUA 4I08A 3TW8A 2FW7A 1FDWA 2PGOA 3IT3A 5EHZA 2I7CA 5JS1A 3CNEA 2D4AA 2JLXA 4P0QB 4OYYA 4HVAA 3PQCA 2IEGA 1X1EA 2GS9A 3EGEA 2B4YA 4AJ1A 4RQTA 2YXBA 3PS9A 1V4VA 2WTAA 4BB6A 1EQ2A 1ZHOA 1KGDA 3KB8A 5K2OA 4KRXA 2G63A 1QSGA 1Y33E 4KN5A 2ADOA 5SV2A 4JITA 4LN1A 3ZR4B 1XU7A 2AD5A 2CW5A 3JVVA 3RGWS 4CMIA 2G40A 3C70A 3DWEX 2VJNA 3W7AA 3D3WA 3H75A 4C6HA 1KTIA 3G9QA 1C7RA 1WXQA 1I0LA 3ORFA 4INAA 5LA6A 1AUOA 4CKCB 1CG6A 1S2MA 3UK1A 3VU1A 1Q50A 1RZ3A 2DWQA 3LOPA 2J3HA 1HQYE 3MPUA 5IKMA 1QK3A 3PX7A 2GR7A 4TV9F 4X7MA 1NULA 3CRVA 2WILA 3L7KA 1S1CA 3LSYA 2VF5X 4EX6A 1NU6A 3X2EA 2GD0A 1NFFA 2PBZA 3QK7A 4HAZA 3DFIA 4IGEA 3R4CA 4CKYA 1Q1BA 4D9MA 4EGAA 3Q87B 1CR0A 4ZO4A 2C03A 1GTL1 1WLSA 2X77A 2V0NA 4KQGA 4EEXA 3P2OA 5K4HA 4A2WA 1FRVA 4M99A 4FXPA 2GKOA 1CY1A 3WTCA 2AB0A 3EXAA 5BVGA 4E5YA 1FXSA 3O3NB 1QTIA 3CI0I 4MR7B 1FP4B 2CC2A 4MIOA 1UFRA 2FWBA 1XAHA 1XMPA 2P69A 4RMHA 4UUOA 3SNHA 3R9WA 1QQ5A 5IT9A 3COYA 4H0FA 1H42A 1OKKA 3ACDA 3IGFA 5KDLA 3KR2A 4RSRA 4UREA 3CISA 3ECAA 4RY2A 1T36A 1I2BA 2HA0A 3TOXA 3L6DA 5JD4A 3BYZA 2P1RA 3BL5A 4NPHA 4OP3A 8ADHA 1RLUA 4NHEA 3SZRA 4AMGA 2FQWA 2X2PA 4GMGA 2VQSA 1DBWA 1UQTA 5G0UA 1ZNZA 2IXBA 1RHJA 4WESB 3W9BA 1EFCA 4OSPA 5NLLA 4TYQA 4DMMA 3IV9A 1TEHA 3FCSB 1GKIA 5G4LA 4ODIA 1W29A 4I6EA 4MRMB 1EZZA 3KHSA 3PVCA 3VOBA 1BS9A 3U4IA 4DTCA 1XYGA 1Z6YA 2RIRA 2YUIA 3LPMA 2LIPA 4MZDA 4S05A 1G9TA 1NE7A 1ZAYA 3EARA 5LUAA 3OFSA 2EZ9A 4MJLA 1TEZA 2IPXA 1OKKD 2IX3A 3G0OA 1ECCA 2C00A 4UKDA 3K8YA 4KPGA 1PS8A 5B2EA 2AZXA 3LW7A 4ZREA 1YCFA 1XAGA 3DF7A 3DKRA 2HPZA 4HLNA 4KQKA 3JRWA 4M0LA 5DIZA 3R7LA 1VMEA