4MUIA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-methoxyphenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
283
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 95
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muiA01
3DPIA 4Q93A 3FIUA 2J5BA 4MAFA 1PFVA 1J21A 1WKBA 2DUMA 1O95D 4TS1A 2QJTA 1QRUA 1K97A 1X6VA 4EG5A 1YIDA 2NSYA 3NBKA 3COWA 5BNZA 2DR2A 1U7DA 2CYBA 1KP2A 1JGTA 1KH3A 2A7XA 4E1AA 1I6LA 4MVXA 3JXEA 1M8FA 3GMIA 1OBCA 3L93A 1F7UA 4MLPA 1QTQA 3KT6A 4PBSA 1I6KA 3X1KA 4R2LA 4DDKA 1COZA 1M8JA 1QU2A 4QBTA 1H3NA 3VRHA 1KP3A 4MW7A 2XRYA 3FWKA 4JXXA 1G59A 4YP6A 1T6XA 1NUPA 1JZSA 4JZYA 2O5RA 3CVVA 4KR7A 1UFVA 4ZCQA 1GAXA 2JA2A 3CLTC 3IDFA 4NAUA 5H7XA 3ZJUA 1J20A 2BYTA 2DXIA 5HUHA 2E0IA 4MUIA 1XNGA 2BTEA 3ND7A 2TS1A 3HGMA 3D6UA 1ZUNA 1VBKA 2YY5A 2JAXA 3S3TA 1EFVB 2H29A 3SP1A 4I6JA 2GM3A 3QTTA 4HPWA 3MMXA 4J75A 1WZ2A 1XNHA 1EUYA 3D6VA 1PFYA 2ZUFA 1R6UA 2CSXA 1NI5A 1N2GA 5FO1A 1KQOA 1F7VA 3VGJA 4ARCA 4ZT4A 4EG4A 1EFPB 3FNRA 4DJAA 3N2YA 3ZGZA 2RE8A 1WY5A 2DLCX 4L2IA 1N2EA 1S4MA 3CLSD 1GZUA 3RJZA 3TS1A 1D2RA 1OBHA 4BWVA 1QQTA 3P52A 2E18A 3K32A 1NZJA 5H16A 1M8KA 2QUKA 3FDXA 4RPIA 4X0EA 1K92A 1T9GR 1IFXA 2V0GA 4DNXA 1QJCA 4EFKA 3X1JA 3IODA 2HMAA 2CV1A 4K03A 5AHWA 2CT8A 4DDMA 1OWNA 2XRZA 2X3FA 4MWCA 3I05A 4H3SA 4WSOA 3ZUGA 3IOEA 4K0RA 4U8HA 4CT0A 2VTBB 4NATA 1WXFA 2H2AA 1T6ZA 1KKUA 1KH2A 1QRTA 1OWMA 4NZPA 1YIAA 1NYLA 4PY2A 4DLPA 4MWEA 1KAMA 4EG1A 4YP5A 4A91A 2QTRA 3UOWA 1U3CA 1O94D 3TNJA 3QE4A 1WQ3A 1O5TA 4MW5A 4F4HA 1NUTA 4KPUA 3MLBA 2CV2A 1EUQA 1MB9A 5LFAA 1WXHA 3CLRD 1YI8A 3ND6A 3SZ3A 1LW7A 5J5AA 1N2JA 4G5FA 1GLNA 4MULA 2QTNA 1IH8A 3FG9A 4YBRA 2EJCA 3H97A 1R6TA 1IQUA 2Z08A 5DEOA 4R0NA 3A04A 1TYAE 3C8ZA 3CVXA 3NV7A 5JBNA 1WXEA 1MBZA 3IUBA 1R6XA 4DE5A 1JEDA 3IVXA 4UZEA 3CR8A 2B7LA 3INNA 4ND7A 3ZXIA 3N9IA 1JEEA 1QU3A 1VLHA 1TEZA 2AZXA 1N77A 2E21A 5KCMA 3CLUC 1O97C 3FY4A 3G5AA 3AFHA 1WOYA 1O0CA 3COVA 2V0CA 3IH5A 1J09A 1NUSA 1EFPA 1HYBA 3K9WA 3OTWA 1MAWA 4GRIA 4XFDA 2J4DA 3P0HA 3TQIA 1U0BB 1N78A 3E27A 4JYZA 1CT9A 1JIJA 2PIDA 4MUFA 4R2MA 4GU5A 3RBAA 3PNYA 1XJQA 2OQ2A 4OUDB 5K0TA 1I2DA 3CVUA 1QRSA 5DB4A 3H9BA 2IELA 2GKSA 3PXUA 1PG2A 4ZCPA 4MWDA 3ILVA 3PNVA 5TEWA 3FHJA 4CDNA 5KWVA 2D54A 4U63A 4MUEA 3AKZA 5K0SA 3CLRC 3SYTA 2VXOA 5J59A 2X1MA 2PZBA 4EGAA 3CLUD 2RD2A 2D5BA 4HJXA 2AKEA 4MVYA 3ZXSA 1MB2A 1ZH0A 4OJMX 2DERA 1G8FA 2D13A 4I6EA 2QTMA 1H3FA 1V47A 5LM3A 1FFYA 4U7JA 1K4MA 1N2IA 4CDMA 4KPUB 3LCJA 3A05A 1OWLA 3A4IA 2QUHA 1KH1A 1U7XA 1X8XA 3IOCA 1TYBE 3X1MA 1ZJWA 4AQ7A 2A1TS 3HL4A 1SURA 3IMEA 3KT0A 4G5YA 1K4KA 3N05A 1N1DA 4ZCTA 1TFUA 2CV0A 2WQ7A 2IP1A 1EE1A 2VTBA 3N8HA 1IQ0A 5KHAA 1QNFA 1T9GS 5TEVA 3SZGA 2PG3A 1Q11A 2R5WA 5IHXA 4MVWA 1GN8A 5FNZA 2JANA 4KKVA 3CLSC 1GPMA 1PG0A 4MW4A 2WQ6A 1Y42X 1YULA 2QJFA 3KFLA 3UY4A 2Z09A 2A84A 3DV2A 2I1LA 1VL2A 1BS2A 1MJHA 4EG8A 1KQNA 1M8PA 2YWBA 1WJGA 4ZT7A 3SDBA 1O96A 3HMQA 1B6TA 3QTBA 4MVCA 4ARIA 1A8HA 1O6BA 1ULHA 4UZFA 1MOPA 4MUGA 3COYA 1ZH6A 1VBMA 2CYAA 4ZT5A 5LLTA 2QJOA 2J08A 3H99A 1YUNA 1TYDE 3MUEA 1JZQA 1LI5A 3RFFA 1J70A 1ILEA 4MUHA 1N2HA 4EF6A 1NSYA 4ZT3A 2YWCA 5TGTA 3Q10A 3FETA 1WQ4A 4FZJA 2Z3VA 5HG0A 1T6YA 1OWOA 1KAQA 4XFJA 3IVCA 1IVSA 2C5SA 3TZEA 1GTSA 4ZCRA 1Q15A 4KR9A 4CQNA 3H05A 1MC1A 1V8FA 2PXHA 4NDAA 1EJ2A 3KT3A 3SEZA 3F3MA 2HZ7A 4ND6A 2YXNA 4ZT2A 3CA8A 1JHDA 2G36A 1MRZA 2A1UA 4MQ6A 2PZ8A 1FYDA 1O94C 3HFJA 4PBTA 5J58A 4S1OA 1U3DA 4DDHA 4YP7A 5TS2A 1JIKA 4HK4A 1KR2A 3Q4GA 2QUIA 3TQOA 3MLAA 1OWPA 3ZJTA 3PNBA 2A4MA 2A88A 1IHOA 2PFSA 4L2IB 1KQPA 3KT8A 1JECA 4EG6A 1G8GA 4JFAA 2X1LA 4NAHA 3IMCA 3UMVA 1M83A 4MW6A 4MW9A 1IRXA 2DETA 4F3RA 4HJRA 4MUJA 1OD6A 1P7PA 3CLTD 3SEQA 1NUQA 2QUJA 2ZP1A 4RUKA 1O96B 1EFVA 3G59A 2ZUEA 1N2OA 3IVGA 4G6ZA 3DO8A 3HV0A 3M5WA 1PFWA 2CFOA 2E89A 3FH0A 1NP7A 1Q77A 3RHSA 3AL0C 3AG6A 1NUUA 5IJXA 4MW1A 1O95C 2WSIA 1RQGA 2DEUA 3ISJA 2J09A 4PBRA 5DASA 1O0BA 2IJGX 3LOQA 3COZA 4MW0A 3H9CA 3UC5A 1NURA 1PFUA 4OUDA 4XSVA 2AG6A 3RK0A 3IMGA 2X0KA 1WXGA 4NX2A 3G6KA 2A1TR 3CVYA 1KORA 1H1TA 3GLVA 4EG3A 1M8GA 1N75A 1G8HA 1JMVA 2J07A 3LE8A 1GTRA 1N2BA 1JILA 3BL5A 5FO0A 2A1UB 2A86A 3U1VA 4YMIA 2CYCA 2GOYA 5EKDA 4I6GA 4MWBA 3IUEA 3NBAA 3AIIA 4ZCSA 1XNJA 1TYCA 2HGZA 4P2BA 3MXTA 1MAUA 1Q19A 3ELBA 1I6MA 1EXDA 1H3EA 2OV4A 3P0IA 1F9AA 1N3LA 1WXIA 4JXZA 3HZRA 4MW2A 2PZAA 2O8VA 4KR6A 2DPLA 3PRHA 3ZJVA 3L92A 4MUKA 3IOBA 4QRDA 1LI7A 3UK2A 1YUMA 2NZ2A 3TZLA 1J1UA 1JIIA 4ZT6A 1J1ZA 4Q16A 5DK4A 3FI0A 1DNPA 3Q12A 3ND5A 1M1ZA 1F4LA 3RK1A 3OP1A 1VBNA 3ZIUA 3DLAA 3CVWA 4QREA 2EL7A 3AG5A 2WB2A 3VU8A 1TQ8A 3P0JA 4WNYA 4J76A 4AS1A 4EG7A 1IQRA 3FOCA 3GUZA 5F23A 1O97D 4MUNA 3A2KA 5HUJA 2CUZA
chains in the Genus database with same CATH superfamily
3QVLA 3UPUA 1GPDG 4LF9B 1RIIA 1X86B 1IAVA 3B8EA 1OX5A 3BIJA 1WKBA 3KVOA 1TF7A 1OXBB 2QD4A 2LE0A 1MEEA 3DJYA 3EQ6A 2RAUA 4JYCA 4E09A 5JNUA 3LC7O 1N5JA 1O77A 3PFCA 4HQOA 4HRYA 2NV2B 1Z7EA 2VR1A 2BZGA 4Q00A 3ORHA 2PWPA 2QXTA 2V6IA 3FGOA 2VOJA 3Q15C 4RQBA 5A62A 3FFWA 5CVDA 4YUXA 3KSUA 4MGEA 2QZ9A 3CY6A 3QV2A 4Z9FA 2GPTA 4C3OB 3RAEC 4EMUA 2VJYA 5BRJA 4KFTA 3JXEA 2A3RA 1UK9A 1SXHA 1OBOA 4YLYA 1ZA2A 4EW6A 1SD1A 1QX4A 1W46A 3SX2A 3NONA 1UBKS 1OXXK 3WRWA 5EIEA 2ZCVA 3VZRA 1ZLXA 16PKA 3KR9A 4PW0A 5CIYA 3HJCA 4KW7A 2BR3A 4FYJA 2BM8A 4OVKA 1U7ZA 1XTPA 2GBIA 4GMXA 2R97A 4IDPA 4YH1A 5IMSA 1OYVA 1SULA 3QE0A 4R1PA 1E4VA 3BZBA 4HQNA 4N39A 2GBFA 1P2SA 3U6KA 5FPTA 4KX3A 1JG2A 1DINA 4NNOA 1JYSA 3VDRA 5JV5A 1O03A 5AIBA 3CXRA 3LFHA 2MSEB 2G9QA 1CE8A 3BWCA 1XZJA 5EMKA 4YHBA 4CLXA 4JBXA 2A1IA 1RU3A 2YZ2A 1IVYA 4OXXA 2C4KA 1G20B 3VC1A 4IUCS 5HMMA 4C7JA 5AUNB 1JF8A 3AUAA 1N5MA 2WG0A 1NVTA 4N4AA 3ZI4A 4LJKA 1WVGA 2ZOSA 1E2IA 3D81A 4X1IB 5H82A 4CXMA 1FUKA 4J0KA 3IRUA 3R0IA 1KVTA 1EX7A 4R0VA 2JVIA 3LYLA 3V8VA 3TEFA 2WFAA 1J06A 3N86A 4M0UA 3A70A 4IIFA 1GWNA 3ZTWA 1F8XA 3A3KA 5SYNA 3A4TA 3QEJA 4ZJYA 1KO5A 4B45A 4FJ2A 4ITVA 3E2MA 2EKLA 2WHEA 4U2GA 2IT1A 2KSQA 1NW7A 2PX0A 2IC5A 3FOBA 4RSGA 3ZV7A 1NI4A 2P3LA 4ZT4A 3VPSA 4BRSA 3C3AA 1ZXXA 3HY4A 2OV3A 2PSJA 1XI2A 4IJ5A 1A8QA 1S4MA 2V7WA 5JDIA 1JVBA 1GZUA 2FUCA 5FF9A 4AG3A 3GLUA 2V8OA 1NJGA 5K20A 5KX5F 1QQTA 1W88A 4LG1A 4G67A 4PSDA 2FUNB 1E2NA 1YFKA 1KETA 1J90A 2EZ4A 5CW1A 4JDUA 4E32A 3KR1A 1JEYA 4YROA 5DI9A 4FZ3A 3VR2D 2CNNA 3L8DA 4KITB 1FFGA 2WU1A 5EHXA 3V7FA 4TN5A 1YK0A 4JQYA 3DNFA 1LPAB 4AKIA 3NWJA 1KYYA 1QZUA 2IYAA 4K03A 1CY4A 4JFRA 3SIPA 2XMRA 5KNBA 2IGTA 2GMWA 5E9JA 1QFZA 4CLRB 2QN1A 2FNAA 1EUCB 2Z98A 3ZEAA 4NK4A 2AI3A 1NXPA 1PT7A 1YO6A 2OO7A 3G2NA 3IT1A 4ILEA 3T3DA 2HN9A 2V74B 1ZGZA 2Q2QA 1PTKA 1MNAA 4C4XA 3VKFA 5IRCD 3O1HB 2BF7A 4PRYA 2C0CA 4U6QA 121PA 1ENOA 1SWVA 1HTTA 1ZKDA 3O82A 4D3FA 2ZUBA 1NYTA 4PQFA 2PFGA 1JKMA 2CLCX 4RF5A 2R8PA 1CRWG 1QK3A 3KDAA 4OXRA 4S2EA 5LBUA 3T0IA 5FTLA 2O06A 2EBWA 1YIAA 3HDTA 5DNUA 3EA0A 1EYZA 2RHCA 3BF7A 3T7SA 1CIPA 2WTAA 4OI1A 4YASA 3R7LA 3UOWA 3M6UA 4BDTA 2RHJA 1D9ZA 2WLSA 3GFPA 4H08A 4XW2A 3IR6A 5ABPA 1X7XB 1B0UA 2VT6A 4UD2A 5B2FA 2BP7A 2RHOA 3T6KA 3H9QA 5J2UA 1W19A 2OCLA 4ZVSA 1COWD 1DAFA 4B6EA 3TCXB 5AQ1A 4CJXA 1LBQA 2LBPA 5J2TA 2CV2A 1P3JA 3VAAA 3ETLA 2BFBB 1C7EA 1EQ2A 1FFAA 2CEKA 2R5NA 3I39X 3QG1A 3PQ8A 4F4DA 2OBLA 3PRYA 2QDKA 2NV6A 1W2WB 4DLSA 1WMBA 1WY7A 2GRJA 3GN1A 3HJUA 3K8QA 2OFXA 3RW9A 3EZXA 3VR5A 2GCOB 4P83A 1T2NA 3CEJA 4V0RA 1BMDA 2PYDA 4JBGA 4RA6B 3PX7A 3TIGA 1YQEA 3DVAA 1SVKA 3BERA 4TWRA 3WZ2A 1TCAA 3OOWA 4V1CI 4J7CA 1U2DC 1MABB 1X7WA 2GASA 2ZEJA 4RV4A 3BJIC 4S35A 2Q7OE 5A4IS 1XEWY 4G4SP 1IEXA 3LNCA 2VQFB 1YR7A 4GR9A 1P2TA 3L46A 4UCXA 1JEDA 4BXOB 5D51S 1W49A 5F98A 3VR2A 4UPDA 3X2SA 2ZRJA 3H9UA 2BEUB 2JRCA 4QQNA 4ZDJA 2X23A 3K71B 1XQ1A 2OHHA 4XWOA 1VE5A 2XJ9A 2G63A 3NNSA 4EVQA 2R7MA 3EUAA 5EHGA 3PUKA 3RREA 1F8UA 3N7UA 1YDWA 4KN9S 5DLQC 5IHPA 2FW9A 5KYWB 3JVIA 1ONPA 2HWWA 1CUCA 2QSZA 2Y1XA 3A3YA 3NWBA 4P3KA 1MAAA 5DWQA 4BECA 4ZZ1A 2XF2A 3BVPA 5AJVB 4Z2YA 4Z8YA 3S8EA 2AV6A 2WPDA 1P1CA 4NV3A 5DNCA 3FCSB 4X6LA 1Y5LA 4QUAA 4UEJA 3UJ7A 1IB6A 1XRRA 1ODSA 2M98A 2ONYA 2AFHB 1T4DA 2EHJA 4LY6A 2H1WA 3KUKA 1L3BA 3M6XA 3OPYB 4OG2A 2WEKA 1UZNA 3I1IA 3IBGA 3RJ5A 1P4GA 3GLRA 2WLTA 3CMCO 1NLYA 3NFRA 3ZW7A 4ANFA 1ULUA 3SDZA 4FVTA 1L2TA 1JLKA 2PMKA 1ZRMA 3H87A 3B6EA 3OFSA 2ZS7A 2EG9A 5DF1A 4F2HA 2X0JA 4MUEA 1AF4A 4MV0A 5HIMA 4K6HA 3UJ9A 3AKZA 2A0FA 1ZZGA 2H5LA 4PZ9A 3DVSX 3AM3A 3KZXA 2QQFA 3CF4A 3G13A 4ETMA 2BEKA 2QD2A 2WG2A 1NBEA 3GRRA 1XQYA 4IIJB 4RA6A 4NNPA 3LF1A 2PS3A 1QZTA 5SY6A 3TZBA 1RJEA 1CY8A 3EAGA 5IXYA 3QG5A 1AGXA 4H9GA 3SYRA 4DHWA 3IUPA 1ZHOA 2ST1A 3B9QA 1X92A 2PRKA 3MD9A 3R75A 4K0KB 4M9QA 4TPKA 5EVJA 3K72B 1H3FA 3PDHA 3GNTA 3VPDA 3Q0TA 3NETA 2PL9A 4TL9A 1HETA 2V55B 2WHQA 3ANYB 5FLYA 2EW2A 1JB9A 2RAVA 1Y34E 2NNLD 2NQ2C 1TT5A 2XMPA 3NWPA 1PSWA 2QUHA 1U7XA 3L1KA 1ZONA 1G8YA 5DFAA 1B0PA 2PD3A 3DEAA 2WOJA 1OZ0A 1G3QA 1ZU4A 4HYYA 4NV1A 2RGXA 3PU6A 2Q6OA 2AG1A 3N05A 5F5NA 5GQSA 3RIGA 2W6OA 3G1UA 4NAVA 3BHJA 3PVZA 4OK6A 2PU5A 3C6XA 5KTPA 1K1EA 1WMSA 3QKWA 5HDQA 1F1BA 4JNCA 1R88A 4EVIA 2Y66A 3J81k 3GGPA 3GJ5A 3EWSA 2NPFA 3PKJA 1I7QB 4WKCA 3VVBA 4IX1A 2HA3A 1TTPB 2OZKA 4PHCA 2QX8A 5THXA 1IIRA 4C06A 4RTPA 2VQEB 4MV9A 2X0RA 1ZM3A 1CJMA 3EYAA 4HP8A 1PF7E 4FFWA 2X86A 2Q4EA 5EA2A 2ANCA 4RF3A 1GZHB 1Y6JA 2RJNA 4KE6A 3DCIA 3ZTYA 1DAKA 3ABSB 1C3JA 4IILA 1U3UA 5C7IO 1K86A 4RVFA 5ENZA 1D2EA 4FTWA 3GLTA 2IV7A 2XTNA 3L7KA 2Q21A 5HCUA 1L5ZA 3C41J 2PNJA 1XP5A 1YR1A 2VUTA 1B4DA 2JEZA 4MJ3A 3H17A 5HIAA 4N5HX 4DLUA 3S2IA 2AIRA 3M1AA 4FGUA 2K7FA 3WS7A 2XYHA 2OLJA 1QYIA 3QPBA 3S6JA 4LRTB 2QRUA 5KTRA 4AU1A 1XRJA 4J29A 4UXHA 1FZTA 1RPJA 2CSUA 3BYZA 3WWZA 1Y9JA 1ZH6A 4CQMA 3WC4A 4DSUA 1V48A 3HJAA 3ZD6A 4KXMA 2IH5A 2K5UA 1CZLA 3LUHA 5I7FA 3BTUA 1TIBA 3ELUA 2Q1XA 4OU4A 2B30A 4EGFA 5CBKA 4O4IB 1T5TA 1L4EA 2DUNA 3RBXA 3NALA 1NLMA 4KK4A 3QENA 4CR6A 2ZIFA 4K28A 1HXHA 1B14A 2FWIA 4LS3A 1W76A 4E7OA 2CXHA 3R6DA 4HR7A 4D8TA 2DBZA 1KAQA 1USKA 4KK3A 4ZTBA 4DR3B 1MG5A 2OAGA 1FF9A 3TTYA 1VHWA 4ZEVA 1P6UA 2G0AA 3ZHUA 2EX4A 3LLMA 4YN3A 3O90A 3BC1A 3I6ZA 3NC1C 3Q85A 1Q15A 1U0EA 2NZXA 3I12A 5CFQA 3ZZ0A 3L8MA 1RFLA 3MZ0A 1KSFX 1C9NA 1ZUIA 3IT2A 3PUZA 4Y0NA 5LYJA 1QZZA 1PQUA 2R4UA 4YXWD 2NYVA 3HR7A 1T91A 3NGXA 4S24A 1D4OA 3EEBA 3O2NA 4FBMA 4H1TA 3D8UA 2H11A 2JBAB 2VCYA 4JYMA 5BP7A 1LFAA 3GG2A 4NICA 1YQTA 5K51A 4S1OA 1TJPB 1USIA 2A59A 3C5HA 5EKUA 4HWTA 3VC7A 1U3DA 7AT1A 3FMFA 4CMGA 1E58A 3MG9A 2F3RA 1VCIA 4JJ8A 4OL0A 2OYSA 2GTIA 4HFRA 5ALTA 1E18A 1T8PA 2HNAA 3PF8A 3T3EA 2C2WA 2HLDD 1KTVA 1IUNA 2MTBA 1B7GO 2QU7A 2R8EA 3CF6R 4LBZA 3TOXA 3OX3A 4RANA 1QG2A 3V7NA 2OGTA 2H57A 2SCUA 4QOSA 3WJ2A 3GEBA 2PFSA 3U7JA 1XG5A 3N53A 1RRGA 3KT8A 2GNPA 3HDQA 4RK5A 4KI7A 3H75A 2Y05A 5EKXA 4NAHA 3W5AA 4AS3A 3AVYA 3OWHA 1AHHA 4MJXA 1XZFA 4MW6A 2IHTA 3VKWA 4CLHA 4RVGA 3THXA 2EBHX 4PICA 2C4NA 1V8PA 1LQTA 3FPFA 5JNSA 2ZJ2A 3AF6A 3CT4A 3I5YA 2KM1A 1LXCA 2IUSA 4M1TA 3IAHA 3VTAA 1H9AA 1UPCA 4ZO8A 4EO7A 2I4MA 1SEPA 3RK4A 1GLVA 1RE0A 2YASA 1SC1A 3K15A 2EG5A 3A3PA 2FFQA 3LDFA 3ODPA 4JJFA 4L1KA 2W6CX 4LHYA 4IIUA 4MS1B 4P3OA 1FX0A 4E15A 4NCAA 2B2XA 1SC4A 1Z6GA 3ZGYA 4EYGA 1F2UB 4OU5A 4RY0A 5I3ZA 3DBRA 3ZG6A 4EF5A 3I83A 3QIVA 4F3YA 2ATIA 5AXBA 1NT2A 2GPBA 4IDGA 4RQUA 1PVDA 4XAQA 1WXQA 1FDOA 2CZQA 5KWEA 1KYWA 1W85A 3EGVA 3FUXA 4I55B 3E70C 3M6LA 1V8BA 5GJCA 4BX9A 2BKXA 5CB4F 2C9CA 3K5HA 3R5SA 4RKWA 4BVGA 9MHTA 1G60A 1JJAA 1FRQA 1M1NB 1A9SA 4EKNB 2CDNA 4DIUA 4UJ5A 4NCJA 2IPOA 2G5GX 5E4JA 4RIEA 4DRXB 4FEYA 1ZK3A 1XVTA 5AJYA 1SXJD 1M2NA 4C4YA 2B4QA 5CA1A 1C1XA 1JKIA 2P77A 1G8HA 5CYGA 3ZNPA 1UUFA 1WEKA 4BV9A 1SKQA 3R4VA 4EYEA 3D1LA 3EIOA 4E4RA 3NUGA 4IS2A 4UQLA 2ZSDA 4M0DA 2X5XA 2A86A 5A6SA 3I1FA 3A2MA 5I9NA 2PX3A 5FXMA 4RK0A 3GVPA 2P79A 1E1NA 5BSGA 1KXJA 1XN4A 3CB2A 1H42A 3H2ZA 4WASA 1IHPA 2E4WA 3ZVKA 2G8NA 4E5PA 3DXFA 4A8JC 5ANRB 1DRKA 1HFWA 4RADA 4F9FA 4QFDA 2QZJA 4BB0A 1CY7A 2R79A 1AK1A 3RU7A 1S2MA 3BH7A 4RMGA 5CNIA 2OM2A 1G17A 1L5MA 1NHWA 1V7ZA 2RCNA 1WKVA 3T4PA 3ZQ4A 2I4NA 2NUAA 3HDVA 4KOAA 4MRMB 4FOOA 3PP8A 2Z2IA 3FGZA 5I47A 2IH4A 5DWDA 4AIRA 4OAQA 1EKXA 5DMHA 6PFKA 1XA4A 2BEWB 3L8GA 3ASVA 3H4TA 4TL6A 1JHAA 1LC0A 1B2LA 1E3QA 2X58A 1QBKC 3LYHA 1F4LA 3K8ZA 3THYA 1GUDA 3BXEA 2FEPA 3UAOA 2CE7A 4O1IA 1GPYA 2MSKA 1TO1E 2P9EA 4CMCA 1LBTA 2GWRA 1D03A 4Q02A 1GGVA 3BOSA 2GK6A 1UPFA 1Q22A 4WN9A 1IQRA 2J0SA 4MUNA 1RRMA 3K0SA 2IHVA 1ULZA 3DDOA 4RE6A 4CKCB 1KY2A 1YONA 4G63A 1A7JA 3GT7A 2M1ZA 4WOPA 1U1DA 1CP3A 4UAVA 1ZR2A 2JLVA 1YJBA 4CNQA 1MO5A 4EARA 1OJLA 3AHGA 4MS4A 3VJRA 4KDRA 2CUTA 3JR7A 1ORTA 1G2PA 4IXTA 3ZJ4A 3HCNA 3FGPA 4R51A 1ZOOA 1FFEA 2PZFA 1BS9A 1IAQA 3BFXA 4PCUA 3VU9B 3GGOA 1NVFA 3COWA 1K6EA 3B1YA 3WGLA 2GW4A 2R8YA 4ILKA 4RH3A 5BWNA 1XTBA 5I01A 1QIFA 3JQAA 1I6LA 3LP5A 3PC6A 3UTCA 5BUQA 4FZ5A 5DTIA 4ZI3A 2Z6VA 1E9DA 1Q74A 4D8XA 3AB8A 3PV0A 221PA 3AFMA 1QO0D 1Q0LA 2V3WA 1XBTA 3HY3A 2GZMA 1T9KA 2XUIA 3LKDA 5FOWA 4TWJA 3JATB 4HB3A 4MARA 4QDUA 2W6ID 3M6MD 4TXLA 3BMXA 1QFYA 4IVPA 3ZBQA 4RULA 4JT9A 3G5MA 3H0CA 3GGGA 4OMUA 4CBVA 2XRYA 3FR8A 2XQFA 4FHDA 1VHLA 4KG7A 4A9AA 5ALZA 3WRVA 2P6OA 4AUEA 3JZFA 4JLVA 2W0SA 1T8YA 4EO4A 4C87A 4Z7NB 2VSNA 2QSYA 2OAP1 4RACA 3HRHA 5ALKA 1QYXA 3EEFA 4Y2PA 4FYYA 1JEJA 1QIEA 2XITA 3D3WB 3I6BA 4OHWA 4YAJA 5A02A 4CN8A 1VBFA 3ZDBA 2LV8A 2WWFA 1UBRS 1NFFA 5TPZD 4EDFA 3K8YA 1VLQA 2Y99A 3QKUA 3ZKWB 5BMVA 4HDSB 2BFEA 3GDWA 3EPJA 2WYHA 4AO8A 3LJKA 5HZKA 4RTSA 5KYYA 3HCPA 3Q3IA 2DF8A 2EP5A 6ADHA 3V1UA 2ES4A 1FOEB 1Z12A 4MCJA 3URKA 4C07A 4GMGA 4A0GA 5JD6A 2VS1A 4UVGA 1ZVQA 1EFPB 3QBDA 4IFBA 9LDTA 2DE0X 1QFJA 3ZGZA 5EUQB 1H2BA 4R1QA 2ZYGA 3ROPA 2D7CA 5EIOA 1W4LA 1ZFNA 4HDMA 2XQIA 2H52A 3EN0A 4QU5A 3EAFA 2G1AA 5KJCA 3PQEA 4N5MA 3MQ2A 1KYTA 2CJPA 4LKOA 4LDJA 4G0XA 1YS6A 1NZJA 4OJKA 1W0KA 3WQHA 3A26A 5IVDA 1A8IA 2OZVA 1NRXA 1YMUA 3FKQA 1OX4A 4O33A 4CKBB 2ZXFA 4I3HA 1M6YA 2V0GA 1CDOA 4FOTA 1JU9A 1SD5A 4ZVPA 1RI5A 5AHWA 1G7CA 1P19A 2AQKA 2FRXA 5DBIA 4A2PA 1ESDA 4Y2XA 4A73A 2X3FA 1UPUA 3S1AB 2I2XB 4NESA 4XDHA 4CT0A 1ZUWA 4NATA 1QH0A 3FPCA 4MPDA 2WYOA 2HYIC 1VOTA 2D0OB 1XLWA 3ESRA 4WOKA 3DVQX 3PL1A 2JI4A 3LPNA 2DM6A 2ISQA 1XZPA 2V9ZA 3RH0A 1KH2A 4D4JA 1E1MA 3AY0A 1MC4A 3IUQA 3R20A 1UJ4A 3UOGA 1P9LA 3KTAB 2HX1A 3I2HA 1L4FA 1SQSA 3U4HA 4I4TA 4URZR 3HDGA 2HEGA 2V6BA 4FYWA 3OZUA 2RDMA 4LYHA 5A9TA 1SBTA 4MW5A 3FB1A 2ZUUA 4F4HA 1NUTA 1T4CB 2AA3A 3L5KA 1YDMA 3HL0A 5CNMA 2PUEA 3TPFA 2NGRA 2ZIAA 3H3FA 5F7XA 1DQYA 3IESA 2P91A 4CW7A 5GINE 1EUQA 1UT8A 3IHWA 1Q1ZA 4LE0A 1QHYA 3PC8C 3PXXA 2WTUA 4ZZIA 1LW7A 2OSBA 5JXHA 2QOEA 4C78A 2BEWA 2QTNA 1F2TA 1V7CA 4PM4A 2AF4C 4XIFA 1IH8A 3TLJA 2FX2A 2H5EA 4IHJF 3TIVA 4B84A 1F2DA 3VVMA 9LDBA 1E3LA 3HNPA 3BTOA 4KJXA 1RKUA 2FG7C 3N6XA 4BFSA 2IX9A 4OHXA 3BT7A 4JLOA 4RELA 1EXVA 2XKJE 3ZK8A 1GPUA 1YU9A 2LWIA 4QXRA 5AO9A 3SJ7A 1WZUA 2GVDC 5FUMA 1ZWKA 3M6IA 3SQDA 2B7LA 4LF4B 3VXKA 3NANA 5ALYA 5AVJA 4RPCA 4GKJB 4E5MA 1A27A 4QICA 1N2CE 2FOLA 2YTZA 5EIAA 1T1IA 1H0SA 1A2BA 3DJFA 1W47A 4QXPA 2NU9A 4J49A 2L18A 2R84A 1A4XA 1UBCA 4BO1A 1MB4A 1KERA 2PZKA 4YMTA 1VL0A 4UAGA 2A7QA 4W1QA 3T1YB 1GT91 4KUHA 2HHCA 5BUCA 4DR5B 1XJ5A 1U0FA 2LGJA 1CEXA 3GHYA 4X85A 1UDWA 2GXQA 2XHZA 4MQ4A 1K6MA 2NU6B 4UMEA 4B4KA 4X1OA 1RYDA 4ZQHA 3F4KA 3NPMA 5A05A 1SVIA 5EN4A 1V71A 2OBXA 4IYRA 3DZKA 1BN7A 5L40A 2OZLB 2ZBQA 4TROA 2PXCA 5F4BA 5JJ5A 1RKVA 3QWAA 3TW6A 5B2EA 3C3DA 1RZRA 1KMNA 1QM5A 4KLRA 2GETA 3HBAA 4HNRA 2IYLD 3TM5A 3SYTA 2GN2A 1E3SA 1JR3E 5CT9A 1EJ0A 4UQOA 2PZBA 2QQGA 3WB1A 4ESHA 1SCUB 1UIRA 3R0QA 1G6HA 2PH5A 4N7RA 4R2WA 5D1HA 5J5VA 4C03A 2P5SA 5J2UB 2YN4A 4R31A 1KOLA 4WCVA 3QKRB 1PTJC 1SK8A 1H2EA 2XE4A 1Z47A 2ZI5A 4CM9D 4YUAA 1N5OX 3EC7A 4DNQA 1E1QD 3OWXA 1IHUA 1P9WA 3PHJA 4LDZA 2FRVA 1GILA 4EAQA 2CXSA 3I37X 1CJUC 1QMGA 1EUDB 1OF1A 1P5FA 4KPUB 3BIOA 3A4IA 4C20A 4UOZA 2WDPA 1TEVA 1QCZA 2Y1EA 1KI2A 4G1CA 2GT1A 3K16A 1ODFA 2Q4TA 3OQ6A 2Q2OA 4BFZA 4Y0VA 1L1FA 4H31A 3W6NA 5GONB 1RYNA 1HH4A 2N46A 3G9TA 3WDKA 3B9RA 4UARA 3RVRA 3G9UA 2VT2A 5AOCA 3GT4A 2NV0A 4C6TA 4EZIA 3Q7EA 5JH7A 1CQXA 1Z22A 2ZT6A 5J47A 3T3OA 1JAHA 2Q49A 3LNTA 2XCSB 1JFFB 1KYZA 3AF5A 4LBYA 4ZQFA 3QV1A 5HX7A 4NV0A 5IZCC 1MORA 4CGZA 5ES4B 1IQ0A 1ORRA 1QHFA 1A9YA 2KBFA 1VTKA 4ZAZA 4ND8A 4YCLA 4O08A 4FNAA 1QO9A 4NOJA 1GQQA 1Z39A 1DO0A 4C1NA 4PQYA 5IWCA 2QBYA 4IVRA 1M5RA 5EMJA 1RWVA 3E7DA 3PNKA 4R9NA 2DKOA 1N8SA 1OT3A 1YZTA 2IXFA 1O4VA 3FUVA 1E77A 3FKSA 3C5EA 4JWKA 4QYIB 1XDBA 3GG9A 3CG0A 3VO2A 3N8KA 4MEAA 3WHKA 5GJVC 4GBMA 4P5EA 2XJ4A 3TOZA 2ZYAA 1CZUA 1C3OA 4LF6B 4KPEC 3KEQA 5CH8A 3RTCA 4EG8A 3TI9A 4IGEA 5ILOA 1G6OA 4ZT7A 1LI4A 5AYVA 3DAYA 1NN1A 3JWEA 5JRJA 1JDSA 3UT5A 3PDUA 1SUDA 1XROA 3UT6A 4QX6A 5EP2A 3X44A 4ARIA 4MVCA 1YZVA 2WJHA 1YK1A 2D1SA 1JFVA 5HF9A 2XY4A 2WRZA 5T57A 3D6HA 2QM3A 2D0PB 5B2ZA 3WI7A 3WYDA 3IUMA 3I58A 4DG5A 3W7VA 4BLSA 4QGGA 5JZ9A 4YJFA 1MF7A 2OILA 4AD8A 3IDOA 3QKRA 1AQYA 1TYDE 2LRHA 4OHMA 4OHZA 1J22A 5JS2A 3KUCA 3THOA 2YC2C 3H4IA 2JGIA 1NSYA 5CA1F 1QIKA 1G1AA 3FPAA 2VOEA 1HV8A 3G8AA 2YWCA 1W44A 2ZWOA 3Q10A 1T1RA 1NI3A 3W8DA 3FYHA 3TQTA 1EK5A 4JC8A 1R16A 1Y48E 2JD1A 4XEUA 1PFGA 3AB7A 3U7RA 1BN6A 4RJTA 2DHEA 4XIJA 1TK9A 2NO1A 3CR7A 1PR3A 1BTOA 2H7YA 4ZAWA 5C8VA 3OF5A 1NJSA 1R12A 3RJMA 1KMQA 1CLEA 3GJ3A 2OXTA 2CWDA 2XZOA 1B23P 3HJGA 2P9QA 3UH1A 2DFKB 4EABA 1L5KA 4XX0B 5CLGA 4PCLA 3CA8A 1AG9A 1Z2CA 1ZNZA 4WKPA 3P27A 4JL6A 1MRZA 4KSBA 4LHWA 1EWYA 3KQQA 5REQA 3RKRA 4AN0A 1YZQA 2XE8A 2QN6A 2FZWA 3QVVA 1S3FA 1A71A 1Q2XA 3JD4A 3QVXA 1ZI9A 3PUVA 5FORA 1C30B 4FW9A 1APBA 1N3YA 4PF1A 1Q83A 1Y3DE 1YQQA 5AKGA 1POWA 3E15A 3QYFA 4G0MA 5T41A 4CEHB 3D4PA 3NTQA 5TQVA 3NEAA 3UKOA 5IKPA 4CR8A 3ONVA 1FRZA 1A8UA 4JR0A 1PEAA 4Z4QA 3P96A 3N28A 1M75A 1H2RS 3IMKA 4DYHA 1MXFA 1JSXA 2YW9A 4JFAA 4RXUA 3WLAA 2DH6A 3UA0A 3DLHA 1B0AA 4IDEA 4QGBA 3WJAA 1QCYA 1M83A 4DWOA 3VPAA 4UTNA 1JDBB 4L4ZA 2FWNA 5AUOB 4KQ9A 4CQMB 1T1SA 2ZB2A 1YQ9A 4ZO6A 4GOKA 4X3PA 4EJ0A 3NHWA 1W93A 4QUEA 2AFIB 1EHCA 1P7YA 4QRIA 4ZMBA 2ZP1A 3BGWA 2X0NA 1HF3A 3ETJA 4BNTA 4CM9A 4F4CA 2OXRA 3LT1A 2Q1UA 2DCMA 2DY1A 3H1TA 4C21A 2A9OA 3WLJA 4CV3A 4DFDA 3KQSA 3DEJA 1I2AA 4GLOA 3EWAA 3ITNA 4FFRA 4XPIB 3FH0A 1DRJA 1QGED 2WJ4A 4LRQA 3HLYA 4NZYA 2RGYA 1LK0A 1EQUA 1Y98A 4LX0A 4YAOA 3DULA 2OZLA 3DWEX 4IL5A 2HI0A 2X3YA 1LLUA 3DDZX 4E14A 1NLFA 4FYKA 5FEMA 3ZCPA 1MX5A 1DLJA 5GM1A 3GZNA 4PC3A 4F2WA 2OCBA 5KWSA 3KZMA 1V9SA 4NLLA 3WRYC 4F85A 3EPPA 5CXUA 3FHOA 3DTVB 1DIRA 4GM4A 3IAM6 4LPSA 3JQAB 3SE0A 3G6KA 5I5EA 2JHPA 4FONA 4HDKA 4MS3A 4BN4A 4LF5B 2QN2A 3LCCA 4HNAA 1CYEA 1YNSA 1O7JA 5E1BA 3C24A 4IWYA 1TCUA 2CWWA 3DGEC 2FWJA 4P4TA 3V48A 4DLRA 2YFHA 4FOPA 5HNKA 1S02A 2LVBA 3CO0S 3AX6A 5J1SB 1KY3A 2GK4A 2O48X 3H6HA 3OFJA 4J2HA 4R3WA 2GR7A 4UVEA 3HSSA 1NF3A 2P6UA 3LQ1A 4NTZA 5FA5A 3B7GA 1C0KA 1M5TA 1SUEA 3GO4A 5HGJA 3BXFA 4EI2A 2B5VA 4DMRA 3DL4A 3IKMB 1RQLA 3QFFA 2CCKA 1H0HA 2Y76A 2UAGA 2VYVA 1AQJA 4E08A 1DV2A 2PX2A 5SYAA 1NAHA 3VR6D 3DC2A 2P2NA 2XTAA 5ILGA 3PPYA 4GSKA 1CZOA 4IUDS 3A9VA 2NTEA 5E2AA 2AZMA 1K9SA 1MAUA 1KS9A 2VSYA 5E6SB 2NZJA 2ZI9A 2ZR8A 2A30A 2YIJA 3HMKA 5EJAA 5LZ8A 4E1VA 1S7CA 3OQVA 1A4UA 1F2UA 1QH1B 1RKXA 1SPXA 2X7XA 2ZBGA 2C5AA 3DUFB 4WY5A 4XVRA 5G0VA 2QKYA 2HF8A 3G7UA 2G9VA 3VKVA 1TB4A 3RYCB 4RHEA 5BUSA 5DYNA 2GPJA 1NQAO 3C98A 1P60A 4TUYA 5IKXA 1B93A 2QTVB 2D74A 4U3JB 1EU1A 8OHMA 1Y3IA 2NZ2A 2XSZA 3K6KA 3QYJA 2QAIA 3TZ6A 3REQA 5IX8A 1J1ZA 4L5AA 4RPJA 4BUCA 1RXIA 2BR5A 1NMEA 4KXVA 5DK4A 4I50B 1SVOA 4DREA 1C8LA 4QXAA 1N1MA 5IARA 3OPNA 4GYKA 4DLTA 4YV1A 3FZNA 4OREX 5KSOA 1EE2A 1U1IA 4MYDA 1XXHE 1VBNA 3AUJB 4H6PA 4B44A 3QW2A 5F77A 1E2EA 5C31A 2QR3A 3F8TA 4KJZA 5H70A 4FILA 2BGTA 1RBMA 4ZA2A 1V3TA 2F3PA 1MVLA 2PUHA 3IJ5A 1H6DA 1V4NA 2XDYA 1ZN9A 1D6SA 3OT5A 3SKXA 3FKJA 1SQ0A 2FYTA 3GLHA 3W6PA 4OXKA 4TYNA 1W1IA 1I32A 2I3DA 1UBEA 3NX4A 4F6RA 3L8FA 2WV7A 1A9QA 4OQMA 1J21A 2VDMB 2WSLA 3KX2A 3DF9A 3B6MA 1N5DA 1J99A 1ESNA 1OZHA 5COBA 3OOYA 2VHVA 3INGA 3FFBA 4P0PB 4WK4B 2JAPA 4HMPA 4KQCA 2EFJA 4OHUA 2ZIVB 4HNAB 4GMHA 5EZYA 1BNCA 3PT9A 1M10A 3K9CA 5IKOA 4NZ9A 2RKBA 2C54A 3PNOA 1IM5A 1SC6A 2MSLA 4KGDA 3TQRA 2HOQA 3WSTA 1FC0A 5I5GA 3I2YX 4KCGA 1O9GA 5J40A 3WL7A 5LOVA 2A35A 2ALJA 1DX4A 2BFMA 4CCAA 1O89A 2FMKA 2QS9A 4JKYA 5B1IA 5AVRA 4BGUA 1SH7A 4RPKA 1AHPA 1T0JB 3WP1B 3HFSA 2ZW9A 4O0LA 1LEHA 3CM0A 4HRAA 4BO5A 2QG6A 1AK9A 2W8BA 4JJ4A 1IEWA 3FYSA 1WETA 1KU0A 2EC5A 3B51X 4G81A 4RQAA 5H1YA 2PS1A 3TTTA 1BRMA 2BSAA 4UEQA 3HSKA 3RS4A 2JS7A 5IPFA 2RGRA 3A4MA 4M1KA 3BX1A 2UYQA 3IDFA 4IH4A 4BFLA 1TX4B 1WUIS 3EQZA 3WK4A 3U56A 3TD9A 3E7WA 2Y0DA 3BFVA 3GVHA 4W5HA 3TXXA 4QTUB 1NC3A 3ENVA 4MVJA 2QP3A 1LSJA 4Z99A 4EVSA 4ENRA 1GV1A 2HPHA 2HGSA 3OM0A 4A8JB 4ALNA 1V5WA 1AURA 1W96A 2H29A 3K4HA 3B5IA 3C1TA 2VH2A 4JEHA 2WKPA 4II7A 1TF2A 2QGFA 1EWQA 2ZZNA 1KRXA 4NPCA 3K2EA 4KO1S 4Q66C 2OENG 5TF0A 2VZ9A 3NAGA 4JLKA 1GQYA 4E03A 1HO3A 4JITA 4L5YA 3GFTA 4POAA 3V1TC 3VH3A 1WMFA 2E49A 2HDNB 5KPDA 3L18A 4NKRA 4Q3DA 2HQRA 2EOAA 3VGJA 2EKPA 2VCEA 4RBNA 4RYDA 4EG4A 4MUYA 2AZ4A 4UHJA 1B2RA 1GUAA 2H2IA 4Y8VA 4DJAA 4W5TA 1GZ5A 2ZJ6A 4D82A 5L3VA 4LDNA 3ONEA 1X7ZB 3JASA 3WAGA 1NRIA 3U5TA 1PHPA 1PX0A 3ESZA 5KDLA 1ZH8A 3L40A 1TUGA 3BRSA 5JMTA 4BBZA 2O2SA 1JG3A 3BHIA 3NDPA 5CLIA 3TMKA 4W5WA 2R48A 4NF2A 1HT2E 1P61B 2QUKA 4HAOA 2Q5CA 1MKYA 4X0EA 1X9GA 1EDOA 1TXGA 2H06A 3CRNA 1TD9A 2XNKA 3BB1A 4FINA 2PS9A 3E22A 4OB7A 4P7KA 3WBKA 1Z5WA 3DGFC 1TC2A 2G9NA 4TWAA 1USWA 1WKCA 2H0QA 4H77A 3WGIA 4URYR 3CEMA 4WFQA 3TINA 5AI9A 3U48A 5BSWA 4L0MA 4RZHA 5JEDA 2WW8A 4G5XA 5LQNA 1RRFA 4UATA 4GOLD 2JI9A 3GT0A 1OI7A 4PLTA 1T8TA 2VTBB 3BULA 3H0EA 1K2WA 3SC2B 1ZUHA 3BEOA 4P3PA 1ZN7A 1CUFA 1W0JA 3ZIAA 1K6XA 2Q28A 2JJ8A 2J4CA 2ZRHA 1M54A 2AFIE 5CRIA 5IT4A 1MZVA 2PL3A 4YP5A 2YXBA 2NT3A 4MTCA 4OV6B 2YH2A 3DG9A 3I52A 4DEVA 3N2KA 1O94D 1J0AA 1OIWA 3KUDA 1GGHA 2AOTB 5DGCA 3QITA 4D56A 2WK1A 3FUUA 4L78A 5ITWA 3W5BA 1P7VA 3F9RA 4B71A 2QD5A 2FHPA 2QTWB 2X13A 3AKCA 2GFIA 1T3GA 3A1CA 4Q03A 1NUAA 2QLBA 4UXIA 4BAGA 4OQEA 2Y9MB 2H18A 3U3RA 1ISSA 3IULA 3VC2A 4TV8B 4RETA 1MOSA 3AERA 5K3EA 4H4DA 3CS3A 3HVHA 1B00A 2DH5A 1P5HA 2V1XA 3QK7A 1V7PC 1MIOA 4CEHA 1J0DA 3IPYA 4S12A 2CD7A 2JLUA 4B4UA 1EVJA 1I6WA 3IIJA 4INOA 1GP2A 3LX6A 1UBNA 2JFNA 4BFUA 1U8EA 4ZYVA 3OLXA 1M2VB 4RGQA 3A27A 3WLQA 1US8B 3EYWA 2JVKA 1P0FA 3EQ7A 2Q5FA 1OX6A 3GLQA 3P9IA 3ZDZB 2PGOA 2X5JO 3BA1A 5F9MA 5F7ZA 5BV7A 5JBNA 4LGMA 2V7TA 5H5JA 3IVXA 2X77A 5BNIA 1CNMA 1TEZA 1Z4KA 1J5XA 3OD5A 5ITZA 3D8SA 3PFNA 2CNWA 3S70A 4ZK6A 1RXWA 2FSFA 1FJXA 4LZOA 3WK6A 4UXJA 2JFQA 4Z4CA 4J43A 2DPHA 1K6IA 1ENPA 5FULA 2VJCA 1JG6A 3JQ7A 3AHEA 5DW0A 1KKLA 1TJ3A 1Z06A 1RM4A 2AUMA 1LRKA 1SO8A 4OO3A 2HCBA 4P92A 3EC2A 1WMDA 5JCXA 2J4FA 3LWZA 3CNNA 4Q4CA 5JSUA 2WF6A 4LNUA 4MKGA 5FD8A 3SJUA 3WA6A 1R8QA 1Z9BA 3TR0A 1IXKA 3U3JA 5B7NA 5BWMA 4W8GA 5BWLA 1B8OA 3KYIB 3UA4A 1KNQA 4ZMSA 3CVUA 4B83A 2YOHA 4IMIB 4JT4A 5JY1A 5ESDA 4GX2A 1UMCB 2QA5A 5BW8A 5JPCA 3R9XA 4AFNA 1C9DB 1XYYA 4ZRDA 2ZTLA 5SZIA 5SZKB 5BSVA 2GCOA 4U7PB 1J07A 2WKWA 4NOKA 4UBJA 1CJKC 3HUFA 2A0UA 2Z2KA 4NPHA 4QDXA 3LECA 3AVUA 2G4VA 1JMKC 1E0DA 2GI4A 5EXDA 3DTNA 5IF9A 1PP4A 1FSPA 1NQVA 2OOSA 4O4IA 2WSSD 3KD3A 4FD2A 5JT1A 1Y6GA 5HS6A 1H2AS 4F92B 3FOAA 4AI6A 4Q4AB 1E2QA 4EGJA 1Y82A 3TRFA 3HUEA 3U19A 1F5NA 1SOUA 1P29A 1ZH0A 4GDMA 4U02A 2CL6X 1SXJB 3IBYA 4GS5A 3FCYA 3LTEA 1LNQA 2AXEA 3KE9A 1VYHA 1T0IA 1ZD2P 2G1JA 2GN4A 2IRWA 1Z5GA 2FX5A 3DBIA 4LQDA 4M76B 4EEKA 2PZGA 3QU4A 3KZNA 1CR2A 2Q7DA 5KWJA 3GRVA 4CU5A 3CVJA 1PHRA 3VDQA 4LE2A 1ZRSA 4HRVA 4GNKA 1QTIA 1WSDA 2W2LA 5G41A 2OCKA 1G8PA 3P45A 1MMFB 3OVMA 4OQNA 2WIDA 1ZJWA 4NYMQ 2RHWA 4WK2B 1DIOB 1H1LB 4XWAA 2DVMA 1VC2A 2IYEA 3D4IA 5HIJA 4O25A 3DW3X 3E8MA 4REQA 3R76A 2CHEA 2A50A 1IN6A 1Y6RA 3CNLA 1M34E 3Q3JB 3I4FA 3ROGA 3S55A 4D80A 4XZ3A 2W8ZA 2O14A 4Z1MA 3IXQA 1T25A 2C57A 5CBPB 1OFIA 3RV4A 3FTFA 1N33B 1JLLB 2FSVC 4B0OA 1EUZA 2JEOA 1UPAA 3FFAA 2A8YA 3I2KA 4JP2A 3W7BA 4D2IA 2VUHB 1Z7YA 4RWEA 5EHQA 1JHUA 4ENVA 1QRAA 3KQLA 3ADDA 2PMFA 5K1ZA 5C8DA 1XFAA 4G0OA 1GUYA 4L8GA 2TSYB 5JBQA 1S8NA 3AP1A 3BFJA 1KI7A 2CXXA 4X41A 5KYVA 1I5EA 2JANA 1Z2PX 2NG1A 3MC1A 4XXHA 3S1LA 1GKYA 3A25A 5J43A 3NUZA 5I9SA 2W83A 4O63O 1YULA 4EUHA 4HN2A 4MPRA 2H59A 1B43A 4RJ2A 4JJAA 1WHSB 3HI6A 3GWGA 2WF5A 2O54A 2Q8NA 4F6RB 4N7JA 4NCHA 3TRHA 1OI2A 2D3TA 2QM8A 3E58A 2P4EA 3EH1A 3OCVA 5DRYA 4AF8A 5A5EA 1FMCA 3UJBA 3G2OA 1SUCA 3GLFA 4EKYA 1WDWB 3RAFC 2G5ZA 2X15A 4CMIB 5J4YA 2VPQA 5CITA 1ND6A 5KAMA 2EHDA 1LLQA 1JKFA 1KI6B 2VP9A 2YYYA 1B6TA 5AVTA 1I1QB 3AU9A 2WSYB 5EESA 4WDQA 2HM7A 1J2YA 2Q3JA 2R6HA 3LK6A 3M82A 2Q2VA 2W6PA 3O1IC 4WLFA 5AOVA 2IV3A 3IEVA 4JBLA 2GCEA 4ARBA 2EGHA 4AYXA 2D8MA 5JJIA 5TV2A 4CM3A 1YQGA 1BXGB 3BQMB 1FMJA 1G20A 5TMEA 5BSKA 5JCJA 4V02A 3R5JA 2DLNA 3HI4A 1ZM9A 1OLSB 1UKEA 3GLIE 4YCBA 4FW8A 3ZD7A 1VI5A 1Y1SA 1XZ8A 4AUNA 1MT0A 2WAMA 5D3ZA 5KMGA 1I7NA 4QPDA 4KR2A 3QYPA 1NVWQ 2C2XA 3DMGA 1ZIXA 3QGMA 4E22A 2Z3VA 4BEWA 2NP6A 3DDNA 2E55A 4DV1B 4RENA 1DAEA 4Z1MD 4O2BA 3W5IA 2YOGA 3EZ9A 1E8DA 2ZJOA 1IVSA 4N40A 2NW6A 3SIWA 2AVDA 4QSHA 4IXDA 1PNRA 3R3HA 3B5EA 1Z45A 4BLRA 4NPAA 4L8FA 5LZ5A 4NDAA 4BMXA 4GRDA 1QV9A 1UODA 3SEZA 5C1PA 5K0ZA 3PEUA 1Z2DA 1K66A 4AMZA 2XODA 5A6SB 3WQBA 4YRBA 2PUFA 1KYVA 2QU8A 2DSNA 3PT5A 4MQUA 4H1VA 5AHKA 2YBDA 3ORQA 1LK7A 2Z9CA 1YMQA 3B12A 4W82A 3WRYA 1YA6A 2QP9X 2VBIA 2HWXA 3H2SA 1DEHA 1G291 4JIMA 3QUBA 2G72A 4ZV7A 4YR7A 4M54A 4D98A 1QPGA 5JHGB 3KLMX 1JYEA 1IWPB 3QJGA 4ARUA 1WXWA 2AR0A 2JLCA 3TQOA 4D3YA 2HSJA 2XYRA 4M8IA 2P6NA 4UNPA 5DW3A 4HLQB 4ZP1A 3ZCUA 3M3PA 4OBEA 1CNEA 4RTLA 4KRFA 2FUG1 1I7PA 3FZGA 3ME5A 4N9QA 3GDHA 3DEZA 5GPBA 5I4BA 4QEZA 5FPSA 2QAJA 2Z95A 3SSAA 3X1YA 3OEEA 4JLBA 3WDLA 1JPUA 2I67A 4R9SA 4RFLA 3OWOA 2H9YA 4TQAA 1G5HA 3CWQA 4HDCA 3OCYA 4JB8A 4QT0A 1XXLA 1EBUA 2VP3A 5F33A 1JHVA 4PO3X 5D3QA 3WIVA 1XRNA 3WL4A 4C0LA 3SQLA 2D0DA 5ELXA 1DGQA 5DISB 1E6WA 1JHOA 3ONFA 3W34A 4FEEA 4Y6GB 3FBWA 4MHSA 3U61B 1J7JA 2J3QA 1I0IA 3FHCB 3I2GA 1E2JA 4FYVA 4D5GA 1S8OA 2VYQA 2OO5A 2R8BA 1RBYA 4DA8A 4E13A 5JQWA 1XHLA 721PA 5IK2D 3A10A 4J4HA 4W6QA 4ZTUB 2QI9F 3Q9SA 3BMNB 3H1GA 3WK8A 4QEKA 4Z3KA 5AW7A 3R3ZA 1IG3A 5D5QA 2D5LA 3OPVA 3H11B 4QDTA 2R25B 4M9XA 2GARA 4WECA 2J31A 3T1NA 3LOUA 4L3VA 3FAKA 2IU6A 1YGPA 4RFSA 2FPXA 1R9NA 3PEEA 3TMYA 3UFBA 2OC9A 2YVUA 3UWSA 3EGXB 4YREA 2X14A 3ISJA 1QP8A 4DR4B 3NHUA 2IKQA 1ABBA 3MHTA 1H2HA 1CDEA 3UBMA 1R5NA 4OP3A 2CY0A 5KVAA 3N0RA 1IRIA 2X2PA 3VNSA 3VNQA 4EFLA 1JDZA 5JFGA 3DMNA 2GESA 1IHDA 1WUHS 2VRCA 2RETA 2FZ4A 2IYZA 1U8CB 3EPRA 3MTGA 4AB1A 5DTQA 5NLLA 3K20A 1KIMA 1OC4A 4PYNA 3ESYA 3HDHA 4DLNA 3S81A 2IZ6A 3HXPA 5DCUA 2BZ0A 2OAEA 1ZSNA 4LAFA 2ZE6A 1QG0A 2PKYX 4LXHA 1DG1G 2OMEA 5HR5A 1FYWA 5LZ4A 1WZEA 1E2BA 1RBQA 1CUVA 1WXXA 2IV2X 4NMMA 5AKLA 2F1KA 3D5TA 1ISPA 3FPGA 1BKSB 1HYEA 4J0DA 1G63A 4M36A 3UYLA 4GXNA 2A5LA 1DBQA 3HO6A 1T9DA 1ZH4A 2KQUA 3PUJA 1XTRA 3GPBA 4W8HA 1XQ6A 1W4RA 3P5BA 5KOYA 4M1EA 3OKCA 3EDRA 2Z83A 1PIWA 3JQRA 3WNBA 3VNUA 2F43A 4A7PA 1ZK2A 1PU2A 4BVHA 1D5CA 1JW9B 2ZUCA 1JPNA 1T4MA 1XRLA 4NWIA 2IITA 3P0IA 4KU4A 2YVLA 2ZB7A 2V4MA 4TS3A 2WICA 2HO5A 1G20E 5AH0A 2EERA 4G0ZA 1YC2A 2DPLA 4XB1A 5H83A 4OLJA 2HJGA 3BILA 1UMKA 3M0EA 4AJ1A 1NATA 2GX6A 3EASA 4HSEA 3X1ZA 2RIRA 2AFIA 4HGRA 3DLBA 2JAQA 2WUWE 1KC1A 2EYQA 1LJLA 1UC4B 1UDAA 4IXJA 1DWPA 1R2QA 5KU1A 3LPCA 4XLLA 3ZY4A 4AKSA 1HEUA 3BJMA 4DQDA 2JIBA 2N3ZA 1NN3A 4DY4A 2OMKA 3U44A 3NYRA 4JJKA 2ORWA 4BFCA 3ZH9B 5K0FA 5B58C 3C3WA 2BPOA 4BMVA 1H66A 3A11A 1X1AA 5C9ZA 1YBFA 1HYGA 3A58B 3PS9A 2W58A 1OVGA 4Q93A 4LCJA 3SLKA 4C4OA 3DBHA 4MAFA 2ACKA 4OBBA 1DT3A 4MV8A 4QDOA 4BVBA 4NBUA 4RM3A 3PDJA 1OHHD 1CRQA 3QMMA 5F1YA 1UOQA 1IBCA 4KMMA 4EBBA 4GGPA 4EG5A 1YIDA 2QZZA 5CA0F 5G2FA 1SM4A 5BNZA 2YIVX 1U7DA 2H07A 1KP2A 4Q1DA 4EYOA 1YZHA 2O57A 2VSFA 3N1UA 3BH6A 5H80A 1WWKA 3VOBA 2B82A 1TK2A 3QHPA 4HH0A 2P0EA 2ASVA 1CUWA 1C4XA 3UMJA 1AUOA 1XD9A 2Q41A 3ZYCA 1U5BA 1B41A 1F4PA 1ODKA 2J3KA 2Q1SA 4PYKA 1CZRA 4RDCA 4ZJZA 1GTJ1 4JJIA 1MNQA 2VQDA 1C7RA 4EGSA 4NG5A 3NPAA 4Q4HB 4JUCA 4Q1VA 4R7ZA 4PHGA 4X45A 5FJJA 1YU6A 3S8YA 4JLMA 4Q3AA 2AGVA 3H5VA 1VZ3A 2XOKA 1LQUA 1G0OA 4UU8A 2NQTA 2B21A 1M8JA 1TZBA 2LCIA 2DQKA 2WOOA 3VRHA 1P74A 4MQFB 2J6BA 3EW7A 1EJBA 4DADA 1AUXA 2OHXA 1OU0A 2R1VA 3PD7A 4DABA 2O5RA 1DP4A 1YJXA 1XB2A 4BUJA 5BRAA 5CG2A 3I9NA 3M9WA 2CHUA 1HL7A 2JLSA 5EXCA 5AUPB 2BHNA 1PJQA 3DDUA 2WTBA 3U31A 3FYUC 3W78A 2BYTA 1QDLB 2GAJA 3M4NA 4KHPB 1L5OA 4NG4A 4KSCA 3RF6A 1A5ZA 3DT9A 3LYUA 3CZAA 3QPCA 2TS1A 3P2IA 4OJNA 5I7SA 1W7AA 1ZUNA 3KDPA 4YMSA 3V8PA 2ZI6A 4FOSA 1NPDA 3PHCA 1G9SA 4GP9A 3O8OA 4B3XA 3O83A 2Y4NA 2IF0A 3FE2A 2O2IA 3VYUB 3ROMA 3BDAA 3TLCA 1C2TA 1Q84A 4YJ2A 2BJVA 1DX6A 3JYHA 5E7JA 3V8NA 4E6EA 3GCXA 4BEJA 3E6AA 1FJHA 4K86A 2YJ6A 1N9KA 4LYGA 4AYWA 1Y33E 2FPGB 3TVTA 4HDRA 3FYTA 4BASA 4JB3A 1LJ8A 3HYCA 4GC9A 4FBLA 4RTKA 4OI0A 4KRXA 4HHEA 2PUAA 1U8UA 3Q7SA 1GKLA 3UT5B 4OQZA 5FHRA 4ZRMA 4BBAA 3DR5A 3KSBC 1FVFA 5ALUA 3UJCA 3FWHA 2HTFA 2QN3A 3DTVA 4OGKA 5K8JB 1KDPA 1KGSA 1P1IA 2B9EA 3L82B 4D0NA 2NU7B 3IPCA 1C9JA 3GR6A 3IDSA 3H1AA 1QORA 3CO5A 1SG9A 3LXUX 4KQKA 1DBIA 2FPMA 1OFVA 3L1IA 4V0SA 4WOJA 2FW6A 1ZMOA 2JGKA 1LBSA 4PLZA 1EFRD 2LNDA 3FZYA 1DU4A 4MICA 2IU0A 5LOVB 1Z6TA 1HT3A 4M8KA 4W9MC 3PA8A 2WT9A 4H3SA 4H4CA 3AF1A 4GKBA 2PO7A 2FZ5A 3IA7A 4QFBA 3BJZA 5D8DA 1WXFA 1S2LA 4MUAA 4K6OA 3HL6A 4PXYA 1QPBA 1OV4A 1WVIA 3WFIA 1GVNB 3QKIA 2O0LA 2ZE7A 3VPXA 2PWYA 3UPTA 5ALPA 3S99A 5DDIP 3RD5A 5IVKA 3JRXA 4EG1A 4MRNA 4A91A 4CEIA 1VKNA 3L49A 4IAOA 1T43A 5BQ5A 1U3CA 4KQMA 3VR0A 3MGAA 5A3JA 4GPAA 5DNYB 3Q8KA 2IW3A 2RFLA 3IGFA 1R0WA 2D00A 2JIPA 3WP0A 2BZ1A 2MU1A 3C3XA 1SCQA 2VRCD 4QWMA 5TQJA 2FSSA 2Q9AA 2J1LA 2Q6IA 1X7HA 4OA8A 1T3LA 1X1CA 4EYSA 2LD4A 3SS9X 4EY4A 1U9ZA 3RDPA 1IBLB 3TG8A 4GLLA 1K5DA 3EXEB 2F3TA 3WLPA 1X9HA 3I64A 2O7SA 3KTAA 4YDQA 3V3TA 4Z7JA 1P1RA 5JZOA 1IMJA 1SRQA 3PICA 1ISHA 2RI1A 2X2OA 1M7HA 1VA5A 4IIVA 1UBUS 2ADFA 3I2FA 3BAZA 4P3NA 5KC9A 2GCPA 2Q5LA 2Z4TA 3H97A 3DEFA 4B82A 4F9EA 1WB9A 3KZ1E 2XB2A 1LV8A 3RNOA 4YRTA 2VNHA 3KPVA 2ZYIA 2BDEA 1K2VN 4YC7A 3CPHA 1PNOA 1TYAE 1KMIY 1YZNA 3UXYA 4TZTA 3CVXA 3SN6A 2I2CA 2FOIA 1SHJA 3MEQA 1WXEA 3QX8A 3OZEA 4HCJA 3ROFA 4EFNA 5BV0A 1LRJA 3KLPX 1OGYA 1EIZA 2C7BA 3UM9A 3EULA 2DPMA 1JV2B 3ZXIA 2H4FA 1JG1A 1KJ9A 1DEKA 3IT0A 4RWZA 2XCTB 2AZXA 2KLHA 1VKRA 2NTVA 2VPXA 4H27A 4PSCA 3ROKA 3IEPA 1IK6A 3L7NA 4RV5A 4BC0A 3TIFA 3CWZA 4BLQA 2AMJA 1T9ZA 4YRPA 3AZQA 1HURA 4FYIA 1NUSA 4YAUA 1W73A 1VFPA 3P2JA 4RKEA 1RPZA 1VKHA 1HG1A 2GD0A 5BORA 4X24A 5IULC 2OHFA 1UC9A 1H2YA 1ORDA 1CJBA 1EX1A 1EVZA 3VVLA 3NKLA 1XJQA 2GILA 3QF7A 4G1FA 1GAEO 3MBKA 4LJ7A 4CTJA 1TGYA 2DFTA 2PVCA 3GVIA 3UWDA 8ABPA 1KEEB 3KJFA 1G6KA 3PXUA 3UXMA 3W6OA 1GLGA 2F48A 3V00A 2F64A 4YRJA 4LYFA 4AMYA 1UEJA 3DM9B 1CY0A 1QS0A 4FE7A 1JSLA 1ZJZA 1ORVA 2J30A 2OV6A 2WMYA 3FPBA 2GUWA 4GMDA 4U63A 3VZBA 3KB8A 4MP3A 1FVOA 1S4QA 3FPKA 3DQPA 3RBVA 1QLJA 4BPBA 3PD0A 4MIKA 5A03A 5C7OO 3I5XA 3TRKA 1N9GA 1YA4A 4LHSA 4D4LA 3RV3A 4X44A 1R6DA 1B8PA 5AW5A 2WMDA 3VR4D 1PKXA 4CMHA 1MDBA 3D8NA 3K2QA 1Z4QA 3QVWA 1TZ2A 2H4JA 4I8DA 5CEJA 4DQVA 3SNKA 3L9XA 3Q3GE 2YFQA 4B5KA 2C7RA 4M49A 2J3EA 2FE4A 2O7QA 1Q57A 3L05A 5FBRB 4NDNE 3ED5A 4XJSA 2BI8A 1SBYA 4BRZA 4CLDA 1YL7A 4ZQCB 9ABPA 4FCWA 1G9TA 4INZA 2R6CA 4EY7A 8GPBA 4LSGA 1TAGA 5I6DA 2IGBA 3BRQA 2BFFA 3M1YA 3TB4A 3RQIA 2BMJA 3PGMA 3HFGA 3X1MA 4KNWA 3ASZA 3ZWDA 4AQ7A 1SQ6A 1YRYE 1HPLA 4L4YA 2XTJA 2YNMD 1FMTA 2JK0A 3CF2A 4TWIA 2CMHA 2PNFA 4HAWA 3TBHA 3EQ9A 4X6XA 4QJBA 3TE6A 3EUEA 1SOAA 1PKEA 4TMKA 5CW2A 4WCFB 4NIMA 5AMXA 5CR9A 5BN1A 1SUWA 2AL7A 3NTUA 2ZUTA 4GM0A 3RS0A 2PGXA 5MFZA 4LE1A 3UXEA 2XQJA 4KHZA 2DFPA 6AT1A 3HXQA 4I1SA 4JLUA 4OHYA 3RU2A 1V6SA 3WGJA 1NJFA 3TUIC 2V4ZA 1MV5A 1KDOA 4ZOCA 5GONA 1J2JA 3VUFA 3GLGE 3UBTA 1YR8A 2O7NA 1HDIA 3F7OA 2QUZA 2IEZA 4HNSA 4MCIA 4UASA 5DN6A 4NXMB 1PWYE 2LP4Y 4HDAA 2FR1A 1D5WA 1XTSA 4GPIB 4ZVUA 1A9PA 1U6JA 2JLXA 4BNIA 5JMPA 2COEA 4BMPB 1QGZA 1ZCFA 2QYTA 1ID8A 4WOCA 4I5GA 2VP6A 2DJ5A 1IZ7A 1FRNA 2FWPA 1V11B 1JDUA 1YDFA 3HYTA 4BC1A 3SPXA 2VHYA 4P31A 2NMVA 4OB6A 2POCA 1X13A 3LQKA 3ADPA 3GRFA 5AW8A 4M0FA 1RMYA 2B35A 5EWLB 3UUWA 2PD6A 2B0JA 3RPEA 3QVKA 3CTMA 1V37A 2BP7B 3C6ZA 4FJ1A 1DZ3A 3T52A 4G8CA 4GMFA 2O8CB 1CUYA 4GX0A 2TMDA 2R6ZA 4AO7A 1GCIA 1RVDA 2QL9A 5BQPA 1UFKA 1XKXA 4DMFA 1TUBB 2GK3A 1VG0B 3A6KA 5E1DA 5T5QA 3U7GA 2OE2A 2YJGA 3V8BA 4NABA 3HYNA 4Y7DA 4QNMA 2GDZA 5FOVA 4MQEA 1WDLA 2VCHA 4GOMD 4O5OA 2WJPA 3JQGB 4ZC1A 4F7DA 2IPLA 5HHTA 2F7SA 2O2ZA 1E1DA 2Y77A 2FPSA 3LY5A 3OOHA 3V2UA 9GPBA 5JJLA 3O8RA 5HG0A 4C7VA 3WO1A 4CMBA 3OETA 3PJEA 2GYVA 4LHEA 5L3RA 3RIMA 2QV7A 3E48A 3MINB 4LTDA 1XNQB 1X7YB 5BW4A 2EFCB 5IFLA 3K30A 5AD1A 3PPVA 3VU3A 5CM2Z 3CUWA 3W9UA 1KAEA 3AZOA 3I01M 2PKQO 1EJ2A 5GZ6A 1DXHA 1XMVA 2HZ7A 2ZDGA 5K4GA 4DHEA 5A4AA 2QHXA 2P2YA 4RTOA 3EIUA 3M6WA 5FI0B 1ZKMA 1ONOA 1LPMA 1YS2X 2G36A 5K8VA 1U9YA 5HRAA 3B60A 2E82A 3FZQA 4MKIA 4WFIA 4BJ1A 5CNJA 4I4TF 4QQKA 3T1TA 1Z28A 1NE7A 1YZYA 2DHRA 2G4LA 3KKPA 3IYLW 4G9EA 1FS4A 5EEHA 1GQFA 2A92A 2PKWA 2XR1A 3A06A 4IOLA 3RC8A 3KKQA 3CNBA 4H6XA 1YR6A 4WH0A 5H02A 4ME6A 3GW8A 4Q7JB 5AKZA 4LZZA 4CDRA 2QUIA 1YD7A 3AF0A 3D7MA 1XTJA 5CH5A 2XAAA 5EUMA 5ESXA 1GU0A 1OWPA 4RIGA 2CMGA 2QLFA 1LU9A 1L5WA 3QKTA 4FMPA 4DIFA 4O4LA 4ARVA 1OLUB 3ZJTA 1VRWA 4B73A 1X8KA 2BRUA 3Q5EA 2WE8A 3IR5A 4TV9B 4ZCMA 4CKWA 3OMWA 1DQPA 4L2IB 4PYOA 1Z8DA 1DARA 2ODPA 3OKAA 1PDWA 4HAYA 4V03A 3V4PB 3KZOA 1X80A 3HBNA 1YVUA 3W5JA 4W5NA 1VHJA 1GXSB 1ML4A 1ENYA 2CHFA 2XVXA 3O26A 1GDDA 3UHOA 4EYQA 5ELLA 3DAPA 5H0IA 2VDWB 1XTIA 1BVRA 4ZCLA 2XMGA 1ZITA 2NVBA 3THYB 3Q88A 4LYDA 4F3RA 4RCZA 1JAIA 2RJ3A 1GN9A 1Q7GA 3A31A 3I23A 4HJRA 4TKZA 4MUJA 5AICA 1MD9A 4WTOA 5IG2A 1SELA 4QARA 4M88A 3NKVA 4L07A 2PAFA 4AAYA 1O96B 4IPTA 1T2CA 1TECE 4OK3A 3BRWD 2BSQA 1CEYA 3W9SA 1B15A 3WWOA 3ZCTA 4DBLE 3WGOA 4XUDA 2XX3A 1JT2A 1T0UA 1UZAA 2QPAA 3ZLTA 5L7WA 4HB4A 5C35A 4AZ3A 2I8CA 1X80B 5KYTA 1GXSA 4UDYX 4F4JA 2DEUA 2DT8A 4ARSA 4HZUA 3BTSA 4IHJB 4OIFA 3KQVA 2CJWB 1UM8A 3NT4A 5JOQA 3C87A 4IJMA 4PO9A 3G2IA 5JMWA 3G0HA 2RH8A 2X40A 1I14A 2CBGA 1LWOA 4CWAA 5FT9A 4NXNB 3NIDB 3QRWA 5D3MA 4ROSA 4EKIA 5AVXA 4UFOA 2I6XA 4FP9A 4TLEA 1XV5A 1PYOA 1QF7A 1JJIA 1H1TA 4QUGA 5ICFA 1ZIOA 1M8GA 1XK7A 2WINI 5HBRA 4YX9A 2OXEA 1O08A 4KO4S 3FNIA 4NYIQ 3EMKA 4UW9A 1C0PA 3FVWA 2CXNA 2VA8A 2VF2A 1VMAA 4LZNA 3RQSA 4ZEXA 5HK9A 2QVXX 3PHGA 4PRZA 1FTYA 2QG9A 1CB0A 1JTEA 2JASA 2F3UA 5D5PA 1J49A 3NG1A 4I6GA 3RUIA 3TJMA 3U4IA 5B1EA 1CZNA 5AVQA 2HFKA 2OD7A 3ICVA 3I45A 2YZMA 5J2TF 1OXTA 2LR0A 4JCCA 2VYND 4R3UC 3F9IA 5IW8A 3PFHA 3KQNA 1X38A 4WLNA 3UENA 1N5LA 4U7HA 5D3MB 5ARCA 1ZHFA 2GF2A 4NU5A 4X90A 4OH1A 1Z5ZA 2Q0QA 4R68A 1N3LA 2A58A 4Y9SA 3OZFA 2H2DA 3FCUB 4M2LA 4BCBA 1Z15A 2WAXA 1DZIA 2AN4A 2ATEA 2F8MA 1QB7A 4JGGA 4D9NA 2GZSA 4JSRA 5D84A 4CT5A 1HZZC 4YCAA 1NX9A 2IY9A 3NAQA 4L74A 3FYUB 3E82A 4CCSA 3HJNA 2N0SA 2WNIA 4K1XA 4MEBA 4UTXA 3D2AA 3D43A 3E5RA 3EARA 3INRA 4JJGA 3O4IA 4C0KA 3SVTA 1U8ZA 4WY8A 2H1OA 3WTBA 4Q16A 1IDN1 4KP7A 2AEFA 3JWIA 4YAFA 1CUZA 3LS2A 3U7FB 2BUAA 3BF8A 3F98A 2BLNA 1D2CA 1O1YA 1Y3HA 2J9GA 4WBSA 4YMGA 5JJKA 4FPXA 2G3DA 1BW9B 1E2DA 1SCAA 2XVMA 4L76A 4DPKA 3L4BA 4WNYA 4M7RA 5HS4A 3Q87B 2EV9A 2VJAA 1O97D 3A0UA 3B20A 5HW0A 1P4JA 3LWNA 3DPIA 3PQ6A 3AHCA 3RVMA 1ESEA 2Q27A 1N25A 1YIOA 5K8IA 1KEKA 3ONDA 4FDTA 2DUMA 1N0WA 1D2MA 3CT6A 4WKOA 3W5DA 1WCIA 2WVGA 4P4SB 1PV1A 4INAA 2E87A 2C4WA 3SG0A 2D2VA 2FVYA 1E2MA 3R7AA 4CGYA 4YWHA 5BQFA 5AK3A 1SGWA 3N0XA 2OGSA 5TR9A 1M0WA 5BSRA 1A98A 1LZKA 3M8KA 5ESWA 2HRQA 4Y98A 4EQ6A 2EKZA 2A54A 1AKQA 2Q3CA 4PZ0A 2I0FA 5ENVA 2I4OA 1TLFA 1UINA 4J0GA 4MZXA 5EXXA 4E5DA 4PV7A 5DN9A 2DWPA 3A1UA 3O73A 1QJ4A 4F46A 3KQUA 1W5TA 1MFZA 1Q17A 4DRXA 2PJRA 2HWYA 3OFNA 3PDIB 4RPGA 5TF4A 4DDKA 2BHRA 3CB4A 1COZA 2CZCA 5DNDA 4Y1RA 5BNFA 1E2PA 1PBTA 4JI5B 2PMDA 3W8EA 3GBSA 3UPDA 5JAMA 3GJ6A 3GLHB 3UJNA 2XQKA 3DBVO 3FSGA 2BUBA 3AKDA 3E8XA 3FNFA 1PR9A 1I51A 2PV0A 2Q1TA 1T4CA 3KM0A 4M7OA 1OB2A 2WC1A 3OY7A 3AJEA 5CHEA 1TLTA 2R65A 1BU8A 1MIOB 1WZNA 2C1ZA 3LMKA 3IUYA 3NI2A 1IPEA 4FU0A 3KU4A 4O3MA 4YMUA 2FFHA 4QXQA 5K45A 4OFXA 4UEOA 5ES3A 2GM3A 4E5VA 1N1GA 3LZDA 2AWOA 3WYAA 3KYCB 4P0TA 5KQLA 2GJ8A 3ENWA 2E4UA 2H1LA 3L79A 2VKTA 1KVSA 1PQYA 2IF2A 3SQOA 3OPQA 4ALIA 2AB0A 4BZQA 1H4VB 2B1QA 4UTOA 1NI5A 5EJ7A 1TKCA 1N2GA 1XZNA 5G4LA 3B2EA 4UNSA 2GXAA 4BRUA 1F7VA 1T10A 2C9YA 4LDPA 5ESRA 1GNVA 4BNGA 5CDFE 1EESA 5J1TB 4E5UA 5EE0A 3FNRA 4UU1A 3CV3A 4RHUA 1B1CA 1M33A 2C1XA 2Q0SA 5AT1A 2RE8A 4E2WA 4M37A 5JXGA 4CUJA 5KNDH 3W5UA 3C1AA 1KY5A 5L3SB 3ICCA 4RNDB 3LBHA 1GZSA 3ESBA 4CF5A 2C2HA 3QHQA 3QXXA 4P35A 5ITSA 1P0MA 4AMUA 1IJEA 2FPRA 3AIOA 2I4RA 4CV2A 3BWMA 1JNXX 1YDHA 3O93A 2C9DA 3CUUA 1GGMA 1NIJA 1X74A 1XVIA 2W2PA 1K92A 3H8SA 3OT4A 2O3RA 3P71T 4YGYA 5CB6A 3CEAA 2C96A 3IE1A 3IBTA 3KR2A 2J5QA 4P1ZA 3RB8A 4MWSA 3ZCSA 1IEVA 1AGPA 1PSDA 4P4UA 5IWAB 2YBEA 4YA6A 2UYCA 2BMEA 4Z1OA 1TTQB 4BIMA 4QYSA 1HNZB 4D57A 1CS0A 2G0NA 2AJBA 2V5UA 3CFIA 3SXUA 5CD9A 3TM4A 3NTOA 1KQGA 3ZHOA 1P6XA 2P30A 2RBEA 4J03A 3KPYA 1QRTA 3O47A 3C3MA 2HCFA 3GP5A 1ZY2A 4GH5A 2B1RA 2D5AA 2H1SA 2FPGA 4LX8A 1J25A 4CTKA 1Q0PA 1NDUA 4JQOA 1E79D 3W90A 1C9YA 1JXQA 4I14A 2F67A 3RVNA 5BNTA 2UU9B 5BV2P 1N34B 3ZHYA 3K09C 1GV0A 2JGDB 3KOZA 3TNFA 4CKZA 4JI2B 1O5TA 1K0FA 1JA9A 1TK3A 1WZIA 2P75A 3KPUA 5GWXA 5FNVF 2OYCA 1WA5A 3AYXB 2HA7A 4PX3A 3N8NA 2HRCA 2SCUB 3P9ZA 1V95A 3FNEA 3CN7A 1JHMA 1P2VA 2PRZA 3QE3A 4S0XA 1WW2A 4DCUA 4PLFA 4J3JA 1XO1A 4ABTA 4HBGA 1HEIA 3MAJA 5JHHB 3O92A 1L8XA 2FXVA 2Y1WA 4NQRA 5KS2A 1R6TA 1CX9B 1SA0B 2B4KA 4LVUA 4EYKA 1YTUA 3E53A 1H2ZA 4R0NA 3MGKA 4RA9A 5EZYF 3QI2A 4OHOA 4H0CA 3H9GA 2YVQA 3DZGA 1U5BB 4WGFA 3ZE0B 1MBZA 5C8YB 3LC0A 1K8RA 3ODGA 4N6NA 4X95A 5FAXA 5ITVA 1BD4A 3KJQA 2O0JA 3IP3A 4IV0A 4RSHA 2QX4A 1L9XA 4NYJQ 4OD0A 1A5BB 1X3SA 3BGVA 3GFSA 3MUNA 4GGMX 5B3JA 4B9EA 4G85A 4JENA 3VI4B 2JFBA 2RAFA 2OHJA 3T15A 3UFXB 5KVCA 1L8QA 2JL1A 4FUTA 3Q8XB 3CISA 4B3BA 3IAM1 3BQ9A 4WJKB 4Y2YA 1DMRA 5CUQA 3GGJA 1OZGA 2FZLA 2G06A 3E9ZA 3PUYA 1EFPA 1XEWX 1ZBDA 2E37A 2K7ZA 4U4AA 5F7OA 4TQUS 1H2WA 4PAOA 3ZNNA 3WL6A 2NO4A 1YI0A 4EHDA 4LZWA 1C14A 3NHRA 1ZDMA 4P82A 3T5PA 1W88B 3CUTA 1ZD4A 4EJFA 2WVHA 3DB2A 1NLUA 3RYIB 3M33A 1DIHA 4RXTA 1C7IA 1DX9A 2BCJQ 1WU7A 4Y2TA 2R87A 1YB5A 5KJEA 2F55A 5JG7A 2B7BA 1P7CA 2JDIA 2MSWA 3MT9A 4FFMA 4WXEA 5DULA 1VYUA 4ATNA 5BQXA 3P2OA 5TGZA 3OUTA 3PTAA 2PEZA 4MYUA 4QYTA 5CFZA 4ROTA 5LIPA 2VWGA 2XUZA 4F97A 5DJ5A 2CLSA 4L4UA 2WMNB 2W6IA 4P5PA 1WLSA 4DDTA 2VF7A 1U8FO 1CF9A 1E20A 3M4ZA 5DU2A 5JSZA 4OYLA 3IIEA 2ZRNA 2JGDA 2R6GA 4GUDA 4PZZA 5JIBA 2B5WA 4ZIRB 5KSWB 5F2EA 1QO0A 2D13A 1WZCA 3QA9A 3RADC 1HRKA 1YE5A 3KCNA 4N7BA 4C2TA 1RW4A 5BOVA 2IYWA 4DT1A 3PFBA 4KTTE 2V7BA 3C39A 4IQ0A 3H8JA 4HYEA 3IJRA 3O3MB 4LC9A 1ZGHA 3GZTB 1HKUA 4OYYA 3AOEC 1J24A 1S96A 2V97A 4QTTB 5EVCA 4XYMA 5EFOA 3SCZA 3MPUA 3PDCA 4OKNA 1JHXA 2HJSA 4LQCA 5JPIA 4V1CB 2PA0A 5L3ZA 5CA0B 2ZPTX 3SBDA 2HC9A 2W2LD 3HXOA 1DG3A 1L5SA 2I66A 2L0XA 3HEAA 1T3ZA 4NONA 4KZPA 3QVSA 4N5IX 4ZU6X 3ZU3A 2OB1A 4U2KA 1PV4A 3CX8A 3DYIA 1M74A 4O4IF 4ECEA 1UBJS 3W3AA 3E7PA 1HRDA 4D9BA 9ATCA 1SBIA 3A1DA 3GRCA 5KYUB 1PJ8A 3LBAA 3SC2A 2MSNA 3T38A 4CKBA 5B55A 4NCBA 3N8HA 1TU3A 1V2GA 3I0MA 3MHPA 4P34A 4W7IA 2A0YA 3VZCA 3EDMA 5CDYA 2ODTX 4NI5A 2NTJA 1YMVA 2H65A 4Q21A 1FDSA 1XLVA 2GN9A 4GRAA 3V4FA 1N36B 2PL1A 3OE7A 1G2IA 2IYVA 1PG0A 3CCFA 1EVEA 4IGFA 3M5CA 4WBNF 4F38A 1LB1B 4E0BA 2FAXA 2ODBA 4AMGA 2XUPA 3V33A 4OLBA 3GK3A 2UXCB 1GU1A 5ETJA 4BTLA 4R8VA 2B6NA 4NZZA 3UMFA 2BAGA 1VE9A 1Q91A 2YYAA 1QHSA 2AFRA 3GEEA 1E69A 3P2KA 3LO5A 2VF5X 3WZMA 4LN1A 4RCYA 2W90A 1O94A 3KEMA 1M6VB 2IOFA 4IQFA 1M1YA 4O2AB 1MABA 4RK4A 1QV7A 4HDSA 3DPUA 4N12A 1DKNA 3I62A 1PD0A 1H05A 3L0CA 4X6UA 2M6KA 2WVAA 3TL3A 3LQ2A 2ERCA 3KSDO 3WQQA 2XB6A 1R5JA 3P2YA 1WM1A 2HLDA 1K63A 1J56A 1ARZA 4O4JA 1UM9B 5A4JA 2XDWA 4GPZA 3EXAA 1OAKA 3U60B 3DAHA 4QLOA 1K08A 2AH5A 3BD8A 3HV2A 3OO0A 5IUKC 3BXGA 5D86A 5E8RA 1YUNA 2QIOA 4FHGA 4KNVA 4LFCB 3ELDA 3RI3A 2R00C 1LI5A 3PUWA 1GDHA 1J70A 2IECA 2AFHE 1N2HA 2DPXA 3CINA 3GYGA 3QPUA 4OY3A 4Z9BA 5K4AA 4CMIA 4DMUB 5C7YA 2QAGC 1GPLA 2JAOA 3IALA 1FNMA 3LX4A 3RFXA 3U62A 3BKWA 1S3GA 4Y1RB 1SKAA 2G17A 2G9RA 4ZKDA 2FW7A 2PH1A 2XAUA 2GM9A 3DWIA 3PGLA 2ZYWX 2VTEA 5EERA 2P69A 4B31A 2V6MA 4IRXA 3GEPA 1E2KA 1AMOA 1EAYA 3U4DA 1J5PA 4TLDA 3FM9A 3L04A 3OHPA 1MN6A 3USCS 5IH7A 1E59A 3DZ8A 3VR5H 3KQTA 3WLFA 2BY4A 1FVXA 2ZJ4A 2YWHA 1PZMA 3ZBUA 4EUFA 5IT0A 5H59A 5FR1A 2I1WA 5LR6A 4QOHA 1NFRA 2AJCA 2MDTA 3L43A 3ML1A 8ATCA 2XCLA 3PFFA 4N49A 3GJSA 4PPGA 3ZR4B 1PT8A 2XNDD 1HGXA 1MVOA 2JPDA 1PEYA 3I9JA 3H2HA 2Z4SA 5TS2A 3UFXA 3MXOA 4BNJA 4DDUA 1L4KA 4IG4A 1TDJA 3GDGA 1X7YA 1WULS 3M2TA 4AJEA 4EM6A