4MUIA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(4-methoxyphenylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
283
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 95
structure length 283
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muiA01
4EG3A 5K0TA 2QJOA 3F3MA 1KQOA 1JEEA 4EF6A 4HPWA 3CLRD 4YP5A 5TEWA 4K03A 1KKUA 2J08A 3RBAA 3VU8A 3DO8A 1WQ4A 1NUSA 1PFYA 4BWVA 1GTSA 1EFVA 1O6BA 4DDKA 3KT8A 2CV1A 3ND6A 2X0KA 1O97D 1R6TA 4MUNA 1XNGA 3RHSA 1IRXA 5KCMA 4XSVA 1EXDA 3LE8A 1MJHA 1T6YA 1NUTA 2WQ7A 3CVUA 3BL5A 1LI5A 2QJFA 2O5RA 4NDAA 3H99A 5HUJA 1N2JA 4XFJA 4NAUA 1LI7A 1ZH0A 1B6TA 1OWNA 1NUUA 5KWVA 1LW7A 1U7XA 1QJCA 4MW2A 1HYBA 3K32A 3AIIA 1H1TA 3L93A 3SYTA 1TYCA 1O5TA 4YBRA 1QU3A 1ZH6A 1Q15A 4JZYA 1WXHA 1ZJWA 3CLSC 4MW5A 1I2DA 3SEZA 4F4HA 4G6ZA 1ZUNA 5TGTA 2VXOA 4ZCQA 4ARCA 3COYA 2PZ8A 3TQIA 3ISJA 4MUHA 5H16A 3A2KA 4QBTA 1WZ2A 3MXTA 1PG2A 1NP7A 4R2LA 4ARIA 1H3EA 5FO0A 3HL4A 2YXNA 3ZXSA 1OBCA 1GAXA 3N8HA 1CT9A 4HJRA 1OWPA 2CSXA 3P0HA 3CLUD 3D6VA 5J59A 3VRHA 1M8KA 3LOQA 2DXIA 4OUDB 2GKSA 2ZUFA 1N2GA 1NSYA 3G6KA 2PZAA 4DDMA 1D2RA 1I6KA 3I05A 2QJTA 3Q12A 1J1UA 1TFUA 2A88A 3X1KA 4G5FA 1K92A 1V47A 2PXHA 3HZRA 2JA2A 3KFLA 1NYLA 2A1TR 4NATA 2QTRA 3ZXIA 1O95C 1ULHA 4NAHA 3ND7A 2A4MA 4JXZA 1P7PA 4MW0A 1YIDA 2ZP1A 2X1LA 4PBTA 4J76A 4ZCRA 1MBZA 1TYBE 2TS1A 4TS1A 2D13A 5TEVA 2CT8A 1WXIA 2CFOA 2QTNA 1KAQA 1J1ZA 3CR8A 4FZJA 1NURA 1N2OA 2DERA 3NBAA 4ZT3A 1IH8A 5LLTA 1GZUA 5DEOA 3K9WA 4ZT6A 3FH0A 4EGAA 2H29A 3H9BA 1KQNA 3RFFA 1TEZA 1S4MA 2QUIA 5DK4A 4ZCTA 4GRIA 4I6EA 3MLAA 3E27A 2PZBA 2WQ6A 1I6MA 3PNBA 1GN8A 3IOEA 1EFPA 3SP1A 4MUGA 5IHXA 3FG9A 4E1AA 1EFPB 3SDBA 3ZGZA 2R5WA 1OBHA 5J5AA 3HMQA 3X1MA 2IP1A 4JYZA 3MUEA 3IMGA 3QTTA 4Q93A 3N2YA 2O8VA 1N2IA 1WJGA 1GLNA 2X1MA 3ZJUA 1T6ZA 4MUEA 5HG0A 1JZQA 3IVCA 2DPLA 3CLSD 3CLTC 3RK0A 1JEDA 1U0BB 1J70A 4YP6A 3KT6A 4GU5A 3NBKA 1WQ3A 3IMEA 2NSYA 3FOCA 1QRUA 2HGZA 2OQ2A 4MW4A 3PXUA 2HZ7A 4I6JA 3ELBA 2Z08A 1RQGA 2YWBA 1QNFA 4MVXA 3IUEA 3MMXA 4PBRA 3KT3A 3PRHA 4HK4A 2A84A 1PFWA 1JIIA 2NZ2A 1OWOA 4ND7A 1WXFA 1JGTA 1PFUA 5K0SA 4OJMX 3OTWA 4AS1A 4MW6A 2QUKA 2DUMA 1N2HA 1K4KA 1WKBA 3IUBA 4EG7A 3FI0A 3H9CA 1WXGA 4MWDA 1O95D 4HJXA 1EUQA 1U3CA 1VBKA 1O94C 1G8FA 4RPIA 4AQ7A 1XNJA 1KH2A 1PFVA 1QQTA 1N2BA 1KQPA 2PG3A 3G5AA 2JANA 4MAFA 2BYTA 4EG5A 1OWMA 4DDHA 3VGJA 3IVGA 2QUHA 4ZT4A 4MW1A 5AHWA 1JIKA 3G59A 1QRTA 1FFYA 4U63A 4XFDA 3CVVA 1OWLA 2A86A 3CVWA 1YI8A 1R6UA 3CLRC 2Z09A 4DJAA 4MULA 1M8PA 2DR2A 3QE4A 1VLHA 5DB4A 4OUDA 2X3FA 3GMIA 2G36A 1H3FA 4Q16A 3CA8A 3TQOA 4UZFA 1NZJA 1WY5A 1JIJA 4MWEA 2WB2A 3TZLA 3COVA 1O97C 3D6UA 5TS2A 1X6VA 1IQRA 2PIDA 1KR2A 2E18A 4ZCSA 1U7DA 3A04A 2E89A 4CDMA 5DASA 1VBMA 2V0GA 1J09A 2J07A 1G8GA 3PNVA 2XRYA 2GM3A 1K97A 5KHAA 3OP1A 3S3TA 3HGMA 3SZGA 4DE5A 1U3DA 2QUJA 1Y42X 5HUHA 4NZPA 3DPIA 1YULA 3CLTD 2JAXA 1IHOA 4ZT7A 1J21A 2IELA 2A1TS 3Q10A 1KP3A 3P52A 3IH5A 1G59A 1Q77A 4EG8A 3DV2A 1YIAA 1I6LA 2HMAA 5FNZA 3TNJA 3N9IA 1F4LA 1M8GA 2CYAA 4QREA 1IQUA 3COWA 1YUNA 2A7XA 2CYBA 3FWKA 1IVSA 2CYCA 1JHDA 3ZUGA 4ND6A 2EJCA 1MOPA 1K4MA 4RUKA 3CLUC 1XJQA 3RK1A 1PG0A 3UK2A 2IJGX 3IVXA 4G5YA 3P0IA 3Q4GA 3SZ3A 1N78A 3TZEA 2WSIA 1F7UA 3IDFA 1ILEA 1MAUA 3COZA 1FYDA 1IFXA 1DNPA 5F23A 3RJZA 1M1ZA 1EE1A 2RD2A 1JECA 1G8HA 3X1JA 3KT0A 3LCJA 1EUYA 4MVYA 3A05A 5IJXA 3H97A 2J09A 3FETA 4DNXA 4CDNA 1TYAE 1MAWA 2CV0A 3AL0C 1MC1A 3M5WA 3AG6A 5JBNA 1GTRA 1QRSA 1GPMA 1M8JA 2DLCX 1TQ8A 2AZXA 1H3NA 1N1DA 1UFVA 1EFVB 5H7XA 3UOWA 3ZIUA 1N3LA 3HFJA 2Z3VA 3P0JA 2DEUA 4QRDA 3CVXA 4KKVA 3AFHA 1F7VA 4MW7A 3U1VA 1QTQA 4NX2A 3AG5A 1JILA 1NUPA 3ND5A 1N2EA 4UZEA 4ZCPA 1EJ2A 4KR6A 3SEQA 2YWCA 1O0CA 3NV7A 1MRZA 1NI5A 3MLBA 4JXXA 1COZA 2RE8A 4R2MA 4KR9A 4EG6A 4S1OA 3GUZA 3FY4A 4WSOA 1Q19A 5FO1A 2BTEA 1IQ0A 3QTBA 5BNZA 3UY4A 3CVYA 3FNRA 4ZT2A 1WOYA 2B7LA 2OV4A 2CUZA 4DLPA 1F9AA 4MW9A 1KORA 4MWBA 2E0IA 4F3RA 5LFAA 2V0CA 4U8HA 4PBSA 2E21A 4EG4A 1Q11A 4MVCA 3A4IA 3INNA 4KPUA 1MB9A 1X8XA 4A91A 1V8FA 1SURA 3PNYA 1OD6A 3JXEA 4JFAA 4KPUB 3IOCA 5EKDA 1VL2A 2D54A 3IODA 1R6XA 2YY5A 3L92A 4CQNA 3N05A 2AG6A 2CV2A 4U7JA 3HV0A 3IOBA 2XRZA 1J20A 1KH1A 2J4DA 1JZSA 4CT0A 4WNYA 3UMVA 1O0BA 4X0EA 3DLAA 4MLPA 1NUQA 1WXEA 1KH3A 1O96A 1TYDE 2I1LA 3GLVA 1YUMA 1QU2A 2A1UA 1O96B 3C8ZA 3ZJTA 1N77A 3TS1A 4J75A 4EFKA 5LM3A 3IMCA 1VBNA 2A1UB 4H3SA 3FDXA 2C5SA 2PFSA 1A8HA 4EG1A 4KR7A 3ZJVA 4MUIA 2H2AA 4L2IA 4ZT5A 4YMIA 1XNHA 5J58A 1T9GR 2QTMA 4L2IB 2VTBA 4MUJA 2EL7A 2VTBB 4MWCA 3FHJA 4MUFA 4MVWA 1KAMA 2J5BA 4I6GA 2GOYA 4R0NA 4K0RA 2ZUEA 4MQ6A 1JMVA 1M83A 2D5BA 1O94D 1KP2A 4MUKA 1MB2A 3AKZA 1N75A 1BS2A 1M8FA 3UC5A 1T9GS 1T6XA 4PY2A 3H05A 4P2BA 3FIUA 2DETA 3ILVA 4YP7A 2AKEA
chains in the Genus database with same CATH superfamily
1U4OA 3FMVA 1ZM7A 2JIRA 3KUDA 1L4EA 2UZ3A 5CMLA 5IN5A 5CB4B 2APJA 1JEYB 5FKJA 6NULA 3BL8A 3A9TA 3V2GA 4ZYXA 1EP1B 1I2CA 2Q3LA 4UAUA 3E22A 3DBVO 3N76A 4UBOA 4YP5A 3RANA 1C9KA 3K94A 2UXCB 4H1WA 4K03A 3SJUA 1R12A 4YRZA 1QTIA 1PFYA 1TVMA 1X39A 3NH9A 3W4JA 2BL4A 3F0TA 3QUSA 1BWSA 1V5WA 4JT9A 3OC0A 1CWUA 1UK8A 3KT8A 1UFKA 2MYUA 2C5LA 3O4FA 3W1WA 3EVNA 5KCZA 3V8NA 2BH9A 2RGBA 2ALJA 3R6DA 4KJZA 2QU8A 3GVHA 3U9TA 4E5MA 5AVWA 1XCGB 1FRVA 3C8HA 1A3CA 3GFOA 1A8UA 2EJUA 4XVHA 3H16A 3H1GA 3NOXA 4HNSA 4DSNA 2PJRA 4JT4A 3BL5A 2WB2A 2V7GA 1DQRA 1QIEA 4W1PA 3V48A 4D5EA 4C21A 2OHOA 3C3EA 2W93A 1M0WA 1P2TA 1QAMA 1H9BA 3QNMA 4N0PA 1DT3A 1H66A 2I3AA 5JARA 1CSEE 4GBED 1KDZA 4FC7A 1LW7A 5E8JA 4ECEA 1HYBA 1ZI8A 3IIIA 1N6LA 4E4YA 1MDFA 4LHWA 5JR3A 4X6XA 4D46A 4J0EA 1XBTA 3EDRA 4HF7A 3SD7A 2RJNA 1AK9A 3WLRA 1E2PA 2GD1O 3PP8A 4G1FA 2ZIXA 2BR4A 3QBEA 4ZOEA 1ZJWA 1U0LA 3CNNA 3PTLA 1LX7A 4C0KA 3T5DA 1QGDA 2HA3A 1FLAA 3D0KA 3WRVA 4CUJA 1G5HA 2VXOA 4BCBA 5ALLA 4R8VA 5DMXA 3RIHA 1KYWA 1GQOA 2QMUA 4KHZA 4MDHA 3DVQX 4DTCA 3A2KA 4ZYWA 3TM4A 3ZR4B 1A7JA 4B3SB 2W70A 1GPDG 5ALRA 4D8VA 8OHMA 4FQ5A 3AKDA 1GN9A 4EGFA 4GLFA 5DI9A 3U3ZA 4DSTA 721PA 4G36A 1CRZA 2XX3A 1U9IA 4PX3A 4YMGA 2YYSA 1H69A 4LJ6A 1VCMA 2FWBA 1WWKA 5FCDA 4MRPA 4QQRA 1P8JA 4DWWA 2NU8A 4JH0A 5BR1A 5LXTA 1OYWA 1T13A 1UF9A 2OCAA 1YV9A 2QUZA 2ADOA 1F2TA 4QSMA 3QH4A 3TMYA 5CB8A 4RD3A 4B3GA 2CCKA 2PEZA 1JMYA 2ZR7A 3GLFA 1XD2A 3ZDRA 4G0NA 1GUAA 2IITA 2ERYA 4QUGA 1HA3A 4WBNA 4N12A 4UUNA 3E81A 1Q6YA 3G2JA 2OILA 3HZRA 4ZK2A 1JQDA 2A1TR 3P27A 4AS2A 2CXXA 3Q8MA 4LOIA 4DCNA 5CJ2A 3C3WA 5DZSA 3FMFA 3QFRA 1BX3A 5EP3A 4LGMA 4GYJA 2BMWA 4ZCRA 1MBZA 5H82A 2QAJA 3RVRA 3HU5A 2RARA 3LUKA 3EMBA 3GVIA 1NBAA 2FUG6 3U4AA 4D4KA 4YDQA 2OCLA 5HS4A 2DX7A 1NVDA 3KLMX 4QIHA 4Y1GA 1JFRA 3UGKA 4AM8A 5BVHB 2C5HA 5DNYB 5JSUA 1IPEA 3I1JA 2CY0A 5JMOA 4P4SA 1E8NA 1GUBA 2JHAA 3IJEB 1KQNA 1SUAA 1HT2E 1CDOA 2FSHA 4V0RA 4ZO8A 1BA3A 1UMDB 2X6TA 3MCTA 1JEAA 1I3OA 3CKKA 1JJ7A 1WXWA 4MQ4A 6PFKA 1VLQA 1KEPA 4C4ZA 2FMXA 1T4DA 1TJ4A 3KJFA 1U2DC 3ED1A 3FM9A 1JHRA 1FYFA 2ETXA 2WQ6A 2RGNC 4W4TA 1OLUB 2D2FA 4HI0E 4L6AA 1YC2A 2ZR8A 3A10A 4B5LA 2R0QC 4FS3A 2PS0A 3EOAI 2HLHA 5DTIA 4U3JA 1DDGA 1JZTA 5CW1A 2PUTA 3BYZA 4TVKA 1I5OA 3IKTA 3LBYA 3K0HA 2JLWA 5A0VA 4E3WA 3LQ4A 2IP1A 2I03A 3A9UA 3AR6A 4JJEA 1UZLA 3U1BA 4YRIA 3BTSA 1Y8AA 3K9QO 4BJ1A 3B1FA 3EZFA 2WM2A 3Q9UA 2Y2UA 3FWHA 2CNNA 5GONB 1LVUA 3S2YA 2RH9B 3PXCX 4DOMA 5AQ1A 1C14A 1L5WA 3LUAA 5H70A 5A4JA 4C0XA 1U0BB 2Q49A 3QWHA 3GZJA 4RJKA 1CY8A 1D5CA 2QKYA 1VGVA 2QXYA 4RYLA 4TLEA 5FH9A 5DMHA 2HSGA 1Z07A 2VPXA 4BTVA 4M8NE 3IFSA 2I2WA 4L5AA 1A04A 1W0JD 4G4IA 2H1FA 4XLTA 4DCSA 5DIFA 3DDOA 1ZGCA 2GKOA 2PH3A 3E8SA 3L40A 1L7NA 4I6JA 3SXJA 2VZ8A 3E18A 4G4SP 4DRYA 5CDGA 5EJ8A 4QGSA 1DV2A 2W2KB 5AJXA 1FQKA 2GAAA 3IELA 4QARA 1XDSA 3HM9A 1SPBS 2HMUA 4KH1A 3ZWWA 4IDBA 1M6VA 2Y0CA 3ENWA 4TMZA 4WFKA 4FKBA 2PFGA 3LTEA 4LXIA 3W8DA 4CLDA 4JGGA 4Z7QB 1LBIA 1PFUA 5BUSA 5I7WA 2Z3ZA 4DDUA 1EVIA 2VBIA 1YL7A 2IE8A 3NX4A 3R7WA 2AF3C 1RBZA 1T9KA 3BE8A 4WVLA 4BYGA 1DX6A 1ORRA 4V0LA 3RKSA 4DJFC 4CMBA 3OU7A 3UAXA 3U9SA 3PC2A 2HY7A 4ZZ3A 4TYWA 1EG2A 3O2NA 2WU1A 3EQ6A 3ZW8A 4F5EA 4O4HB 1Z28A 3HO1A 3R40A 5EUCA 2IXEA 5JNRA 1I3MA 4MWDA 4BPBA 1JXQA 1ORIA 1BS1A 5REQA 4C4YA 4PWYA 4UCQA 1LWNA 4QAQA 1N7IA 3R1IA 1YBFA 3WK9A 1T8SA 3L7IA 4PLHA 3U19A 4PLGA 3NC0C 3NHBA 1CIVA 5HNKA 1S3GA 3FJ1A 1PFVA 4KGXA 3PUWA 1N2BA 1KZ6A 4TUYA 2O2GA 3V9AA 4AJ1A 5JDIC 5KYWB 3JAWB 4X1KB 4MRSA 2NVWA 4S35A 4EVQA 4P9NA 3OEYA 2XD4A 5JEDA 1HYEA 1Y5LA 3PNKA 2KJQA 3TLCA 8MHTA 5TPZD 3ZPXA 3FWNA 3ZLUA 2O14A 4CPDA 2DUUA 2J3JA 2AS0A 2B8TA 2IYSA 4NHOA 4EB0A 2Z0MA 2WTAA 2V58A 2J0UA 5HF5A 1VB5A 4RJJA 1TM1E 1BOOA 3GMIA 1MT3A 2BEVA 1VHQA 2QDXA 4MYSA 4TPKA 5CVEA 2OYRA 5BURA 1XRMA 2ZLBA 3U7JA 1G8YA 1HDZA 1U1DA 4U5QA 2D5CA 5ES3A 2C3YA 4BZQA 4AY4A 1SH7A 1RYHA 1ABFA 1UM8A 3R23A 4NHEA 3RIYA 3WO0A 5TS2A 3EPRA 3STTA 3K31A 3KFXA 4XH9B 3VHQA 5HKBA 4U9IS 1DIOB 2GI4A 2XGOA 4AJHA 4ZCSA 5I4BA 1U7DA 6ABPA 1E9SA 3KYDA 1ODKA 2BEUA 1VBMA 3Q11A 4E7PA 3BSWA 2V0GA 4L5CA 3QMMA 5BY2A 1T15A 2VLBA 4NBSA 2XRYA 3INTA 4X92A 4LVNA 1G41A 4YXWA 3SIRA 1Q92A 2QEQA 4PAMA 1UCFA 4LY6A 1K08A 3IPCA 1JXOA 1SQGA 2AXNA 2X2FA 1I0IA 3GT7A 4MKGA 3A1UA 2QUJA 1J5PA 1UMBA 2RONA 2O2CA 1GV0A 2A1IA 2AG5A 3VR5D 4PONA 3GMDA 4NAVA 1XWFA 5A4MS 2O7QA 2VFAA 2PTGA 1IBCA 1ZJZA 2DQ4A 2C59A 1JU9A 3PYMA 2PQ6A 3N86A 3TSYA 3P5SA 1NVVR 4TV9B 2BGRA 4F5ZA 1Q77A 4D57A 4F96A 4WZAB 1KI2A 3UT5A 1JYEA 3MM4A 1XZQA 4PCVA 1L5SA 2ATCA 2P6OA 1TTHA 3COSA 3HLTA 1Z34A 4JLOA 5B3LA 2I2DA 1AQLA 3L79A 1CUZA 2GNPA 2VK2A 5ETJA 3RSLA 5PGMA 2ZSEA 1W4ZA 1D7OA 1ML4A 2IOFK 1DXYA 2BBWA 4K6HA 3AZQA 1IK4A 1LBEA 4I46A 4M1ZA 4ER5A 3A9CA 4KWEA 5E6SB 4OHYA 2HLNA 2L18A 1EK1A 1IIRA 2I7XA 4I14A 4MQBA 1IONA 1P5ZB 5KVCA 4YB8A 1RLTA 2W6ID 3FWKA 4ZV9A 1Q1BA 4QELA 1JLMA 3PF8A 4EKYA 4B47A 2JZNA 1SKUA 2AFRA 2QAIA 4OQNA 3ANMA 5T5QA 5LSAA 4BOYA 1JSXA 3OKPA 2VCHA 4EZIA 1DBSA 1RIFA 3L07A 1Q6ZA 3TTUA 3T7SA 5CB0A 5CXQA 3I32A 3WGYA 221PA 1PNVA 2WSSA 2Q27A 5F2OA 2XMQA 2YBEA 2ZE8A 3IB3A 3GPIA 1GPNA 2NTEA 3ICPA 3WJAA 2A4KA 4FOOA 3UYLA 5AICA 1C4WA 1LXCA 1C9JA 1ML3A 1GT91 4DMKA 4RTLA 2ZVDA 1EFKA 4N5DA 3AX6A 3AJAA 4RPLA 3KQQA 5E2IA 2C3UA 3T7RA 3LK7A 1B4DA 2BKVA 1MQSA 4D96A 3UPTA 4WK4B 3WI7A 5HRUA 3NHZA 3T3IA 2PBZA 5LL6P 2R00C 2FGKA 4MKRA 2ZIFA 3JX9A 4EEXA 5BSHA 5J4KA 4MKZA 3NDPA 1W96A 2O8EA 2EKBA 4ML3A 4N5HX 3PGA1 1QRSA 2J5QA 4RTNA 1K68A 4CIBA 3PQ8A 1OGIA 4AMZA 3DVLA 2XWJI 5E7QA 4OBBA 3GAZA 3SNHA 3BGDA 3MOIA 3OM1A 4G63A 5E9QA 2Z3VA 3L0ZA 2Q2VA 4U7FA 2Y1OA 4KITB 1K6EA 1X19A 4RW0A 3W5CA 4OA5A 4Q4HB 2HRRA 2F55A 2FN8A 3NAGA 1RXSA 2P67A 4L07A 4TT3D 4XB2A 4A3SA 4JQZA 4A10A 5JYBA 2GZDA 5C5DA 1S1MA 1SUFA 1G60A 3H1FA 4I3GA 4E14A 1LF5A 4ZAZA 3WMFA 5JWRA 3BFPA 4D4MA 1M2HA 2QD5A 4F9FA 4JBHA 4JXXA 1LJ8A 1Z7GA 4HWRA 4Q9DA 4REQA 4RHUA 5ARDA 5FPKA 3GUZA 1TU4A 1VPEA 2NU6A 4ARUA 2ZUWA 2WTUA 4WN3A 1S9HA 4QUBA 5BN3A 3R3JA 3CZRA 4IG4A 1WOYA 4X1IB 2QN3A 1FSSA 2JAUA 3BEOA 4B6SA 5LJIA 3FCCA 3VKFA 2Z6QA 3QPDA 1IXRC 1LSUA 1W85B 1U8CB 2JEZA 2X2OA 2O06A 4KG7A 2V96A 2ATIA 4QBGB 5IZ4A 4D9CA 1LNQA 4Y2YA 1QPBA 1ZVMA 3S2IA 3ZU3A 5LD2C 5IKOA 1THMA 3AGPA 4FGWA 5DXAA 5LOVA 2F90A 3IDQA 2PL5A 2VEDA 4BV9A 2JFHA 2QZZA 2ZSHA 1HYHA 4RHTA 4R5MA 1N6KA 4EO7A 3T1YB 3CJQA 3LA8A 3R3WA 4U9HS 4YDHB 4P93A 1NBEA 1ZKDA 1IUOA 5K3AA 1CUJA 3O4IA 2V03A 2BDTA 3LY5A 1V26A 4DV7B 1XYVA 3RRJA 4F5YA 3G7SA 1JQ5A 1FRNA 4IV0A 4DUGD 4V3BA 4E1VA 4AD8A 3AEQA 5FBRB 3V8VA 3A06A 2IOYA 2PWAA 3N28A 4F6RB 1GA4A 3NHKA 2I0FA 4W6ZA 2Q29A 1JZSA 2ZXFA 3WL7A 5JALA 2YN4A 4WKGA 4ZOLF 2BJVA 3F46A 1NUQA 3CURA 1L5KA 2VJAA 4DHEA 4UPEA 1GSIA 3CI0K 1Y37A 3P45A 1WV0A 2I65A 5JBIA 2AV6A 2P4SA 3JQ8A 1FX0B 3AHDA 3FDXA 3T4PA 4ZKDA 2PSDA 1GQFA 1T9CA 5D1HA 3BSYA 4OM8A 4TYQA 4IV8A 4G84A 3NRCA 4QGAA 1G64A 4LQ4A 4OH7A 1L8LA 3OEHD 5DHUA 3OAAD 4KR7A 2EWMA 4I5IA 4YJGB 3EGOA 1MC8A 3PWKA 1A9OA 5JAQA 4DLLA 1OAKA 1DZIA 1ECFA 1MEJA 3N0RA 1UBCA 3LRTA 3PXGA 4R71A 4QXRA 3CONA 1OC2A 3IT2A 3ZVMA 2FUKA 2ZKLA 1P7VA 2IYNA 3BE6A 4R7GA 3M5DA 5FR2A 4EB8A 4WCFA 5JS2A 3SX4A 5AYVA 1ANKA 1T4GA 1GL3A 1NIPA 1W2GA 2DY0A 2BSXA 1EBFA 2C8KA 2J5BA 3DW3X 5DNWA 5B58T 2REOA 1U2GC 3SKYA 4B3FX 5D51S 2Y0EA 4MQ6A 1QAQA 1UWCA 2DQSA 2H9AA 2W8ZA 3G2PA 3KOMA 3D8SA 4LC0A 5HJEA 2OXTA 4J16C 4NCNA 3GHYA 1RI2A 2ZRJA 3H3JA 1KO8A 4O1MA 2F9FA 3UCXA 4ZI7A 2R8BA 4HDNB 3GFVA 4G97A 1AO3A 2D4AA 3BBLA 5TF4A 5LYYA 2Q3EA 3IBGA 3WXBA 1HXHA 3EMVA 4GPBA 3FOAA 4DANA 3M9LA 3ZCPA 4AVYA 2NV0A 2Q3JA 2QI9C 1J8YF 1U11A 4OU4A 3KYJB 1NULA 4B3TB 3WMWA 4QDTA 4Q1FA 2JBHA 3QY9A 1A82A 2ZOSA 1VE5A 1EFVA 3BWCA 1NVGA 3K8OE 1CY6A 1G291 1IB0A 2VHTA 1ULSA 3GJ7A 4QO7A 1PSDA 3TD9A 2DBYA 2XA2A 3AKYA 3F2IA 5T8KA 2AOXA 2OZEA 1R4AA 2ADMA 4EI2A 3QBDA 1MJHA 4W9RA 3ASVA 5AK0A 4CM9A 4D0LB 1ENYA 2ZR0A 2ZBFA 4GMGA 4O4JF 3RG8A 3T61A 4H7HA 1MB0A 5DSXA 3VV3A 4HNAB 4ZIRA 2GLXA 2RGWA 2Z5GA 3ZXUB 3RJMA 3ICEA 3K0CA 5D87A 2VDPB 5HUJA 2CMDA 2WKSA 4L4RA 3QF7A 4BMSA 5FUQA 3T5AA 4AXBA 2H1WA 5KJFA 1OXSC 5FFFA 3KTDA 4B9AA 4IIYA 1G2IA 4QA9A 1B6TA 4AX8A 4C88A 2DR0A 1Z4LA 2V6IA 3MD0A 3NOOA 3CNEA 5FJJA 1G8SA 1THZA 2XSZD 3PB3A 3DXFA 3U4IA 3UGTA 1BEUB 4C2TA 2CVQA 2O2HA 3AEKA 3MJSA 1EQAA 4IGKA 1BU8A 1WXHA 4JZYA 2VQEB 4A15A 4MGYR 2PH1A 4KQEA 2DSTA 3THSA 3HL6A 5B58C 5EJ5A 4ARBA 4EY3A 3N70A 4RVDA 1HE2A 3AC0A 3PBKA 4HZUB 4OHBA 1SHZA 3KPYA 2AZ4A 1GD1O 4POAA 3AZPA 1RHJA 3D1LA 3D3QA 2FPPA 3OHMA 4L8WB 4RORA 1DUIA 4TTRA 4XEUA 5FTWA 5EQDA 1VKRA 4KKXB 3O7WA 4X66B 3KKEA 1NP7A 1RM0A 5AXDA 4A6PA 2WJGA 2AYXA 2CMFA 1ZH4A 4RSMA 1MVNA 3PFHA 4AO8A 1X1SA 3V33A 3NWEA 2EKPA 3IC5A 1RABA 2GJKA 1N4AA 3PCXA 1DQPA 4NYJR 4WASA 3TR6A 5ENVA 3V2HA 3WSTA 2AX3A 4XDHA 3B7GA 4FGSA 1DOAA 3IP7A 5C4IA 3A6GA 1Z6GA 2FZGA 4OEHA 4EI7A 3UV7A 2QLLA 5LU9A 2VTEA 3MRTA 4M89A 2I3BA 4HTFB 5G41A 4IFIA 3FFWA 2GEJA 1J00A 1NSYA 1MW9X 1BZYA 1ESNA 2FWPA 3B13B 2D59A 1N25A 3DC7A 4G1UC 3K8ZA 3KYCA 4LCBA 1XUOA 5AKIA 1VHLA 4MP3A 3JWHA 2O2ZA 4WXMA 1K92A 3WFIA 2IHNA 1ADYA 1XTIA 1WTCA 1QV7A 1XDUA 3Q3CA 1LJUA 1E3DA 3CLVA 4XJTA 3X2SA 4FMDB 4UTZA 2X1VA 3BMQA 4E3ZA 2OCXA 4GZLA 3S2ZA 4DIFA 2YMLA 1E7RA 1XKTA 2P0AA 2GWRA 2C3PA 3QLTA 2R84A 4MLCA 2X6RA 4DIDA 5M04A 4CEIB 1NURA 1PBTA 3AUJB 1JQKA 3AY6A 3DZKA 2W00A 2GYVA 5CVDA 5C8XA 5LLTA 1WBBA 2ODNA 1S5PA 1GG8A 2JGAA 4YAWA 2GPBA 3C98A 3RVMA 1WPXA 4RKYA 4B7CA 4YCLA 3A1VA 3N8KA 2WD8A 3K5PA 4JVMA 4QXMA 2VUHB 4W1RA 2DFDA 2PD3A 2PPVA 4RD6A 2IH4A 3RVNA 5B3JA 1RHUA 1SCKA 1DO0A 4EITA 3EBOA 3KELA 1M2EA 1M1NB 4JP3A 1V4NA 2P3SA 1RKUA 2CXHA 2XIQA 3BJMA 4RVOA 2HB6A 4JJZA 4Y2RA 1T9HA 3VYSB 4C87A 2GJAA 4TWRA 2XNJA 1ZM9A 1L5VA 2DTDA 4XB6B 3WKDA 3CPJB 4P83A 2IF0A 3MB8A 4GMHA 1NNEA 4KNVA 4ZHQF 2GK4A 2HSZA 1GIAA 4YJ2B 3HJUA 3UJ3X 4E1AA 5HZKA 1XMIA 3L18A 2R5WA 4YDRA 5EMNA 1PQUA 4NU6A 5ALKA 4WI1A 4BVHA 3X1MA 3O74A 4QPPA 4UEJA 4A8JB 4B45A 3TAHA 4V0NA 2ZDGA 2F64A 2RBEA 4CEHB 2OPBA 3L01A 5THXA 1YASA 2GK7A 2XODA 3N2YA 4I5FA 4JKOA 1C7IA 1NLFA 3CX3A 3JARB 4IV5A 3TG8A 1DKRA 5B64A 1J8QA 3GXBA 4KXWA 5HG0A 5DCLA 5H0IA 1II8B 2Y4NA 1EU1A 2IEAA 1KI9A 1JEDA 3WHLA 4UVHA 4ETWA 2PMEA 1EVKA 3DAOA 4BFTA 3IKJA 1WZCA 3UHOA 1KS9A 3LBAA 4IIVA 2D0IA 4ZO6A 3STWA 3TTVA 1IHUA 2WE7A 2CEKA 3T1QA 2RH4A 2QOEA 4QM7A 1BCRA 3D6FA 4KE7A 4X20B 3OI7A 1DOZA 1U9IC 2G40A 3B89A 1B26A 2GNAA 3GLTA 1NV8A 1CDDA 2FP4B 4ZEOA 3ADPA 2LW7A 1W0KA 2VYND 2C4HA 4XPZA 2ZB2A 3QXGA 1BGVA 1O9GA 3LY8A 4P3KA 5AXBA 1C0KA 2GZRA 3QVMA 1KL7A 2P40A 1NONA 4RCZA 5HCNA 2VRWA 2O23A 2W2OA 3SZRA 4PZLA 2VHWA 1NKTA 3AJ9A 4AMVA 4FCTA 1DXQA 4BNDA 1NN3A 1K8ZB 2HQRA 2VJQA 3GLHA 4I2VA 1F17A 2A9RA 2FZWA 2X5OA 3BWXA 4XQ0A 2QLJA 1N8KA 4KVFA 5AK3A 4N18A 5FBWB 1G4AE 1JPNA 3DBRA 2YIDA 1VI6A 3DLPX 2PUJA 3N2ZB 4RM2A 3SFZA 3TLEA 1WXGA 4CL3A 4M1MA 4EGJA 5B7PA 1CQJA 3H19A 4S1PA 4P82A 5ECGC 4YUVA 4LFBB 5K99A 4HJXA 1WCYA 3QVJA 4XXHA 4MIOA 4J2HA 1SUEA 2A57A 1T9AA 3VX4A 4W6QA 2YWEA 3KKKA 4FOSA 4MIEA 4K28A 1H2YA 1YI1A 4JR2A 4ZRMA 3L4JA 3DZDA 4RZUA 4N7JA 2B1GA 3IHKA 4DQDA 1GNQA 4FWBA 5F5NA 4AKSA 2JI6A 2IEYA 1UJ4A 1H0KA 2CB9A 3IVMA 4NU5A 1ZUHA 2QW0X 3KQYA 4C7MA 5ECYA 4OYLA 3O2QB 3T5PA 3TIXB 1Y48E 4RJIA 4ZDIA 1VPDA 2X4GA 4HADA 5ICGA 3BGOS 4ZDWA 4PPFA 1G0OA 4NPHA 1JEJA 5DB4A 4OUDA 4AUMA 5C1BA 1Y33E 2W6OA 3CZMA 1LSJA 2QJRA 4C0AC 3RLIA 4R2HA 2UUAB 5ECDA 5J1SB 2CL6X 3I01M 2FZKA 3KEQA 1JX6A 2CVHA 2Q7DA 5AD1A 1VB3A 4HXYA 4QECA 4FGZA 3UWKA 3D6UA 4MQMA 4UBKA 1VJ1A 5AI5A 1Q1EA 5HILA 3RVPA 3ZGVA 3A6LA 3WOVA 1TJYA 3OX2A 1D07A 3U60B 1PT8A 3FNBA 3JQAB 3NU1A 1SKAA 3Q7QA 2HCJB 3NTVA 4DM4A 3IVAA 5IDQA 1NI4A 3WGHA 4LSGA 3BK7A 2UZ4A 4HGYA 2H2FA 4ZI5A 1EXNA 2BFFA 3H2JA 1XN1A 4IZHA 1I4LD 2GM5A 2OGWA 2RCYA 3I6BA 3G0DA 5GGYA 5IBRA 2OO7A 1F1BA 1NNUA 1W4RA 2PAFA 1K5GA 4NZPA 1M2NA 4L51A 3SQDA 5HJ5A 2PJZA 1FFXA 4AJLA 1IHOA 1IC6A 4TM7A 1Y1LA 3TG2A 4WZBE 421PA 2JGEA 5CVCA 2CJWA 3JV7A 1LLUA 3OQ6A 3TZKA 1W1WA 5JRJA 5LMCA 5SYAA 4DBZA 1XXLA 3D6AA 1U80A 1P39A 3IH5A 4EENA 1F2VA 5G53C 3ZZMA 2QPLA 4JVNA 4C1NA 3IOMA 5E4FA 4KBYA 4LBZA 1YZGA 1JKFA 2HMAA 5FNZA 3FB4A 3ST7A 5LN1A 1JWLA 5I48A 3KVYA 4YIHA 1X42A 4JB0A 1HNZB 4ZVPA 1YRAA 1LU9A 3ZHVA 2O0JA 1J2EA 2P2LA 1JDBC 2PH5A 5CT9A 4BHTA 4C4RA 4Q15A 1Y8QA 1VIAA 1EVJA 4JSTA 2NTVA 5EPOA 2B21A 1MXFA 3RJ5A 2QP4A 3ZUGA 5JCOC 1K5DA 3F9CA 3NPMA 4HGOA 1ZHOA 5EIWA 4Y2VA 2BW0A 2I29A 3I3SR 3U81A 2VJBA 2Q45A 3AK4A 1XHFA 1SXJA 1H5QA 2V7BA 5E0KB 3SQMA 3WIUA 3UK2A 3NP7A 4HEA6 5ENDA 2QORA 4LJYA 5TMBA 4BRZA 5EGSA 4WKBA 4OCZA 4EFDA 2O1WA 2QVGA 1N8SA 2HSJA 4ADSG 1XTSA 3DULA 3A4LA 3RRXA 1E4EB 1R64A 2V7QA 3EWIA 4P1ZA 1TKCA 4JLPA 1WNFA 1AU9A 3MWYW 3I9FA 5EYPB 3H5IA 3MT7A 2UKDA 1K66A 4MMZB 1UEJA 4QOSA 3TRFA 4EZBA 5TPWA 1GAEO 4C7JA 4P0PB 4TTTS 2Q8NA 1EUCB 1Z17A 3VNBA 5AW4A 4EKIA 2J09A 3FETA 4MUYA 3M1LA 3D4LA 3R5FA 1K89A 4LHVA 4M49A 4XAQA 4B33A 2XEDA 3TBHA 5IJWA 5ALPA 1NVBA 2XDQA 5G0SA 2X0DA 1GKKA 3A1DA 2PUAA 3BB3A 2WC1A 3HUTA 2ACVA 3ESAA 3P9RA 5KQMA 3MEQA 3TW4A 1OI2A 1BXRB 2FAXA 3TM5A 1CR0A 1H3NA 4EMBA 1ESDA 1IWOA 3UG6A 2QN8A 1MW8X 3DVRX 3BJIC 1R4NA 4IW3B 1XRSB 3TVYA 5EGNA 1QAOA 1E59A 4I3FA 2PM8A 3H2HA 4FEGA 3BXPA 3NC4A 4LY0A 3KVNA 3VNRA 3TPCA 1JNYA 2H7XA 4PINA 3WAKA 1UUFA 2P8SA 3GGPA 4IJMA 2OXIA 3BH7A 5K0JA 5ALZA 1O6ZA 3NDJA 5ECWA 3R7BA 1JW9B 1TCBA 3O0TA 4WZZA 3IE0A 3KKLA 4PGGA 1YXMA 3TEJA 5CG1A 3IQZA 3HXLA 3SSMA 3UWDA 1K2WA 1TAGA 5J4LA 5LLDA 2DTEA 3KCQA 4PC2A 5TX7A 1I1QB 4INPA 4YLEA 2D2EA 3I76A 3VZDA 3FPAA 2VUIB 4R2MA 4UD6A 5DN6D 4G0QA 3KU4A 1EAMA 2H4JA 1TNDA 1Z5WA 4KXUA 3R5KA 3USES 3M1YA 2RSLA 3GLUA 2XQFA 1XMQB 3HCCA 1VZ3A 2Z3WA 5B3KA 2V7TA 2JGKA 4KYUA 4OHMA 2YV5A 4PRLA 2PVPA 2C99A 3C48A 5DYGA 5E4YA 4B0PA 4OHXA 1Q12A 4RTKA 3K1AB 3BQ9A 1RMYA 4DZRA 2J3KA 2CF6A 3AY7A 1LV7A 5KYUA 2Z8YA 1IAQA 2WD7B 4UTNA 2WWWA 5JAIA 1BE0A 1L1EA 3U16A 4QOEA 3FZNA 1I7PA 3QOWA 4YAOA 3W6NA 1B74A 4ACAA 4AY5A 2KS6A 3BIOA 4RO0A 1IHDA 1SXPA 5HMMA 2DCMA 2VTKA 1YCGA 1AKVA 3L43A 3VXKA 2A5DA 4RLFA 4N8EA 1W9MA 1EVYA 1ZOSA 3RBZA 1A72A 4YT4A 4U2DA 1MABB 5BRJA 2ZCVA 3HABA 2I54A 2YY5A 1Y89A 1QVAA 4HFJA 2B35A 3ZCVA 5C7OO 1PGNA 4J7CA 4KR3A 3FUUA 5HCIA 4OQYA 1PBNA 3WIVA 2J4DA 1O4VA 5LVAA 1JAXA 4OSEA 5EJMA 1GCOA 5EKUA 5F35A 1PQWA 1JG3A 4DV5B 1XJ5A 5JZMA 4BVAA 1QPZA 3G7UA 1A9PA 4EY6A 1KH3A 3NR2A 5AKYA 3O8LA 1GZ5A 2GBLC 5F3WB 1OT5A 3PIIA 4WESA 5CJJA 2YXLA 2IYOA 2O7RA 4PCLA 9ABPA 4PZEA 3G9XA 1NAHA 6REQB 3AVTA 1JB1A 2WSBA 5DNEA 3RSFA 2IYEA 4P4UA 1Z12A 3PI6A 2A53A 1NWCA 1C7ZA 1KSHA 4CMGA 4MVJD 3QM1A 2WPDA 2H2AA 3F9RA 3MZ0A 3PNMA 4DY6A 3E5NA 4A8HA 4BS9A 1EFAA 1XNHA 4IHAA 2GD2A 4LOHA 2XLBA 3CSDA 2NADA 1T1RA 3KSMA 2FSFA 4YP1A 1HI9A 1XRRA 1USKA 3QPWA 2XT6A 2QRHA 3QVGA 1FRZA 3JASA 3FLBA 1V11A 2VAMA 1KI6B 3WJ2A 4CG3A 5K0CA 1KK2A 3LL4A 5JNSA 4XGIA 1GFZA 4KOAA 3UPUA 3K9LA 1N75A 2QE6A 4LV8B 5B1HA 2CLMB 1EHYA 4KNWA 4IINA 2AMLA 2RHOA 4CW7A 5A5EA 4M6WA 1W88A 3LZCA 3WQSB 2IU6A 2DETA 2C7PA 4QUKA 3NYRA 4LJKA 2QRNA 1DCKA 2O48X 1C8VB 1GZDA 3RRMA 3VAAA 2IS1A 3GP5A 4B46A 1LVGA 2R1UA 4C4AA 1H94A 2J9FB 2BE7A 4QOHA 3PPYA 3BFVA 1KMHA 4ZOLA 3ZJVA 4EAAA 1JSCA 1QV6A 3K6KA 2PSJA 4F4JA 3CX8A 2ZGVA 2F1OA 2P2ZA 2J30A 3H2IA 4YH1A 2Y6VA 5AVQA 1PWXA 1IVYA 1AS3A 1YQWA 2FVYA 2I2FA 2WKQA 4YRTA 3ZJ4A 5JWOA 3KHTA 4L5BA 3S70A 4MA5A 5FUYA 1Q83A 2BJWA 2GM4A 5CH3A 3EMOA 1OV4A 3D8BA 3KR1A 2PKXA 4ALKA 4G41A 1NQVA 3FBWA 3NBYC 3VVBA 3GXOA 1KS2A 2J7PD 4YQYA 4EW3A 4IYRA 3RS9A 3B7WA 2F8MA 2W2LD 3P9CA 1U65A 5JROA 4M9UA 4BX0A 3OMWA 2JASA 4UE6A 4GD3Q 3U4MA 2CMKA 2ZYTX 4D0GA 2DHEA 4RULA 4LFAB 1F6BA 1XEAA 3WLIA 4CV2A 4FOLA 5IKPA 4RPJA 1X7XB 1ZJYA 4F2WA 3I9V6 2ZTHA 1NOKA 1P45A 2VHEA 5CVUA 1TUEA 4YBRA 1ZWKA 3GJSA 3PX2A 4KGZA 4WADA 1NNSA 4BO4A 3I9NA 2IY8A 4TM8A 3RRFA 1N2CE 1PX2A 3HPRA 3QQ5A 4S2UA 5EWLB 1SK9A 1K3FA 5A6VA 5IJ0A 3UGQA 4MW5A 5U9CA 1H5NA 4CL0A 3AEYA 5A71A 5T3UA 2I22A 5IKXA 4KTTE 2J3HA 3G0GA 1ZUNB 3LZ6A 1KSFX 2IU0A 1C9NA 3CEHA 3I8XA 4YMSA 3VSAA 1VKNA 2NXEA 4K6CA 4GX5A 4C0QC 4RJTA 3NAZA 2GK6A 5AJWA 4F3NA 1Z35A 2V45A 3B20A 1UBUS 3E3LA 4B6FA 1QO9A 4RZHA 2Q6KA 3ZHRA 2FRDC 3HTXA 1ZMBA 4MS4B 5K3EA 2QQFA 3DTVB 5MFZA 1AV6A 2A54A 3MPOA 2YQ5A 2I4TA 1XZPA 3BFKA 1ZZEA 2WAXA 2I78A 4QGGA 3ENQA 1AF4A 3SAJA 3PQ2A 1P9LA 4RY8A 3G2OA 1YMVA 3JQGB 2IPAB 1RACA 3HL0A 2FOXA 1KHHA 4HB3A 3QXXA 4AO6A 4O4JA 3I05A 4QNRA 4WBSA 5J2UF 1YB6A 3EEFA 3Q12A 3NS7A 4WEOA 1J1UA 4N3GA 5CM9C 2JJQA 1SUBA 2IECA 4G9GA 3HR7A 3EUAA 2OSVA 3K5HA 3S99A 2LV8A 3KFLA 1NYLA 1YZUA 3WGNA 4CI0B 4PLZA 1TQ6A 1ULHA 3ZTYA 1RJ9A 1ZRMA 4LDRA 2F1KA 4KGDA 1E60A 1ZEJA 2GILA 3OT4A 3SC2B 3SCZA 4BE9A 4D02A 5AW3A 2WAOA 4TROA 4DJ5X 4U5XA 3BKXA 3L82B 3GN2A 4CM8A 4HQKA 2IYZA 2CT8A 1NXSA 1OXMA 1Y5MA 2G07A 4O2BF 1N2OA 3UAGA 1WVIA 3VDMA 1Z73A 1L5HB 1KO5A 3KXKA 1DPFA 4OXYA 2GBCA 3K9WA 2YQZA 3DLIA 3DMRA 4JHXA 4LAFA 4PEVA 5BQ5A 3UUFA 4KRXA 5M5BA 1PDVA 4EKNB 1E1RA 2EBFX 2FV8A 2AI1A 2R60A 4R69A 1GUYA 4MXDA 2BUAA 1UZUA 1TVKB 2FF7A 2OGFA 2JJ8A 2BGNA 2DRIA 4LRTB 4XZ3A 4ZZ2A 4KMRA 2J85A 2WF7A 3NHMA 4BGUA 3BAFA 4MV4A 1NYTA 4RVHA 1PUIA 1AUQA 3FOBA 3TLAA 4YV0A 1LPPA 3OX3A 5FNVF 1X7GA 2XVMA 4PYKA 4JI3B 5E4JA 4M0CA 4BP1A 4LYHA 3K0CC 3WV5A 4BNWA 1EI9A 4FIDA 3T8YA 2DPHA 2YOFA 3HKEA 2QTGA 2GEDA 2YNMA 5LD2B 1T36A 2PKEA 3O47A 3VOBA 1PFGA 1NW9B 1TCAA 3G1UA 1JKJA 2PN1A 4F4CA 1EPUA 2GTIA 4URWR 3SHFA 2J0VA 2Q46A 1MAHA 2AB0A 4MIKA 4PIPA 5BOVA 1CY7A 4MVJM 4ZZIA 1BHSA 4TLMB 5JSFA 2R1VA 4JS0A 4DBVO 4WZAE 1GARA 3QEKA 3CJTA 4PGMA 1KAOA 5JFGA 2YZ7A 3OD5A 4MUEA 1K0FA 2OGSA 4WQMA 4CM5A 4YRNA 5KVVA 1FUEA 3THWA 1G16A 1P0CA 1H22A 2BELA 2KSQA 4U2KA 3I72A 3F90A 4E31A 4IX1A 4CKBA 4UU1A 5KOYA 1SCAA 5KNLA 4RSHA 4KPYA 1I4EB 5IVIA 2WIFA 1SC4A 2HNKA 4K9PA 4F0JA 5JAUA 1RRFA 1E5LA 5U4QA 3A6JA 1HE8B 3FSGA 3EXHC 5SZJA 3VDQA 3OE7D 2B3DA 2BKEA 1VLJA 3LWNA 3MFQA 1CEQA 2GLTA 3KCNA 4GGOA 1LLDA 4I2NA 1QHSA 1IN4A 4P7KA 4RYDA 5AVSA 4BVJA 5HQ3A 3NCHA 4HWKA 3HFRA 3ZE0B 3PRHA 2RGEA 3HCPA 4OX9Y 2J0SA 1Z4OA 1E5VA 2NZ2A 4F85A 4ND7A 1IHPA 2PY6A 2Q9UA 3IBCA 1UIMA 3EPPA 5JSZA 3PFKA 1D4AA 2QRGA 3FVQA 4GLOA 4Q4JB 3PWSA 2VZEA 4CTKA 3PDWA 2P8JA 1DBIA 2JFOA 4EMUA 2XRFA 2BFBA 3QK7A 3CC8A 4TZ0A 1V7ZA 4NBLA 3MWGA 3UH1A 4EG7A 4L16A 3KB6A 3ZZUA 2FE1A 4ZHQA 1C7QA 3V3TA 4OTZA 2ZJAA 2ECQA 5CA1F 1CQZA 3TBKA 1T2FA 3E1SA 5BQ3A 5I51A 2IIPA 2RBKA 3C1TA 4YCDA 4EB6A 4F06A 2KPOA 5KIAA 3OSUA 5I6DA 3HDJA 4LX8A 3JWEA 1EFRD 5AJYA 1G8PA 1E7YA 2QRQA 3INYA 5EZSA 2FUG1 3HCDA 5JZVA 4RDIA 1TLLA 2CFRA 3OA0A 4BX3A 4GKKB 5F76A 2HL6A 3UAWA 4KHPB 1G7TA 2JFWA 2Q1TA 4QDJA 1LTQA 3Q6MA 1T91A 3DFFA 4OJNA 4NXMB 1NLYA 1RHMA 3NB0A 3L7NA 4AJIA 1ADJA 2AR0A 2CNWA 2F9MA 2BBTA 5B3JC 7REQB 2H2WA 2JA1A 2W0MA 2XUKA 3VZPA 4FB4A 3LH5A 1P73A 3QXJA 1GKLA 2WHPB 4PVCA 1JT2A 1XFAA 3SZLA 2G36A 1Y1RA 3FD8A 2GVZC 3C6YA 5IRCD 2PE5A 2O19A 3PGMA 3CA8A 4O0MA 2PU5A 2JFYA 1XZLA 1FVXA 1GGEA 2G4LA 2GT1A 3AV0B 3CNQS 4JJFA 4KO3S 3QPUA 4MWEA 1YOVB 1Z2NX 2JCGA 1NF8A 3B9BA 3L7YA 4Q02A 4YBZA 5BMVB 3H42B 5KOHB 5JPDA 1XX6A 3ICWA 2J5KA 4TXJA 4WV3A 3PVCA 3LQQA 3DR5A 3OCVA 1MG5A 2OAQ1 3ZDEA 3X1DA 3WGMA 1GXSB 3B8HA 1C8BA 3BXGA 1YZNA 2QQEA 3CTPA 3GT3A 5C31A 3GA5A 4LRUA 3BILA 3JATB 3MUFA 5AW9A 3DBHB 5BNWA 2HCFA 5AK4A 3OP1A 1VGRA 2XYQA 5LWHA 2BKAA 1XU7A 2YQ4A 1UWLA 1F0PA 5JASA 3WB1A 5ADHA 1RKVA 5ALXA 5F52A 4FLFA 1YDWA 1M5RA 4R4JA 3W4KA 4B2IA 1P1CA 4TKVB 1F4VA 2O2SA 1MJFA 2IELA 5JXHA 1HY3A 1K7YA 4W5OA 3BRWA 1WIWA 3HRKA 1DJLA 4L95C 1ITZA 4TXNA 4MGEA 2R6GA 1OLSB 2WY2D 3BWMA 2PYZA 2GR7A 4AZ3A 4C0LA 1LNZA 1UXJA 1MZPA 1M0TA 4CEJA 4NPAA 4RGVA 2BI8A 3WYAA 3PUZA 4J1SA 1W48A 4AC9A 1Z2EA 3L04A 3E35A 2YFYA 1MHTA 2AWNA 2ZI5A 1NP3A 3EQ9A 1BG6A 3Q9NA 1OFIA 4Y2JA 2I34A 2XNHA 1FFSA 1LJLA 2IYYA 4IVQA 4EF5A 5JS8A 3AGQA 1KDRA 1L4KA 2ZBQA 3R9XB 2YCBA 4OF4A 5K6AA 2VJKA 2XXBA 1UXOA 3BZBA 1A2QA 1X3SA 4I1PA 3WSWA 1I24A 5G3YA 4LXGA 1UJCA 1QHHB 4HAWA 4LNUB 4QXPA 1VQ1A 3NO4A 5EMHA 3N2GA 1CS0B 3CE9A 3TR5A 4AJOA 4F7DA 5SYMA 3ECCA 2WUDA 2A0KA 4F5DA 1PG0A 5LDDC 5AUQA 2QP3A 1RQPA 3BFXA 2AK2A 5AW6A 3T3MB 4YLGA 3RADC 3PDHA 1WUJS 1BRMA 3EOBI 5D6NA 1ETHA 2JAOA 4LJ9A 4N6GA 4NSNA 5BUCA 4HQFA 1P4JA 5F23A 4L15A 3EGXB 1HMPA 2PXAA 1PVOA 3DDSA 3H11B 3ESRA 5A9SA 1U1CA 5A5VA 4GUDA 4ZHSA 1O95A 3ADKA 4M8SA 1P5HA 1NJ8A 5LZ5A 5LMZA 2AEEA 4MRMA 1M7HA 2BZ1A 3BL6A 2XT0A 3GLIE 3PICA 3ADOA 1UAAA 1XZ8A 2GF0A 3DEJA 1MX5A 1U0GA 1QIFA 4MITA 3UK0A 1G7CA 1AM4D 5AI9A 1G1AA 4D82A 4R3NA 2VJMB 5I4IA 5IMSA 1Q17A 2AN4A 2Q3BA 1LDGA 2DPYA 3AJEA 3PHIA 1M5TA 5F5XA 4E51A 5JAOA 2PLWA 1AQIA 1YKFA 4D99A 3L77A 1JAZA 1VG0B 1TQ8A 4PZ9A 5AKGA 3QVOA 2IF2A 4F8JA 2P75A 5L3QB 3C5CA 1HE1C 2HQBA 2NO6A 1QF7A 2EJTA 1UBKS 1T5IA 2G72A 2YJZA 2ZB3A 4N5IX 5DTMA 1N0WA 2AWOA 3A9WA 1YIOA 1KZHA 4HDQB 4JBLA 5K0BA 5A5GA 1YR2A 3M6AA 4UOZA 1XDZA 2ZRHA 1W9HA 3DE2X 5DP2A 3RO7A 2OAGA 5JJLA 5GJWC 2HPVA 4BP9A 2CL5A 3NALA 1CF9A 1RSZA 3H4IA 3RYHB 3AYZB 4YUWA 3L4SO 1TT7A 2FWRA 3P9IA 1NQAO 1ZXXA 3PUVA 4AG6A 2PUEA 1L5NA 3P2OA 2VHYA 1YVPA 5IJ9A 1D1TA 1ODTC 1Q19A 1LDMA 3B3GA 3CH6A 4R1SA 4DQ0A 4P0TA 4QQNA 5KNCD 3HXTA 1IXSB 4BNZA 3FFBA 2B7LA 4K9KA 4UDYX 3A25A 3ZQKA 1KNQA 3GRAA 2DVMA 3FLMA 1I1HA 4LK2A 2B3TA 3TUZC 2E0IA 2YVLA 3B78A 4E08A 1KWGA 1QH1B 2Z95A 3VR3A 3GP3A 4CLRB 4EQZA 5G3ZA 3RTEA 1EGMB 3PIRA 3ZKWA 5IT9A 4NEQA 4XRRA 4Y8VA 1DP4A 1AUXA 1ZONA 4YMTA 3DEAA 2GBGA 5HOQA 4PSVA 4A73A 2H00A 5EJ6A 3EUFA 1DL5A 4GC5A 4L73A 3HCFA 1JQJC 1X8XA 4UNRA 3DSRA 5CT6A 1SA0A 3G0IA 4NENA 1TE2A 1YA8A 2K2QB 2H1CA 1A71A 2N75A 4CLOB 2YJ3A 4Y1EA 3FPSA 2Q5QA 1SXJC 3SF8B 3SX2A 1A8SA 4C6SA 2OHJA 3ZDCA 3MPUA 5GZ6A 3QZUA 4B7UA 3CVOA 1Q84A 3PC6A 1KSGA 3M83A 3L8HA 1GZ4A 1W29A 4YC7A 2NU8B 1ENPA 1QFYA 3BD7A 3O1LA 3VZSA 5D6OA 3EFOA 1L1FA 1JJVA 2HDWA 4L85A 4F9EA 4AIIA 3LPLA 1VMAA 1XD2B 1O77A 4ZFNA 2HPAA 2QSUA 3UMJA 1UJ2A 3HFSA 1OTHA 4LXUA 4YQZA 2ZPUA 3KYBA 4YMWA 4PN3A 5EP2A 2ZWPA 5U4XA 2GPJA 1ZOPA 2A14A 2ZG6A 1I9GA 3PKIA 3RVOA 1YZ3A 3H5VA 2QPAA 1MAAA 4FYYA 2BMVA 3W6OA 4URVR 2QT1A 4HPJB 2HFKA 1OLXA 4YCCA 5B36A 2PUFA 1SC9A 2UAGA 2FETA 3FF1A 1P0MA 2G0TA 1TIPA 2QTVB 1TAHA 3UHPA 2BGWA 4XUGB 1UQRA 2B4YA 4ZT5A 2KX7A 3KAJA 5A0FA 2RG1A 4C7OA 2QTMA 4L2IB 5E2BA 4A6DA 3E4DA 4Q9NA 3GGSA 4P4SB 3ROTA 4BJ5A 1ZR4A 5H3LA 1TECE 3DL7A 4LPSA 3E7DA 2VXCA 3K2BA 3GLGB 2ZIUB 1SCUB 2ZBEA 3Q72A 3I30X 2GN9A 4LWQA 4X9XA 2YZ2A 5EPUA 5J63A 2EFEB 3EUWA 4B31A 3G85A 5E6RA 1QYXA 2E3JA 2L19A 3PQ6A 1MO2A 3K9FC 4HYTA 5KQRA 3WL3A 1F2UA 1H1LA 3A3PA 3HKDA 4CDRA 1JJFA 1CZOA 4DAEA 5EJ7A 3LK6A 3NG1A 5CRIA 4O1IA 4WOBA 3L4EA 3B5EA 4YNBA 5DRYA 3ROXA 3VAZA 3I8OA 4XCVA 4AKHA 4P80A 4OQDA 2YJ6A 2ODPA 4ZYVA 1IUNA 5JS1A 2K4MA 3B1JA 1NR7A 2OEPA 2P9BA 2Z30A 2AKEA 1GFWA 1WRBA 4OHFA 4EFLA 1KQOA 3DTNA 2JI7A 1GKIA 3FR8A 3JQPA 2NXCA 1BHJA 2PGIA 4QFMA 1QHFA 1X2BA 5FOUA 2OC9A 2HA6A 1U8YA 2VA9A 3G9UA 2XA9A 4FNOA 3TQQA 2XQJA 4ZXPA 4D2IA 5M7EA 1JEQA 4B4VA 1KKUA 1NQTA 2OBXA 3RPEA 5AVOA 1XTZA 1VOTA 3C6XA 1PLJA 2AW3A 3LO8A 3OJCA 4EUHA 4G0WA 1PGQA 3IUJA 5DM1A 2G70A 2Q5CA 3HBMA 1IM8A 3OZSA 3TMKA 5C5IA 4D4IA 2CLIB 1FNDA 1NU8A 1MX9A 1PIWA 1WNTA 2A35A 2B2XA 3ETCA 3FKQA 4JDUA 1FYWA 4LDZA 4RC9A 5F4BA 3T5CA 5LPNA 1EXDA 3F73A 5DKFA 3HBFA 5ITWA 3C6KA 1P0QA 4CVNA 5C8VA 4P3XA 2NZYA 3MS7A 4HBZA 1LI5A 2A67A 1NBIA 1ZXBA 4B3DA 2I71A 4Y98A 2GDJA 3VHXB 1NSTA 3A27A 1OKKD 1ZM2A 2NV2B 3GLIA 2L42A 4I55B 1XQWA 1SBIA 3K8YA 2B36A 1RAFA 4BU0A 3GP8A 4PTZA 4FHCA 1A9XA 1OWNA 1JH8A 4K5QA 2QA5A 1JG1A 1R5OA 3W78A 1QJCA 2OOKA 4J29A 5C32A 3FOFC 2IS2A 1QQ7A 3OO0A 2QXTA 1CQWA 2G28A 2Y71A 4KJXA 3WV4A 1KVRA 4ZYZA 4UEKA 5LBUA 2P91A 4FOTA 3W5UA 4EGSA 2D7JA 2A56A 1CRPA 2I6GA 1FQJA 2NZWA 1P81A 4LZLA 3DDHA 3CLSC 1ADFA 4U8GA 4R7ZA 4AS3A 4P98A 5REQB 1NF3A 2OP0A 4E09A 1VDZA 5J3JA 2VXYA 5BR8B 2P5UA 5AI4A 4Q1BA 5KWSA 3ZOKA 3CX7A 3H5NA 4K6KA 4UHJA 2FEWB 4I9GA 3ZXSA 4F1WA 2D5IA 3R6LA 3QUTA 1YUBA 1GAXA 2OZPA 1KARA 2WWRA 2XYPA 3ZQUA 1AC5A 1R4ZA 4DV3B 3EYAA 3FCXA 3V7UA 1HTTA 2ONCA 5JMTA 2C4TA 2DCUA 2JARA 1S89A 1N0UA 4YJHA 4WKCA 2J0UB 3QYJA 1JALA 3GC6A 4MV6A 4A0HA 1IG3A 4W1QA 4QYWA 5HCUA 1AG9A 3TECE 3ORYA 4MWZA 3B2QA 4BMDA 8ADHA 1QH8A 2QJTA 5GONF 3NHAA 1ZD3A 3U3JA 1B3BA 4BJ3A 3CU5A 1C1XA 3HWX1 3QUBA 3CX4A 4IQ0A 4LMAA 4BNYA 4UCWA 4NATA 1YMQA 1Z0JA 3M1AA 4C14A 2ZUUA 2UVPB 2X8JA 4LSWA 4EMTA 1J23A 1CE8A 2L2QA 1IU9A 1JHYA 4R8KA 4OBWA 1TYBE 1AB6A 3AR5A 4HQRA 1ZSVA 5CYFA 1PS9A 2W0SA 3TLGA 4PHGA 4A2WA 4E5UA 4E30A 4XIGS 1KAQA 1Y3AA 1ZOIA 2BBSA 2WJAA 3AR4A 1NP6A 3F47A 1X15A 1O87A 3GJ6A 3MSCA 4HEJA 4W82A 1UKBA 4ZT3A 1V9CA 5ITSA 1P44A 2ASEA 2GPAA 3KR2A 4PG4A 4ZT6A 1SO8A 4IBOA 4MV3A 1LX6A 3DWGA 5JHGB 1SMKA 1MO5A 2BMJA 2W83A 3OIGA 4HN2A 3PKJA 3TH5A 1ICEA 3N8GA 2DYKA 3O8DA 3JVIA 4TWAA 4OGGA 1IYZA 1IY8A 1Y0BA 3AFNA 4B6GA 5A2GA 1FFGA 1PJSA 3E2IA 2H7VA 2ZJ7A 3K0AB 2PZBA 3T52A 4J0QA 4RZSA 2UYCA 2D00A 1JFLA 1V4VA 2HIMA 2AOUB 4O4HF 1HG1A 4PQRA 4TTJA 2OBNA 4JKYA 1ACMA 1R0XA 3PEVA 3NTRA 1E3WB 2HBYA 1IK6A 2JCXA 1JR3A 3ILSA 4HVTA 2CNDA 5FUBA 2YJNA 3P94A 3BD9A 1VKJA 1GG9A 1OBHA 2NAPA 2FNAA 2R6FA 3F3YA 3JRXA 4MRRA 4QD3A 5J5AA 2CVOA 4AT1A 2PLRA 2XUQA 2XUHA 2P11A 3WLNA 5J2UA 4UVEA 2G17A 3UAYA 4P8RA 1T3TA 1L7EA 3FHCB 5EE3A 3LGAA 1WJGA 1J5XA 1U28A 2C3MA 2EARA 2XVYA 3L1KA 2CB0A 4D4HA 1YFKA 2DPLA 1RI4A 1Z5OA 3D3NA 3KD2A 2ZE6A 2WUFA 5LB2A 1GGFA 2WHRA 4PYOA 2RAVA 3C6ZA 4Q03A 3D7KA 3I6IA 3Q15C 3SSNA 4D43A 3NIWA 2I62A 3BB1A 1R74A 5A7GA 3AJDA 5IH7A 1V5GA 3EAQA 4C3VA 5GTDA 5CLHA 1WQ3A 1NRIA 4O2BA 3HYSA 4YCBA 1U7TA 2VZ0A 4Z0HO 3ZIAD 1XD9A 4CR8A 4RQBA 1B8PA 1D0IA 4TL9A 1YA6A 3KQNA 4DLNA 4GI2A 4G9BA 2RHLA 2O2YA 5DW0A 3UH0A 1TJNA 3LUFA 4MVXA 4ODIA 3LKBA 4E6PA 1GCIA 5FV7A 3HWWA 2H1VA 1T8WA 3NTOA 5T4FA 1RPNA 5AM2A 3FA2A 1VYTA 3L05A 3TW0A 1U8ZA 2PKQO 5IVKA 1G3QA 1T3ZA 3CBGA 4A03A 4IRMA 2GRJA 2W43A 2HJWA 2BFMA 1YU6A 1I7LA 4OMFG 2ZJ3A 3U3XA 2WVJA 4NVRA 4YCJA 3L02A 1M2WA 3WHPA 1DRJA 1ZIXA 3KZOA 3K8QA 5FNVA 3TQTA 1JE0A 3QQPA 3FYDA 1BYIA 3NIDB 3BDIA 4DWVA 1PVVA 1W52X 2W71A 3G6WA 3IAM1 3VQTA 4DV4B 1ORDA 2VDNB 1Z22A 3GZNA 4L4XA 4WK6A 4TV9F 1U3CA 1TQDA 4E6EA 1FIUA 4E15A 3PF9A 4JP2A 4LSZA 5E6UA 3VC7A 4CE6A 1XJCA 4Z7JA 2ZRQA 4XGNA 1QFZA 4KL8S 1G19A 3Q7IA 3BB4A 1ZX1A 2EDCA 3U3KA 2V3WA 3JD2A 3VGJA 1WMAA 5JANA 2Z43A 4O3MA 1H2BA 3NYWA 5AHWA 3TQCA 2HMWA 4GI7A 3ZS8A 4N3CA 3CRVA 1SCBA 3EF0A 1E6EA 3R3ZA 1RDFA 3DXZA 4WCVA 3V3KA 1RAHA 1TTQB 3EY4A 4PPQA 5IC4A 2M1ZA 5KSWB 2CK3A 3DCYA 3QXCA 2R8EA 1GTG1 2XOKD 1QR6A 1D2NA 1YH3A 5BN3B 4EZEA 1C80A 2WI8A 4B3RB 3V6LA 1H3FA 2VCYA 1T34A 1T24A 4GYKA 4JLKA 1FZTA 1R6DA 1M2OA 2AXQA 2XCQA 3E5HA 5DW3A 1NBOA 4WFJA 2PBRA 2GFIA 2YNMC 4PLCA 3OURA 4UTPA 1RCFA 2OECA 1ENOA 1UBFA 3GUYA 2Y77A 4G09A 4G24A 1X3LA 2O0LA 4D0SA 4LGYA 3PUKA 5LOVB 4X44A 5CK5A 4H1TA 5EXEA 5LQKA 1URPA 1ZAKA 2VRBA 3TGLA 1C9DB 4GMXA 2VAVA 4RDHA 1DS6A 1HLGA 1FXUA 2EG5A 3PGLA 4MWTA 1AQNA 2GK3A 3QVWA 2DPMA 4CM4A 4H15A 4P0QB 2X4LA 3K4QA 3KEGA 4G23A 3OICA 2P1RA 1ODCA 1C1DA 3EVGA 3OCJA 3TK1A 2F3PA 4DR1B 2PR2A 2YX1A 4ZQGA 5TQ2B 5CA1A 4Z99A 3I23A 3MINA 1I5EA 2JJMA 2TMKA 4EH1A 2P5TB 2HTEA 1RBYA 1T10A 1YB2A 2P6PA 2SKDA 2VTDA 3E82A 3TI9A 3KTFA 3G49A 5JHHB 1G59A 2OCPA 3TFQA 2ZRMA 1X74A 1IWBB 4ZQCB 4QTTB 2X7JA 3SYKA 3E70C 4OQQA 4NLLA 3RFXA 2C61A 3KKQA 4N5NA 4RQAA 1QRDA 3U31A 1EHIA 2A92A 1Y34E 2HU8A 5CB6A 4MYRA 5HR5A 1LTHR 4HATA 4KPFC 4QYSA 5JYDA 3EVAA 1KOFA 1TK2A 2WJPA 2ZRLA 2B82A 3IRUA 3NJRA 1Z6AA 4MB2A 3ZWQA 2CXTA 2AR7A 4ETNA 2BFOA 4PSKA 4DDWA 4AI6A 1PLKA 2XBUA 3HKCB 4L50A 4OJQA 2O54A 3HYLA 1RLUA 1U1EA 2MWMA 2JGJA 4L7QA 3GRRA 5G1OA 4D8TA 1BVHA 2FRVA 1E99A 2P9YA 2V1XA 4I0WB 1F6DA 5CT4A 3SZ3A 1RAIA 2REQA 2WSIA 4NJEA 5FWXA 3EIWA 3CF6R 2IU4A 2Z5VA 1J2UA 1U0SY 2ZBPA 1GLGA 3CGWA 1Z2AA 2Z04A 3OZXA 1Z82A 1C9MA 2FX5A 3DT9A 5FLYA 2ZWMA 3RJZA 3DB1A 2ZTLA 1KEKA 2G6TA 4R81A 1FXSA 3AZOA 1ST2A 3FMOB 5KWJA 1QVWA 1VJ5A 2FR0A 1NVTA 2O6HA 2VBGA 1RRGA 3GRFA 3IDOA 3X1WA 4H7EA 1JWAB 1FRQA 3HDYA 3QU4A 3RAGA 1EFUA 3SBOA 4C2BA 2RHCA 1MVLA 2Z8ZA 3B5IA 3QU9A 3H97A 3OTQA 4XWAA 4YROA 1L4UA 1ZESA 5MFPA 3ZV7A 3EG9A 3VR6H 4Z7NB 3BUSA 3B2EA 4G2TA 5ICMA 2HOQA 3DE6X 3PNOA 3RVDA 1KMNA 2HCBA 2XZLA 4IJWA 3VO1A 4M60A 2HJVA 1BCSA 5BYBA 1E6KA 3WLQA 2FCRA 4IEIA 1M8JA 4KLNA 2G1JA 4MI1A 4WN9A 4FGJA 4QL3A 5D3MA 5DGIA 2AZXA 2DLCX 5C81A 4EHKA 1EFVB 4KLAA 2ZYVX 5K03A 2IYRA 1N3LA 4D0RA 1YE3A 3OP4A 4KAXA 5BW6B 1OA1A 1WMSA 2B2CA 3P2MA 3L5OA 3ZHTA 1C2YA 1MAVA 3EFBA 2R79A 4G3XA 9LDTA 1IXKA 4KKVA 4F4FA 4QZVA 3AVVA 3CW9A 3ZY5A 4N0DA 3U1VA 2GHTA 2CD7A 2MINA 4II2A 2RBGA 2CNLA 5BN4B 1OZGA 2D5AA 3KHSA 2XB4A 4ZIRB 1EDBA 4ZCPA 1P1FA 2QX7A 3RS3A 5CLIA 3CJRA 2JKVA 1X9HA 5K1ZA 3CZ9A 3HVKA 4N65A 2LDBA 4L8FA 2WIAA 3IESA 5TMPA 4EWLA 1A95A 1CC1S 4NICA 3EZ6A 4MEAA 3G0BA 1NUHA 1OXVA 3ZS9A 2BGKA 3N6RA 3OPVA 5A3JA 4EB3A 4BP3A 3AW9A 3QUAA 2QX9A 4W8OA 3LDHA 3L46A 3KWFA 2JKZA 3FDZA 3OO1A 3VDRA 1D1QA 3KSZO 2UDPA 4QNMA 3HJBA 4QLBA 5KQGA 2CUZA 3SZOA 4BQOA 3D2AA 1ULTA 1D9XA 4RANA 3SQLA 5CBPB 4DLZA 2BKUA 1AHIA 2EWVA 2HJSA 4M1YA 4X6LA 5JZBA 2FPPB 4Q66C 1IEWA 3KXDA 1E1KA 1LVHA 4MEBA 4OLAA 2CHQA 3ACDA 3O1HB 3SYRA 3UMFA 1GRQA 3EXHB 4U7DA 4CV0A 1LGYA 2C77A 2XWSA 3W9BA 3P9SA 1TQHA 4AU1A 2HSDA 1OD6A 4NOLA 4CQMD 3RSOA 4PCUA 4BO6A 1VL8A 4I81A 4UPDA 4MS1A 5I9TA 3WBFA 3GCWA 3NWJA 4RKRA 3UA0A 2PJUA 4MP8A 5F3RA 3SQNA 1ATZA 3C85A 2DF8A 2H2GA 4ENQA 4IIGA 2VDJA 3HUEA 1GQYA 5ALHA 1KMCA 1DJNA 5BV2P 1XDDA 1QHXA 5I9MA 5DBHX 3N0TA 4R3WA 4IZIA 5H5JA 2C5EA 5IDYA 2AUNA 3ET5A 4KR2A 3KYCB 3UKOA 2EBUA 2EP7A 4GVPA 2OWDA 3TINA 2JBAB 1W7AA 3HXOA 4IILA 1PR3A 3ELYA 3I42A 2MCFA 4Q3AA 3ESXA 3F71A 5L3RA 4P4LA 3IMCA 4EJ6A 4QT0A 4CKWB 5BV0A 3BMQB 2ST1A 4IUCS 2XZOA 3RFTA 1I80A 3W5VA 3SKVA 5I7VA 1A98A 5DYIA 4ZMSA 4NCAA 1N6RA 4BFLA 1GQSA 1DKMA 4Q37A 5DSTA 1Z2OX 3GJYA 3MUNA 1R0ZA 2YHAA 1AIPA 4IWYA 4HVAA 1KI3A 1N6HA 4H17A 2O9JA 4HC4A 2ZZMA 4E33A 3OEWA 1I13A 3V7FA 2ID4A 3C97A 1J7KA 4GS5A 4PC7A 4RK0A 4TTPA 4Y9UA 4MROA 3WRXA 2M98A 4G86A 1OOEA 2P3QA 4C89A 2BHSA 1BWRA 2ACKA 3NVDA 3SXUB 2CFSA 3K1TA 4IOJA 2QYSA 4MR9A 1KI1A 3V4FA 3CUVA 2D5BA 4Y9DA 2P6RA 4XYLA 1BS2A 4QUIA 2NNWB 1M8FA 1TC1A 2ZAIA 1R6BX 2VSFA 3UC5A 1YQGA 4J0JA 4BN5A 3GEHA 4RDXA 3ZDAA 1YWGO 1PZFA 4X84A 4AP6A 4EARA 1IBMB 4QODA 1OA0A 1Q20A 5IAGA 3DMFA 3TNLA 3C3KA 2ECOA 4G67A 1MZVA 4YECA 1M6YA 3F3MA 1E8DA 3TRJA 4KX5A 3UA3A 4V3CA 3TFOA 4EF6A 4C4SA 4ILKA 1UDXA 4JZKA 1HLPA 2CUTA 3ZVLA 4D4LA 3BZUA 5G2OA 4OQ4A 4M37A 1NMXA 1RQ7A 4HDRB 4ZANA 2CE2X 3H86A 2PUDA 1T5LA 3KU1A 4EHIA 2E85A 2WEKA 1B8UA 2XXJA 3FR7A 3P9KA 3VO9A 5JRZA 5LQRA 4JI0B 2AL7A 3O4JA 4OQXA 3OWHA 3BQNB 5FF9A 5KCMA 3QELA 4L8YA 2B25A 3KDSE 2BFWA 1V71A 1QFMA 2WYIA 4WLOA 3CVUA 2G88A 1BCRB 1X1AA 5F12A 1DJOA 1FLNA 2A59A 2FZLA 4Q3CA 1GR1A 4UM9D 3Q1KA 1ODLA 4TX1A 3FGZA 2Z5LA 3KJXA 1G9XA 4RZ2A 5L40A 3EHEA 3ESQA 7ABPA 2QG4A 1HE4A 2WWTA 3W9YA 3ROZA 4NYIQ 5E7JA 2R8PA 2XUGA 3QX9A 4HRVA 1ZAYA 2IDKA 3VUFA 3CFFL 1E1CA 1MJGM 1XZGA 4L72A 4UOQA 5JTTA 4D74A 1QIGA 4ABYA 1U9YA 4FHDA 3SFTA 5AJVB 5I01A 3R3SA 4MWOA 5L3SB 3DBOB 1ZH6A 4FBLA 5IUKC 3GCDA 5CDYA 3DBRB 5H68A 4FFBB 4I5DA 1Q7BA 1G63A 4UVGA 5TR9A 5ALGA 4OI1A 1D8TA 4OQPA 3LPNA 3SEZA 1QE5A 3BULA 4A0GA 5BW8A 3T1HB 4BLOA 5IW8A 4IYJA 4M83A 1CB7A 4YFYA 4M1EA 2V6JA 4XJSA 3BFJA 3MXTA 4FDAA 3ZE9A 4CCWA 3H9EO 3EZ2A 1HNNA 1SUSA 4LX0A 3TLJA 4D9HA 2I3GA 3MMPA 1ONNA 4M87A 1P1KA 1FSZA 1MV5A 2PZJA 4YJ2F 1ETUA 3B60A 3PHJA 2P41A 1CT9A 1JVSA 3G5MA 4NQZA 1NMQA 2QYHA 1OWPA 2YWJA 1DAPA 2CNOA 4HP8A 1PV2A 4UBIA 5KTRA 3P0HA 1G3UA 1UBGA 4ZTUB 4FDUA 3BF7A 1V3TA 1WLSA 5TARA 1XOIA 1FXWF 4QPNA 2IUSA 1OAOA 4OUDB 4BL5A 4H1VA 1BKSB 4TL6A 5HGJA 1UK6A 1Y82A 4HQOA 4DDMA 2R85A 3I2IA 4JJ6A 4KYTA 1RYEA 3QITA 2ZI4A 1UPXA 4OH1A 2A88A 1KXJA 1X7HA 3DXXA 2OC4A 1V47A 3RFVA 3RBVA 2C58A 5A3VA 4DW8A 1L4NA 1ESCA 4OIFA 1K8XB 3AR2A 4R1UA 1HDEA 2F7SA 3E7PA 1OZAA 3ND7A 1VFNA 4NAHA 5KNDA 1P0FA 1PHPA 4JJ7A 4KN9S 1Q44A 2ZVJA 1LQTA 3KUXA 5GM1A 4BP8A 4U7HA 4CG2A 5A4IS 5B7GA 3KR9A 5I7AA 2JFFA 2X0FA 1SG6A 1TYZA 4IDHA 4PLYA 3SC3A 4BVBA 1N5JA 4OKIA 3WIBA 1WXIA 1T9DA 2CFOA 3ITEA 4LWPA 1TEVA 4IJ5A 2O3JA 4X3CA 4PGHA 1IULA 5BVHA 1ESMA 2D7DA 3HCBA 3VKHA 3GJXC 1GZUA 2QZJA 4PYIA 5EZQA 3WISA 2NTJA 3LXXA 4RS4A 121PA 3SQOA 5LQCA 3A2LA 1ISMA 1K7EB 1JIXA 4FCWA 1UMDA 4H31A 1OXUA 2IUEA 2VP9A 4K9RA 4N3AA 1JIUA 4HGQA 4ZU6X 3UAVA 3RUHA 1OB5A 3K73O 4RKEA 2CJWB 2NP7A 1TCVA 4QNNA 2QTBA 2J45A 3GEGA 3A2MA 2ZPAA 3WNBA 1FVHA 4U4AA 5G1PA 3CNLA 5JEEA 4KQFA 5IBQA 1OLUA 3NASA 3NHLA 4DV1B 2F1RA 2BGMA 5J40A 3KQOA 1G21A 1C4KA 3T9DA 4BZPA 1EDZA 4GQAA 1Y8CA 1NVEA 4OD0A 1Y7HA 4TVBA 4UUBA 2DT8A 2B8EA 2OMEA 4G8CA 3OQPA 2JHPA 4GF5A 2GCGA 3O21A 1QZTA 1WL8A 3EGCA 3REFA 2WU8A 3BMXA 3G5TA 4KODA 1FJ2A 4G5QA 5BSRA 2EVWX 5P21A 1V37A 4LOKA 5DLPA 3L1IA 2AA3A 2KB0A 3GY0A 4D3FA 4CQJA 1YJCA 2HIGA 1TW2A 3SM3A 3EASA 5GONA 6GPBA 3OM9A 3HE3A 3I9V1 4JODA 1S3SA 1A4IA 3QKTA 4DNFA 2IC5A 2YVUA 3HPQA 2C00A 2JHFA 4HS9A 2CKDA 3OLVA 1B00A 2E6KA 4LRQA 2FKNA 3L8MA 2QDKA 2W6JA 2BGLA 1P19A 4E5KA 2ZATA 2NPFA 1WUIS 3D8RA 4CCSA 4R6WA 1SVLA 1LUAA 5F7XA 3PX7A 4FFDA 3UT6A 1L7OA 1VRWA 4KQWA 3C5VA 3OZGA 1XL1A 1WD7A 3IX7A 2QQ0A 1P5JA 1XSEA 2P2YA 1KYVA 2JIMA 3OIVA 4MW4A 3V8EA 2IYLD 2W2KA 4GO1A 4X7RA 3PKZA 4BXOB 2HW8A 1E3JA 3DBLB 5TPWB 4ZD6A 1M2FA 2BY4A 2PS9A 3IV7A 3PE4A 3FOZA 5BQOA 2V97A 2LCFA 4BFXA 3CEPB 3IQFA 1GL9B 4GMDA 3BHMA 1E1QD 3JYNA 3O73A 4KXQA 2XDQB 1JGTA 1EQUA 1YOBA 1OVGA 1VMDA 3H2GA 1I51A 3LT4A 4WINA 2JW5A 1TKBA 4O4HA 3B52X 2CWWA 2Y1WA 3DZCA 2ZBGA 3GVPA 4L6IA 3IUPA 4NS4A 1P4GA 1TIKA 2ZI7A 1F14A 3PQ5A 3CLHA 4HV4A 4PPGA 4QLAA 4Y18A 2IXGA 3L4KA 3KAPA 4DUGA 1LS1A 1RJFA 1SU8A 5C7IO 1YFZA 3A4TA 1D04A 3EZXA 3KLOA 3NWPA 3PV0A 1SRRA 5FL7A 1LLCA 3NHUA 3BD6A 4NOKA 2XDAA 4AQ7A 1N5OX 1JVNA 1XNJA 3OZ7A 4X1KA 1C8KA 3FDJA 4DA9A 3OPYB 5KHLB 2Y67A 2R86A 1REQA 3GJZA 1X2EA 2PFKA 5A3RA 4CL2A 2EFDB 4YMLA 4Z1MD 2GH1A 4KBGA 3IT0A 2RHJA 4PX9A 4YK7A 1QPGA 3R6GA 1XMOB 1BTOA 3QBVA 4A8PA 1KJWA 2P90A 4AXXA 3ENKA 3UUGA 1BJKA 5GAJA 1QRTA 2WJYA 3LPMA 3HXQA 1H4SA 3ZWNA 2XKAA 3SEAA 1N4DA 3VMFA 3W06A 4AK9A 4D97A 2XADA 1SOMA 4PQYA 1R8QA 4OL0A 3D9QX 3GB9A 3K53A 3KKNA 3J81A 4BLVA 3OAAA 2C82A 4XARA 3WLAA 2C9DA 1F3LA 4QFCA 5DM0A 5EKXA 5IULC 1EFLA 4Z9FA 3TL2A 1AXRA 2Z58A 4FMPA 3EDYA 2WKPA 3PPWA 3H1TA 1EWYA 1J9GA 1T2DA 2H57A 2B37A 3E9QA 1YZKA 1FVOA 1W2HA 5KNBA 1BD3A 2HXYA 4Z0PA 1YZQA 1NPTO 1XQVA 3A04A 4GQIA 4FJ0A 4OBXA 1CUWA 2GF9A 4D8YA 3ZWXA 2FP3A 1J09A 1O3YA 2HNAA 4MDYA 3CF2A 2PX2A 1E64A 2G5TA 4R16A 4Z3DA 5KHAA 3QEAZ 4NH4A 3B3FA 3KZCA 3S3TA 4D0NA 1QHYA 2GXQA 3WB2A 4PG5A 2X58A 2YJ5A 5TC4A 5JADA 1KBQA 5JAZA 4NG4A 3QUCA 4YQFA 3OZAA 3RQIA 2JAXA 2WIBA 3S1LA 1IDN1 4ZJYA 1HR0B 2I52A 2FSGA 4EA8A 3ESBA 4TV9A 4UCXA 4HRYA 3D2LA 2F1HA 3GDOA 2FN9A 2GFQA 3LQ1A 1E1LA 1EK5A 1KU0A 1TO1E 1Y9AA 4GPD1 2EIXA 3HEBA 4WZAA 5HX7A 2VPYA 4FZRA 2RHDA 2YRFA 4EG8A 3UJ6A 2HLDD 1F5SA 3HCOA 5LIRA 1P2BA 4IOMA 3TNJA 4UULA 2J87A 2XNDA 3LX4A 3PX3A 4YP9A 5E6SA 1F4LA 1OH8A 2Q3CA 5A1JA 3T9CA 4MJLA 3V5NA 1V4BA 3VTFA 4B9EA 4GXNA 2DECA 3DCIA 1YVEI 3LQRA 2QM3A 4NU8X 4O6VA 3FRJA 4NJMA 1CQPA 1MX3A 1K6JA 3H9UA 1VIYA 4DF3A 3ZWAA 2O57A 5LP6F 1TJ5A 1QM5A 3L0BA 1PYOA 2VDKB 4ZODA 3O4HA 4K9MA 1YDGA 4ZCMA 1XHLA 3CLUC 3FXAA 5KEIA 1KWKA 1QGED 3U56A 4NECA 1NDQA 3NVAA 2VK8A 2ICAA 4XEHA 3AJRA 1QIKA 3FTFA 3B1VA 1LRKA 1JKXA 4XYGA 5DU2A 1I3KA 3G88A 1ONBA 2IDJA 2C2BA 2IKSA 4W9NA 1DELA 2TMYA 4RACA 3CRQA 4BMZA 1YCDA 2D8AA 3GJ3A 2XWBF 4JN6B 4WNCA 5KSYA 3LCJA 2B83A 3TZBA 1QGUA 2HJGA 3MIZA 3EXFB 4FJ1A 4KXNA 3K15A 4PQFA 3WMRA 5KYGA 2C1EA 2Q0SA 3A05A 1UOPA 1Z4QA 2ESRA 1JFVA 3MTBA 3OE1A 2QRVA 4YJFB 5DNAA 1CERA 1XMVA 3LLUA 4I4CA 2C96A 3CKYA 5EP4A 3CKLA 3W2HA 4BBPA 4CDNA 2XGSA 4CMCA 3GLGE 4H16A 3BMNB 3VTAA 2Y1FA 2JK1A 1J9ZA 5GM2A 1Z39A 1XK6A 5EVCA 2DUWA 3THYB 4NXNB 4ZOLB 2Y1CA 5HVNA 1J06A 1PR2A 3NUZA 2AZTA 2EQBA 4NI5A 4P3PA 5JD5A 5KYTA 1UZAA 1ZCZA 2XVZA 1J8VA 2ZCUA 3KG2A 1SXGA 2R6ZA 5B6PA 1U1FA 3CEAA 5MGNA 3GYBA 1DKOA 2AUMA 1ZK3A 2WAMA 3Q3IA 4WEQA 1XCOA 2IFTA 4FGKA 3FPJA 1H93A 1HDXA 3UZUA 1QO0D 3U7QA 3NKVA 4XPIA 3HFJA 4Q4HA 1WD5A 1JFTA 1T2EA 1XZBA 3TXAA 2JLBA 3I34X 1BEEA 1JG7A 3IB6A 3DDWA 3VR4D 1L4BA 1UODA 1DEXA 4NX2A 1T2NA 4FZVA 5JD6A 2PRIA 4WNAB 2VQDA 3PFNA 2GGSA 4HLQB 1DAKA 2WAYA