4MUPA

Crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
284
structure length
284
Chain Sequence
RKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPGGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPHNSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Agrobacterium tumefaciens ATU3138 (EFI target 505157), apo structure
rcsb
source organism Agrobacterium fabrum
molecule tags Hydrolase
molecule keywords AMIDOHYDROLASE
total genus 101
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 5.4.1.4: D-galactarolactone isomerase.
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4mupA00
4C6NA 1R9ZA 2Z27A 4AQLA 2D2JA 1I0BA 4DI9A 4F0SA 1K70A 3NEHA 1EJSC 4C6BA 3K2GA 1WXYA 1ITQA 1QW7A 2QT3A 4UBPC 1UIOA 3URBA 1NDWA 3WMLA 3LS9A 1V4YA 4IFKA 1KRMA 3AU2A 4GY7A 3S2NA 4IQJA 4QS6A 3RN6A 4C6KA 2IMRA 3OJGA 3ORWA 1HZYA 2E1WA 2VC7A 5A6TC 3MVTA 2ADAA 2DVXA 4TQTA 3GTFA 3AU6A 2YZ5A 4C6MA 4IH3A 4P5UA 3GU1A 4QRNA 1NDVA 3GU2A 3EGJA 2GZXA 2WJDA 4ERAA 1YBQA 3UR2A 1FWIC 1K1DA 2EG7A 4C6LA 1YNYA 4H9TA 3QGKC 3DC8A 4IFRA 3UPMA 3KM8A 3QY6A 1J79A 3IV8A 1RJRA 4H9MA 4J2MA 1RA0A 1XGEA 4KERA 4HK7A 5E5CA 3OOQA 3CAKA 3K5XA 4IGNA 3HM7A 2CZVA 1ZZMA 4GZ7A 1WXZA 4XD5A 3MTWA 4NP7A 2D2HA 4GK8A 3C86A 1A5LC 1EF2A 4ZSUA 3T1GA 2BB0A 4XAGA 3IARA 3GTXA 1PTAA 4YIWA 3UF9A 4RDYA 2VM8A 4KEVA 2UBPC 3OU8A 3LY0A 3PAOA 3GTHA 2Z4GA 4H9VA 4ZSTA 3S2MA 1J6OA 3CS2A 5LXXA 4LALA 4WVXA 1ITUA 4AC7C 1K6WA 4H9YA 1V7AA 1P6CA 1FWHC 3E38A 3E74A 4BKNA 1RK6A 2OODA 2Z26A 4RDVA 3A3XA 1FKWA 1PO9A 1M68A 2Z2BA 4CQBA 3PBMA 1FWEC 3MPGA 2FTWA 4H00A 1KRCC 3E0LA 3TN3A 1VFLA 4ERIA 4C6FA 2P50A 2FVKA 3IACA 4PE8A 3GIQA 3RHGA 4C6OA 3NURA 3QGAC 4GY1A 2FVMA 2E25A 4NG3A 1P1MA 4CEUC 4GBDA 1POKA 1J6PA 3TN4A 4F0LA 1R9YA 2PAJA 4GOAA 2QVNA 4R88A 5FSEC 4DI8A 3IGHX 3S2JA 3PANA 3S2LA 2YB4A 2AMXA 3URNA 2QPXA 3B40A 3LGDA 3DCPA 4GY0A 1M7JA 2XIOA 4KETA 1FWCC 1V79A 2DVTA 4LAOA 1GKRA 3PNZA 3K4WA 3IJ6A 4UB9A 4J35A 3HTWA 1RJQA 5G4HC 3RCMA 2OOFA 4DZIA 1FKXA 4V1YA 2Z00A 1S3TC 1GKQA 4LFYA 4H01A 4WGXA 2O4MA 1GKPA 4CQDA 4G7EB 4KQNA 4WHBA 2O4QA 1W1IE 1KCXA 1UIPA 2R1MA 3PNUA 4Z42C 3FDKA 2R1NA 2Z2AA 2ANUA 4E3TA 4M51A 1A5OC 3GIPA 2VR2A 4OFCA 1O5RA 3EWDA 2RAGA 2PLMA 2ZC1A 3LSCA 4PBEA 3E2VA 4XD6A 1YMYA 3LNPA 4LH8A 1JGMA 1QXLA 1YIXA 4RZBA 3OQEA 1IE7C 5CH9A 4DNMA 2Q01A 2R1LA 1EJXC 1V51A 2QS8A 4LANA 4QS5A 4RDZA 4I6VA 3TNBA 4DO7A 1KRAC 4BY3A 4EPEC 1E9YB 4KIRA 3CJPA 1FWGC 4IG2A 4C6QA 3LGGA 4C5ZA 2FTYA 4B3ZA 3EWCA 4V1XA 4XD4A 2BGNE 4IF2A 4IG2B 4C65A 2D2GA 3MDWA 3T81A 4EPKA 3GRIA 4L6DA 3MDUA 4EP8C 1A5MC 3TN6A 4EPBC 2HBVA 2ICSA 2G3FA 2EG6A 2EG8A 3F2CA 1NDZA 2F6KA 3LU2A 4HK5A 2Z24A 3OODA 2Z28A 1RJPA 2KAUC 2WM1A 4IFOA 4INFA 4B92A 4B91A 4PCPA 4CNSA 3ID7A 3ICJA 4H9XA 2I5GA 1EJUC 1V77A 4IGMA 2DVUA 4QROA 1ADDA 4C6DA 4R7WA 3HPAA 1ONWA 4DLFA 1NFGA 1O12A 3ITCA 3URAA 4XD3A 3DUGA 3F4DA 4CNTA 3NQBA 4RDWA 2UZ9A 3O7UA 2PGFA 4GXWA 4HK6A 1FWAC 3E0FA 3GUWA 1XRFA 1RA5A 5AKQA 2AQOA 1FWFC 4J5NA 3AUOA 3FDGA 3F2BA 1UBPC 4H9ZA 1YRRA 2PGRA 2VC5A 1J5SA 1XWYA 2OQLA 1EJRC 3IPWA 3LSBA 1I0DA 2R1PA 4QTGA 3WZ0E 1EJTC 1RAKA 4C6CA 4B90A 3BE7A 1E9ZB 1DPMA 4KEZA 4KEUA 3MSRA 1PB0A 4NI8A 4DIAA 2GWNA 3D6NA 2R1KA 2HPMA 2Z29A 3UBPC 3G77A 2AQVA 1M65A 3F4CA 4PBFA 3GG7A 3QY7A 2Z25A 2HNHA 3LA4A 2GOKA 1PSCA 2HPIA 2Q09A 1EYWA 1P6BA 2I9UA 4KF1A 2GSEA 4C6IA 4C60A 2HQAA 3V7PA 3MJMA 2OGJA 4XAYA 4C6JA 4D8LA 1EJVC 4R85A 1FWDC 4XAFA 3TN5A 4CEXC 3URQA 4BJHA 2VHLA 4RE0A 5HMFA 3N2CA 4LAKA 2OB3A 2VUNA 4KESA 4PCNA 4GX8A 4DYKA 4DLMA 4G2DA 4C6EA 2P53A 3ISIX 3JZEA 3A3WA 4I6KA 1A4MA 3FEQA 4JOMA 5HMEA 2Y1HA 2PUZA 1KRBC 4CQCA 4LAMA 3GTIA 3S4TA 4LCRA 2WJEA 3B0XA 3A4JA 4H9UA 3T8LA 4DZHA 4HA0A 2Z7GA 5FSDC 4ICMA 1A4LA 4EPDC 4F0RA 1A5KC 3UR5A 1EZ2A 1NDYA 4C5YA 3O0FA 4ERGA 5HMDA 1ONXA 1BF6A 3F2DA 1EJWC 4GC3A 1FWBC 4G7EA 1YBQB 3E3HA 3MVIA 4L9XA 2FFIA 3IRSA 3GU9A 4QSFA 3OVGA 2YB1A 1RK5A 4GYFA 2GWGA 1XRTA 3SFWA 3B0YA 2WJFA 4CNUA 3MKVA 4LEFA 4HJWA 4LCQA 1POJA 4MUPA 4XAZA 3QY8A 2YXOA 4GX9A 2A3LA 1A5NC 2W9MA 1UMLA 1R9XA 4C6PA 1FWJC 3WYZA 3SO7A 4IFKB 3R0DA 4LCSA 3RYSA 2HBXA
chains in the Genus database with same CATH superfamily
1O6IA 4OKDA 3AHTA 2O9OA 1DE5A 3R6IA 4AD5A 4OUIA 3S83A 3VKKA 5LIXX 4TO8A 3VCCA 3VM7A 4UBPC 4GYPC 4IPLA 2NVDA 4PMRA 3UJFA 5GJNA 3HMJG 1XBZA 1WKFA 2ZVRA 5C6MA 1QPOA 3ORWA 4JPGA 5A6TC 3RILA 2DSUA 1K7FA 3P61A 1LQ0A 3EKZA 2VWSA 3N15A 3UG5A 4GQBA 1GVQA 1XP3A 4LB4A 1OHLA 1CGXA 2QAFA 4MZ8A 4Q8MA 4Q4MA 4LBRA 4DO5A 1YQ2A 4IFRA 4NJGA 3H7UA 3TMQA 4I9AA 5LIKX 2H3DA 4H9MA 1IGWA 5AOUA 1ELSA 3VNJA 2VGFA 3BDKA 3K5XA 2QEZA 3DECA 2V3FA 3HGJA 2PDHA 1DWHM 4GMEA 2H6RA 1Z41A 3DXIA 5FEZA 2WVTA 2XUCA 4WDXA 4EOUA 4GZ7A 3WMSA 2FHCA 3T0TA 4YPJA 2Q3OA 1EF2A 3TMLA 5FOOA 4MFDA 3MI6A 1Y5WA 4A2SA 2PWFA 1FTXA 4IOTA 2UBPC 3A4WA 4YL2A 3LX9A 1KQZA 2A4AA 3WLSA 4ZOCA 3UWWA 1FWHC 3KTCA 4Y90A 4LUYA 3E74A 1PWMA 4O1BA 2Z26A 1FKWA 2I17A 4RZ6A 3VIFA 2BHYA 3RM8A 3UG8A 3MWCA 4ZTXA 4PULA 3CMJA 4U2ZA 2OFJA 4NXSA 4X61A 1XLLA 4NG3A 5DMMA 4OECA 2QPSA 3CHCA 3N34A 5EMJA 4CEUC 5LA1A 2Q8XA 3N12A 3TN4A 3QQ0A 2QF7A 2OEMA 4IP5A 1VEOA 2DP3A 3OLEA 3UWVA 5FJPA 3SGGA 3PANA 3MUIA 1KV5A 3LGDA 4MZ1A 3K4AA 1S1PA 4HNOA 3CZKA 5CZTA 2F9RA 2B7OA 5H8UA 2NQHA 5A6MA 1JCNA 1LP6A 1NY1A 4DBEA 4KFPA 4MB1A 4GO8A 4DF2A 3MMWA 3EPNA 2OTDA 3NQVA 4FNRA 5EA9A 2FQIA 4FX6M 3AIRA 1Y0EA 3T8QA 3JZUA 3AO0A 3PNUA 3FHQA 4HN8A 2CESA 1NP0A 4GH3A 4AZ5A 2R8WA 1TV7A 3TTQA 4UNKA 5D9NA 2PU1A 3PTMA 1PKNA 1GG0A 1WA3A 4FNQA 4TV5A 2WXDM 1JGMA 2X0HA 1QDSA 1XYAA 4CD8A 4NASA 3PUEA 1VR6A 3NZRA 3NQ7A 2INZA 5JIPA 1TTJA 1RVKA 2PRHA 4IG2A 4IX2A 1V6WA 3IWPA 3F4WA 5HNNA 1W3HA 4LVAA 2WHMA 1OC5A 4IG2B 1E40A 2X7VA 3C0SA 2D2GA 3TA6A 3HGSA 3SUTA 3GR7A 1Q65A 1S2UA 4EPBC 3KBMA 1GZJA 4W7UA 2FJKA 1RBAA 5I00A 2CWXA 2I5IA 3OTRA 2CKRA 4Q8WA 4GBUA 4B91A 1E3ZA 1EP2A 2X7WA 4GFSA 2BY1A 2GJPA 3SZ8A 3BOFA 3S5ZA 1S5VA 3HPAA 3FAXA 1R3VA 1F6KA 1KNWA 1TIMA 1CXHA 3VKDA 4UTTC 2J9XA 1LL7A 1XIIA 3URAA 3M46A 4AWSA 1XS2A 3O7UA 1K9EA 4JZ5A 2PGFA 4M19A 3OGVA 1X7IA 4OOZA 3MS8A 3VD9A 4JYEA 4KPLA 4O28A 3AZTA 3TROA 4P7LA 4AISA 2PRMA 3NDZA 1V6YA 3IV3A 3K4DA 4UR8A 5EPDA 1LBLA 5E9XA 4WY0B 3UZZA 3BW4A 4OOUA 4QTGA 3WH6A 3WD2A 1UHVA 4I7WA 4HPJA 2E6FA 3WNNA 3UR8A 1JRBA 2XSAA 4OJYA 3QN3A 3W00A 4HOWA 1XISA 2HDJA 4DQWA 4QR6A 3STGA 1AD4A 5HNTA 4DHGA 4QJ5B 2XIMA 5AYBA 3W3OA 4C91A 3KOFA 3IUIA 1JDCA 2J7CA 2CZ5A 3UZ5A 2NSXA 1GQNA 1B3OA 2TRSA 4AF0A 2JKEA 2JALA 5CPTA 1F6PA 1BRLB 3BCFA 4ZB0A 2IXVA 1A47A 3URQA 1G4PA 1TELA 3W7CA 1VYSX 5HUOA 4JQ1A 1PCKA 2W92A 2PDCA 4HYRA 4Z08A 4D72A 2YDSA 5XIMA 4GI9A 2WWCA 5KZ6A 4O18A 5CPQA 2Y89A 2W91A 3UFYA 5J04A 4H9UA 4U5KA 4QP0A 4GGBA 3GS6A 2AGKA 2VEGA 3QM3A 2XFFA 3BLIA 3M7WA 4A8LA 1H50A 3G22A 3BLDA 3GNNA 4RE2A 3FNDA 4AVOA 2A85A 1HXJA 2F61A 5DELA 3B9DA 2C8NA 1TWSA 4Z1AA 4MUPA 2P76A 1C7TA 2VD8A 1W1B1 4QEEA 4JTDA 4GX9A 1MYRA 2PC4A 3IVTA 4CU7A 5FAGA 4QJ4B 4Z1DA 2ZX5A 2D2JA 2OT1A 1O66A 3MI2A 1JULA 3ZZ1A 3QFEA 3P8JA 3KS6A 3P3BA 4B5TA 1TA3A 2OSWA 1ZNNA 1WBHA 3G1XA 3B97A 3G3DA 1H51A 3TJ4A 2NV1A 7ENLA 1UQYA 4QDMA 1XLIA 2BNJA 5BCAA 3CQKA 3W27A 3DFPA 4NZ3A 1FDZA 3QV7A 5IDZA 3WQCA 3BZGA 4R34A 3RPDA 3KVMA 1GQJA 2A3AA 2WSPA 1WB0A 1RBOB 2POTA 3BLLA 5HINA 4CU8A 3M4HA 2NX9A 3SW6A 2VEKA 3NQMA 4H9TA 3QGKC 4KW2A 4QNEA 1XYFA 4Z0SA 4GISA 2O7QA 2ZA2A 3K8LA 3ZT7A 5E5CA 5DBTA 1GVYA 1QOXA 4ZQMA 4PTVA 2JKAA 1DTUA 2G3JA 3M43A 4Q8NA 1XYBA 5A1AA 1V6TA 1UKQA 4S23A 3W26A 3REQA 4HMCA 3ELFA 1BVNP 4PB5A 3GTHA 3KBSA 3B0UX 4J2PA 3G1AA 3KE0A 4WVXA 4C7DA 3W1RA 4BK9A 2VZTA 3T40A 4BR1A 4W85A 4KRTA 3SCPA 1B3ZA 3E2QA 3NOEA 3O9NA 1XDJA 1W5PA 1TSIA 3L7RA 4ZQOA 3O6AA 5B7YA 4WDUA 5H8MA 4ZQNA 1SFTA 2DSVA 5BMWA 1WAUA 4QG8A 2OMAA 2XYLA 3QHOA 4MAVA 3VCRA 4B4HA 3WLMA 4DI8A 2ZZ5A 4DUXA 4MTVA 3WNLA 4C90A 3VI2A 2DZXA 1TE6A 1BAGA 4ENLA 1EX5A 4W7VA 1FWCC 7TIMA 5D05A 5G4HC 2HCVA 5CZSA 3WBEA 4LEQA 1TREA 3VIJA 1UH4A 2ZDSA 3NOYA 2Q8ZA 3BW3A 5I3GA 4HMDA 2CITA 5I3IA 2J9ZA 1HF6A 1JPHA 2OO0A 1HVXA 4B9YA 3VGDA 4Z42C 6ENLA 3W7MA 2ANUA 2QR6A 2ZADA 1E6SM 3BLPX 2XIQA 1QK2A 4YMZA 4JX5A 1G01A 4HCDA 3IJ7A 4LUSB 3H22A 4NI3A 1H7XA 1PYMA 4ICCX 3COTA 1BPLB 3GM8A 4D6FA 4O8AA 4LANA 3LXCA 1IT8A 4HZ7A 3TTOA 4AIEA 2GOUA 1FH9A 4KGLA 2V5LA 3UJSA 1LBFA 3I7QA 4TR9A 4OGZA 3AS3A 1V8EA 3MMTA 5GPRA 4DJEA 4B3ZA 1PXGA 5FJTA 4G7FA 2VX6A 3LPGA 1LWJA 4UTMA 1XQKA 1BSIA 4DPQA 3V18A 3GRIA 3MDUA 5HWMA 5CCZA 4GWEA 3ZT6A 5I3FA 9CGTA 2RKXA 2Q02A 1UW9A 1UH2A 1HKWA 4ZTYA 5G1MA 5C7VA 2Z24A 3OODA 5I78A 3QSRA 1ZL1A 3LHVA 2GVGA 3SCVA 1TG7A 2B4GA 3ALGA 1OF8A 4ZZ9A 3NQEA 3MSGA 4D6GA 4MWAA 4ORIA 3VNZA 3LLDA 4C7FA 3MKCA 2J7DA 2DZTA 2VGBA 4PCSA 1EUAA 5E1QA 4WJ8A 3KBVA 5AYZA 1E6ZA 1WDRA 1ICSA 3A21A 2W5FA 1TV3A 1XINA 5ABGA 2YX0A 4V15A 3F2BA 2XIJA 1NQ6A 3WBYA 3AJ7A 2V5CA 1L0PA 1EIBA 3USBA 1O7AA 5FCZA 3SSJA 4DXKA 1E51A 2G95A 1XLAA 1US0A 1C7SA 3KS5A 1FP8A 3QZAA 4DY1A 3NTYA 5ECVA 1XLEA 3MYOA 2J78A 3U4AA 3UXLA 3LOTA 4OU1A 3N1AA 3GTNA 4YNGA 4L65A 1SGJA 4AUBA 2X0YA 3U4FA 1SMAA 3W73A 2PDWA 2ZUVA 1S5NA 1T8QA 3AFBA 5FKYA 1ZAIA 4CNPA 1EYWA 3G1RA 4IIDA 3P7YA 2A7NA 4UQCA 1JF6A 4C6IA 2EPNA 2HQAA 1DKWA 3ERPA 4G8TA 1JL8A 1UWRA 1MUCA 1HX0A 4E2OA 1G9HA 2L5HA 3A3WA 1WKDA 3VIKA 4IJCA 1XLCA 2ALDA 3KEHA 3L5MA 2VURA 3ZXWA 2GVEA 1B57A 3ANYA 5AHLA 2WKJA 1H09A 3TJLA 4ERGA 2EO7A 3HOJA 4RNJA 4UTWA 1F6YA 4L7ZA 3OIHA 1TE1A 3E3HA 4C1NA 3GU9A 1UWTA 3B0YA 4MHBA 5E70A 4U4MA 1C29A 2ZA1A 3U2ZA 3AWNA 1PX3A 2QCNA 3OGRA 3W7NA 3PHAA 3ALFA 2OPJA 4JXCA 4ATWA 4C6PA 5DLCA 5TIMA 3FAWA 3HJZA 4CCDA 3EWWA 4C6NA 1OX4A 4H6EA 2OWXA 2R24A 3TTEA 4F0SA 1V0KA 3VNYA 3K2GA 4Z2KA 1ITQA 2VZVA 1TJ1A 3LYEA 2J7BA 2DT0A 3URBA 4N7QA 3D46A 1V4YA 3SSZA 3IEBA 4JD4A 2PFHA 4Z2HA 1J96A 3MVTA 2SFPA 4L61A 5AFDA 3ARTA 1JZ2A 3ZJ8A 1XYMA 4H83A 2E40A 2Y88A 1M9HA 2QCGA 4HVXA 2OLAA 1K9DA 1BXCA 1V02E 2Y5EA 3NDYA 3I68A 1H7WA 1S1RA 2GZXA 3Q94A 4FI4A 2E4TA 4NZCA 1K1DA 2XM1A 1G69A 3BG3A 4HA1A 4P7RA 5I3HA 1R0MA 3MV01 1EF3A 4TX9A 4WKAA 1T96A 1WZLA 1XI3A 1UP3A 1QJWA 1KWGA 3MTWA 1YLVA 1XM3A 3HQ1A 3IAPA 1QK0A 4RDYA 3B05A 1J11A 3W7KA 3CEPA 2HJPA 4YN5A 1F05A 1QNQA 4F2TA 3CUXA 2P3ZA 1J6OA 1I2QA 3BICA 4E4FA 1QNRA 1R3QA 4PFMA 1CZ1A 2X42A 4BI5A 3MSYA 5A6BD 3HFTA 1FWEC 4H00A 1HGYA 4XZBA 1OC7A 3RHGA 1S2VA 5A6LA 1CLKA 5G4EA 4Q8PA 4GQGA 3C4UA 3BPWA 3FLUA 4CD5A 4O54A 2VTFA 4PTXA 5HK4A 2WZTA 2CC0A 1ZU8A 1QTWA 3RFAA 4KCWA 3W38A 3MT1A 2ZA3A 3MCOA 4IJBA 2XDFA 3DCPA 2QUMA 2YFOA 3SBFA 4AB4A 5AC7A 3R94A 4Y9OA 1UQZA 2DJXA 3R0KA 3B03A 3EAUA 4WEVX 1UKOA 2Q71A 2DUZA 4B9ZA 3U2OA 2WO5A 1S3TC 5XIAA 2WSYA 1NOWA 4H01A 2REQB 4EXAA 1KKRA 4WHBA 3W7GA 4ZOEA 1OQFA 1W1IE 1KCXA 4ZQCA 5LIUX 1UIPA 1B1YA 2R1MA 1BFNA 1N82A 2Z2AA 4F9DA 2DSZA 5I77A 3B8WA 3EWXA 3PZ9A 4Y8FA 3N4AA 3R1ZA 1ZQ5A 4TX6A 4EE9A 1LCOA 4O4VA 2MANA 3NGFA 2CLKA 5I0DA 4JBRA 4MB3A 3PJUA 3VK5A 2WC7A 4NKCA 2QS8A 4RDZA 1NELA 2NUYA 4XVDA 5CGQA 1C8VA 3NA8A 4ALDA 1UWAA 2PF8A 3C2RA 4HYWA 1FWGC 3W37A 3MC5A 1IXOA 4K1WA 5D37A 1F73A 1WUEA 5RUBA 1F2JA 5EL1A 1HTIA 1FH8A 4L4OA 3N9SA 1CXIA 4EPKA 6XIAA 1XSIA 1DQUA 3KUMA 3ZVHA 4CUCA 2E9BA 4ML9A 1GEHA 2Z1BA 1Q63A 4PEEA 4EXBA 5M03A 4EVZA 4RLIA 1DJWA 3L65A 4HQVA 4B92A 4FOJA 2PB1A 2J8TA 2A0NA 2FYMA 3V16A 1YW1A 1XRVA 1G7UA 3P0XA 2PGWA 1UP2A 3XISA 3C2VA 3LCGA 4JHMA 2OLHA 1UD4A 2Z6IA 3S9IA 2P5NA 3OYXA 4NX5A 1QUMA 3KBWA 2CZDA 3UWZA 4GKTA 3TA9A 3KOXA 1XH1A 2IUZA 1KCKA 2WYSA 1JQXA 1KXVA 4FIQA 2YFNA 5LNSA 1NOFA 1A5AA 1VBHA 3WF1A 3BLKA 3I7RA 1QPNA 2RDTA 3W7QA 3BE7A 1GJWA 3MSRA 3N11A 4E8GA 4NI8A 5T26A 1PDZA 3HGRA 1NWTA 2BVYA 2Z29A 3AYSA 3WK0A 4Q4PA 2Z25A 4BWLC 2HNHA 3TONA 4DJDD 1TVLA 3UXDA 1LF1A 5DRIA 2QDGA 3RU8X 3UD6A 2QXWA 4GIAA 1AJ2A 4O0KA 2PPGA 1GYLA 3A64A 1LG2A 1U83A 3QOMA 2DORA 3SCQA 2PDIA 2HMCA 2OG9A 1XSKA 4A3UA 2NQZA 1W3LA 2X1SA 2QUVA 3U7VA 3A6OA 4KESA 3A23A 2R6OA 2VL4A 1Q45A 1ZAHA 2CCRA 4I6KA 1JYNA 1JPKA 4GNKB 1AK5A 2FB2A 1RCXB 5M5DA 4GYJA 3V0UA 4HOXA 4AD3A 1R2RA 3VM5A 2HS8A 1VPXA 3ZR4A 3B8UA 5MKGA 5FJJA 1NF7A 2V5DA 5C55A 4W88A 1OIFA 4JY9A 4WD0A 4F0RA 1QNPA 4JKKA 1AJZA 2P8CA 3LERA 3OO2A 1E56A 3HG2A 1J2WA 1LDCA 2PZ0A 2ZVIA 4L9XA 4LVBA 3TW7A 4RW3A 4XV0A 4XWUA 4K6AA 4NYYA 2VCAA 1XRTA 4JIHA 3NZ1A 1UC4A 3MKVA 5CAHA 1IR2A 4S3CA 1A5SA 2ATMA 2XVNA 4QAIA 4Y9AA 4PL1A 3T05A 5LIWX 2X2YA 4WQ6A 4XUGA 1GTHA 4MVAA 1K7EA 3FA3A 3G6LA 3GNDA 5KINA 3E1F1 3O63A 3ARPA 5A8NA 3Q2DA 2WMFA 2P10A 1NDWA 5D32A 3LS9A 4IMFA 4EWND 2D69A 1PX8A 4UMBA 4LB3A 3LEPA 1IZKA 1RD6A 4FF7A 5IXEA 3L5AA 3LLFA 4F8XA 4QRNA 1OFAA 3SUVA 4LS1A 4M29A 4FXJA 4ERAA 3EXSA 4ZCWA 5ENLA 3QC0A 3W4RA 5EFDA 2BXZA 2G3MA 4GYPA 1RJRA 2VCCA 1RBLA 5E0KA 2HRWA 2QV5A 2INEA 2X1TA 1XDLA 1TYGA 2PDUA 1GORA 2HK1A 4LT9A 5CJNA 3C6CA 3T0CA 4XAGA 5CEWA 2A3BA 3CQ0A 4NZFA 1W3KA 2Y7FA 2FMOA 2QV4A 3RR1A 5A8PA 3SQSA 3S2MA 4MJ2A 1MQRA 4IGHA 2J4GA 1V7AA 4JTSA 3VC6A 3A9BA 1K4HA 4J3ZA 4ZGYA 1E70M 4IICA 3S5YA 4EF8A 1OIMA 3C5QA 2BOGX 3W2KA 1TPUA 1EBGA 1JVNA 3FSTA 3N9RA 3W7PA 3UZYA 1XPYA 4QAWA 4B3LA 3UZJA 4MB5A 3VAVA 1XLMA 3LCIA 2R82A 1E43A 2ZE3A 3MHUA 4NU7A 4MWAE 4XZIA 3DHDA 4UFLA 2V6AA 3ANVA 5F1UA 1OG0A 4IPIA 2Y24A 2XHYA 1A0DA 2GJXB 5I2UA 2WSQA 3BZJA 1ONEA 5GNYA 1TMQA 5LHFA 3TK7A 3GXDA 3A13A 4UFMA 4RXGA 4DWSC 3DC0A 3MUY1 2QKFA 4JNZA 4H2CA 1NM9A 4M51A 4JFWA 3EWYA 1ZSXA 1DXIA 4H8VA 4AD2A 3E12A 2WZIA 3PSWA 3LNPA 4LH8A 4WJEA 3NM1A 3W70A 1ZBKA 2VEFA 3FGCA 2VKZG 3I65A 1OD0A 1WX0A 3CV7A 4UC5A 3WUBA 1RP8A 4NAFB 1JDAA 4B2DD 3ZYZA 4NNBA 3GFXA 2QCCA 1WDWA 3ARRA 2PWHA 2R91A 3QHNA 3DHPA 4IPNB 2YCJA 3DEQA 4C65A 3ABZA 4LYPA 3P14A 1PKLA 3NPWA 3GC4A 4Z1BA 3V0TA 4GABA 1RCOB 1PKMA 4WF7A 1PE1A 3CEUA 3H53A 1GOOA 4I5RA 4E6MA 3HB9A 2PWGA 3LU2A 1CW2A 4INFA 1QW9A 1JPIA 1JAKA 4NHVA 3UYIA 3TC3A 3C3NA 2I5GA 2YGYA 4R7OA 5L6UA 3AYRA 2VC6A 5CBBA 2XN2A 3GUGA 3NZGA 3FS2A 5K4XA 3MV11 1CENA 4CVUA 3APTA 3SGUA 4CNTA 4RDWA 3PF3A 5T9CE 2KZHA 1YPIA 2ISSA 1JF5A 4U31A 2NLYA 1YPXA 3D0CA 1A3XA 2OYKA 3T6CA 2VEIA 2DT3A 2YA2A 1XV8A 4HZ6A 3I6EA 1XLBA 2F7FA 5C2CA 1EA0A 1LLWA 4NX0A 1Z42A 4DN1A 3EDEA 3MZNA 1HKMA 1E9ZB 1DPMA 3TQPA 2A7PA 1W2VA 3B4UA 4S1FA 1I60A 3CT7A 1F7BA 3VKCA 1TKKA 2GWNA 2E6AA 1FA2A 4IPJA 5KZMA 4TU1A 1MW0A 4OZOA 2PDBA 2CXEA 5D33A 5GQBA 2ABAA 1EIXA 1WDPA 2J79A 4IMGA 2I7GA 3WQ5A 1GOIA 1QBBA 3LPPA 1XLHA 4I8YA 3CM4A 5REQB 5CPNA 5H2ZA 2RUSA 4Z17A 2V3EA 4U2YA 3SIMA 4BJHA 3CPGA 2VHLA 3FCPA 4RE0A 3SRKA 4AEFA 4GX8A 4DLMA 4DNHA 3M0LA 2P53A 1JYXA 4EX4A 1KFJA 1EXBA 2V0TA 5HMEA 5BOFA 1MEIA 1H49A 1RQEA 4HCHA 3L4XA 1ZJIA 2WJEA 4QJ1A 4WXYA 1S2WA 1H7NA 4GZJA 4XQ6A 5A94A 4EAYA 1LRQA 3EX1A 1OGGA 4XZLX 1VF8A 3S42A 3GNRA 3VMNA 4O17A 2UY3A 4JY8A 3QYQA 1ONXA 3NAVA 1A5BA 5G2WA 4YXGA 3W72A 3ZR5A 1DIEA 5C9UA 1Q2SA 1EJWC 1WE5A 1IEIA 4PSPA 1UKPA 4ORMA 5AVNA 3EOUA 3EX3A 4Z2GA 3KCLA 5D8ZA 4GI6A 4W5ZA 1NQKA 1EOKA 3PBWA 2JFEX 1M04A 4Y9MA 3QRHA 3QY8A 1WKEA 4FS9A 1A5NC 5D2TA 1MXSA 3U2CA 4W84A 5ABHA 1MQPA 3GO2A 3CAQA 1LUCA 5CC7A 1I0BA 4HBKA 3E2SA 4LPCA 3T7VA 1HKJA 4JTUA 2Z1XA 1JYVA 2PP3A 4ZB2A 2GJXA 3UETA 4IQJA 1PUDA 3U7BA 4AD1A 1TPWA 2ZX7A 2IPFA 3IVSA 2PD9A 1WQ5A 7XIMA 2BY2A 3BGJA 2FGZA 5AHIA 4HNLA 4UTLA 2YL8A 1KGXA 5HATA 3WDQA 1BVWA 2WJDA 1LBMA 4I9MA 2QDHA 4MY8A 1FWIC 4UCGA 2YBTA 4G56A 3H7VA 4NT0A 4C6LA 4DUWA 1DHKA 5I09A 3Q4DA 3KM8A 3SRFA 1TV8A 3C52A 2XSXA 5MF5A 1Y65A 4GUGA 1S5TA 4IIHA 3VNIA 4GIEA 3GXNA 4GO9A 3CUFA 4M80A 5JMUA 2DQWA 1D8CA 1W2PA 4JQ3A 5FL0A 1UOZA 3PR2A 3Q67A 1BXBA 4TUFA 3M0YA 1SO6A 3H8AA 4GK8A 1MZHA 1EYEA 1TMLA 3WMBA 3ENLA 3CUHA 1J12A 4L6HA 1D9EA 4ML4A 3UF9A 3TXZA 2G3IA 5JH2A 2X40A 5IRPA 4AZIA 1UOKA 4ZVJA 1KW1A 3EMZA 2C91A 1PDYA 1P7TB 2QCDB 1XJBA 2EPLX 3P93A 1X1NA 3IIOA 2PI6A 2QUTA 1V0NA 5DCBA 5A8OA 4MLRA 2P50A 1W9UA 3EX6A 4C7GA 2ZZ1A 2OYMA 1T40A 2FVMA 2X1UA 1K8CA 1NSJA 3WLOA 4QGCA 3L4UA 3LXBA 2GK1B 2BZNA 2E28A 5DO8A 1G7VA 4K7VA 1Q6CA 1KFEA 2BVTA 1QI2A 1QMLA 2E7FA 3BMWA 1FCBA 1GKRA 1VCFA 1UA3A 5FJOA 5J5DA 3W82A 1O4UA 3EPMA 2GDVA 1FFRA 3G5EA 4MADA 2EHHA 5CZ0A 3WH7A 3GG0A 5BXRA 4G7EB 1CDGA 2OJPA 5CGMA 2A3CA 1Z6KA 3FKRA 3WH9A 4HZMA 2PTYA 2VUYA 3BMVA 2ZWYA 2PSNA 2PWEA 1XUUA 2CLLA 1JXKA 4ZQPA 2V8ZA 2EF9A 3NCOA 3VGHA 4LVFA 4O0QA 3TEVA 2GUYA 3E2VA 2WM0A 3VIIA 3WENA 4Q8UA 3WO8A 7A3HA 1ECEA 4ATDA 5FEPA 1IR1A 1SUXA 1CGWA 4LAZA 1UZDA 2E77A 2FZNA 1VRDA 1E9YB 3WK3A 1ESWA 3WQEA 2GQAA 3O6DA 4TX8A 4J28A 3RK8A 3TAKA 2G50A 1XIBA 1TTIA 2FDMA 5M2FX 2CNCA 2QDEA 3EX2A 3QW3A 3T09A 2AL1A 2B81A 1LRNA 1HW6A 3EEZA 3O8AA 4TVDA 5LA0A 3O05A 3TTSA 1LT7A 3AQUA 3WQWA 5H6HA 2D0GA 4HNUA 4LAUA 3V5FA 5FEWA 3AXHA 3TUUA 1O5XA 3LM7A 3UP8A 1J0YA 2DDXA 4AVNA 3NQ6A 3F5JA 4O11A 4H1ZA 4H9XA 3L4YA 4JR5A 4AG0A 4C6DA 2V5JA 5CPSA 1NFGA 1SR9A 3BC9A 8CGTA 3QR3A 4JTGA 3HPXA 1IEVA 3WFAA 3W25A 4UTUA 3TQ0A 1OYCA 3KL5A 1T6MA 3TW9A 3VCNA 1N8IA 3GVQA 4OE7A 1EPXA 3S1GA 1OCBA 2AQWA 4TV6A 4H8HA 4DWDA 4H9ZA 1SFLA 2GVYA 3LK6A 3WDRA 4CKQA 3A5FA 1EJRC 5G1TA 4L1GA 2V3GA 4C6CA 4E4UA 1XD1A 5K7JA 1ME7A 1JZ4A 1H60A 3RM4A 5HOSA 2G97A 1W3IA 6A3HA 4EKJA 4JX4A 1LM1A 4AY1A 4CVWA 2B31A 2GOKA 3RG6A 4UFJA 5BW6A 1TCMA 1BD0A 1GYNA 3B8IA 1A50A 4E8CA 2CHOA 2WHKA 4Q8QA 4WGHA 5HWNA 3C61A 2GSEA 4YVPA 3HMCA 5HQLA 3EYPA 1HNYA 4LVDA 4RE3A 3TR2A 2EPKX 1Q66A 2BFGA 4YTQA 3MY9A 2WMKA 3W7DA 4HTYA 4LAKA 4JEJA 4D9PA 2X8RA 1MUMA 3GLCA 4BI7A 5JBFA 4X2PA 3WH8A 4CQCA 4LAMA 3NGJA 4UNIA 1ZLPA 3RF9A 3IAQA 1UPMB 3UR7A 4DWSD 1A4LA 3CT2A 4EPDC 2CHNA 4PMDA 3AIWA 5HMDA 1H7PA 3CLWA 4AVFA 2NXGA 5I3KA 4PODA 2YZRA 4D8ZA 4PMXA 2FFIA 2YB1A 3W1AA 2P3EA 3M9YA 3TYDA 1Y7VA 2YDQA 4N2YA 3LMZA 3GR4A 2IKJA 4S3FA 4IMAA 2JKPA 3BG5A 2E5BA 4F2BA 2CXGA 2YXOA 5AZ0A 1S39A 1UD2A 4UOZA 1R8LA 1ISZA 1HL8A 2D1ZA 1W1TA 3SCSA 5IFPA 4YVXA 3WQ4A 2V81A 3LQLA 3XIMA 3I4KA 5A3HA 4C6BA 2YW4A 4GKLA 1V93A 2REQA 3VNDA 5K9XA 5CJMA 4GCAA 3PPHA 1RSCA 4DYJA 3B9NA 1XLGA 1XG4A 2C3ZA 5L9FA 2QJJA 5CPLA 3IJ8A 1HJXA 1JEZA 3N04A 4TTUA 3DG3A 3GTFA 4HTBA 4C6MA 3GVWA 4LW7A 1YYAA 3OVQA 4UTTA 1KBBA 3U3HA 5IFTA 2Y5SA 3DESA 2EG7A 2XPKA 2OWCA 3ZIZA 4DF0A 4EANA 3W2UA 4IQEA 1R3RA 3SN4A 3CU2A 4QDWA 3GDMA 4ZOBA 4JL1A 2C13A 1O5KA 4F0KA 2ZTKA 2VD9A 4K8GA 4HNVA 4M7TA 1X8FA 4LS0A 2CEQA 4L4LA 2CU0A 2OU4A 2GQ3A 3TZNA 1RV8A 1EDGA 1TQJA 3EMCA 3IARA 2OQYA 1PTAA 4HGXA 4KCUA 4UTIA 4UTHA 3N29A 5LA2A 5F4WA 3M5XA 2CBIA 4GRSA 5F2IA 5FD0A 3WFLA 3UWYA 3ARUA 3PPCA 1QRQA 3E38A 3WLKX 1V3JA 1GOMA 1QWKA 4E2VA 4OUEA 4I3GA 3E0LA 3TN3A 4AZCA 1ZB5A 4NYUA 4E0CA 1H7RA 4HPGA 1V03A 3B0PA 3IACA 3V1PA 3OBKA 5G5IA 3BSHA 3AZRA 4GY1A 2PDNA 2PA6A 1P0KA 3RLUA 4Y9PA 4Q3MA 1B4KA 2AAMA 1POKA 4H6QA 4R27A 4P2VA 5JBEA 2YLLA 4NILA 2NX1A 1U5HA 2YLAA 2NV9A 3WL0A 3FJ4A 3PFMA 3URNA 2ZXDA 1LLOA 2ZX8A 2ZRVA 1BQCA 1PEZA 5A8QA 2PEVA 1ZAJA 2FJUB 3DFHA 4IP4A 3L0KA 4KEMA 3CZLA 3HTWA 1G1YA 3AC0A 3NWRA 4DAIA 3LZ3A 3ABRA 2ABBA 3IUDA 4KQNA 1XF0A 5D9MA 1YDVA 3KVLA 1V5XA 3UJ2A 4F79A 3W01A 1GOWA 4XZHA 1OM0A 2BGSA 2Y6ZA 2VR2A 2PDKA 7REQB 1OK6A 5D2YA 4GD0A 2F84A 4XD6A 1UPPA 2Y4SA 4US5A 4UQAA 3E96A 2FH8A 3UQNA 1JNEA 1E5JA 2JK2A 4K37A 2J7HA 4I6VA 3U5YA 1S3HA 4QFUA 4KWOA 2RJGA 3W7OA 4MIMA 4M6UA 1TWWA 1YTEA 3GC2A 4HHLA 2ZUUA 5A5WA 1BG9A 3P74A 4Z1YA 2IPGA 4M56A 3PZIA 5BNKA 1HIZA 3VKAA 3T81A 2NUXA 2CFFA 4IQLA 3KAOA 2QIWA 3RMJA 2W63A 3FJLA 4PCTA 5DANA 1SW0A 3CLMA 1F5ZA 4M1RA 1GEQA 4IISA 4O10A 2FDSA 2OVLA 2A6LA 1DXEA 4F4RA 2VFIA 5HPCA 2PC8A 3W87A 4E3VA 4YTRA 4W86A 1RCQA 3L4ZA 3GVGA 2IQ0A 1VFHA 3ZWSA 1TWDA 1AL7A 2OSXA 3UJEA 3PM6A 2J74A 2GPTA 4PR4A 4JKLA 3EB4A 1DJHA 1UKSA 4ZO6A 1VAHA 1E4IA 2OWWA 5AKQA 2NQ5A 2Y63A 3QGVA 1TPEA 1E1FA 4FZIA 3SUUA 3UYCA 4HU4A 3MHGA 3RX3A 3B9AA 3GDLA 2XG9A 2WC3A 2D3LA 1I0DA 3W2NA 1GYMA 3WZ0E 3ZFHA 1EJTC 3OG3A 1AJ0A 4KEUA 2VVSA 1Y8BA 3DI0A 2XFYA 1DQWA 3OW1A 3EOLA 2PGEA 1B30A 2B7PA 2VYOA 3K1DA 5AYYA 1JUKA 2IPJA 1TV5A 3HJEA 1GWJA 4HOZA 2WB5A 5G2HA 3WDHA 2BG5A 3WQ8A 4MGGA 4KF1A 4HU8A 3BH4A 1MDRA 4GI8A 4F0HA 1F9CA 1EX1A 4C6JA 1CB2A 2UY4A 1TJ0A 1CB7B 3OZPA 5G1YA 4PMYA 5IDIA 4JTCA 4ZMGA 1Z3NA 4DYKA 3LENA 2NVCA 1DJZA 5BZAA 4UZSA 4TXEA 3E9AA 4HMEA 2FMNA 3ZM8A 5BOEA 1OINA 3JR2A 1JDFA 1JCLA 1RR2A 3BV7A 1WZMA 2NT1A 3I7SA 1B3VA 1GOXA 2WMIA 2Z7GA 3AIVA 3NR0A 4RPPA 2X41A 5HDRA 4UUIA 5EMUA 1KTBA 1NDYA 1ZHAA 2ZX9A 1R47A 1PHQA 3O0FA 1UZHA 2PCEA 4MFEA 3TYZA 1RLDA 3NNTA 1EZWA 1YBQB 3VNMA 1EJ7L 2XGIA 3TSMA 1OFDA 3CQJA 2AAAA 1B9BA 3ZMRA 1P5BA 1PBGA 1Q3NA 2QW5A 4RL3A 1JFXA 3VZZA 1BVZA 3BGGA 3VC5A 3UJRA 1R87A 1R9XA 1OJXA 4YHEA 1ODZA 3KRUA 1JD9A 4JEQA 5K9CA 1WOAA 2YW3A 1RALA 3W7LA 3NEHA 1FFQA 1VFUA 2YCLA 2CKSA 4UTFA 3FX4A 3CL6A 2PP0A 5D38A 4LUJA 1KRMA 4M82A 3WNPA 3O06A 3N4FA 3QZEA 3N14A 4MG4A 1AQFA 2HE8A 2BV9A 2G41A 1REQA 4KGJA 3DFSA 2YZ5A 2J7EA 3N73A 1RXOB 3ZLFA 5LNVA 2PLJA 4R9OA 2W67A 3ZR6A 1E0WA 5DMYA 4AIUA 1RY8A 1B54A 1VGAA 2V2DA 2F2KA 5DCDA 3VD7A 4KERA 3CAKA 4IGNA 5D2VA 3HM7A 3DBNA 2CZVA 4D71A 1VBRA 1KFWA 3W75A 3E5BA 5F2LA 4UQEA 1TJ2A 2PWUA 2BY0A 9RUBA 3CV1A 4H7VA 3OGSA 1M7XA 1OG6A 2G37A 3G8RA 3H54A 1Q4NX 3AICA 5A6SA 1EL3A 3LY0A 4G9PA 3W07A 2Z4GA 3B4YA 1NEYA 5LXXA 3L5LA 4AC7C 3E0WA 1L6WA 3M0XA 4AX7A 2DT1A 3T0DA 1D2KA 1TR1A 3AISA 1RK6A 3BUVA 5AHNA 5AECA 5CC5A 2CLEA 1KRCC 3QHMA 4K39A 1E4NA 3M47A 4IXHA 1T99A 4Q8TA 4D8AA 2HVMA 4W5UA 1W1PA 1P1MA 5BU6A 3CMFA 1OT2A 2EAWA 3VU2A 1B9ZA 4BA0A 3GDRA 1VYPX 2AMXA 4OBTA 4K1GA 4GG9A 1DQXA 1EEPA 1KM5A 4ILSA 2XIIA 4IP7A 2GDQA 4LAOA 3EA1A 3ITVA 4IIEA 3S3GA 5AB3A 3H4WA 4RX0A 4NSBA 4NZ5A 1TA3B 2OOFA 3THAA 4AMCA 2Z00A 4B5VA 5BXSA 5K9DA 4P8WA 4WZHA 3WQOA 3ABSA 3KTXA 1C92A 1CCWB 3CUGA 4G1NA 4HSOA 2VO5A 4QCFA 5I03A 2ZBTA 2EJ1A 1HKIA 3W1PA 4HSNA 2BODX 5J8LA 1JD7A 1G0CA 1HJVA 4G1KA 4I9TA 1XIGA 5EGRA 3DYMA 4DPPA 2PTXA 3I3BA 2PDXA 4MLJA 2MNRA 4FALA 3OQEA 3W6LA 3VD4A 1A5CA 4DO7A 4NY2A 2BOEX 2PTWA 2ASHA 4QLLA 3WUEA 4ZO9A 2OZ0A 2QYGA 2DZBA 3O15A 1TX0A 1SZEA 1P0NA 3WQVA 1FCVA 3HPZA 1KD0A 2JEPA 4PMJA 1YXDA 3BCJA 3FXYA 4EACA 3L2IA 1TPH1 3TOPA 1MSSA 3CUIA 2XGBA 2BLEA 3DENA 2DZPA 3B3DA 3GAYA 3OBEA 3BW2A 1MO0A 3KVKA 2WM1A 1VPYA 1AG1O 2WCAA 3PAJA 1FWRA 1KR1A 1OWQA 3CZ8A 2W4XA 4N02A 2HV5A 3T0BA 2VOTA 2PODA 3IVUA 3NVTA 1K9FA 2ZFAA 1T5AA 4Y6GA 1N7KA 1AUSL 3QYSA 3CBWA 1NVMA 3NL3A 1C8XA 1BRLA 2AL2B 5CQ1A 4YHGA 1NIUA 1EWEA 5I3DA 3S6DA 2Y7EA 3QTPA 2QJGA 2WSKA 4W8BA 5D03A 4ZE4A 3RR4A 1JUBA 8XIAA 2ONEA 4F3HA 1F74A 3A4AA 3O07A 2WJZA 3HO8A 1Q6QA 1SVDA 3KCJA 4BEQA 2QVHA 3MBFA 1RP9A 1TTPA 5AHMA 1K77A 2H9AA 4JTFA 3VGFA 1EFZA 4D6JA 4LUIA 3II1A 4KWWA 2IQTA 3HG3A 5A2BA 1J8VA 3UBPC 4O1CA 3AROA 1M65A 3N2XA 3MUXA 1OX6A 1KR0A 4ZXLA 3R12A 3PZVA 1RPXA 4O1EA 1PSCA 3KHDA 1J4EA 2C71A 2QMKA 1OYBA 1P7TA 1B3XA 1TV4A 2WKLA 2VXNA 4ONVA 4FNUA 4A4AA 4PUWA 3MZ2A 2CBVA 3UWUA 2XU2A 3W84A 4G2DA 3L66A 1KWKA 3ISIX 3JZEA 2PZNA 1TWZA 4S3KA 4PMUA 4HNCA 4IL2A 1ME8A 4FF5A 2C15A 1XBYA 3K8MA 1OFRA 4XZ9A 3CYVA 2DIJA 1A5KC 1LROA 3UR5A 1MQQA 4JYDA 1J9YA 2HTMA 4KCVA 3ARYA 4LWWA 3TDFA 4X9SA 1HL9A 5ABTA 2ISDA 1XL9A 1H5YA 3NL6A 1XFBA 4Z0JA 3IRSA 1IXPA 2GGIA 3W85A 1TRIA 2JGYA 1NFPA 4KRUA 3GB6A 1TIWA 3IIVA 4XBSA 2DW7A 3NPXA 3VIGA 5FJUA 4M6QA 3WMCA 3BAXA 3SCUA 3SO7A 4GNJA 5FF2A 3I3EA 4AQLA 2CHRA 2NX3A 4WOZA 2XWDA 1P0DA 2XIBA 3ITXA 4NJJA 3VDCA 1Z9AA 1KC7A 2INFA 1M03A 5A6KA 3UEQA 2A3HA 2NXIA 1K6AA 3WD1A 4DBDA 3WBXA 2HROA 5HUPA 1TJPA 3BAKA 2ZRXA 1UC5A 3FOKA 4MPKA 1PZ3A 1A3HA 2QIIA 2F8QA 3XINA 2PDYA 3OHMB 1ENUA 2BY3A 1EB3A 4BHYA 1KBLA 3SDOA 3VOCA 1QATA 3EOEA 3NQAA 5A69A 3H70A 2V38A 1R3TA 1SU5A 1J79A 2FH6A 4NL1A 2D20A 4ZXOA 3PBGA 3N19B 2G5WA 1I9CB 4JIIX 3CHDA 1GUVA 1QT1A 1JUEA 3WL1A 3OLIA 1BYCA 1ZTVA 3MJYA 2VZOA 5GJMA 4CNNA 4ZSUA 3W6YA 4ZL1A 1V08A 7CGTA 1W9PA 1WYIA 1JI2A 1V6VA 1PIGA 2PDMA 1JYWA 1UR4A 4H9YA 4HMNA 2YSWA 1YDNA 2CWNA 1P6CA 6PTDA 2XFWA 3SY8A 2RDUA 1DV7A 3PZTA 4L9YA 4RDVA 5HNRA 2PCQA 1KXQA 2FTWA 1VFMA 4M7SA 4A3RA 3T78A 2ZICA 5FESA 3RLGA 4N4QA 3UU0A 4Q8VA 1DJXA 3S8HA 3O3RA 4W8LA 3D47A 1S5MA 4PMNA 1CTNA 4R5EA 4CCZA 4DBWA 1NH6A 5CXPA 3S2LA 4AMAA 4CCEA 2OELA 1M7JA 1VRXA 3NSMA 4ROQA 5D2XA 3HU7A 4Y96A 1HJWA 3ARZA 4W93A 1MZRA 1V0MA 3BK0A 1AZ2A 4NAEA 5A2AA 3H21A 3DI1A 1WO2A 1Q7QA 3CZJA 2YCLB 3AMLA 1VIZA 3BCDA 2HXUA 2DIEA 2G0WA 3NSXA 2H8XA 3BANA 3EWBX 2GJNA 3BXWA 3ZSSA 1GVEA 5I07A 3R2GA 5G2IA 4QHRA 2Q8LA 1DEDA 1JR1A 2Y8VA 4ROPA 3RITA 2OSYA 3KZPA 1OZQA 3GX9A 3DFQA 3TC6A 4WSKA 1S38A 3PZGA 1CGUA 3UXAA 4AZHA 3KP1A 2GDUA 2R1LA 1V51A 2QULA 2ODOA 2P8BA 4H4IA 3VIPA 1E55A 4E38A 4KIRA 2VCBA 3SM0A 2D3NA 1W56A 1SJDA 3GG8A 1EDTA 5HJLA 3AYTA 1JCJA 4V1XA 1Y5VA 4RUBA 1ZBVA 2DIKA 3W02A 1PZ2A 1DOSA 3G0XA 4DUOA 2PE4A 4NAFA 4U5IA 1VB9A 4D6EA 1HO1A 3HV9A 1TUXA 3W83A 2C1GA 3RGTA 3FGCB 2PMQA 2D0HA 3M41A 1K03A 1VJZA 2J88A 2YJQA 3WUFA 4HK5A 2W61A 4TIMA 1RJPA 3C2FA 2CIPA 1T0OA 1OY0A 3THUA 4HB7A 5KTLA 1EJUC 1F61A 3VZYA 1ONWA 4X2RA 4PUEA 5C0QA 5E0FA 1EQPA 2W66A 5A6JA 4RZ4A 4PGLA 1NFBA 4WIWA 4A29A 1FWAC 2BASA 2VRJA 3LDVA 3WK1A 4MDPA 3B8VA 3GY1A 4FAMA 1ZGDA 3TYUA 4AY7A 4RKAA 2XH4A 2LLEA 1QHZA 1YNPA 1E0VA 3GIYA 2OQLA 3IPWA 1H7OA 4O1FA 1UP0A 1UD3A 1RAKA 3JRKA 2Y85A 3IGXA 2CZFA 4Q8OA 3S5NA 2H8ZA 4XG1A 4DIAA 4ZFCA 1US3A 1XD0A 2ZZ7A 3QC3A 1CBGA 4ZOAA 3LHTA 2C79A 3POCA 1V02A 1GONA 5PTDA 4QX4A 1ZBWA 3MP4A 1KQYA 2V30A 1J0HA 3A12A 2XWEA 6CGTA 3DKLA 4S3BA 3AXIA 3VZXA 2VC9A 3CWNA 5CGTA 2E8YA 4B5NA 1FHLA 3U48A 3QLLA 1SJBA 3MJMA 1EJVC 3GFYA 3MMUA 3T2QA 2OZ3A 3WN6A 1MVYA 2FB3A 3ABXA 1TVNA 2J9YA 1ISWA 3AMKA 3CZEA 2VX7A 1KXHA 3C56A 4MNMA 1N8FA 2WPBA 3TJXA 4DO6A 3PY2A 2HEJA 3NEVA 1AMKA 1FDJA 1A4MA 2XZ9A 4YVVA 4UNLA 4DBSA 1LZOA 2QCLA 1KRBC 3S4TA 3NYDA 2Z6JA 2ZUSA 3TP4A 1KA9F 4AZGA 4HA0A 3VX0A 3V4BA 3FVDA 4OTKA 3FJNA 2JIWA 4Q22A 1W1VA 3KX6A 1AQHA 4TVCA 1K7XA 3DDMA 4E8DA 1N2VA 2XINA 4QQUA 3NQGA 1E1CB 3P62A 3HBLA 3ABOA 4O1DA 5HQEA 2E3ZA 3AHXA 1RVGA 3KBNA 4J9JA 4KH2A 5HBFA 4NVTA 3RU6A 1VC4A 3NYZA 3G6MA 4ZQRA 1I1WA 2A3LA 5A8MA 2DY3A 4I9JA 3MSDA 4FEZA 3RUBL 3NXLA 3IRDA 3EOOA 3W24A 3D5HA 2Z27A 1HO4A 4CD7A 1H2JA 4DI9A 2PTDA 1Z32X 2DEPA 1RHCA 1NWSA 3NPVA 4LYRA 1TPC1 3WMLA 4JAWA 5K2ZA 2QNEA 1DJIA 3GXIA 3OJGA 4YYCA 2C0AA 5KMYA 1KBKA 3S5SA 1R2SA 4TQTA 1SO3A 1XH0A 1CT5A 3EKGA 3VO0A 1XHGA 2G96A 2ISWA 2JF6A 3ARXA 3HF3A 5T9BG 5CLTA 3UR2A 3P60A 3TJIA 3CL7A 3EX4A 1HVQA 3WY1A 1D3HA 3CV2A 5CJ5A 2V2CA 1UBSA 1W6TA 1TPDA 1RA0A 5BMXA 4KMQA 5U4NA 1E9LA 4I8DA 3WJYA 4ATLA 1VEMA 2E09A 5C9RA 4MY9A 3EPOA 1B0IA 1SJCA 2VQTA 2V69A 1E72M 4GIRA 1IT7A 3UY8A 4A3QA 1E0UA 4GPNA 1YDOA 2J6VA 1MUWA 2PWVA 4OV4A 2QUNA 4YWSA 4Z2LA 3VD5A 1B2YA 5ECUA 1DWJM 1PO9A 1M68A 1UG6A 2TPSA 1P43A 3HQNA 3C8NA 4ADUA 1PTDA 1X6LA 4GFIA 3PTQA 4AZBA 1H0GA 1UWIA 4H8UA 3TYAA 1KFKA 3LGEA 2E5DA 5FSEC 3O16A 4BS0A 2Z7KA 1VFFA 5D9PA 1PAMA 4QXIA 3G0SA 4FXFA 1GVFA 4GHRA 1XYLA 3TAOA 2A2IA 3CWHA 3ZSTA 4O1AA 4FIRA 4PCFA 3AIBA 3V75A 2NQJA 4DEFA 1KO0A 1VJSA 4HN4A 4OWGA 2QF8A 4LFYA 5T91A 3ECQA 1GT8A 3UESA 1SQ7A 4U3AA 3H2AA 1EUNA 1KXTA 4LY4A 3DFTA 5LNRA 3B9EA 2O92A 1I4NA 3IIPA 4UXDA 2GUBA 1CLXA 5JXQA 4FLOA 3GBEA 2ZC1A 4PBEA 1UA7A 3AMCA 2I57A 1U33A 5C71A 1YMYA 3MA8A 4UOJA 1Q7MA 2XZ7A 3H4XA 1NU5A 3GDTA 2OX1A 4TMBA 2ZC8A 3A24A 1BLIA 2JE8A 4PUMA 1KFCA 3WQGA 4EPEC 1M3UA 1WZAA 1LG1A 2BWGA 3O1NA 5AC5A 1OGBA 2GQ9A 2DU2A 3LZ5A 3LHYA 4GQ0A 3WEMA 1W54A 3F5KA 2ZOXA 5CPMA 3WDIA 1BTMA 5BU9A 3PWGA 2R94A 4Y8EA 2Y2WA 1VQTA 1V0LA 3TVAA 1KTNA 2EKGA 7ODCA 3SB0A 3C0LA 4NAEB 2Z28A 1EHAA 3UPWA 4BQ2A 2YDAA 3ICJA 2IKGA 3S1UA 5DRCA 6XIMA 2DVUA 4LNYA 2P0OA 1EDQA 1Q5MA 1XXXA 1DVJA 1F3EA 4LNCA 3N9KA 1VZWA 3LCFA 5LYRA 3DUGA 3PZOA 3E5PA 3NQBA 1PS9A 4Q4SA 4X9YA 1R3SA 4PRTA 4HKPA 3KZSA 4ZODA 4GXWA 3E2RA 2E5CA 4J5NA 2YBVA 5FEXA 1NOUA 4JN6A 3OIXA 4LYQA 3UPBA 5TF0A 2VC5A 1U1UA 3CTLA 1Q6EA 3PWAA 1UD5A 8TIMA 1AVAA 2QJMA 3FJ6A 4B90A 1ITXA 1D7KA 2WPGA 1CLVA 3S1VA 1X38A 1TTQA 3K13A 3QPEA 1DWFM 5CKSA 1ZCCA 2FHFA 1QR7A 1XCFA 2FTPA 3QR0A 2C7FA 4F2UA 4ACYA 3NIYA 1W8SA 2O55A 3MYPA 3H6OA 2E6YA 1KM1A 2J8GA 2I9UA 4MKNA 5C8BB 5TD4A 3PZQA 5LSMA 4H3DA 4D8LA 3F7JA 1OCQA 1Q6RA 2GQ8A 3A22A 5D04C 3RPMA 4X60A 2BHUA 1OT1A 2VUNA 4BI6A 4AU0A 3STEA 2CZEA 2ZYFA 1SZRA 3PBVA 3ITLA 1FHVA 3R0UA 3LCWA 4A8RA 5DQPA 2DSKA 4D6DA 1CECA 2ZTJA 1F4HA 4XKMA 3RX4A 1KM6A 3GTIA 4TMCA 3T8LA 3TW6A 4DZHA 4Q33A 1U5VA 2ALRA 3KP0A 1GHRA 1YDYA 3WJSA 5DT7A 3PVFA 3TYCA 3MHFA 3M5YA 2O9TA 1QHPA 3U8GA 1W1ZA 3VOGA 4MNLA 4LY8A 4HHHA 1FOBA 1IV8A 4O53A 4GYFA 4H04A 2D24A 1UR9A 3N17A 1E5NA 1POJA 3CHFA 3P81A 2J77A 4BF9A 4RCXA 4FB7A 4ACZB 3HPSA 3TQKA 1I2PA 1Z8AA 3LTPA 3WUGA 1EO5A 2NV2A 2PD5A 4O52A 3W1TA 3OVRA 1ML1A 1IWBA 3SUSA 1R9ZA 2QGHA 3UERA 3VKBA 3WEZA 1K70A 3DYPA 1V3LA 2QCFA 3OZYA 3MCNA 3U5UA 3BL3A 3E02A 3LBMA 4O19A 1HJSA 3FEMA 3PSVA 2OEKA 1O1ZA 5JIWA 3PP7A 1LQ2A 3BOLA 1W31A 2IKHA 1BWKA 1ZS2A 4EK7A 1QI3A 4IX0A 4S2BA 1GJUA 3NQFA 2IW0A 4KS0A 3BWWA 2F6XA 3CIVA 1E1CA 3GU2A 1J2BA 3EGJA 1DWAM 3T07A 3OB8A 4NJKA 1SPQA 3VOJA 3BJSA 2GFTA 3T9PA 3TQVA 3OYZA 2Y8KA 2AKMA 2QAPA 4WR3A 1YHTA 1YXYA 3KXQA 3WH5A 1DIOA 3EOSA 2HK0A 1GPFA 1OFPA 3W88A 1PZ1A 4FP1A 1LL4A 4MMWA 4GE8A 2D2HA 2ZXQA 1K8YA 3T1GA 2Y0FA 4R53A 4JL2A 3OA3A 1A0EA 1LT8A 4IPPA 2WSRA 2OYLA 3PAOA 3T08A 4S3AA 3LQGA 2RHGA 3CS2A 1FQ0A 3QMSA 1X39A 2QJIA 3N6JA 4IQDA 3RRAA 1R38A 2YOCA 4B15A 4BKNA 4JTKA 2Z2BA 3VILA 4HA4A 3N2MA 2V9DA 4XZMX 1XIFA 2BP1A 1CNVA 2AMGA 2XSBA 4RNFA 4ERIA 2QQ6A 4LV4A 2PDGA 4MUZA 3K1GA 3UGVA 4QE4A 2C6QA 2G8ZA 4FMVA 4R33A 3H26A 4XAPA 4WUIA 1IEQA 1UR1A 4HNNA 4RK8A 4JNMA 4F0LA 1BF2A 3WJXA 4XSLA 5CLWA 3WF2A 2VRKA 4H7CA 3TFCA 4NNCA 4XUYA 1KFLA 2AL2A 4GQRA 2QPXA 2XIOA 2ATSA 1WAWA 4MJ4A 1G5AA 3CHEA 1PTGA 4BWLA 5DN1A 3N2OA 1EP1A 4NJIA 6TIMA 4DX3A 2GUUA 2FGBA 4FR6A 1SSGA 4MZYA 4DZIA 2GYIA 1QFEA 1XUZA 2O4MA 2JBMA 3ZOAA 4DUVA 4FOUA 3VOHA 2QJHA 3W7EA 3TH6A 4JTIA 4CN1A 2F6UA 3SN1A 1Q85A 3DBPA 4GGHA 1A5OC 2FIQA 4W7WA 5ABFB 2FZ9A 3LV6A 2XM2A 4KFNA 1ME9A 2VGGA 1XC4A 2GGHA 4H6KA 4L9ZA 1IE7C 5CC6A 1BGGA 4QM1A 3PN8A 1SJAA 4E5TA 3WBAA 1FDYA 3BOXA 1WPCA 2PU0A 3L4VA 1SW3A 2ZRUA 4C5ZA 2FTYA 2XVGA 1VYRA 4JCLA 5BXTA 2J6XA 1E6RA 3GD6A 3SY1A 3QFWA 1XLJA 5C9ZA 1L6YA 1ICPA 1F8MA 1OD8A 3T0AA 4GNVA 3KRBA 3HN3A 4JS3A 1EKOA 4LF2A 4S39A 1SYTA 5FIPA 2ICSA 2XH7A 3VE7A 2EG8A 1NDZA 2F6KA 2OCZA 3H2EA 3N6QA 2CYGA 2WNQA 2ZZ2A 4BF5A 3NPUA 3TE9A 1QI0A 4GUHA 5AYXA 3SIZA 3EXTA 3GH4A 3ONCA 2FZ8A 4N9DA 3TR9A 2PDJA 4ICNA 1ICQA 4B3KA 4PMZA 5A6AA 3I6RA 1E6NA 4WKFA 4XKYA 3CV6A 2WQDA 1UUMA 3TIMA 4HK6A 2C0HA 4DJFC 1UBPC 3ITGA 5TAOA 1UD8A 2VQUA 1W1YA 4DJDC 3WLRA 2X2GA 3H2CA 1QW8A 1UJPA 1XWYA 3LN3A 1QAPA 3C2EA 1T41A 3IK4A 2VFDA 4MOZA 3EKLA 1IIHA 1HP4A 3LRLA 1WKYA 3BVJA 2PS2A 3G1SA 2PLKA 3EDFA 3GG7A 4AFYA 4Y7EA 3KTSA 5K3VA 1IZCA 1W17A 3QQ1A 2RJHA 3SCRA 3LA4A 2PDFA 1TCDA 2WVUA 1Q2RA 2Y70A 3DX5A 4IMDA 3RRXA 1ZENA 2XFRA 1UR2A 3GNXA 1AFSA 2H3BA 4C60A 1XH2A 2I1OA 4ADTA 2ON3A 1OCNA 4UZUA 3BURA 3M6YA 3I3DA 3DG7A 4GJ1A 1A49A 3IK2A 3GDKA 5AC8A 1JZ8A 3REQB 3EBVA 3N2CA 4PA8A 3TYBA 4M1BA 3W0KA 4KT2A 1L9WA 3OLGA 3U0HA 3U9IA 5CPOA 4MF4A 3RJXA 4F0MA 1DE6A 4HPXA 1HN1A 1MW1A 2PUZA 3LBCA 1XSJA 1UH3A 2YA1A 4R3UA 3S1XA 1QNVA 3E0VA 3SCNA 1AQMA 3UXIA 4A3HA 1Q6DA 4JCMA 3F4NA 3H12A 3V3WA 4O15A 4O50A 2DZVA 1F07A 1ISVA 4AC1X 2VFEA 4IGSA 3ITYA 2VX5A 4AEOA 1DHPA 1DWIM 1GW1A 3PUOA 1OFEA 4RV8A 4B4FA 4HYVA 4WY0F 4BZYA 4D1IA 1F4AA 3PPGA 1EWDA 3QR1A 1UWSA 2IPWA 4CNUA 4Y2WA 2BVDA 3RLHA 4QQ3A 4LEFA 4XAZA 2W9MA 1UMLA 3EZ4A 3DOPA 1FWJC 2GGEA 2ZRZA 2BVWA 4E2DA 2ZZ4A 2YCIX 3GSMA 2ZUNA 5C2GA 4DJDA 2Q3RA 1GK8A 1OADA 1EJSC 1WXYA 2E9LA 2X0SA 3FW6A 3BAWA 4W87A 4F48A 2XISA 1FHDA 4RJEA 3GHTA 2E1WA 3AXXA 1R6WA 2ZIDA 2ADAA 4ZA0A 2DVXA 3R8HA 2BS9A 3TZFA 3NSNA 4DM2A 2EBNA 5A2CA 3KWSA 3AU6A 2FFCA 4IH3A 2EEXA 2VWTA 1ZUAX 1NDVA 3H24A 2DFAA 2VEMA 3KLKA 2KX9A 3H2MA 5AC4A 2CBJA 5D09A 1PVNA 3K46A 4E2BA 1YNYA 3PULA 3CB3A 1EGMA 5M3WA 3FVMA 3L21A 1U1HA 1I45A 4LUTB 4HCLA 3CXOA 1OF6A 1F3WA 3WLLA 1H3GA 2QHAA 1ZZMA 3TSDA 3QVQA 3WSUA 4QG6A 4EIVA 4IMCA 4POCA 3N13A 1IYXA 2BB0A 5B80A 1S2AA 4S38A 2VMFA 4CQ9A 4DELA 4YTTA 1UWUA 1JAEA 4KEVA 3UZWA 3BJTA 1K02A 1XIJA 3BLOA 2CERA 4OVXA 1XKJA 5I7GA 1Z48A 2O7SA 3INPA 1E6PA 1AW2A 2OXNA 2CBUA 3BAJA 3WK2A 3W71A 3A3XA 1CXKA 4L1XA 1L6FA 3NZQA 3MPGA 5KSWA 1CGTA 3DKJA 2Y61A 4HIBA 3H55A 3P80A 4C6FA 1NWUA 2A21A 3LCHA 3FV9A 4V28A 5E09A 3QKEA 1EPVA 1K8ZA 5TQLA 1RD5A 2ZWZA 1ISXA 2QPUA 4HJFA 3IGHX 2WANA 2GL5A 1BWLA 3SGZA 1XIEA 1E4MM 1XW8A 2YB4A 3U6WA 2A3EA 4HZ8A 3P67A 3DHFA 4GY0A 4GLEA 1R5YA 4KETA 3APGA 4KWUA 4RZ5A 1V79A 2DVTA 3M5VA 4UB9A 2I14A 3C0JA 3LTSA 3WDJA 1ISYA 4CN6A 4FO4A 1B5TA 2XN0A 5HANA 1C9DA 1JCMP 4LSBA 3P0WA 1NARA 4IZGA 1I2RA 1GKPA 1H11A 3VMPA 4PB3A 1HJUA 3KOZA 1WP6A 4LXFA 3FDKA 3KFTA 3LHUA 4X0NA 2R1NA 3QV9A 3G18A 3GIPA 3V36A 1O5RA 2F38A 2PLMA 1YTDA 1DTNA 4NF7A 1R7AA 3R7MA 3VDHA 3BARA 3GW0A 3QTGA 3PUGA 1PYFA 1VLWA 4IM4A 2UY5A 3CHVA 3S5OA 4HT3A 4AAJA 3CO8A 1L8NA 1KRAC 4O16A 1LRTA 3GXPA 2VFFA 3NQDA 3P8IA 4DXVA 4MYAA 1X6UA 4FSAA 3G1YA 3BQ5A 4LU0A 1CX9A 2C1IA 3EDJA 8XIMA 4CD4A 3CQHA 4IF2A 3KRSA 1I1XA 3K8KA 1RPKA 3WNOA 1AODA 4AHOA 1M7PA 1VCGA 5B7ZA 4FHAA 4P7OA 3T42A 3TCSA 1GHSA 3MBDA 4HU3A 4A2RA 4FNSA 2G3FA 3RJYA 2EG6A 2XN1A 5I5RA 3F2CA 4JFVA 3AS2A 4M8UA 3GHSA 4IIBA 4AD4A 2V2HA 4OT7A 1IQ8A 4IIGA 3VDAA 4JICA 1YE4A 4IGMA 4XB3A 4XO7A 3TKFA 2V67A 3U2EA 2DPEA 4WLCA 3WCZA 3THDA 3EB3A 1O12A 1JZ3A 1OC6A 3SN0A 3LMYA 1Z7AA 5IHRA 4LRTA 3PB0A 2UZ9A 4AYGA 1ZP4A 3LPOA 2A5HA 2WOQA 1TV2A 3AOFA 4QCEA 3C0QA 4H6RA 3MI3A 4AZCB 1YRRA 3EWZA 4KBXA 4WSHA 1I2NA 3W23A 2V68A 5F4XA 4LX4A 3FXGA 3GXMA 1FY6A 1XIDA 1UUQA 2DW6A 1JZ6A 1VJIA 3CPUA 1O1HA 3UWEA 2AQVA 6ALDA 1TPVA 1F8IA 4PBFA 5JUVA 1R7OA 3GC5A 3V5CA 1IEWA 5ABEA 3ITOA 4BF7A 4B2DA 2Q09A 1UR3M 5HWJA 4J3WA 5CAKA 3VNLA 5GVJA 1VHCA 4R85A 1AL8A 4Q7BA 4XAFA 2ZUTA 2BDQA 4Q7NA 8A3HA 4UQ9A 1QI4A 3AIEA 4QIUA 1EEXA 2BXVA 3PJXA 3O6CA 1HG3A 1VCVA 3GWQA 1DL3A 3L4TA 2PDLA 1E9IA 4UQBA 4W9TA 2F2HA 4NRSA 3IGUA 3P82A 3KHJA 2FZMA 1S2TA 4LUSA 2BGQA 3VFLA 4RV3A 3B0XA 3A4JA 3M0VA 5JBDA 2ACQA 4JQAA 2CLPA 3RM9A 1KV8A 1WUFA 4Q4RA 2GGGA 3LM3A 1QWGA 1VIWA 4YCPA 3R58A 5EMKA 3JVAA 1XYCA 4FX8A 4GC3A 4FX7A 2E1DA 3WQ6A 1CXLA 3DU0A 2FLIA 1REQB 3SQMA 4HJWA 1SO5A 2A7RA 3ZO9A 4PTDA 1EGZA 3S46A 1LLZA 3R0DA 4O57A 2ACSA 3UVAA 4X63A 1OABA 4PTNA 1Q6OA 2DGAA 5CZJA 1OZMA 2QT3A 6REQA 1VENA 3W1MA 1UIOA 5XINA 1QCWA 1R3YA 3IJDA 2Y7DA 3UWQA 1JPDX 2J62A 3CC1A 3YPIA 1EH9A 3VXGA 3HPFA 3AMDA 4ES4A 3OBAA 3WF3A 2O0TA 3RO8A 4K68A 3SJ3A 1T7LA 1YBQA 3L23A 2WVVB 3L9CA 3R79A 4OQVA 3OZMA 4WSJA 4PSRA 2BMBA 3LCLA 4US5D 3SADA 3L2LA 1YKWA 1K9TA 5AN7A 3UPMA 3QY6A 2Z1KA 5D4YA 1K3UA 3WX7A 1KGWA 3W28A 3TX9A 1JCTA 2RDXA 1W5OA 3OOQA 3LI0A 2TODA 4KRZA 1XLDA 1Z69A 2G4FA 3PUDA 1FBAA 3NFUA 4Q6XA 5DX7A 4HHPA 1LTDA 2HXTA 2WCGA 4J3SA 1WXZA 4TTGA 2G3NA 3N3TA 3UGRA 4NXKA 1PIIA 4UWMA 5BRBA 1W3NA 2HS6A 3ZJ7A 2E67A 1H1YA 5C7HA 1CPUA 1AW5A 2X1IA 5BWFA 4A3YA 3MW7A 2XH2A 3IJIA 4N4PA 3FA4A 3UY7A 3AHZA 2ZXBA 1CWYA 3CUJA 1S5WA 4FLSA 2HVOA 2VDGA 4DJED 4Q6JA 3SECA 2P0IA 5H1WA 1VFLA 4MSSA 1KB3A 2UV8G 4DO4A 1W5MA 1VFTA 1YEYA 1O60A 1J0ZA 2V3DA 2W62A 1J6PA 5LGZA 3TOYA 4R88A 3TNOA 3VIHA 4IUGA 3W1UA 2D0FA 2DZAA 3NUKA 2J24A 1MDLA 1Q8AA 1HKKA 3N18A 1IWAA 1VS1A 4LVGA 3BMXA 3KL0A 5DEZA 3WNMA 4J3XA 1Q6LA 2PDQA 4DB7A 3LUTA 1IZJA 1FUYA 3K4WA 4GVFA 2C16A 4Z1CA 4GJJA 1TUFA 1PL9A 1E6QM 5EYWA 2B7NA 4PEKA 3LNMA 3SY5A 4FLQA 3W29A 1KM4A 1FP9A 1UD6A 3RX2A 2GVLA 1W91A 4V33A 2CETA 2G4JA 1OB0A 2J27A 4URIA 4GXPA 3MWAA 4CGTA 4B5WA 1GOKA 2I16A 3PB2A 4DM1A 4GXMA 3VE9A 3W76A 4YLWA 1H61A 4UTKA 2RAGA 1VH7A 3M0JA 3OP2A 2P88A 1PV8A 3W7RA 2WLZA 3WQFA 4RNHA 2HISA 4A8NA 5F4SA 1QXLA 3LB0A 4J3UA 2WK2A 3MQTA 4QG9A 3CK5A 3RCYA 1SFJA 4IWWA 3QPYA 3PZUA 1UKTA 1JCXA 1R3WA 3VIMA 2WZEA 2OOGA 3NO1A 2YA0A 3OLDA 3LGGA 4PRRA 2B7QA 4XD4A 2VR5A 3V35A 2J75A 2O56A 1IWPA 3W53A 2AKZA 3NQ8A 4EP8C 1GTEA 1W9DM 7PTDA 2HBVA 4HPNA 2DH3A 3MUAA 4GVHA 4NNAA 3KWXA 4UFIA 3S0CA 2YPIA 2RH9A 4XZWA 3TU9A 1XFCA 1U2YA 1C90A 4RW5A 4CNSA 1B3WA 3HURA 2H9AB 1H63A 4R7WA 1GPWA 3MB9A 8RUCA 3R13A 1XRSA 5J5RA 5IBXA 3R10A 4GC4A 1ZRQA 2ZXAA 1CGVA 1CEOA 2WWDA 1NAL1 2I9EA 1E0XA 1M6JA 3SCWA 3ZWTA 5BWAA 2W27A 4H19A 3GUWA 1RA5A 4HA3A 3P2VA 1TRDA 5CSYA 3HQPA 4JHZA 4MYXA 4DWSA 4Q4QA 2Y7GA 1JDEA 2DZUA 2BSLA 1IHIA 3LSBA 2W6RA 2NWSA 2QCDA 2R1PA 1V7YA 4J1OA 3VIOA 4C1KA 3UZXA 1I2OA 5E6ZA 3H2FA 2R1KA 3VVGA 2HPMA 4A05A 2W79A 3TCEA 3KW3A 3EEGA 1QI5A 1EQCA 3D3FA 3T44A 1D3CA 3OHIA 1O5QA 5BROA 2WV8A 1SSDA 1BGAA 1O68A 4PN2A 3DERA 4LUTA 3AIUA 4I5XA 1VHNA 4XK2A 1B4EA 1U1JA 4XAYA 4QITA 3WJWA 2B0MA 1NWRA 4Q4OA 1QNSA 3UVIA 4XISA 4ASTA 4KFOA 4YTUA 4ZBCA 4L56A 1R30A 2YL5A 4JIRA 4C6EA 1FH7A 2HSAA 1E6XM 1V6XA 2Y1HA 5BYWA 4MY1A 4NZJA 3B8TA 3QW4B 1J01A 3GH5A 4LCRA 1Q6FA 1UR8A 3VABA 4ICMA 1KFBA 1SR0A 1TMHA 1NF0A 4Z2JA 1EC7A 3T4CA 1BF6A 4G6CA 3PZNA 3R43A 4DYEA 4QSFA 2ZX6A 3S6OA 4AWEA 2WVSA 4MKSA 4YYFA 1AH0A 1THFD 3WELA 3LHZA 1FWWA 4PTWA 3AZSA 1TZ9A 3EWUA 2VZUA 3THQA 3M0MA 3MMDA 4DXXA 5CG0A 2PLCA 1NP2A 1QOQA 2BX7A 4XIMA 3UCCA 1RQHA 4X0VA 1QPQA 1C9WA 1EC9A 2XVKA 3RNDA 2EGZA 3ABQA 3CIXA 5AHEA 1PHWA 2IXUA 3WEOA 1BHGA 3G3MA 4ZE5A 1U30A 4FNTA 4L5ZA 3W2JA 3AU2A 1VBJA 4PB4A 1X1ZA 4C6KA 3GK0A 1ONRA 4MM1A 3STCA 1W5QA 1VBUA 1XCWA 3GVRA 2VX4A 7TAAA 3S9ZA 5A8GA 5C70A 3WD3A 1MEWA 4UFHA 4AYSA 2GSHA 3W1QA 1FWSA 4GQQA 4JIQA 1G4SA 1BTCA 1QO5A 4IT1A 3ZQ9A 2OGYA 4LS2A 3W2MA 1Z44A 1D3GA 5REQA 2E6DA 2Y62A 4HK7A 4TOQA 1OK4A 3N2BA 3GAKA 3DYOA 1KCZA 5F2GA 1TJRA 4XD5A 1J5TA 3RIKA 3SFKA 1RQBA 3AXMA 1ADOA 3EXRA 3FY1A 4A35A 2WBKA 3O2LA 3GXTA 3LRMA 2V82A 2V63A 4YIWA 3RXZA 1FCQA 3OVPA 4NJHA 4UR9A 4XBJA 3OU8A 4XZNX 1QASA 4H9VA 1ZFJA 4LALA 3PJTA 1ITUA 2NXHA 4CLMA 3IIZA 1K6WA 4UIOA 4US6A 4QJ3B 1VBGA 4BQ5A 2ZZ3A 4L64A 5EBAA 5HJYA 2I5QA 4XTDA 5BXPA 4BEUA 5C54A 2WLYA 5FF4A 3UA4A 3RPTA 4TVUA 2NZLA 2FVKA 2VENA 1B3YA 3DH7A 3I6TA 4WRHA 1MEHA 3BO9A 1UCWA 3MANA 3ANUA 3R8RA 1I8JA 4XKYB 1QPRA 3PBYA 1W37A 2GJLA 5DCEA 5CSSA 4BFAA 4IIFA 3S2JA 3KLLA 4J4KA 3B40A 1AMYA 3M0KA 3A47A 5FJRA 3VD3A 5I79A 3HQOA 3VDBA 3KBJA 5H91A 5E9AA 1RJQA 4FXRA 1O95A 1XLFA 1IIGA 1W1A1 3BAYA 4V1YA 6REQB 3QQWA 4JHOA 2O4QA 2DH2A 1P4CA 2C19A 1V3HA 4AIOA 1RZMA 2A79A 1K4GA 1DJYA 4BCEA 1H5VA 2R9RA 1QBAA 2WMIB 1I6NA 5AHFA 4JN7A 4QBXA 4MJZA 3SCOA 4PZVA 5F7UA 2VDIA 3IJ9A 5HA7A 5IM51 4HU0A 4N0RA 2J13A 4U10A 4OIFA 3LCXA 1YIXA 1CI1A 4RZBA 4X3ZA 2CLMA 3BSGA 5DFAA 3MCMA 1XCXA 3TWBA 2YCEA 1ITCA 4DVOA 2FGLA 5I06A 3QV6A 4HHMA 4L4PA 3EB2A 1XICA 3W2LA 4RXFA 4ZR8A 3AALA 3D3AA 3CGTA 4C6QA 2RDWA 2UWFA 3EWCA 4GVGA 1KGUA 4XSMA 3R5EA 1Q8JA 1UR0A 4G5DA 3RMEA 5JU6A 3TN6A 4KKXA 3QSTA 2HNEA 2CLFA 3C2OA 3WQDA 1PPIA 5IBXC 1PWLA 4R7JA 1C93A 3KCOA 2ZQ0A 2JF7A 3B8DA 3HA1A 2EJAA 4PCPA 1J10A 2H90A 1WZKA 3W22A 5CBJA 3ARQA 4WCJA 4JFUA 3PWIA 5FAJA 4NRRA 2GSJA 4QROA 3S9YA 3BAIA 4P8XA 3CPRA 1BG4A 1JZ7A 2PRLA 2QDDA 4U3CA 2C14A 1JJKA 4LRSA 1V6UA 4RE4A 1E1EA 3M5ZA 3CB8A 3K30A 1EXPA 3CWOX 3OG2A 4FPSA 3LPFA 1FXQA 3QEZA 5HXMA 3L0NA 3GNOA 1SW7A 3C8FA 1QO2A 3FHAA 4ZEPA 1FVPA 2PGRA 2NWRA 4P8VA 3AUJA 4V27A 2D23A 4JFTA 2Q6ZA 4V2XA 4WY0A 3V1HA 5LNUA 5MHBA 3JUGA 4JYFA 3RAOA 4KEZA 3FYPA 3O6YX 2GK1A 2PBOA 4LJ3A 4S3DA 2CLIA 2OT0A 1JNDA 3GKAA 3UCQA 3UXKA 1RLCL 5KZDA 3QY7A 1UB3A 2J7FA 3B04A 1XG3A 1BWVA 1H1NA 1PZ0A 4DJFA 4PFHA 1JPMA 3WLIA 5C9WA 1JZ5A 3VUPA 4GCXA 1TQXA 3NG3A 3TN5A 3EA3A 3L4WA 1EC8A 3F4VA 5DT5A 4DBUA 5HMFA 1KBIA 1A53A 1J93A 2E68A 3QF0A 4JTTA 1SMDA 1R86A 2WW5A 5D9OA 1SZGA 3T2OA 3AXKA 2J7GA 3FEQA 1XIMA 2EPOA 4D6CA 2DQXA 1H1ZA 2EPMX 7REQA 1X1OA 3WLTA 5FSDC 3G1HA 3QV8A 3MO4A 1SM9A 5HMSA 1W9XA 3SRDA 1EZ2A 5G4WA 1VLIA 3GZ3A 5HR6A 1WDDA 4LOCA 1FWBC 3POHA 4S2CA 2OZ8A 3ME3A 3OVGA 3AYVA 1RK5A 3C3UA 5AC6A 4GYKA 2GWGA 3LD5A 4K7YA 4WJXA 1AQ0A 1BYBA 4FA3A 2PWDA 4PUKA 1XR2A 4ACZA 3G1DA 4CNOA 4UMAA 4JNYA 3N2TA 3MP5A 3GYEA 3M1ZA 1VFOA 2E0PA 3U57A 3WYZA 3WFZA 3OZOA 5D8WA 1GGOA 4S3EA 1OFBA 1KM3A 3RYSA 2HBXA 4GJIA 3DHUA 2J25A 1CIUA 2QJNA 2CLOA 5EY5A 3QMTA 1TZ7A 4JDBA 4JIEA 3HIJA 2ZDRA 1HUVA 1LOLA 4QE1A 4QLJA 3I4EA 2FVLA 3ARSA 2WNNA 4GI4A 4IFKA 3VOFA 3WLPA 4XBKA 3S2NA 3H2OA 4QS6A 2ZE0A 3B8SA 1HZYA 3BQ6A 4S3JA 2HWGA 4DF1A 1LOSA 5GNZA 4FR1A 5IOBA 3N4EA 1XC6A 1OFQA 1Q13A 3GH7A 4JTEA 3RCNA 4GACA 4JTAA 3S2CA 5I6SA 1E73M 1ALDA 2YXXA 1P1XA 2OEJA 1NTHA 1T8XA 4Q7IA 3DC8A 2DT2A 1IXQA 1BEUA 1CXFA 1FHUA 5I02A 2CPUA 4J2MA 3IGSA 1XGEA 1MRAA 4O13A 5D30A 1LYXA 3SEPA 3WG6A 3LTYA 3GR8A 1OX5A 1YX1A 2C18A 5EKYA 3WLNA 1J0JA 1GCYA 3IJQA 3A4XA 1A5LC 4AEEA 4EAMA 3VA8A 5A95A 3GTXA 1L6SA 1ZPTA 2C1HA 3V0SA 5HR7A 2VR4A 1A3WA 3W7IA 1YXCA 4PH6A 1P48A 1XPGA 2Y8UA 4B16A 1WOBA 4JQ2A 1VPQA 1US2A 5HULA 2OODA 5FL1A 3V5OA 2XVPA 3PBMA 3RDKA 4YJ5A 1BYAA 4NIRA 3QH2A 1MFUA 4K8HA 3PJWA 2VRQA 4PUDA 4IL0A 6TAAA 4PE8A 3GIQA 3A3HA 1HT6A 3PTDA 3SR7A 5CSRA 2DV0A 1S2CA 1W8GA 3SUWA 3M44A 5FACA 2VP8A 4CD6A 1QVBA 1LJYA 1ZJHA 2BBFA 3AHVA 3VINA 4QNWA 4GA8A 1H4PA 1OVDA 2NUWA 3TYEA 3AAMA 2OO6A 1TB3A 3IJ6A 5EMLA 1J0IA 4M3PA 1DBTA 3CYJA 2WKGA 3A9IA 4O14A 2YDRA 4A22A 2O9RA 1IXNA 2YKKA 4K38A 5K4ZA 2EKCA 2AOSA 1U5JA 1GKQA 3WD0A 1JDDA 1ODUA 3GXFA 2DUAA 3BTNA 4PL2A 3GZAA 1SFSA 4QE5A 4F66A 3ZVHB 2WAGA 5AY7A 2MUCA 1DYSA 4MNKA 2PURA 3DFYA 4MJMA 3IIXA 3W1XA 5AYIA 3LSCA 1E15A 1S46A 4NUWA 1GG1A 2A6NA 1QOPA 5JVLA 4HPHA 2Q01A 2DJLA 3M7SA 2JEQA 1U22A 4N6FA 4K2SA 4PRWA 1BXNA 1XQLA 3CO4A 2OX4A 1CXEA 5EMYA 3ITTA 4FK9A 3GKFA 4AXNA 3P5YA 3S6TA 3VGGA 3VGBA 1ADSA 1L2QA 2VOMA 4UTWC 2Z1WA 3H4GA 4J40A 3MDWA 1JIBA 1DORA 3HGOA 2YYUA 2OKTA 2Z1SA 2XJ7A 1L8PA 4MPQA 2VJXA 5AVHA 2ACRA 2D2OA 1FX6A 4JTRA 5U7SA 3QKZA 1P0EA 4DJEC 4IFOA 1GJPA 1DJGA