4MUPA

Crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
284
structure length
284
Chain Sequence
b'RKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPGGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPHNSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMIDOHYDROLASE
publication title Crystal structure of Agrobacterium tumefaciens ATU3138 (EFI target 505157), apo structure
rcsb
source organism Agrobacterium fabrum
molecule tags Hydrolase
total genus 101
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 5.4.1.4: D-galactarolactone isomerase.
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4mupA00
4PCPA 1NDWA 2VC5A 5A6TC 2PGFA 1EYWA 2YZ5A 1K1DA 3LNPA 1FWCC 3MVIA 1UIPA 4UB9A 3S2JA 4YIWA 3E0FA 2ANUA 2GSEA 1O12A 3MSRA 3AU6A 2O4QA 3G77A 2QVNA 4V1XA 1R9ZA 1POJA 3BE7A 3UBPC 1UMLA 1FKWA 3B40A 2OODA 4WHBA 4C6OA 1FWHC 4DI9A 1P6BA 2Z26A 4J5NA 4B92A 3IPWA 3SFWA 5FSDC 1YNYA 1ONXA 3LSBA 2Q09A 4GXWA 4ZSUA 4XD4A 3DCPA 1XRTA 2OB3A 4IGNA 1RK5A 3EWCA 3ITCA 4C6BA 4CNUA 1J6PA 3QGAC 3UPMA 2ADAA 2DVTA 4KESA 4D8LA 4BJHA 4C6FA 3R0DA 3QY7A 3OODA 2Z25A 4AC7C 2VUNA 4J35A 4KIRA 3TN4A 4CNSA 3MPGA 4NP7A 4QS5A 3HTWA 3GTIA 3E74A 4R88A 4GC3A 4C6QA 1ADDA 3QGKC 1KRMA 4GY1A 1XRFA 4ZSTA 1NDYA 1W1IE 3K5XA 4B91A 3QY6A 3A3WA 2GWGA 1EZ2A 1YIXA 1RJRA 3E2VA 1XWYA 4XD5A 1EJVC 3FDGA 1XGEA 1P6CA 3PNZA 3LA4A 3F4CA 4C60A 1WXZA 4H9YA 4C65A 3K2GA 3LGGA 1FWGC 1EJWC 2AQVA 3MDUA 3TNBA 3E0LA 4CNTA 2QS8A 4DLFA 4L6DA 3CAKA 3S4TA 4QSFA 3GU2A 3IRSA 1GKQA 1V51A 2R1NA 3GUWA 5AKQA 2F6KA 2QT3A 1RJQA 2FVMA 1EJSC 1PB0A 3AU2A 4HK7A 1YMYA 3GTHA 4ERAA 3K4WA 1NDZA 1NDVA 2ICSA 1RA0A 4ERIA 4KETA 3UR5A 2OOFA 3ICJA 2Q01A 2VHLA 2VC7A 3OQEA 4C5YA 3HPAA 4AQLA 3TN6A 3MJMA 4I6VA 3OU8A 3GRIA 1J6OA 2Z4GA 4KEVA 1FWJC 1RJPA 4QRNA 4RDYA 1FWBC 3O0FA 3DC8A 3URQA 4CQDA 1M7JA 3A3XA 1K70A 4LFYA 1PSCA 5HMDA 1M65A 3LSCA 4BY3A 3PANA 4GX9A 4J2MA 4IF2A 1YRRA 3S2MA 1FWIC 3S2LA 2BGNE 4C6EA 4P5UA 2KAUC 3GG7A 4DI8A 4LCRA 3V7PA 1YBQA 2HNHA 2AQOA 3EGJA 1V4YA 4C6KA 4C6DA 3WMLA 2Z00A 4HK6A 3NURA 3MVTA 2Z7GA 2HBXA 3JZEA 2VM8A 4HA0A 3LU2A 3LY0A 4INFA 4CEUC 4PBFA 2WJFA 1RAKA 3IARA 3AUOA 4IFKA 4CQBA 1YBQB 1FWAC 2HQAA 3E38A 3E3HA 3IGHX 1QW7A 4CQCA 2I9UA 1UIOA 1V79A 1EJTC 4DZIA 2Z29A 4H9ZA 2R1MA 4JOMA 4QTGA 4KERA 4QROA 4EPKA 3MDWA 4H9VA 4XD3A 4B3ZA 5LXXA 2FFIA 3IV8A 1GKRA 4LALA 2UZ9A 3F2DA 2Z2AA 2EG7A 3T8LA 4EPEC 3GIQA 4IFKB 2QPXA 2HPMA 1FWEC 2FTYA 2AMXA 1A5OC 2OGJA 4EP8C 4H9MA 5HMFA 1A4MA 3OVGA 4IGMA 1ITUA 4BKNA 3EWDA 4IH3A 3OOQA 1A5KC 3UR2A 4DO7A 3F2BA 2WJDA 3URAA 3ORWA 3RCMA 3ID7A 4GZ7A 2WM1A 1ZZMA 4NG3A 4F0RA 3IACA 4QS6A 1GKPA 1EJUC 3URNA 4B90A 4I6KA 4H9XA 4LEFA 4IQJA 4IFOA 1O5RA 4GOAA 4LH8A 4XAZA 2P53A 3RYSA 2W9MA 3LGDA 2GZXA 4C6NA 5G4HC 1FWDC 1KRAC 3KM8A 2A3LA 4GX8A 3FEQA 4KEZA 4DIAA 4H9TA 2P50A 1V7AA 2Y1HA 4ICMA 1R9XA 4F0SA 2R1KA 3WYZA 1E9YB 1FKXA 3NQBA 1RA5A 2HPIA 5CH9A 1UBPC 2R1PA 2PGRA 2BB0A 4H01A 1PO9A 1BF6A 4LCSA 3GU9A 4G7EA 3SO7A 1V77A 3A4JA 4E3TA 5HMEA 2ZC1A 3IJ6A 4CEXC 1IE7C 1J5SA 1KRBC 2D2JA 3B0YA 4PCNA 3TN3A 4G2DA 3B0XA 2DVUA 4LAMA 2YXOA 1M68A 2EG6A 2VR2A 4C5ZA 4DZHA 3URBA 3MKVA 4C6IA 4IG2B 2YB1A 4H00A 4V1YA 3GTFA 2RAGA 3C86A 4G7EB 1ONWA 2DVXA 2Z28A 4RDWA 2CZVA 1VFLA 4NI8A 4C6CA 4OFCA 2XIOA 3N2CA 4GY0A 2IMRA 3LS9A 1R9YA 3FDKA 2FTWA 4GYFA 2D2GA 4IFRA 4WVXA 4EPBC 4C6PA 2UBPC 4HJWA 1POKA 2HBVA 2WJEA 1JGMA 4RE0A 4ERGA 4XD6A 2I5GA 3RHGA 1E9ZB 4Z42C 3RN6A 4H9UA 1EJXC 4XAGA 3T1GA 1EJRC 1RK6A 4DNMA 3PBMA 4RDVA 1K6WA 4LAKA 1A5MC 3QY8A 4XAYA 2EG8A 3S2NA 4EPDC 4L9XA 4LAOA 1P1MA 3ISIX 1WXYA 4GBDA 4GY7A 3PNUA 4M51A 3TN5A 4MUPA 1NFGA 2E1WA 4KF1A 4PBEA 2GOKA 1J79A 3D6NA 4C6MA 4PE8A 2Z2BA 4WGXA 4R7WA 2GWNA 3NEHA 2Z27A 5FSEC 4GK8A 1I0BA 4LANA 1ITQA 4R85A 3GTXA 2O4MA 3WZ0E 1FWFC 4RZBA 1A4LA 5E5CA 1S3TC 2YB4A 2G3FA 3HM7A 4HK5A 2OQLA 4KEUA 3DUGA 3CJPA 2E25A 2PUZA 4TQTA 3MTWA 1QXLA 3T81A 2PAJA 3F4DA 4RDZA 4KQNA 1HZYA 4UBPC 2D2HA 1DPMA 1PTAA 3GU1A 3UF9A 2Z24A 2PLMA 1I0DA 3OJGA 4C6JA 3F2CA 4F0LA 2R1LA 2FVKA 3PAOA 3CS2A 3O7UA 1A5LC 4C6LA 4DLMA 4DYKA 3GIPA 4XAFA 1EF2A 1A5NC 4LCQA 4IG2A 1KRCC 1KCXA
chains in the Genus database with same CATH superfamily
1AMKA 1L6WA 3FA5A 1EDGA 5IM51 3OBEA 4M1RA 2G96A 4J3WA 2V8ZA 5CC5A 1O12A 2J9YA 1CECA 3MT1A 3PPHA 2QJNA 3V5FA 2QQ6A 1FWHC 3L5LA 1P6BA 1DTNA 2W6RA 2QDGA 2VELA 2VDIA 3IPWA 3NR0A 3IJQA 1QPKA 3NPVA 1K8ZA 4B5SA 3MI2A 1F3EA 5T9BG 1C9WA 4J3VA 4FK9A 1DL3A 4I3GA 2DVTA 4R7OA 1Y7VA 4BJHA 5FOOA 3LCIA 4IISA 2DZXA 4AVOA 4FIQA 2VUNA 2ZC8A 4YHEA 5H8UA 3MPGA 2XN0A 4QEEA 3EWZA 5PTDA 4ZSTA 2WVTA 4FS9A 2J77A 2J7DA 4R9XA 4B91A 3QY6A 4LUIA 1MDLA 4JIHA 3INPA 3P74A 4S1FA 2VCBA 4WKFA 2BY1A 3RX2A 4PUUA 1W2VA 3OTRA 4V33A 3RMJA 1UMYA 3G1HA 1KGUA 5ECUA 3LV6A 4QDMA 2O55A 1I4NA 2VI0A 2ZE3A 3LCLA 2NXGA 2JGQA 2VCAA 1NP2A 3GUWA 1W5QA 1LLZA 3TP4A 2YYTA 1XW8A 4LF1A 1E1CA 4DJEA 1TPVA 2WB5A 2B7OA 1YXDA 1VFUA 5EMLA 5CXPA 4ZBCA 3G8EA 2XWEA 3M9YA 4PTMA 2J7FA 1CXKA 3KHDA 2XUCA 4UTJA 3ICJA 4UFIA 1PYMA 1W9PA 2B0MA 4W4QA 1LLOA 3U7VA 7ODCA 1BRLB 1QATA 1TB3A 4UNIA 3DC8A 3GNXA 2WZTA 2VVNA 4DUWA 4L9YA 1H1ZA 1OGBA 1W3LA 2WYSA 1FDZA 2O9OA 4JDYA 4UC5A 4B5XA 4YJ5A 3DIPA 4P5UA 5GJNA 3PPFA 4LCRA 4GVFA 3R58A 4YVVA 4AF0A 3DOPA 1QWGA 4MNKA 3QH2A 4LVDA 3GC5A 3TC3A 5A2CA 5LIKX 2ZZ7A 1ZRQA 4HSNA 4YXGA 2G4JA 2PP0A 2VM8A 2ZTKA 3LU2A 3W2NA 3LCXA 4Y7EA 2WZEA 2VGFA 2PRLA 5I24A 3VDHA 3OW1A 3C0LA 5A8NA 4F40A 1D7FA 4E5TA 3VD7A 3UWWA 2X2YA 1VFSA 5G1MA 3AWNA 1ZENA 2B4GA 3H2AA 1Q6FA 3QMTA 4FF5A 1YLVA 4L7ZA 3LZ5A 4AEEA 5CBJA 4IMCA 1FXQA 1NEYA 3N2TA 2GQAA 1ML1A 1TJ0A 1PIIA 2YCKX 2YZRA 4A4AA 3BW4A 2X8RA 1PXGA 4AWUA 2CLKA 4MWAC 2RDUA 3DFOA 4BQ3A 5FD0A 2V67A 3E2RA 4JFSA 1UKSA 5I07A 1TWSA 1N82A 1GOMA 1JZ5A 3VIFA 1DTUA 1HP4A 3B4UA 2VRQA 1MDRA 2BNJA 1D9EA 2AL2B 3CB8A 2OYKA 2AMGA 4WOZA 2W9MA 3W28A 1R3SA 3NGJA 3P81A 4QSHA 3WBYA 1B2YA 3L12A 3MP4A 4UMAA 1Z8AA 2DU2A 3B8SA 3FAWA 1VP5A 2DJLA 3W1LA 4LX4A 4RE2A 5E70A 3UZWA 2ZRVA 1SZGA 4O28A 4ECLA 4FOUA 1EC7A 3U7BA 4LPCA 5CG0A 4E3TA 1VFFA 4L9ZA 1GYLA 3QKZA 2D2JA 1FP8A 3BG5A 3FXGA 3KEHA 4HYVA 1UHVA 1R2RA 2L5HA 4QE1A 5L9FA 3MKVA 1AH0A 3T4CA 2VEIA 4V1YA 3REQA 1JD7A 3NL5A 3C86A 5IHSA 2NSXA 5CJNA 1P0EA 5AFDA 3DGRA 1H41A 1OC5A 2YDRA 2X0YA 1GOQA 5C54A 2IMRA 1H2JA 1P6WA 2A6LA 4AD2A 4H19A 3VX0A 4WVXA 5D2VA 4C6PA 3F1QA 1GEQA 2UBPC 4KH2A 2ALRA 4NJGA 3UT0A 3UPBA 4PL1A 4HHPA 4LVGA 1TPDA 2E9MA 3S5OA 1RY8A 4WY0B 2CHOA 1J0IA 1PE1A 5CZTA 1AJ2A 4JQ4A 4LAKA 3TTSA 3MCNA 3W1NA 2IKJA 5MHBA 1Z42A 1KFWA 1OINA 2E40A 2OFJA 2DZBA 3NFUA 3GDKA 1RPKA 2QGYA 2H9AA 5AHFA 1QI5A 4PRRA 3WLMA 4Z1CA 1JI2A 1F6YA 5I7GA 4PEEA 2O4MA 3AXKA 1UW9A 4QJ5B 1B4KA 2I56A 5HMSA 5GJMA 3BANA 3ABRA 2G37A 3GTNA 4XWUA 1GG1A 3GO2A 3ZWTA 2YXXA 3BLOA 1PTAA 1NIUA 3GU1A 3U2ZA 3T2OA 2PDCA 3OGRA 4P7NA 5EL1A 2CYGA 1B57A 3DXIA 4C6JA 3W0KA 3P8IA 2XGIA 2PWEA 2JKAA 2FHBA 3GXDA 3CZEA 4DLMA 1HJQA 3GIPA 1DJGA 1X1ZA 1WO2A 3UXAA 3N4FA 4AVFA 1VHCA 4YTQA 3OGVA 2FZ8A 3LI1A 2V3GA 1SFTA 3KOXA 5CAKA 3MVIA 1VFOA 4JTQA 4DX3A 2OMAA 6REQB 1QK0A 2QVHA 3EOUA 5HR6A 2IQ0A 2O4QA 3TXZA 3WK2A 3LPPA 3SN0A 1GQNA 4PB4A 4F2UA 4ES4A 3KCOA 3JRKA 3PTKA 2HXUA 4BEQA 2C91A 1XP3A 1I45A 1OT1A 1QFEA 4NNAA 4FALA 2I17A 3BCFA 4GXWA 5BOOA 3UXIA 3EWCA 1K03A 1KBIA 4FSAA 1XCWA 3AICA 3FCPA 3NQCA 2G3NA 4LVFA 5C71A 5BRBA 1JF5A 3WFZA 1LQ0A 3D5HA 2Z7KA 3VUPA 4S2BA 2W91A 2WZHA 3ALFA 1V0KA 1BHGA 1G1YA 2BWGA 4GVHA 3CV6A 1KFKA 1H0IA 5CBIA 3GLCA 4A3RA 3TTYA 2HXTA 2JEPA 3SCRA 1U5VA 4MLRA 3M07A 5BU6A 1FWNA 1EGVA 5ABFA 1XGEA 4GCAA 4ORMA 4B5UA 4MKNA 4MJ4A 1EXPA 1JR1A 2QS8A 4Q32A 1W3NA 2J13A 1QJWA 2IXUA 2GOUA 2WVVA 3DFPA 2QF8A 4HMNA 5D8ZA 5RUBA 4N9BA 3FAXA 6CGTA 2PODA 3GQYA 1JIBA 3ARUA 5CPMA 2REQA 1NDVA 3CUXA 2ICSA 4QX4A 3VMNA 1MEWA 3N9KA 3TN6A 3RGTA 4B5VA 1F9CA 1BAGA 1EEPA 1XH0A 3GXIA 3M16A 3PBWA 2F2HA 1WQ5A 5DBTA 4WSJA 1LBMA 2ZZ3A 2E3ZA 4LFYA 3ZWSA 1M65A 3IIVA 1UA7A 1QBAA 3RCNA 2BFGA 4J2MA 3L21A 2FLIA 3N14A 4UZUA 5H8PA 2KAUC 2HS6A 3N1AA 3CMJA 3V7PA 2GL5A 5AN7A 1BTCA 3M64A 1TMLA 5HAOA 4E6MA 3CV7A 5EBUA 3E49A 1DP0A 1XPGA 4FAMA 1SM9A 4NZFA 3VGEA 3ARVA 2NQ5A 4I8DA 3NQ7A 3SUUA 1YDYA 2D69A 3R79A 2PU0A 2NX3A 3N73A 2WMJA 2ODOA 3N25A 3DI1A 4DZIA 4S23A 4MLJA 4D1JA 1JDDA 3WQFA 4JHMA 1ONEA 1XH1A 3RNDA 3M0IA 4EPEC 1XKJA 3GXPA 2FFCA 2QPXA 2VR4A 1E5NA 4J3XA 1UR0A 3JU2A 1B3YA 1NJJA 5EGRA 4DO7A 2ACQA 1EH9A 3JS3A 1AW1A 1O60A 1GONA 3ZJ7A 4A05A 1R6WA 5AHIA 4Z2GA 1HO4A 3A9IA 2E8YA 5C55A 5A69A 1UR4A 5BMWA 3UJFA 3A5FA 1FWRA 4AD0A 5D03A 1P0BA 3H7UA 3KOWA 3QN3A 3U4AA 2I16A 2PDLA 1KB3A 2QMJA 5EFFA 1JFHA 1V7AA 1B30A 1CGVA 4QEHA 2WCAA 4HOZA 1ZP3A 3E02A 4BF9A 3ITGA 3H21A 2WKGA 1B3WA 4GNKB 3L4UA 4LS0A 4R3UA 1LDCA 3GU9A 4G7EA 4U2ZA 1UH2A 1FY6A 4XBKA 5LZLA 4RXFA 3B0YA 3TN3A 2A0NA 1BQGA 1XYCA 3V35A 3B8UA 3MSGA 2BX7A 2RGMA 1TV4A 4DZHA 3EX2A 4B9YA 1CZ1A 3PZOA 4O52A 1UB3A 1UKTA 1CXEA 1JF6A 5I77A 3WLJA 3CQHA 2DVXA 4PTWA 1DIDA 3SUWA 3MO7A 3WQVA 4MADA 4C6CA 1PHQA 3R0KA 1QPRA 3WSUA 2G3IA 2Q8XA 4Z0SA 4KBXA 3LHVA 1Q6GA 1W37A 2Y4SA 2J47A 4M80A 3T42A 4H8NA 3SECA 1VFHA 3RN6A 4H8HA 3C8NA 4DBEA 1K6WA 1X7FA 3FHQA 2PWGA 5LNRA 3QYQA 3S2NA 2I5IA 4EPDC 4H3DA 3HURA 3ISIX 2QKFA 4GBDA 3L0NA 4UQEA 1E4IA 1RQHA 3G0SA 1QNQA 4PBEA 1KTBA 4N6EA 3ATYA 1QHOA 1L6FA 2QGHA 3KP1A 5KZMA 3UQNA 1I0BA 1OIMA 2XH4A 1AA1B 4R85A 2R9RA 5I3JA 3BARA 5F2GA 3WQ5A 2D1ZA 1F3XA 2CLOA 2V2HA 4ZO6A 1IWAA 3T9PA 1VJSA 3MCOA 2E25A 2OLHA 3EWXA 1WZAA 4HNVA 1WUEA 1EA0A 3GKAA 1M1BA 2EKCA 4UMCA 1UWSA 4NXKA 4OUEA 2Q71A 1DPMA 3ZMRA 3VO0A 2PLMA 1S5WA 3RF9A 4XISA 1KFJA 4LY8A 4J28A 1TJ2A 4XAFA 3GH4A 1Y5VA 1FQ0A 2XVNA 4KGLA 3Q67A 3W7EA 3VNYA 3MHGA 3WMSA 2PDFA 3QEZA 5AOUA 1HVXA 1OWQA 1SSDA 3S5YA 3W7PA 4UOJA 4PMNA 1NTHA 3WD3A 9CGTA 3AMLA 3ZT5A 4PSPA 4FX8A 3HMCA 3UG8A 4Q22A 1D8CA 1NU5A 1O1HA 3CPUA 3N9SA 3UZXA 3HJZA 4DELA 1YNYA 3GG1A 1YHTA 1ONXA 4QCFA 4AW7A 5F4XA 1XRTA 1WDSA 2MANA 1H61A 4GZIA 1WAWA 6ALDA 1X98A 4IX0A 2VD9A 4HTYA 3PZNA 1VYRA 3OQ8A 4KESA 2HNEA 4NT0A 3ANYA 3FSTA 4WOQA 2JQXA 2XGZA 3OODA 3HFYA 1TWWA 1W91A 4HGXA 4CNSA 3HTWA 3GTIA 3M1ZA 4PGLA 2J25A 1OC6A 3ANVA 3S9YA 4IJRA 1FFRA 3USZA 3VNKA 1W31A 4WDUA 3T0AA 3OVRA 2QUMA 3T8QA 3G1VA 1EZ2A 4JQAA 3UGRA 3S0CA 4FNSA 1VBGA 4I90A 1IZKA 5E9XA 4XKYB 4JL1A 3MZNA 8TIMA 4NIRA 3WLHA 1OBAA 1IZCA 4LAZA 1I9CB 3EX3A 4W8AA 3MI6A 5I6SA 3WIJA 3NSMA 1G94A 3LTSA 4QG8A 4DJFD 2VO5A 4UOQA 2NLIA 2R1NA 2ZDSA 2X09A 4FLRA 5CPTA 3N6QA 3MHUA 3ZJ8A 4OT7A 2CCRA 3QLLA 4Q6XA 4NASA 1YXCA 3YPIA 1V3LA 4XIAA 4A3HA 1FWTA 5AYZA 1D3CA 2NXHA 4QJ1A 4C5YA 4ZTXA 3DBNA 4UFKA 3HU7A 3LHTA 4AHQA 5DCDA 4QRNA 3T78A 3C8FA 3CUHA 2ZX6A 3DYOA 3CHDA 5I3KA 5EYWA 2EJAA 3CTLA 1QPQA 2DORA 4LT9A 1OZMA 2B81A 1HJUA 3OA3A 1ICPA 3TC6A 3GG7A 2RDXA 3TLQA 3CAVA 4REQB 5C9UA 2F6UA 2OG9A 1FCVA 2NWSA 1GOKA 3CO4A 3QFWA 3TWBA 1SO3A 4GYJA 4H6RA 4B2DD 3CIWA 2J66A 3CM4A 5E6YA 3EZ4A 3CUIA 1MO0A 1NSJA 2PP1A 1LG2A 2XVPA 1GZGA 4XZ9A 1SW3A 3SCNA 3IAQA 4H83A 4J9JA 3AXXA 4CD6A 2A7RA 2WMGA 1QW7A 3B8DA 3M5YA 1PCWA 3U8GA 2V3EA 1SW7A 3IUHA 2ZX9A 3AYSA 5FJTA 4EPKA 3TOPA 5CLTA 3TJ4A 4N4PA 2W66A 4K7YA 3WD1A 2Y5EA 4H9MA 1S38A 1N8IA 4L4LA 3RLUA 1B31A 1LF1A 4PODA 4WDWA 5CEWA 4JIIX 1E0VA 4NQ1A 2ZA1A 3VM5A 1H5YA 1S5MA 2OKTA 1QASA 3P5YA 2D0HA 3BDKA 3CUFA 1OIFA 1AL8A 2ALDA 1P0DA 4O1EA 4ZCWA 4WK9A 3B8IA 1GVIA 2Q3OA 5G1TA 4C6NA 4RUBA 2C1IA 2PWUA 4GIEA 3S1UA 3SRKA 2DFAA 3AMKA 3S8HA 4DVOA 3LB0A 4KEZA 2WMFA 4AWEA 4EF9A 4DEFA 2CBIA 2DSKA 4BQ5A 2Z2UA 1K8YA 3QRHA 2OEKA 2INZA 4BK9A 2BV9A 3B0VC 4LBRA 3ITLA 2W63A 3GR8A 3B0UX 1IEQA 1JPMA 3G6MA 2PBGA 4QCEA 1J4EA 3UY8A 1NP0A 2FHFA 5DQPA 3VGBA 4OV4A 2DZUA 2BS9A 3GXMA 4AIBA 4RV3A 4UQ9A 2VC6A 3QV6A 2OSYA 3BAXA 4FIRA 4HJFA 3VI2A 1I60A 1VBJA 4NYYA 1UD2A 1M7OA 1O95A 4OFCA 2R24A 3ECQA 3VZXA 2W5FA 3UWEA 3SAZA 3AHZA 1M7PA 2V3DA 3OO2A 4Z2KA 1KQYA 4HPHA 1SU5A 2I5GA 3QC3A 1EX1A 3ARSA 3CUZA 2ZX5A 5AY7A 4MMWA 3IEBA 1XRVA 1P1MA 2FDSA 4ASTA 4PMXA 3CQIA 4XZIA 5C2CA 5AYBA 3N3MA 1IHIA 2Z27A 1E3ZA 4PMQA 1JZ6A 1GOXA 1G4PA 3T4WA 2JIWA 2IXVA 2YCLA 1LOQA 3H22A 3MO4A 3P61A 2ZICA 3WZ0E 3ZT6A 1FWFC 3NQGA 3ZR6A 2EJ1A 5LIWX 4JL2A 5I02A 4KEUA 1C7TA 4D6HA 3MUAA 3VGGA 2VFFA 2OVLA 3O6CA 1F73A 1GZ1A 4ZZ9A 1WA3A 3NSNA 2Q8LA 2J75A 2Y70A 4GE8A 2C14A 3M7WA 3CZKA 2ZBTA 3UJ2A 4RNHA 3WJWA 1T5AA 4MNLA 1PBGA 3TH6A 2QV5A 3HQNA 4O8AA 4RXGA 2R1LA 1UZDA 1WV2A 1W9BM 1E6SM 2V69A 1EF2A 1TWZA 3N17A 1G6CA 3G1SA 1B3XA 4D8AA 4JX6A 3GNOA 1P4CA 4Q8QA 4Z2HA 1ME7A 1QNSA 3GHTA 1EYWA 5AHMA 5I23A 2ZX7A 3HQPA 1ECQA 4XZMX 3RR1A 1P48A 3S2JA 2YLAA 2OYLA 2ZKMX 1EO7A 4V1XA 5EY5A 3ANUA 4RZ4A 2XH2A 4HB7A 3IJ7A 3TZFA 1EC9A 2J7HA 3EPMA 3BK0A 1ICSA 5JVLA 4QP0A 3QMSA 1TPEA 2F38A 2B7PA 1WE5A 3B9NA 3L4TA 1LZOA 4H1ZA 3TOYA 4GGBA 4M6PA 2DZVA 4LJ3A 3HN3A 4HZ8A 4H6KA 3ITCA 4E38A 4GXMA 4JNYA 1SR9A 3W4RA 4AY8A 3CO8A 1GEHA 1YQ2A 4WKAA 4GHRA 2PC4A 3ONCA 2Z25A 1R86A 1B1YA 1R2SA 2ZXAA 4Q8NA 1E56A 4JXCA 3TCSA 4PUJA 3CIXA 2F2KA 4AY7A 2NQHA 3CH9A 1EJVC 1E5JA 4ZE4A 2FZ9A 1UQZA 4ZQCA 4U33A 2BVYA 3CUGA 1X7IA 5FEXA 4DWSD 1A0CA 3BMXA 1KM1A 3SRFA 3ARWA 1HW6A 4GUJA 4PB3A 4HCDA 4DLFA 1G4SA 2FH6A 3GU2A 4J3SA 1V51A 2DH2A 3UYIA 3ABXA 3C0SA 3L2MA 1TO3A 3A22A 1HKKA 1OCQA 1N7KA 2BODX 1OF6A 3OLGA 2PGWA 4Z1AA 4KCUA 2DGAA 4M3PA 3R6IA 1H7OA 4L4PA 4ZGYA 1MXGA 3OU8A 3TSBA 3UFYA 2BP1A 2A7PA 2BOFX 1E1CB 5FKYA 4B4FA 3W83A 3URQA 2Y85A 3FLUA 5D2WA 1M7JA 3USBA 1CGXA 5A6LA 1MUCA 4HN8A 1PTGA 1UYQA 4CD4A 3DBPA 5BW6A 4IF2A 3B9EA 3OBAA 1Q65A 3GZ3A 1D8WA 3SURA 1XBXA 4GH1A 4O0KA 1GJPA 1NOFA 4UCGA 2UY4A 3R8GA 5DLCA 1W5MA 3WMLA 3H4WA 1OB0A 1M03A 1SFJA 3NPWA 2VFGA 2YL6A 3NL2A 1TPFA 1H5VA 3UZZA 3WH5A 2Y8VA 1FWAC 2HQAA 5HQMA 2QPUA 3CAWA 1GVQA 3VD3A 3WNNA 4IMFA 1DEDA 4DO4A 2AL1A 2CBVA 1Q6DA 1LL4A 4DPQA 1TR9A 3ARRA 2J74A 4S3FA 3T8LA 1LT7A 2OQHA 3UA4A 4GC4A 1GW1A 4MJ2A 5H6HA 3N11A 1E6RA 3EB4A 3OVGA 4GLEA 4GZEA 5REQA 1KWKA 4HMCA 4WQ6A 3LUTA 2O56A 4MFDA 1A5KC 2O9RA 2VEMA 2VJXA 5F2LA 2Y7EA 3W00A 4D2JA 3T09A 3P8JA 4JFWA 5LXEA 1J10A 3WUBA 1DWFM 1CIUA 1F8MA 4TU1A 1W8SA 1V8EA 2Z1XA 3NNTA 5D38A 2TRSA 3W7DA 1OGGA 1VH7A 2XINA 2BVDA 3GDMA 1H7PA 3THDA 1XM3A 1AFSA 3APGA 3WYZA 1NH6A 4WGHA 4GIYA 4YYCA 3GBDA 2R1PA 4UIOA 4HTBA 1VZWA 1DIKA 4TX8A 3TYBA 2PDXA 1KO0A 3DG7A 4GQBA 4P8VA 1S5VA 3HGRA 1CLVA 2QXWA 1I1WA 3GDLA 4MG4A 4JTEA 4C5ZA 2FGLA 3SCVA 1B3ZA 3I10A 2H8XA 1ZJHA 1Q7ZA 3BGAA 2HEJA 3E5BA 2FKPA 3TAOA 3RX4A 2X2GA 3WNMA 1H4PA 1XYBA 1ZLPA 1ZTVA 4GG9A 1X1NA 3W29A 1J9YA 4NI8A 2BZNA 1LOLA 3LTYA 4D6CA 4ZEPA 3QM3A 3QPZA 5A8GA 2Y5SA 2ASHA 1JZ8A 2OWCA 1W8GA 1RZMA 2WJEA 3WUGA 3FGCB 1LL7A 1YADA 1E9ZB 1ZS2A 4MWAE 2JE8A 3OHMB 3TE9A 5FF4A 2GJNA 3AIUA 4ZB5A 3MUZ1 3VKCA 5FL1A 2EG8A 5B80A 4OGZA 1ADSA 3W7RA 1E4LA 1K02A 1GCYA 1EQCA 3BOXA 1XLHA 3PS7A 3BV7A 3CPRA 4AIOA 3UWUA 5M2FX 3NEHA 1O1ZA 1R0MA 4TMBA 4DYJA 2XIIA 2ZYFA 3ZOAA 2OTDA 4CU6A 3AUJA 3VZYA 2I57A 1VEPA 2UY2A 1DIEA 1JUKA 3THCA 1XGZA 3DX5A 3WBWA 3WENA 1P0KA 3S6OA 2H9AB 3C2EA 4L6HA 1UC5A 1G4EA 4P2VA 4M1BA 2ABAA 2FZDA 4HMDA 3S9ZA 4KQNA 3GX9A 4M0XA 1CGYA 4U3CA 3L67A 3MUY1 3AXHA 3MWAA 1S39A 4UOZA 2ATSA 1WZMA 3EXSA 3SCQA 1GWJA 4O54A 3Q37A 2YCJA 3LPGA 1LWHA 2X1IA 3WQOA 3UZ5A 1OC7A 1LRQA 3ZVHA 4XO7A 2ZRWA 5HNRA 4O8RA 3AS1A 1A53A 2A3BA 2Y89A 5A2AA 4Q4RA 4M6QA 1RSCA 4C1NA 4BQ4A 4CCEA 2VR5A 3DFSA 3SQLA 3T44A 3SCPA 4WIWA 1W1A1 5AVHA 5TQLA 2HDJA 4O4VA 2IPFA 3WN6A 4GNVA 4DQWA 3SCTA 2GQ9A 4KWOA 4AZHA 4GINA 2ATMA 4UFLA 2VZTA 2ZUNA 3QR3A 3F7JA 2QMKA 4AD4A 4FR1A 5D09A 1PDYA 3L0GA 3WMBA 1QOXA 3PULA 2IW0A 3W22A 4LEQA 3HV8A 4C6FA 3R0DA 4X9YA 3AIEA 3STEA 5A6JA 4DYEA 2Y6ZA 4X3ZA 3LD5A 3N2MA 3LLFA 4S3CA 4IJCA 3COTA 2C0AA 1KRMA 1GOIA 2GUYA 4W5UA 3BQ5A 1M5WA 1W9DM 3CASA 3SQMA 2PDWA 5G5IA 2YOCA 2OGYA 4JKKA 4XX6A 4QAIA 5K2ZA 1WKEA 3TSDA 3P2VA 2WC4A 3QV9A 2X0SA 3LGGA 3CC1A 1KNWA 1PPIA 2AQVA 3LBOA 4WR3A 5DELA 4XAPA 4CD8A 3O8AA 1EBGA 1N8FA 2PTYA 1XCFA 5AKQA 2YIHA 1KTCA 1QHPA 2ZVIA 3EWWA 3H53A 4LTSA 3WQ4A 1GQJA 1TV8A 3BAKA 3NXFA 1US2A 3ITVA 3K4WA 1V6XA 4E4FA 4V27A 3BAJA 1PJ9A 3JVAA 1ESWA 2QCMA 3ABOA 3PSVA 4I9MA 1EPXA 2WQPA 5DMLA 1KXVA 2EPLX 1REQB 3L0KA 4QE5A 2PC8A 9XIMA 4NJKA 1FWBC 4X9SA 3PTQA 2Y8UA 2VWTA 2REQB 3I65A 3DECA 2DIKA 3UJRA 3SY8A 4C1LA 4A35A 1HGWA 1Q5MA 1V6WA 1JPDX 4QG6A 2CETA 4NAEB 1UUQA 4ZMGA 2ABBA 1Q66A 2GGHA 2J88A 3B03A 5AB3A 4IZGA 1NQKA 2H90A 4D6DA 3UZJA 4PMDA 3JZEA 2PTZA 4GABA 4HA0A 3RK8A 4DPPA 3GYEA 4JTTA 4W7UA 3LOTA 2ZOXA 3IARA 2Y5JA 1E1EA 1JDEA 5H8MA 2W0UA 1SO4A 4ATDA 3MU7A 1AZ1A 2P3ZA 2ZX8A 3WD4A 5DMNA 3TQVA 2GJXB 1TYGA 3BG9A 4U28A 4H9VA 3O0KA 4TOQA 5SWUA 2OLSA 4EXBA 3WQEA 3WLPA 1SYTA 2I5QA 1TIMA 2WSQA 1FWEC 5JBDA 1UWUA 3WH8A 3LENA 3P0XA 2V68A 4BKNA 3RO6A 4Y9PA 3SUTA 1HJWA 5E93A 3VILA 4N9EA 2XVGA 4GQQA 1RLCL 5TBOA 4AU0A 4N42A 4MSSA 3P67A 4IFOA 4L6OA 3BJFA 4GOAA 1BSIA 3IGXA 3W38A 2HE8A 1H60A 2BXVA 3B9OA 1K9DA 3SCOA 3H54A 1ZJBA 3O9NA 4HBKA 1ODZA 3ZR4A 4L5ZA 4ICMA 1FFQA 2P76A 3R13A 1GQKA 1T41A 1U33A 1E9YB 1FKXA 3STCA 1UA3A 1RA5A 2BOEX 2BOGX 4UMBA 2PGRA 3WQPA 1EGZA 2VDGA 3Q94A 1PO9A 2O7SA 4IPLA 1SPQA 1XISA 1BWLA 2VZOA 1BXCA 3KZSA 3W7KA 2GUBA 1VAHA 1Q6LA 1DKWA 4FNTA 2VUYA 4HYRA 1IWPA 2QCFA 3DG3A 4HYWA 2XFWA 4DNHA 3QFEA 4Q8TA 3U3HA 4G7EB 3SM0A 3GAYA 5IDZA 4UXDA 1LRTA 4DJFC 3IRDA 3B97A 2CZVA 3BG3A 3WF2A 3OZYA 4JTAA 3N4EA 3GHUA 2V63A 4DO5A 1P7TA 2HJPA 1TV3A 1R9YA 3FDKA 1FA2A 4H7CA 4IFRA 5CGMA 2PLCA 4QG9A 4X2PA 2ZADA 4IMAA 3UWVA 1R3WA 5BCAA 1E4MM 2F9RA 3FYYA 1F61A 3RHGA 3S6DA 1DHKA 3AZTA 2BG5A 4NZ3A 2PURA 4M81A 3KHJA 4KF1A 1JZ4A 1A5CA 4Z2LA 1QBBA 2YW3A 3W72A 1HQTA 5I3FA 4W84A 2CZEA 3RLHA 1FHVA 1UUOA 3M5VA 4U4MA 3TW6A 1IT8A 3HMJG 4TO8A 3HA1A 3M7SA 1R46A 1A4LA 1KM6A 4YVPA 3SGUA 1ZFJA 4TVCA 4FZIA 4L4MA 1TPWA 4ADUA 1RCOB 3BPWA 2PAJA 3FJ6A 2PD9A 2HVOA 4RDZA 3UW6A 3I4KA 2WMIA 4GUFA 3ERPA 3UF9A 1EXBA 3A13A 5D4YA 3DFNA 3GW3A 3HG2A 3F2CA 2VEFA 3WBXA 2X0HA 3VKDA 1OHLA 2QCHA 4FMVA 4XG1A 4LCQA 2D20A 1XR2A 1KRCC 1KCXA 1E72M 3NEVA 2YZ5A 4J1OA 3LCGA 3E0WA 3Q4DA 3BV4A 1QK2A 3GBEA 3GDBA 3LRLA 1V02E 4CVWA 4GQRA 3B40A 1XV8A 5FCZA 3WEOA 1E6QM 1TVPA 2DSZA 1V93A 4H4IA 2B7QA 1U1HA 2QCDA 3E6EA 4Y6GA 1R38A 1ZJIA 2VOMA 3HOJA 1TSIA 2RDTA 4KIEA 4CNUA 1J6PA 5HATA 1LJYA 4NKCA 1MRAA 1TJ1A 1K3UA 2VFHA 5IBXC 3IJ8A 1FWWA 3K8LA 1C29A 3W7IA 1F5ZA 1KM5A 3ME3A 3V0UA 1EP3A 2NQLA 2J24A 4NP7A 4UQAA 2CU0A 1W9UA 4WJ8A 4WEVX 1HKJA 2DUXA 4OOZA 4YYFA 3Q45A 1GUVA 4W7VA 4ZXOA 1WOBA 1QAPA 1GVFA 4J27A 1OADA 1X6UA 4ICCX 1HUVA 3GNDA 1N2VA 3E2VA 4DBUA 1S5NA 2RDWA 4LOCA 1EHAA 3PNZA 3U5UA 4NY2A 1UP2A 4H9YA 2Q3RA 4RL3A 4YS1A 3NJ3A 4R5EA 1W17A 3LMYA 4CN6A 5GNYA 1TV5A 3ONBA 3BO9A 3CT7A 1GVYA 4JX4A 2BBFA 2WOQA 2QT3A 2WWCA 3KTCA 1J2BA 2NVCA 4LUSA 2PWFA 1XG4A 3LNMA 4ILSA 3GTHA 1VPYA 1MVYA 3DC0A 2HCVA 1J0YA 1H7WA 5F4WA 1MW3A 5FA5A 2Y7DA 2PD5A 3R94A 3QHNA 2OOFA 1TJRA 4JICA 1CENA 3U48A 2VURA 3VKJA 2X7WA 4RLIA 1XX1A 1J6OA 4TIMA 1WZKA 3GNPA 4RDYA 2CZFA 2YKKA 3C0QA 4IP7A 4ZOAA 1Q4WA 3OHIA 1PSCA 3LSCA 1KM2A 3ZLGA 2NZLA 5E9AA 1B3VA 1BGAA 4BWLA 1GJWA 1IR2A 4AXKA 4BHYA 4C6DA 1MW1A 2BVTA 4HK6A 1JG9A 2ZE0A 1JCLA 3PTDA 1W0MA 2XVKA 2PDIA 3AOFA 3V0SA 3CZJA 2XSAA 1WCGA 3NSXA 2E0PA 1BQCA 1ISWA 4N02A 2PZ0A 3E3HA 3MUIA 4P7LA 1PAMA 1S2UA 4H9ZA 2R1MA 1GYNA 3MDWA 4HP5A 3IV8A 1PL9A 5F2IA 4DF0A 3DKJA 1BWKA 2EG7A 3BCJA 3HPXA 5BU9A 4PTXA 1RQBA 5EMYA 3WLNA 3G1AA 3S5ZA 4NAFA 3HGOA 4PMVA 1E0TA 1UKQA 4S3EA 3W88A 3TJXA 1YYAA 4KPLA 3DZ1A 4ATWA 3KXQA 3RCMA 2R82A 3GSMA 3P80A 4NG3A 1OJXA 1GKPA 1N8WA 4MAVA 1KQZA 2PTXA 1S2CA 1G7UA 1O5QA 4XAZA 3UWYA 1HO1A 3QLDA 1C7SA 3TFCA 1O6IA 3IJDA 3O6YX 2OELA 1EOKA 2A79A 4NZ1A 1W3JA 5FAJA 3UWZA 2ISDA 4NVTA 2P50A 1OX6A 4S3BA 3K1DA 3CZ8A 2CLFA 5GJPA 2QUVA 2OO0A 1R9XA 2WZIA 1OX5A 1XIEA 2R1KA 2DPEA 3W71A 3RILA 3PBVA 1H63A 2BB0A 1L2QA 4EKJA 1XJBA 3L2IA 5AC6A 4GPNA 3O05A 5JU6A 1VC4A 4G2DA 2VEKA 4JNMA 4DXKA 2PDBA 4LAMA 2NV1A 3AYTA 3GB6A 3URBA 1H1NA 1XDMA 2J78A 1GQLA 4S38A 1Q4NX 1RCXB 3QGVA 1LUCA 4DWSC 2YB1A 3PB2A 3SQSA 5EMUA 4YCOA 4Q8VA 5E6ZA 3VKAA 1QCWA 3LLDA 1GYMA 3P5ZA 1SFLA 4UQDA 4OE7A 2WMHA 5BOFA 4LV9A 5HBFA 1FOBA 3DEQA 5HWNA 4GMEA 1NY1A 1PS9A 3FVMA 1R3QA 3VA8A 4EPBC 4J4KA 3B04A 1UD4A 2GSJA 4S3KA 4JTSA 4FLSA 2P8BA 5FAGA 4YTUA 2FDMA 5TAOA 1XG3A 3VC5A 4YVXA 2V5KA 2BXZA 3P93A 4FPSA 1BYAA 2J9ZA 3PSWA 3S47A 4JIEA 1OG0A 2J8FA 3BAYA 2WLYA 2ZWYA 1AL7A 2J9XA 3ES8A 1UH4A 3KS5A 3LPFA 1JYNA 1JFXA 1C8QA 1M9HA 3AWOA 4JR5A 3DFQA 4URIA 1KR1A 3S5NA 1UWQA 3G3DA 1XSJA 1V3IA 3NM3A 3M46A 5TIMA 1W32A 1JCNA 4KWWA 3AC0A 3G1YA 2ZUTA 4NXSA 4A2SA 1Y5WA 3U57A 3T81A 3GHRA 4QGCA 4UBPC 1ALDA 4ZVJA 3TJLA 4TTUA 3EXTA 2YCLB 1DWHM 3PAJA 1UC4A 2PLKA 4AVNA 1EL3A 1C3FA 1RXOB 3IK4A 3WFLA 1JUEA 2X42A 5BYWA 1I2OA 4JX5A 1U83A 1US0A 4IG2A 1UUMA 2BGQA 2YW4A 1NDWA 3FXYA 3HJEA 4M56A 4Y90A 3D3FA 1V6YA 4FXFA 5A6KA 3U4FA 4UB9A 3N18A 5BOEA 1HKMA 4AYSA 3W74A 1R5YA 4HU4A 3CQKA 4DF2A 1XLEA 1H11A 1AH3A 4KCTA 4JTHA 4QJ4B 1W5OA 3VIKA 3VFCA 3WDPP 1HFBA 3KUMA 3GAKA 4IGNA 3VFLA 3R89A 1BD0A 4H8VA 4DM1A 4K7VA 5M1TA 2HRWA 4V28A 2QJIA 3UERA 4AZ6A 3MV11 2E6FA 1PZ0A 5EMJA 3TN4A 2V6AA 3HZ3A 1RBAA 1B54A 1JRCA 4NI3A 2WK2A 2FPVA 3DFYA 4JN8A 3L4ZA 2V82A 2OT0A 5E1QA 1U5JA 3BSMA 1LROA 2EHHA 4DJDD 4X0NA 3EWYA 4RZ6A 2VFIA 2QCNA 3K1GA 5FEWA 4G6CA 1ZPTA 2WO5A 1MWOA 3EDDA 4S2CA 1GJUA 3CQ0A 3KFTA 1RP8A 4GVGA 2A85A 3QOKA 4CCZA 4PUEA 1X39A 3TTOA 5AC4A 3O63A 1JJKA 1MW0A 1T6MA 3HPFA 1H0GA 2IKIA 3D46A 3II1A 1JCYA 1X1OA 3AU2A 1EA9C 1RCQA 3L2LA 4AAJA 3KOFA 3RG6A 4KETA 2Q01A 5I79A 4CCCA 4H7VA 2PP3A 4I6VA 4MWAA 3G3MA 3CZGA 1FWJC 4U5KA 3VOHA 1PKLA 3O0FA 5DCEA 1NVMA 1T8QA 1JDCA 4CQDA 1B5TA 3GG0A 1KGXA 4K36A 3LHYA 1EUNA 1BEUA 4Q4QA 1OD8A 1VEMA 2ZUSA 4GX9A 5BXPA 1KTNA 4C6EA 4MOZA 2DZAA 1XFCA 4DI8A 1FCUA 1W1YA 3WLTA 1FWSA 3N15A 2QCLA 1E0XA 3WL0A 5TNVA 1ELSA 3NQ2A 3M6YA 2HBXA 1LP6A 3CLMA 3ZLHA 4AZIA 2AGTA 5ABEA 4J3TA 4LRSA 1JCTA 5KETA 2XYLA 1M53A 3DGBA 1V79A 4G1KA 3JUGA 5T91A 4ML4A 3NQVA 5A6BD 2ON3A 5BNKA 3SRDA 2GGIA 5I0DA 1QI3A 1TMHA 2GJRA 4OBSA 4AMCA 3HG5A 2TPSA 2ZZ4A 1VPXA 2X16A 4ZL1A 3WDJA 7CGTA 2Q8ZA 3UR2A 2P10A 4KKXA 1I6NA 1FCBA 4OU1A 3WF1A 1JGIA 3A47A 3WO8A 2VCCA 3WMCA 4A8NA 4G56A 1TPC1 2GQ8A 2ZZ2A 3TQKA 4GVIA 4B90A 3B06A 4I6KA 1JUBA 1OZQA 1SMDA 3GR4A 4LS2A 3B0PA 3WKZA 2VX4A 1OG6A 2GZXA 3QQWA 5BRQA 4D72A 4A3QA 3WBAA 2FMOA 4EXQA 4BFAA 3BZGA 2D22A 1QUMA 3VK5A 4B5NA 4DIAA 3GG8A 4IMEA 3MYPA 2UWFA 3WQDA 1H7XA 2EEXA 3QPEA 4GO8A 3GVQA 1OF8A 2HPIA 3NA8A 3PB0A 1CBGA 1O5KA 3DYMA 3KBJA 4NZJA 1EC8A 1BF6A 3SO7A 1XUZA 3A4JA 1HJXA 8RUCA 3TJIA 3PR2A 3TCEA 1J5SA 2D2OA 3VC6A 1LT8A 1QOPA 4RPQA 1PX4A 1E71M 3O3RA 4FOJA 1SJBA 2JKEA 3HPSA 4QISA 4UZSA 5HUPA 4KFPA 3FJ4A 4ZO8A 3GVVA 1OM0A 2B31A 5FF7A 1K8CA 5FEZA 1NFBA 5EMMA 4GYFA 1F05A 2A1YA 4DXXA 1PZ1A 5AZ1A 4HCHA 3N19B 2MNRA 2BASA 1XIGA 2PLJA 2DZSA 4ZODA 3SCUA 3QY8A 4CKQA 1NWRA 4EANA 3W7JA 4GJIA 1W3TA 4MUPA 3ARXA 3W84A 3RRXA 3BJSA 3UGVA 3L9CA 4C6MA 3GNNA 3ZZ1A 5FSEC 1H49A 3KBMA 3GH5A 1XC4A 4Y9OA 4MB4A 4XIMA 1WBJA 1OFBA 4LAUA 4R34A 1JCMP 4AZ5A 4ZOCA 2WJZA 3CU2A 2E5BA 5M5DA 1EO5A 2OYMA 2CNCA 5F1VA 2I7GA 1K77A 4P7QA 3MTWA 3PBUA 4C7FA 2FQIA 4FB7A 2PFHA 5FI8A 2VMFA 4F2BA 4HU0A 3GDTA 3UCQA 1ODUA 3AO0A 4P7OA 4B5WA 4F0LA 3C61A 4XZWA 5CSRA 2JBMA 4YMZA 2VL4A 1DJYA 3TMQA 3V5CA 4B3KA 3LLXA 1IV8A 2HROA 1NAL1 4YLWA 2RHGA 3R7MA 1XYFA 1WXJA 4QLKA 2XSBA 1K1DA 3AXMA 3NGFA 3LNPA 7A3HA 1KLYA 3STGA 2E77A 3GFYA 1XQLA 2GSEA 3NM1A 2W27A 1I75A 1XIJA 4CU8A 3G77A 1QRQA 3ZVHB 2XDFA 1Q6OA 1HL2A 1Q7QA 1TPUA 4LUYA 2V30A 3MKCA 4PCSA 1ZBVA 3V1HA 5AYYA 3WUEA 1XIMA 4C1NB 1CGWA 3N9RA 5A6AA 1HVQA 4OOUA 1PV8A 3GNRA 1IQ8A 4K1WA 2G4FA 3UPMA 2VXNA 5KEZA 4UR9A 3G0UA 1DXIA 3DH7A 2NVDA 2DDXA 5DY3A 5DN1A 2PDQA 2ONEA 4N0RA 3L4VA 4GC3A 1AMYA 4KFOA 2YDAA 1J01A 1KV5A 4PUKA 2IS7A 1VS1A 4ZB0A 4S39A 3FW6A 3BW2A 1NARA 5D02A 2RUSA 3UG3A 3E5PA 6TIMA 3VE7A 1ZAIA 1YIXA 3WNOA 1Z7AA 1Q8JA 1UWRA 3JW7A 4JTUA 5BROA 3FDGA 1XSKA 4Q8OA 3CIVA 3M41A 1QU4A 3W7LA 4PA8A 1FWGC 4E2VA 3W82A 4M8UA 3UXLA 3QBUA 1XIDA 1SMAA 4RX0A 4AC1X 4G9PA 5LGZA 4JS3A 4LSBA 4F8XA 1I2QA 1VLWA 3OEXA 4E8DA 1JYVA 4Y9AA 4POCA 3LTPA 1EZWA 2JALA 2I1OA 1O4UA 3CK5A 4Q8PA 1HX0A 2GDVA 4AUBA 4X63A 3RR4A 3Q58A 4YTTA 3MCMA 3PUOA 2VFDA 1AD1A 3WF0A 4BS0A 3LBMA 2PTWA 1JULA 5LNVA 3F5JA 3I3DA 1G0CA 4WUIA 1RBOB 5A95A 1OFAA 1J5TA 3S2MA 4F2TA 3C2OA 1ZHAA 3KWSA 3GWQA 2WMKA 3WD0A 2JF7A 1UR8A 4FO4A 3L5AA 5DRIA 4GJ1A 1C92A 4QQ3A 4QHRA 4INFA 2VP8A 4Q4OA 4J40A 1VIWA 2CHRA 3P84A 4IFKA 3K30A 1TUXA 1LCOA 4G7FA 3IGHX 4MY1A 4D6GA 1DQWA 1TA3A 3C6CA 3V18A 4HZMA 1TMQA 3A24A 5IFPA 5DFAA 4XD3A 4M29A 3TMLA 4B3ZA 4Y96A 2PTDA 2Z2AA 2PWVA 3VYLA 2PF0A 3C2FA 4PYSA 1DJIA 2AMXA 1A5OC 1DQXA 4GI4A 5K7JA 1CPUA 1KBBA 2OT1A 3FHAA 4UTKA 2J62A 5ABHA 2NQ9A 3ZVIA 1XHGA 1K7FA 3UA3A 3GUGA 1WNOA 3E2SA 4UTIA 1V02A 2WJDA 3N3TA 3T40A 3D0CA 4PTNA 5BXSA 2IPJA 1J0JA 4CD7A 3NYDA 1KC7A 1LRNA 3H26A 1S2VA 5HNNA 1XLAA 3WDRA 3VCRA 1L8NA 1O5RA 2E4TA 2QCGA 3LDVA 4NYUA 3MWCA 1KRAC 2NUXA 3DKLA 3ARYA 3KX6A 3OG2A 3VNMA 4CN4A 1A5AA 3EMZA 2FB2A 4KCWA 4LUTA 4HHMA 1RD5A 4G8TA 4F0SA 3KDOA 2BDQA 5H91A 5BXRA 1A3WA 1W3IA 2FMNA 3MB9A 1F07A 4XVEA 1ECEA 5G4EA 1XIBA 9XIAA 4WF7A 4ATLA 4Q7BA 2C0HA 4H7ZA 5HMEA 4GYPC 4HPXA 1W54A 1GTEA 1ZBCA 2V2DA 4RK8A 3NTYA 2AGKA 2YXGA 4AHPA 5JH1A 1UH3A 3IIZA 3UD6A 2R91A 1FDJA 3SR7A 3A9BA 3E0IA 2VD8A 4GIRA 4C6IA 4HNOA 4KFNA 5CC7A 2CXEA 5I06A 1TPH1 1XICA 4K8EA 3PC0A 4MY9A 5HQEA 3P6LA 2GDUA 4HA3A 1ZL1A 2VGIA 4QDWA 1XLFA 5EPDA 1Q2RA 2G3JA 1KLZA 4QJ3B 1UR1A 1EHNA 1DWIM 4L1XA 2FB3A 2PCQA 1NF0A 3W1PA 5CPOA 4RE0A 3ABZA 2XJ7A 1A0EA 2AAAA 3POHA 2YA0A 1VR6A 3F4VA 3K8KA 2W4XA 3H12A 2Y62A 4JN6A 3ITOA 4CUCA 2XZ9A 2IPGA 1CNVA 3GXNA 2YL5A 4R9OA 1IGSA 4PMZA 1FBAA 5A5WA 7REQA 1EIBA 3BLDA 5CJMA 1X38A 1GZJA 4GH3A 2OQLA 4R7JA 1HKVA 1XYAA 1VB9A 1K9FA 1ZB5A 3WF4A 2ZXBA 2QJGA 4AZGA 3CHVA 3KRUA 4JTDA 5DT5A 1GHRA 4LY4A 1I1XA 4HT3A 3UR7A 1Q6QA 4ZQNA 3CNYA 4DJED 2FVKA 4AZCA 1D3GA 1G5AA 1Z44A 4MY8A 1ZALA 2VEPA 3F4WA 2FHCA 4A29A 1BLIA 4XV0A 1AJ0A 2XIJA 1SQ7A 4Z2IA 4UQCA 2ZIDA 1EKOA 3CV2A 2C1HA 3T0TA 4B92A 1TZZA 3EDKA 3GW0A 4ZQMA 2W3ZA 2EBNA 4ZSUA 4TXEA 1UP0A 2PRHA 4TR9A 1Z32X 4MIMA 1RK5A 1MW2A 1TCMA 5I3HA 3W2KA 2E7FA 3L68A 1AUSL 4TUFA 3EYPA 4MM1A 3QY7A 1EOMA 2CBJA 2GUUA 5C7VA 2PRMA 4UNLA 1IEIA 3SJ3A 3VVGA 2QCDB 2INEA 4C6QA 1YEYA 3F4NA 2QZRA 1XC6A 3G0XA 4K8HA 4GIAA 1UZHA 1XRFA 4O57A 2W67A 3DG6A 3QQ1A 2EPKX 1TE6A 3KW3A 3A3WA 2ZUUA 1RJRA 2ZWZA 1EUAA 2EO7A 1Y65A 1P6CA 2WHMA 3SSJA 2HS8A 3SN4A 4LYRA 2ISVA 3G1FA 3U0HA 2FYMA 5CCZA 1H62A 3M0ZA 2CZ5A 4IQLA 5C9RA 4CNTA 4YWIA 4Z1YA 4U2YA 4G5DA 2UY3A 1PIGA 3MC5A 1YNPA 1LL6A 5IRPA 2BXYA 4YNGA 2JIEA 1DIOA 3IWPA 4IT1A 2HZGA 1W1VA 1V6VA 9RUBA 4LF2A 2X1RA 2WPBA 4AG0A 4N9CA 3RMEA 4BF5A 5HXMA 2ZVRA 1XYZA 5M03A 1OFQA 3F03K 4G1NA 3J7HA 3W2UA 2QJJA 3H8AA 4LUSB 3EKGA 2GVEA 1YDNA 3A3XA 4NL1A 3KBWA 1IGWA 5F4SA 3LX9A 3NVDA 4BY3A 2YCEA 3TYZA 1ICQA 3P60A 2C6QA 4IP5A 5T26A 1YRRA 4Z2JA 4DBDA 2BGNE 4OTKA 1P0NA 2YX0A 1CWYA 1YBQA 4W9TA 4AFYA 2GVLA 1VYPX 1OFRA 2G0WA 3EGJA 1KFCA 4LWWA 3ZSTA 3RPDA 3FV9A 5D9NA 2F7FA 1IF2A 4FR6A 2CLEA 2WNQA 1AQMA 5KZDA 3W01A 3U2EA 1W1B1 4CQBA 5CC3A 1OT2A 2ZRUA 1DQUA 1EDTA 4GI8A 1XD0A 3O07A 4UR8A 4CQCA 5E0CA 4F0HA 3NOEA 1UIOA 1JZ7A 4F0MA 3BURA 4NUWA 2WQDA 4O4WA 3EX1A 2R8WA 5K9DA 1PX8A 1GKRA 2UZ9A 2CXGA 1A4MA 3VX1A 3BWWA 4PSRA 1A0DA 2QJMA 4HVXA 1KA9F 4ZO7A 5EMKA 3H2NA 3F2BA 3WLQA 2ZRYA 2WM1A 2E67A 1DJHA 1ZAHA 5C6MA 1MQPA 2YYUA 1D7KA 4NAFB 3URNA 1F6PA 5C7HA 1MRQA 1OK4A 3VIOA 3LRMA 4LH8A 4XTIA 4M5PA 2OWWA 4H2HA 1Q85A 3PHAA 5G4HC 3UG4A 4IIHA 3TFXA 4LXFA 3E12A 1CGTA 3PG8A 2POTA 1VLIA 5EU9A 2J7GA 2Z6JA 2X1TA 5D9OA 4EWND 2QAPA 1W5NA 3EBVA 3MP3A 3GC4A 3PWGA 4LV4A 1J11A 4DJDC 5AYXA 3UPWA 2CIPA 3CT2A 4Q7IA 3W1AA 3NL3A 2CHNA 7XIMA 1YTDA 2EG6A 4N4QA 5HJLA 4NX0A 2EXOA 3AHTA 4IGHA 4UWMA 4Y8FA 4AWTA 4ONVA 3FYOA 4GQGA 3TYUA 3TR2A 4CU7A 3QSTA 4GI6A 1PYFA 2FJUB 4GD0A 2GPTA 4BZYA 1DORA 4NJHA 1ITCA 3PK7A 3OVQA 4K6AA 1VF8A 1LUCB 3WNKA 2BY3A 3V4BA 4TVDA 3M47A 3BLKA 3KVKA 4ERGA 3PUEA 3OGSA 3IUDA 3PZIA 1EIXA 1H7NA 4I7VA 4OJYA 3L5MA 4PRTA 3MSDA 2WC3A 3MMTA 2W79A 1BTMA 1NFGA 2E1WA 5D04C 3KL0A 2OZ8A 4PMOA 2PE4A 4ZFMA 4QLLA 1HKIA 4GWEA 3QC0A 4XQ6A 1R3YA 4WJEA 4O16A 4K68A 1KCKA 4PTDA 3UEQA 2ZZ5A 3APYA 5E5CA 2ZZ1A 4PB5A 2IQDA 4BWLC 2VZSA 4D6IA 3SADA 4CLMA 2PUZA 3TDFA 3GXTA 1QXLA 2YFOA 2Z6IA 1VCGA 3TV8A 2JK2A 5LSMA 2G97A 3TYEA 3RPMA 2Z24A 5AZ0A 3RU8X 3EX6A 5I2UA 3CAQA 3NO1A 1DE6A 2ZA2A 3M6DA 3H70A 3MJYA 2WC7A 3O2LA 3AFBA 1SGJA 2OR2A 2XN2A 4J2PA 3CYJA 2SFPA 1XL9A 4JTLA 3B8TA 4HA4A 1Q45A 2WCGA 1VBUA 1HL8A 4IIBA 3BSHA 1UIPA 5DMYA 3M5XA 4DM2A 5GNZA 3LRKA 2WCSA 4HPJA 1W9VA 3H2OA 4W93A 4FXSA 2WHLA 1R9ZA 3BE7A 1TTQA 1VQTA 1DWAM 1FKWA 2CLMA 4JY8A 4Z17A 1UROA 4WHBA 4R53A 3QXBA 2TMDA 2XFYA 1JQVA 2OLAA 5FSDC 3A6OA 2Y0FA 4PMJA 3TVAA 2EAWA 5K4ZA 4XD4A 2E28A 5G2IA 2OJPA 2YR1A 3KOYA 1YDVA 4D8LA 1NOWA 4AMAA 1MYRA 3CBWA 4JEJA 1L6GA 1GORA 4UTTC 3BXWA 1B9BA 4J35A 1IT7A 4QS5A 2J8TA 3TC7A 2QIWA 4R88A 5BRPA 1DVJA 2DIJA 3VCCA 4IXHA 4GY1A 3TNOA 3CMGA 3K8MA 1NELA 3SSZA 3TZNA 1KM4A 3UVAA 4UTWC 3QW4B 2A3HA 3C56A 3WBEA 4NZ4A 3AIWA 3QHMA 3P62A 3W1TA 3BUVA 2BGSA 3GZAA 3KTSA 3ZXWA 4GFSA 3NXLA 3LM7A 4LUJA 1S46A 1F4AA 4QSFA 3WK1A 3CL7A 2FPTA 4RE3A 2EPNA 5B7YA 3LXAA 4UFHA 1PB0A 3RM8A 2EPHA 3OG3A 1YMYA 2Z1SA 3S5SA 2F61A 3AZSA 2Y8KA 4Z0JA 3TKFA 3G18A 3PF3A 3P3BA 1PZ2A 3UR5A 4ZA0A 3W75A 5CJ5A 3BICA 3ELFA 4Z08A 3MJMA 2WBKA 4E2BA 1VJZA 3TTEA 1Y8BA 1MUWA 1U30A 3NWRA 3A4AA 3PUDA 4FNPA 2AQWA 1TQXA 2OPJA 1B3OA 4A3YA 4JKLA 2XIQA 1ITXA 5KMYA 1U1JA 2YA2A 5XIMA 4E8CA 4IM4A 3VDGA 3WCZA 1X97A 4HSOA 3VMOA 4FNRA 4JCLA 3RLVA 2PDUA 4MWAB 3H4GA 2AQOA 3T08A 3VOGA 2Z00A 3A64A 4JHZA 1GVSA 2VX6A 4M7TA 4GUGA 4WLCA 4CQ9A 2V5BA 2XFRA 3LY0A 4CEUC 1HTIA 1PTDA 5IOBA 1XGDA 5LNSA 3IANA 1GW9A 5G4WA 3O6DA 3BLFA 3IIOA 5XINA 2I9UA 4N6FA 4IHCA 4JDBA 4QTGA 4IICA 3IVUA 1A47A 1JPIA 1SSGA 5LIYX 1U22A 2OEJA 3ZQ9A 3UP8A 7TIMA 3EDEA 1IYXA 3VD5A 3CL6A 3Q65A 4PCFA 4EP8C 1E9IA 1W1ZA 2GVGA 4M6UA 1XCXA 3WK3A 4IJBA 1Q3NA 5ENLA 3VU2A 4AH7A 4S3GA 1R30A 1IXNA 4MTVA 1UD5A 4E3VA 1QT1A 2AAMA 4QS6A 3LM3A 3ATZA 3C2RA 4CVUA 3QYSA 1L6YA 3BGJA 3W2MA 3MA8A 5FJOA 2WAGA 3FSUA 5T9CE 3RYSA 3QZ6A 1BKHA 1R3TA 3V3WA 3W23A 2P8CA 3EMCA 3AISA 3N12A 1PWMA 4MPQA 3SDOA 1L9WA 2UY5A 3OZOA 4WXYA 1DE5A 4AEFA 4HOWA 3VIGA 2GK1A 3A23A 4E4PA 3CPGA 3DI0A 1K6AA 2VRKA 3TR9A 4PUWA 4H01A 5I09A 1WAUA 3PZTA 4GXPA 3ARPA 2D23A 3MSYA 1W3KA 4CNOA 1CXLA 2O9TA 2OU4A 3MMWA 2ESCA 1IE7C 3DHFA 1BF2A 3PG9A 1QMLA 3WH7A 4NJIA 1THFD 2DVUA 4CN1A 2O9PA 2O0TA 4IPPA 1S2TA 4MGGA 1UD6A 3AYVA 4TV5A 3KDNA 1IXQA 4TX6A 4NZCA 4A21A 1VPQA 3KLLA 3PP7A 3WELA 1HIZA 2Z28A 1JDAA 1J12A 3QQ0A 1FHDA 2XIOA 4I5RA 3AMCA 2QJHA 1Q2SA 1OFOA 2ACUA 3I68A 3NZGA 3ES7A 1OYCA 2OQYA 1S1RA 1ME8A 2F84A 2YCIX 4Q4PA 3BMVA 3M0XA 4XAGA 1BXBA 2PGEA 2XVLA 3EKZA 2DIEA 1R87A 4R33A 4HMEA 2OO6A 1EBHA 1UD3A 2V5JA 4GI9A 2XWDA 2KX9A 4D8ZA 1VYSX 3UYCA 4EOUA 4KGJA 2OXNA 1M41A 5HPCA 1KCZA 4EACA 2Q6ZA 3BLIA 3T0DA 1ISXA 1E6NA 3IGUA 4D71A 4XZLX 3S9IA 4I9JA 5LNWA 3HQ1A 1SJAA 3RIKA 3I7SA 4GYKA 3VZZA 1H50A 3DUGA 3O06A 3A3HA 1W1TA 3NZRA 3IV3A 3CWOX 3RO8A 2NLYA 2GDQA 2H3BA 3I4EA 4H2CA 4QQUA 3W6MA 4LB4A 4Y9NA 1ISZA 4HU3A 1HZYA 4B3LA 1GTHA 6PTDA 1I0DA 4HZ7A 1JL8A 3NCOA 3M0LA 3AIBA 3UJSA 3O7UA 1A5LC 4DYKA 1GOWA 3NOYA 4PC8A 4M19A 1CYGA 3BTNA 2FGZA 2WPGA 3CL8A 4JYDA 1TELA 4KWVA 3C2VA 2Y2WA 2OCZA 1QI2A 1XUUA 3NDZA 2ANUA 3EA3A 1LM1A 1XIHA 5E0KA 4KCVA 2QVNA 4IIDA 3V75A 1POJA 1CX9A 4PULA 3GIYA 1AZ2A 3TROA 3KOZA 4OQVA 4F0KA 2ZRXA 3FGCA 3CQJA 1G7VA 1F7BA 1BG4A 3W02A 2FTPA 4FLQA 1MXSA 1MZHA 4HPNA 3EEZA 3W53A 1EEXA 3HV9A 3R8HA 1BVWA 3R0UA 1WZLA 3M4HA 2YBTA 3EDFA 1OD0A 4KRZA 2G41A 5AHLA 4JCMA 1YPXA 4ZTYA 5J8LA 5A3HA 3C0JA 3ABQA 1IXPA 4AF0B 5FL0A 4XBSA 2VWSA 4IMGA 5FF2A 1L8PA 1DJNA 3KBVA 2Y61A 5C9ZA 4O50A 1J18A 4OV9A 3VABA 5IFTA 4RKAA 4BI6A 1JPHA 5LHFA 1ZBKA 4BI7A 2CITA 3QR1A 1YW1A 3R10A 3M43A 5CPQA 2RFGA 2XH7A 3RXZA 4LBUA 3DESA 3IAPA 3SIMA 3NAVA 3W73A 5I3GA 4JN7A 4XZNX 2HISA 3ZJ6A 4PL2A 4C65A 4LB3A 1Q6EA 2QEZA 3I6RA 2HE5A 4RCXA 4I9TA 4LQ1A 3WJSA 3NZQA 2OX4A 3CAKA 3S4TA 2GJLA 4H04A 3IRSA 4AZ7A 3OA5A 3M5ZA 4LC8A 1Z41A 3O16A 3LEPA 2AKMA 2WM0A 3RU6A 3FJLA 4MKSA 1S2AA 2OSXA 4FXRA 1F76A 4HCLA 1GPFA 4O19A 3H24A 4F3HA 1BPLB 2C18A 3HG3A 2H6RA 2VHLA 4I7UA 1OFPA 4AQLA 1AG1O 2A2IA 3LZ3A 3AIQA 5CSYA 3DU0A 4YU1A 5HOSA 2GLKA 3S1GA 2E8ZA 4A6GA 2EF9A 4KEVA 2NX1A 1OK6A 1YDOA 3MKKA 4UTFA 2OKOA 5B7ZA 4QR6A 3CGTA 2PU1A 3UWQA 1M6JA 1US3A 4JTJA 5CZSA 2D3LA 1E55A 2KZHA 1JI1A 2TAAA 3BH4A 2V3FA 3CMFA 3WLRA 1AD4A 5JBFA 1MMFA 3K4AA 5H2ZA 4YPJA 3MVTA 4Y9MA 4ZOBA 2YPIA 3CHFA 1UR9A 4HHLA 3ZO9A 5AECA 4JFUA 1MZRA 4F48A 3POCA 1I2NA 2BSLA 3CUJA 3RJYA 3G5EA 4M6VA 1DXFA 4S3DA 1RY0A 3E38A 2IKHA 1S2WA 4MUZA 2DQXA 1QNRA 3VUSA 4NNCA 1Q7MA 1EB3A 2C8NA 4IPIA 4OKDA 4KERA 2WXDM 1EYEA 3WJZA 3SUSA 4DJEC 3REQB 2FZNA 3WQGA 3NYZA 3W85A 4IFKB 3FS2A 4YWSA 4F79A 1AW5A 2OGJA 1SO6A 1CGUA 4IGMA 3W7GA 1TA3B 3UU0A 5HQLA 5AC7A 3PVFA 1MEIA 1PWLA 1NQ6A 3N34A 5CPNA 5HR7A 1XYMA 4DJFA 3OOQA 1QI0A 2PDHA 2DSWA 3OBKA 5DRCA 3ID7A 2RH9A 3H7RA 4QAWA 7PTDA 1IZJA 1FH7A 4GISA 1TV7A 3W3OA 3RAOA 5I03A 1TG7A 1XXXA 1JVNA 5HWJA 4OBRA 1REQA 1FTXA 4D1IA 1BSLA 5E0FA 2NQZA 1RLDA 4JQ3A 1XYLA 1GT8A 3LPOA 3LXBA 4W7WA 3VD9A 1H51A 4HNTA 1UWIA 4PMYA 2UV8G 5JUVA 4ZO9A 4MZ1A 4DRSA 1PKYA 1MQRA 2XIBA 4NAEA 5IHRA 3AJXA 3NO5A 3NQBA 4XK2A 1ENUA 5AYIA 3WFAA 1HKWA 1XFBA 2ZUMA 3KAOA 3KCLA 4DO6A 3W2LA 3QPYA 4HHHA 4LUTB 3HFTA 1FCQA 3C4UA 1VBRA 4B2DA 1EF3A 3SFKA 5D2TA 2GJXA 3H4XA 4Q8MA 4TTGA 1E6XM 4XKMA 3QJAA 1DOSA 1FDYA 3IJIA 2WHJA 4RDWA 4AISA 2WV8A 5CKSA 4Q6JA 1KXTA 4EWJA 6TAAA 4RR4A 1KCLA 3RJXA 3R5EA 4LU0A 2QR6A 4W85A 4DAIA 1UJQA 1BWVA 3P14A 4HIBA 3NQMA 1EJXC 2PSNA 1GG0A 3EB2A 1YE6A 4LAOA 1VFTA 3KBNA 2H8ZA 1VCFA 4LVBA 5HUOA 5KINA 3KS6A 2DUAA 2YGYA 2EKGA 1J79A 1CXFA 5EKYA 3GVWA 3FFSA 4GK8A 3NL6A 4UFJA 2B7NA 4IQEA 1WPCA 4B9ZA 1VENA 5IBXA 3AALA 4GZJA 4RZBA 3TEVA 1U5HA 4JFVA 3CJPA 1W6TA 2CEQA 3V36A 1M3UA 3TONA 4TQTA 4YTRA 2FIQA 3V0TA 3CYVA 1ISYA 4ZQOA 1SJDA 2POZA 3F4DA 3O6AA 2PA6A 1O5XA 3UNTA 2PDYA 4OBTA 1WP6A 2A3AA 5ABFB 1QWKA 7REQB 4JTIA 1ONRA 1H7RA 2ACRA 4MKVA 4RPPA 4C6LA 1H1YA 1YPIA 3W81A 1NWTA 3T1GA 2OSWA 5CBBA 4PCPA 1WDPA 1E73M 5LNUA 3B3DA 2WVVB 4HKPA 4N7QA 2BVWA 1EGMA 1CB2A 2PI6A 3NUKA 3DDMA 1RH9A 2CESA 3E0FA 3AU6A 1UD8A 3S83A 3MHFA 4AZCB 2IKGA 3PZMA 1EX5A 2RJGA 2DT2A 1OX4A 4UTUA 1AQ0A 3N29A 5AHNA 4LGXA 1IIHA 4WD0A 2J6XA 2PPGA 3IJ9A 3OLIA 4J5NA 4PZVA 1WX0A 5CGQA 4KS0A 4LVAA 4OUIA 2DQWA 3WX7A 2VVSA 1CCWB 2JGYA 3ARQA 1Q63A 3FNDA 4S3AA 3L23A 2F6XA 3EOEA 1W5PA 1UZ4A 1ZSXA 1X6NA 3TU9A 2Z1BA 3WL1A 3S3GA 3CEPA 3NG3A 2NV9A 1X96A 5CAHA 3NQ6A 3T7VA 1ADDA 2FGBA 2DZPA 4NRRA 1FX6A 3BJTA 3VKKA 1JDFA 3TSMA 3WK0A 1MFVA 4AY1A 1JNEA 2HVMA 1GQIA 3UG5A 1EP1A 1F74A 1AJZA 4IL2A 3A5VA 4HPGA 6A3HA 3F4CA 3E1F1 4DN1A 4QNEA 3VIMA 3K2GA 4BR1A 5LA0A 1QNOA 2YBUA 4IPJA 1Z89A 4L6DA 3ZFHA 4K1GA 2Y7GA 1GKQA 1ZGDA 1HXJA 2F6KA 2A3EA 5EFDA 3NIYA 1JEZA 1NFPA 3W87A 4ACZA 2QCEA 1XDLA 1M01A 3MI3A 5HPOA 3EDJA 1SO5A 1NDZA 4IIGA 5D30A 4H6QA 2VC7A 2WKJA 4L65A 3FEMA 1T8XA 4KMQA 3RPTA 2BMBA 4GACA 3BMWA 1PKMA 2YSWA 2G3MA 4O0QA 4L1GA 2BHZA 4UTMA 2DH3A 3VOFA 1DWGM 3LQLA 5HMDA 1KXQA 3WH6A 5CPLA 4QDPA 4DHGA 1SVDA 2GFTA 3SCWA 1QO2A 4NSBA 3B8VA 4NNBA 4AEOA 2A4AA 3GVGA 1D3HA 5HK4A 4CQAA 1B90A 3R1ZA 3B05A 5ABGA 2ZCGA 4D6EA 1XBVA 3IIXA 3PFMA 2YBVA 4PBFA 3AUOA 1E1FA 2WKLA 1YBQB 4JQ1A 4QXIA 3TK7A 3VGDA 1XLDA 4XZBA 4AIEA 1TV2A 1Z6KA 3ABSA 1EJTC 2Z29A 1VRDA 3PPGA 3LMZA 1F6KA 2FFIA 1O66A 3AHXA 4ICNA 3LHUA 4PBGA 1QNPA 2OOGA 4W86A 3VKBA 3VNLA 1V03A 1GVRA 3LCHA 1HGYA 2CERA 4US5A 3NVTA 4QBXA 5G1YA 4DWSA 2V81A 3THQA 4IWWA 4E8GA 2ZXQA 5A6MA 3CV1A 4IX2A 3OLDA 1W1PA 1KFBA 3ZJKA 4ALDA 1J0KA 2VTFA 1V08A 3L66A 5HWMA 2A3CA 5A8MA 4ML9A 1BYDA 1TIWA 4GBUA 5G2HA 3TAKA 4DWDA 3G1DA 1UG6A 4HNNA 3EB3A 4U10A 3RM9A 3H2FA 2VYOA 5C5YA 2CPUA 3LQGA 4DF1A 3E9AA 4IL0A 3MV01 3OPSA 3WLIA 4AD5A 1UR2A 4H9TA 1TWIA 4LNCA 3FYPA 3E2QA 3CEUA 2C71A 3D3AA 5U7SA 4O14A 3CXOA 2G95A 4XSLA 1UKOA 3TA9A 4HU8A 2E5CA 4QNWA 1NM9A 3LYEA 2PDMA 4WRHA 2E6DA 2E6YA 2VT0A 1VCVA 5C8BB 5JIPA 4EK7A 3W7OA 1V77A 1YTEA 5A94A 3ZLFA 4RJEA 2WSPA 5HANA 1QPNA 1DJWA 2CKRA 1QI4A 2OZTA 3KTXA 1WKFA 4K38A 5D9MA 4DBWA 2J7CA 5D37A 1LYXA 4PN2A 3G1XA 1PX3A 2P5NA 1QVBA 1V0NA 3N2CA 4IGSA 3LS9A 2PCEA 4LYPA 2WSKA 4GJJA 1I2PA 1Q13A 4X61A 4A2RA 2V2CA 5MKGA 1JGMA 4HNCA 3MUXA 2ZFAA 2E5DA 3KWXA 5TF0A 4DNMA 2HMCA 5K9CA 3RUBL 5KSWA 1JCJA 4FHAA 1UBSA 1E6PA 2YJQA 1WXYA 4GY7A 3FN9A 3HQOA 4O1CA 3TQ0A 2J4GA 4H41A 2WLZA 2CLLA 4LW7A 3PBYA 4WGXA 4EXAA 3BOFA 1L2UA 1TTPA 1JAEA 3CLWA 3VMPA 2QUNA 2EPMX 3NDYA 3PJWA 1XLCA 3AZRA 2WBGA 1BYBA 1S3TC 3FKRA 2ZUWA 2Z1WA 1EP2A 2VOTA 5F1UA 1E40A 3VE9A 1S3HA 3M0HA 3G6LA 3S1WA 3G1RA 1MEHA 5CGTA 1J2WA 4Q7NA 1V0MA 4LS1A 2VDHA 2X1SA 2A5HA 4RZ5A 3NO3A 4MNMA 4CD5A 3QHOA 1CDGA 5KTLA 4ZFCA 4C90A 4BEUA 3ALGA 3IIPA 3FA3A 5ABTA 2TSYA 3Q2DA 3G24A 2Y24A 1KD0A 4TV6A 5JIWA 1OYAA 3KVMA 1R2TA 1FWCC 4X22A 5EB8A 3GHSA 1T40A 3BQ6A 3N4AA 2Z1KA 3RCYA 4FLOA 1UMLA 1K4GA 4JIRA 1NWUA 3G2GA 1ZJAA 4C6OA 4W8BA 1BYCA 5U4NA 3NQFA 1RVKA 1ZAJA 5DXXA 4TMCA 2HV5A 2VNCA 1ME9A 1DJQA 4AB4A 3DCPA 5HNTA 4C6BA 3EPNA 3MYOA 2P3EA 1A3XA 2E09A 3QGAC 2PWHA 2PS2A 5FJJA 1SUXA 3WLSA 2VQUA 3VNJA 4MZYA 3H23A 3ITXA 4O1DA 1XKYA 1DV7A 3BVJA 4TVUA 1MXDA 3QV8A 3GS6A 4CNPA 1RP9A 1VKFA 3S42A 1W56A 2WSRA 2WSYA 2DUZA 1IR1A 2HK0A 2DEPA 3IGSA 1VEOA 2V0TA 3QW3A 4C7DA 1W1IE 3B9AA 1BGGA 4AXNA 1XLBA 1VIZA 3L7RA 2NUYA 2GQ3A 1XIIA 2YL9A 2BY0A 3DFTA 3H2CA 2C79A 4IUGA 3H2EA 1EWDA 2DJXA 4C7GA 4IIEA 3E0LA 4FI4A 3V16A 3WLLA 3VOCA 2XH0A 3KP0A 2TODA 4DZ5A 4JTRA 3WG6A 2NSOA 1EFZA 1V5XA 4FOKA 3I6EA 4JY9A 2WZMA 3I3EA 5HJXA 2TYSA 2D0GA 1K7XA 4OHQA 2QIIA 3OQEA 4L61A 3WF3A 3UCDA 1TREA 3CWNA 1RBLA 3AS3A 3W26A 1PUDA 1RJPA 3KVLA 3DHDA 1K7EA 1XS2A 1UKPA 1XBYA 3MY9A 3GKFA 1A5BA 1T99A 3W7HA 1B0IA 4XSMA 4BA0A 3FY1A 3I3BA 1M04A 3LGEA 3HGJA 4WSKA 5LGXA 2PWDA 5FJIA 4A3UA 3BCDA 4A8LA 3WQCA 3K13A 7ENLA 1LWJA 1V7YA 3SBFA 3MQTA 1WDWA 2Z7GA 3UR8A 1Q6RA 1OYBA 4U5IA 3SGGA 1TTIA 3UVIA 4Y2WA 2WJFA 3DHUA 4DB7A 1I8JA 1OCNA 3PFRA 3AMGA 3UXKA 3KVJA 1A5SA 2A7NA 3HB9A 4BCEA 2VZVA 1WOAA 4TX9A 2BY2A 3W7NA 3QZEA 1ADOA 4E2DA 1CI1A 4IOTA 3FOKA 3C3UA 4GNJA 5FESA 4NILA 4QROA 1DHPA 5CC6A 2C19A 1NOUA 3QKEA 1AK5A 3EA2A 5D8WA 4EE9A 1C93A 2FTYA 5HMFA 1ITUA 3A21A 4KRTA 4K39A 3KBSA 4UR7A 3PJXA 3T05A 3P82A 4US5D 3OIXA 1LBFA 1WKYA 2PDGA 3I6TA 4GGHA 5LA2A 3M0VA 3IACA 1Z9AA 1W3HA 3LCWA 2I14A 1QW8A 1EJUC 1W9XA 2NVAA 6ENLA 1PHWA 1XF0A 2XM2A 4LEFA 6XIAA 4NX5A 3IVSA 3OVPA 2C15A 5J5DA 2PMQA 2WVSA 3GR7A 4FX7A 1Z69A 2BLEA 2A3LA 3QV7A 1QR7A 1WDQA 2ZZ6A 5D33A 1KFLA 1KWGA 2FJKA 3DERA 1E0UA 2GGGA 3LHWA 2QULA 3PUGA 4O13A 4JTCA 3R12A 4PH6A 3MBFA 4ADTA 1E6ZA 5FJRA 8XIMA 4QITA 4EAYA 4LCSA 1KBJA 4JTGA 3W1QA 3EXRA 2HWGA 4CEXC 2EPOA 3AJ7A 4PCNA 1YNQA 3U2OA 2GK1B 1PEZA 3WJXA 2W62A 1LQ2A 3WJYA 3ZM8A 1E4NA 8CGTA 3B4YA 3GTFA 2RAGA 3ARTA 3ZSSA 2PEVA 5M3WA 3N13A 1MFUA 2DT3A 1CW2A 5CZ0A 2Y63A 4GY0A 1TQJA 5DCBA 1ISVA 1FP9A 3NQ8A 2XTKA 1UOZA 3BLLA 2E1DA 3R11A 4HJWA 2NQJA 2R94A 2HBVA 5CQ1A 3W70A 1CB7B 1TZ7A 3RDKA 4Z42C 5CZKA 4RDVA 4X2RA 3IS4A 3P7YA 1V3KA 3ENLA 1SJCA 3UCCA 5AHEA 5AC5A 3EWUA 1OVDA 4UCFA 4N2YA 5D32A 4MB5A 5DX7A 3W86A 2Z2BA 3WH9A 1KFEA 5J5RA 4PFHA 4GUHA 1X8FA 3GDRA 1VBHA 3STFA 1LOSA 5LIXX 3VM7A 4RV8A 2YB4A 3QSRA 3HM7A 1QW9A 1BFNA 3LI0A 3N2BA 5M17A 4MYXA 3VNZA 3S2CA 4HNUA 3ZS4A 5BWAA 3H7VA 1E43A 4ACYA 5KITA 1GGOA 2WNNA 1OQFA 3THAA 5D9PA 2X05A 4LNYA 4DZAA 3CS2A 3VIHA 2QDHA 2XM1A 4PFMA 3VTRA 3AYRA 2DY3A 3UETA 2CZDA 2QAFA 4OWGA 2HK1A 4P8XA 2XZ7A 1ZUAX 2IUZA 4X0VA 4JEQA 5A8QA 5DXYA 3W7CA 1FVPA 1KBKA 3BLPX 1A49A 2DT0A 1XLLA 4WDTA 4ADSA 1JQXA 2EQDA 2YFNA 2FZBA 4N9DA 4DI9A 5FEPA 1UCWA 1ZU8A 4PUDA 2XSXA 1Y0EA 3APTA 5I3DA 3TYCA 2OB3A 3EOSA 1F4HA 4MPKA 3R8RA 2QYGA 4W88A 3QZAA 3SIZA 2ADAA 2VZUA 1F8IA 3VOJA 3QF0A 4QM1A 2DV0A 2E6AA 2QW5A 3LK6A 6XIMA 5FF3A 3EX4A 1VRXA 2RJHA 1V0LA 2FZMA 2VX5A 1E70M 5K3VA 5KZ6A 3EEGA 2XU2A 1OFEA 3ZR5A 2V5DA 3M44A 4C1KA 3AIVA 1DWJM 3NDOA 1AODA 3M0MA 5LA1A 2J7BA 1TRIA 3DFHA 2ZRZA 1GHSA 3LA4A 4C91A 1WXZA 1ZP4A 1ZCCA 4LRTA 4LYQA 1EPVA 3PN8A 2OZ0A 4NJJA 2BHUA 4QIUA 5JXQA 5F2MA 4ZB2A 3T0BA 3EAUA 4UQBA 3C2YA 4IQDA 3UJEA 3KL3A 1EJ7L 3G8RA 5REQB 1BRLA 4O11A 5DANA 2GGJA 3OYZA 1MI3A 1RHCA 3GFXA 2O7QA 5CSSA 1RA0A 3SUVA 3KRZA 3TUUA 1O7AA 4K37A 2LLEA 5H1WA 2ZA3A 4JTKA 1SZEA 3PWIA 1AQFA 3PBGA 3HBLA 4JIQA 3ZYZA 2CKSA 1XPYA 1XBZA 5C70A 3B9DA 1HN1A 2DSUA 3MANA 1IWBA 5TD4A 4HD5A 4B16A 3IJLA 4O17A 1PKNA 3EKLA 4U3AA 1FWIC 3S2LA 3BL3A 1HNYA 1UWTA 3R4IA 1K4HA 4O10A 4HZ6A 4ZQPA 3HPZA 2HNHA 2FPYA 2FVLA 3E0VA 4A8IA 2EGZA 4C6KA 1V3HA 4ZXLA 1RQEA 1FH9A 3VDCA 2NW0A 1R3VA 2J27A 1O94A 3FK4A 4GKTA 1RAKA 3W1RA 5HNUA 4E0CA 1TE1A 3CWHA 5DY2A 4RW3A 5BZAA 4E2OA 1XDJA 2XPKA 1E15A 1A50A 1CXHA 1UQYA 5GPRA 4JOMA 3WY1A 4GYPA 3UZYA 3W37A 1GK8A 1ZBWA 4GKLA 4RNFA 4PUMA 1J0HA 4HSHA 3GIQA 5DEZA 5I3IA 4HQVA 1HL9A 1XLKA 3VGHA 1F2JA 1C9DA 4GRSA 4Y8EA 2AL2A 2Q02A 4XUYA 2Y7FA 3W76A 3SY1A 5A6SA 3QTPA 3TA6A 3URAA 1ZZMA 4AZBA 4X60A 3QOMA 1MSSA 4F0RA 3OIHA 4GCXA 3PPCA 2CLPA 1GOOA 3S46A 2WW5A 4AIUA 1WB0A 2F8QA 3C5QA 4H9XA 4V2XA 3AMDA 2CLHA 5HULA 4WDXA 1LG1A 3V1PA 5FF0A 2QLYA 3LGDA 3H55A 2OZ3A 2V5LA 2OEMA 4GX8A 3C3NA 3QMRA 1XQKA 3FEQA 2VC9A 4J7RA 1JXJA 4V15A 5CG7A 1A80A 2C1GA 2CC0A