4MUPA

Crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
284
structure length
284
Chain Sequence
RKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPGGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPHNSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMIDOHYDROLASE
publication title Crystal structure of Agrobacterium tumefaciens ATU3138 (EFI target 505157), apo structure
rcsb
source organism Agrobacterium fabrum
molecule tags Hydrolase
total genus 101
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 5.4.1.4: D-galactarolactone isomerase.
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4mupA00
1GKPA 4C5YA 3IARA 1E9ZB 4I6KA 2Z29A 2R1PA 3N2CA 3UBPC 4C6DA 1PSCA 3UR5A 4DI9A 3OU8A 3WMLA 2ANUA 3LSBA 1P6CA 4DZHA 3AUOA 2CZVA 2ICSA 1NDWA 3UPMA 1P6BA 1O12A 1PB0A 2AMXA 5HMFA 4EPKA 1FWAC 2OOFA 3O7UA 3QGAC 4H9ZA 3IPWA 4C6BA 3NQBA 3C86A 4H9VA 3GUWA 4H9YA 3URQA 4LAMA 3E0FA 3PNUA 4YIWA 3F4DA 2BGNE 4IGNA 2OODA 3MVTA 1QXLA 3FEQA 4QRNA 4CEUC 1EJRC 3IGHX 4C6IA 4IFOA 4H00A 3E74A 3GU1A 3UF9A 1V7AA 4C60A 4LAOA 4AQLA 3QGKC 1NFGA 1A4LA 1XRTA 4KERA 4CQDA 4GY0A 3OVGA 1W1IE 4DIAA 3FDKA 2OB3A 4DO7A 4CQCA 4R88A 2A3LA 3TN4A 3RN6A 1A5MC 3GTXA 4TQTA 2AQVA 1A5LC 3E3HA 1XWYA 3RCMA 3AU2A 3S2MA 4GYFA 4IFKB 3LGDA 2ADAA 4XAYA 3B0XA 4PBFA 1EJUC 4HK5A 3EWCA 4LALA 2D2HA 2VHLA 2XIOA 3URAA 5FSDC 4LCRA 3CAKA 1M65A 1PO9A 5LXXA 2HPMA 4GX9A 3LY0A 3B40A 1K6WA 3MSRA 1M7JA 3GU2A 4QS6A 3IRSA 1O5RA 2HBVA 3K5XA 2O4QA 5A6TC 1YBQB 4L9XA 1EJWC 2KAUC 4RZBA 1RAKA 2GZXA 4PCPA 4RDWA 2QVNA 4KQNA 4ZSUA 2QPXA 2E25A 1J6PA 3FDGA 4C6QA 1V77A 2Z26A 3E0LA 3A4JA 1UMLA 1EJVC 3S2LA 1GKQA 4Z42C 2W9MA 3TNBA 1E9YB 4HA0A 4UBPC 3LNPA 2HBXA 1RJPA 2QS8A 1J79A 3D6NA 2VC7A 4J2MA 4XD4A 3DC8A 4GX8A 3G77A 3B0YA 1K70A 1FWEC 3MDWA 3T8LA 3MVIA 3SFWA 2EG8A 4GBDA 4IQJA 4XAFA 4LFYA 1FWHC 1UIPA 2P53A 2PAJA 1RK5A 2E1WA 3F2DA 4J35A 4D8LA 4IFKA 4V1YA 4CNTA 4G7EB 4WVXA 2FTWA 1FKWA 4C6JA 4DYKA 2FVKA 4KEZA 1ONXA 4ERIA 4EPBC 2OGJA 2UZ9A 4XAZA 1ZZMA 3AU6A 1FKXA 3OQEA 4H01A 4DLFA 4E3TA 2VM8A 5HMDA 2HNHA 2VUNA 3S4TA 4B3ZA 4DNMA 4XAGA 3URNA 1GKRA 1IE7C 3TN6A 2D2GA 3URBA 4UB9A 3NEHA 4HJWA 4C6NA 4XD3A 1YIXA 3GTHA 1WXZA 2OQLA 5G4HC 3MDUA 3NURA 1FWCC 4LAKA 3ISIX 3K2GA 2PGRA 3CS2A 2FVMA 4LANA 4V1XA 4ERAA 2PLMA 4BY3A 1YNYA 3LS9A 4L6DA 3IJ6A 4M51A 1EYWA 1UBPC 3K4WA 1RA5A 3UR2A 3LGGA 1EZ2A 2F6KA 4CNSA 3OODA 5AKQA 4ICMA 1ITQA 4H9TA 1BF6A 4P5UA 5E5CA 4BKNA 2I9UA 4GC3A 1I0DA 3GG7A 2GWNA 2R1MA 1POJA 3T81A 2GWGA 1KRBC 2GSEA 2I5GA 3CJPA 2Z2BA 1UIOA 2O4MA 4G7EA 3HPAA 4C6CA 2DVXA 4NI8A 4WGXA 3S2NA 4QROA 3SO7A 4CQBA 3GRIA 1FWJC 4C6LA 2Q09A 4PCNA 2FFIA 2Z27A 4DI8A 3IACA 2EG6A 3A3XA 4XD6A 2PGFA 1P1MA 1R9ZA 2Z28A 3A3WA 3GTFA 1FWIC 2Z24A 2BB0A 4G2DA 3ITCA 4KESA 3ID7A 4IG2B 3E2VA 2WM1A 1KCXA 4R85A 3DCPA 3RYSA 1K1DA 1ADDA 3EWDA 4RE0A 4IF2A 1PTAA 1RJQA 3OJGA 2HPIA 4XD5A 2P50A 2YXOA 4C6OA 4AC7C 4C6FA 3ICJA 1S3TC 2Z7GA 4PE8A 4B92A 4J5NA 2PUZA 2Z4GA 4NG3A 5HMEA 3E38A 2YB4A 3QY7A 2QT3A 4BJHA 4C6PA 3PAOA 4EPDC 4F0RA 3LA4A 4IGMA 3WZ0E 4GY7A 3MKVA 2R1LA 1A4MA 4LCSA 1JGMA 3T1GA 1NDVA 3MJMA 2RAGA 3F2CA 1HZYA 2Z2AA 4GOAA 4QSFA 2GOKA 4ZSTA 1YRRA 4KETA 3ORWA 1EJTC 3LU2A 4B91A 1A5KC 1ITUA 4JOMA 2Y1HA 1FWDC 4EP8C 1DPMA 1XGEA 4KEUA 2YZ5A 1YBQA 2IMRA 1FWBC 2ZC1A 3OOQA 2EG7A 4RDZA 4C6EA 1V51A 1A5NC 3GTIA 4F0SA 1KRMA 1I0BA 1KRAC 2WJDA 3GIPA 2AQOA 4IG2A 2VC5A 4DLMA 3PNZA 4OFCA 2HQAA 3PBMA 1R9YA 3V7PA 4EPEC 1RJRA 4NP7A 5FSEC 3QY8A 4RDYA 3PANA 1XRFA 1NDZA 3JZEA 4C6KA 2VR2A 3IV8A 1YMYA 1POKA 4GXWA 4LEFA 4LH8A 1R9XA 1VFLA 3QY6A 3S2JA 2WJFA 3DUGA 3TN5A 4F0LA 4WHBA 4H9UA 3TN3A 4C5ZA 4QTGA 1RA0A 4B90A 2R1NA 1FWFC 4H9MA 1RK6A 3F4CA 4QS5A 1A5OC 3RHGA 3BE7A 3WYZA 1QW7A 3MTWA 4IH3A 4HK7A 4I6VA 1KRCC 2YB1A 4R7WA 2G3FA 3GU9A 4PBEA 4IFRA 1ONWA 3GIQA 1V79A 4GK8A 4C6MA 3EGJA 4ERGA 4CNUA 4GY1A 4DZIA 2DVUA 3HTWA 4KIRA 3R0DA 4MUPA 1V4YA 1J5SA 1EF2A 4HK6A 1EJXC 3F2BA 3MPGA 2UBPC 4C65A 3HM7A 1WXYA 2FTYA 2Z00A 5CH9A 3LSCA 4KEVA 2D2JA 1NDYA 4CEXC 4INFA 4RDVA 1FWGC 4GZ7A 3O0FA 2R1KA 2Q01A 2DVTA 4LCQA 2WJEA 2Z25A 4KF1A 1M68A 1EJSC 4H9XA 1J6OA 3KM8A
chains in the Genus database with same CATH superfamily
5CG7A 4PYSA 2BS9A 2MUCA 3VGGA 2R1PA 3UBPC 4B5XA 1W2VA 3PHAA 5H8UA 2WMKA 3TAKA 1R87A 1W3LA 1OVDA 4ZOEA 4WRHA 4LBUA 4AX7A 1F9CA 4PL2A 1RPKA 5AYZA 1PBGA 3GUWA 1VIWA 1B5TA 1OZQA 2JF7A 1ZB5A 3SCRA 4IGNA 2OODA 2UY2A 3W7RA 2VWSA 3EPOA 1SM9A 3W84A 2DT0A 4CD5A 4WY0A 1T7LA 3MUIA 4RZ6A 1JRCA 5FJUA 4TVDA 4AQLA 5KSWA 2RDXA 2QAFA 1MZHA 1JFHA 1Y65A 2V5KA 1A4LA 1U33A 1XRTA 3PPCA 5A1AA 1W1IE 4BZYA 1TMQA 3VFCA 4OV9A 4LYKA 4DO6A 4O1FA 1D3GA 3AIBA 5IFTA 1KGWA 2R6OA 3WLQA 4DJEA 4GGHA 3N6HA 3CMGA 1DIDA 1GONA 3TZNA 1YDOA 4O13A 4IL0A 3QR0A 1BXBA 4J7RA 1CGUA 2ZX8A 4PEEA 2PWVA 3UXKA 5AC7A 2G5WA 4PFMA 1DHKA 1AW1A 2E5BA 4S3BA 1XCFA 3VD3A 4KT2A 2J9XA 4NXKA 5D33A 1VENA 1QNPA 4O11A 1YBQB 2X42A 1PIGA 3GXDA 2C15A 4C91A 4LRTA 3SN0A 5B7ZA 1JUEA 4NJGA 2QPXA 1S2AA 3GYEA 5CSSA 1V77A 5ABFA 1YKWA 2A4AA 5AOUA 1UMLA 4KRUA 3VM7A 3LNPA 4H19A 3VE9A 3GD6A 3O15A 3TLLA 3RMJA 1KFWA 3MDWA 1GJUA 3BGJA 2WYSA 2ZYFA 4PB5A 3FLUA 3RG6A 3V5CA 2EJAA 3F2DA 3W1RA 1K7XA 4DYKA 4B4FA 2FTWA 3BAWA 4XV0A 2FVKA 3E2RA 2F61A 3HA1A 1TB3A 4KPLA 2GK1A 5FF2A 3S6TA 4WDWA 5I3HA 3MYPA 5K9CA 4ASTA 3LHZA 1CGVA 1HJQA 2HS8A 4AC1X 1I2OA 3J7HA 2XZ9A 3UP8A 3LZ3A 3WH7A 1KTBA 3MUZ1 1WXZA 1F74A 4WKHA 3BW2A 1HJVA 4EXAA 3QHNA 4LYPA 4Z2JA 5JH2A 1F73A 2QR6A 4JIPA 4ZQMA 4DF0A 2FJUB 4M51A 4UTFA 1UBPC 2HSAA 1FHDA 1RA5A 3EMZA 1F3WA 3NO1A 3CZ8A 5PTDA 4E4PA 3CLMA 2X1IA 3CH0A 5K2ZA 1JZ6A 3E6EA 4MMWA 1SQ7A 3AFBA 2GGGA 4MWAD 3UVIA 2GSEA 3P84A 3W27A 1BF2A 2E1DA 1QTWA 1N8WA 3WLPA 3PSVA 1Q8AA 5EMMA 1UH4A 3UXDA 1Q65A 1E9LA 3PJTA 2FFIA 4AF0B 5A8MA 4XD6A 3H2CA 3RX4A 2PGFA 3GNOA 1VBUA 4TVCA 1NVMA 2XIJA 4UNLA 2QVHA 3RYSA 3QKEA 2PFHA 3MBFA 4CNNA 1EBHA 3SQMA 1EO7A 3A12A 1L2UA 1WDWA 3ABOA 2W67A 2V6AA 1H0GA 2RDUA 1OZMA 3T78A 1KLZA 4NT0A 4XB3A 2ZC8A 4P7LA 1J9YA 1OC5A 3QY7A 2QT3A 3SCOA 2HJPA 3VI2A 1Q5MA 4N42A 1LYXA 3S5YA 3CWNA 3VX0A 1UKPA 2EPOA 1P7TA 3FV9A 1KGUA 5I09A 1UG6A 3NNTA 4J2PA 1YRRA 1VBGA 3RX3A 1XBXA 1E40A 2CXGA 3LHVA 4B3KA 4E3VA 3KBMA 1RCOB 3WN6A 3MSYA 3QZAA 3S47A 3NXLA 4KEUA 4U3AA 4AD0A 4C7GA 1GTHA 3W22A 4MJMA 1OFDA 2EG7A 3NQAA 4C6EA 3WD3A 4LEQA 2QUTA 3EYPA 5DXYA 1E6PA 4AUBA 2WJDA 3WY1A 1Z9AA 1K8CA 1Q6OA 4JFWA 3RXZA 4IPPA 5B80A 1QVBA 2VC5A 2CNCA 1QNQA 2I16A 4MWAE 4HHPA 1VP5A 4XKYA 4O1DA 1H2JA 1UOZA 2GSHA 3LHYA 4HHMA 1NDZA 4HNLA 4X9YA 5D05A 1JCMP 4UZSA 2PDNA 1TQJA 3QY6A 1RR2A 2QCEA 2NV2A 3M6YA 2X0YA 1OFAA 2VDGA 3DOPA 3F4CA 4JFUA 1H7NA 4UTIA 4GABA 4L1GA 3VDGA 1W91A 2X1SA 3ZXWA 4EANA 3QEZA 4HKPA 4ZB2A 3I7QA 4PRWA 1G4EA 2H8XA 2C13A 4OOZA 3ZS4A 3B8SA 3R8HA 1C3FA 5BXPA 1V0NA 3BG9A 5BNKA 4PUMA 2A6NA 4C90A 1CGWA 1TELA 3UCCA 1FCQA 4JYEA 3MY9A 3PSWA 1AJ2A 3BPWA 3ARSA 1EF2A 2CYGA 4REQB 4MG4A 3H12A 3W1TA 3WF4A 1I9CB 3BZJA 3BGGA 4L65A 4XZLX 1WXYA 4U3CA 3REQA 5HBFA 3W85A 1X7IA 3HPXA 4FMVA 4NNCA 1K7FA 2E40A 4CQAA 5A94A 1UR3M 2WJEA 1D3HA 1EDQA 3L4UA 4GE8A 5A6AA 1QPRA 1LQAA 4Y90A 1YNPA 5JUVA 1W1A1 5HA7A 1Q6DA 2NLYA 3L23A 4C6DA 3LERA 3TWAA 1UKSA 4P7NA 2QHAA 4DI9A 3GSMA 3WMLA 2CW6A 5GPRA 2CEQA 4DF2A 4FAMA 4ZE5A 1LWHA 3QSTA 3WX7A 1H11A 1TUXA 1YDYA 2DSZA 4KCWA 1UOKA 2VJXA 2WVUA 2BOFX 4H9VA 3E0FA 4HN4A 4YIWA 5AECA 4UCGA 2C1HA 2Z1XA 4ZEPA 2BGNE 4HNUA 4EWJA 2X0SA 4QJ1A 4R27A 3TH6A 3L4VA 5BRQA 4A3RA 5BWAA 4NIRA 2XM1A 3GU1A 1JUBA 4OE7A 3EWZA 1TTJA 5LA2A 4NSBA 1RP9A 3P74A 3LPGA 2FYMA 3WLLA 1JDDA 4UOQA 1ADSA 2XGZA 1LG2A 1XF0A 3PZ9A 3S2MA 3NSXA 4IFKB 1UR8A 4YXGA 1XIGA 1AZ2A 2I56A 1AVAA 4ZA0A 4D71A 3WD4A 4V27A 2XIOA 1S2UA 4HHLA 2BX7A 3OZMA 1XG3A 1K6WA 1BVZA 4GJ1A 2ZXQA 3TYCA 1JYWA 1M7PA 3A9IA 3NZ1A 4ZENA 3IJ9A 1MEIA 2J6VA 3GZ3A 4M5PA 5CGQA 4MDOA 1N8IA 3VNZA 3MO4A 4PCPA 1J0HA 1JD9A 4DJFD 5I24A 5T9CE 1IWPA 4HPJA 3AS2A 1WV2A 2GUBA 1Z89A 3QBUA 5GJPA 3MCNA 4LNYA 4Z42C 4UBPC 2HBXA 4W4QA 4Y96A 5HATA 4IISA 3UY8A 5FJJA 3FIGA 3UYCA 2DIKA 3BLLA 4U2YA 3QM3A 3ZFHA 1B31A 4PEKA 5IBXC 4MVAA 4QEEA 3LN3A 3BLPX 1XICA 3P82A 1ZJAA 1F6YA 3UA4A 4C6JA 3TX9A 4XWUA 5REQB 1UR0A 3B9AA 4L5ZA 1FKXA 1HL2A 1G4TA 3G8RA 4ONVA 2J78A 4IL2A 3U7VA 1EPVA 4XAGA 4M80A 1VFTA 5CJ5A 3BCDA 4C6NA 1F4HA 3SIMA 4XZ9A 2P3ZA 2FIQA 3MKKA 2DUZA 4QNWA 5C2CA 1R3SA 2QJMA 3DAQA 3DFPA 1VJSA 2ATSA 1WPCA 3KCOA 3W7MA 3IV3A 3U8GA 5DMNA 2BGSA 1T6MA 3TKFA 4I5XA 3EX4A 4FP1A 1R46A 4WD0A 2CKSA 3E02A 2JGQA 1ICPA 4JY8A 1FWTA 3IUHA 2GWGA 4GNJA 1V0KA 2DUAA 2OWCA 5HANA 5BRPA 2CKRA 3AYRA 3MO7A 3O6CA 2ABBA 4JTQA 1Q2RA 2DVXA 3SRHA 1DJIA 1G67A 2J62A 2ZZ2A 4PTDA 1QK0A 1BKSA 1WDSA 2XINA 3NAVA 3F5KA 1X8FA 3TYAA 4TR9A 3H2MA 2P0OA 4WOQA 2PLJA 4GJIA 1BSLA 3LMZA 4M1BA 6TIMA 5HJYA 4ICNA 3VXGA 3KOYA 4RE0A 4IF2A 2FZNA 5L9FA 2GDQA 5A2AA 4XD5A 2A21A 1M03A 2D0GA 1THFD 1LZOA 1GOXA 1OIFA 1J10A 3NOEA 3M0HA 1EX5A 3K1GA 3BAXA 4S3KA 4EPDC 2VMFA 3ARWA 4BQ3A 4AIUA 1XLMA 5ECVA 4JYDA 3KX6A 1D9EA 2RAGA 4DHGA 1MW0A 1US0A 1BLIA 2QUNA 1E6ZA 2J66A 4B91A 4EIVA 2OOGA 2TODA 4Z2KA 1GW1A 1R5YA 2NQ5A 4GHRA 1GQJA 3T40A 4ZO8A 3BARA 2QZRA 2QMKA 5FJRA 3NOYA 3KBWA 3DHDA 3RU6A 1TFVA 1L6SA 3WLJA 1XIJA 2I5QA 1W31A 2PB1A 5CJNA 4EX4A 3PBMA 5FSEC 2ALRA 3DIPA 5LIUX 1XCXA 4GUHA 1YMYA 4HZMA 4LEFA 3WL1A 4LTSA 1IHIA 4GUIA 3VIJA 4RXGA 1V3JA 2OGYA 3WLOA 3LK6A 2QPUA 5AHLA 4QTGA 1RA0A 3R10A 3CB8A 1UYQA 4W8LA 3U4AA 3HPSA 2DZWA 2QDHA 5KTLA 5F4XA 4QX4A 2GK1B 3MA8A 4K2SA 2NWRA 3IUDA 1QOPA 3GW3A 1GVSA 3FXGA 3SQSA 1V79A 4HU4A 4IP7A 2TSYA 4LT9A 3UESA 1JCNA 1E1EA 1O1ZA 4ZODA 4B9ZA 1J5SA 1TJ1A 3EPNA 4WDUA 5H8MA 3AQUA 3CNYA 1I2QA 5BU6A 3VGHA 4AD3A 1F61A 3W6YA 3NL6A 3QC0A 3QKZA 1YHTA 4XVDA 3WBWA 3PFRA 3W37A 1NWUA 2IW0A 2VGBA 4UQAA 4IJBA 2EPNA 5FJOA 4Z0SA 1EJSC 4QDMA 1JDCA 3VABA 2Z7KA 3MMTA 3UG5A 3GXPA 1F07A 3CH9A 1U5JA 1YTEA 4CGTA 4DWSA 2BY2A 5CPLA 1Q6CA 1TE1A 3U2ZA 1ENUA 3IPWA 2ISVA 1OIMA 3HURA 3QGVA 4NYUA 5KMYA 3SB0A 2X2GA 2HK0A 1PDYA 3KBJA 4FR6A 2Y89A 1D8CA 4IFOA 4H00A 3UF9A 3M46A 3ZSSA 4LOCA 3OIXA 4BFAA 3PWAA 4M6PA 3P93A 1H7PA 4DIAA 3FAXA 1Q2SA 3CHVA 4WXYA 3DECA 3W7QA 3AHYA 4G1KA 2XIQA 3N4AA 4Y9PA 5GQBA 4XAYA 2A85A 1WP6A 2EPKX 5AYIA 1DXFA 1E6SM 4PMYA 3U2CA 4PUWA 1M65A 3HG2A 5LKYA 3GR4A 2D3NA 2NX3A 3B0VC 3MSRA 2ZZ7A 3WQCA 3RPTA 5D03A 3VFLA 4L9XA 1GEHA 1QHZA 4RE3A 5M3WA 3SW6A 3EOUA 5CGMA 1FWRA 2Z26A 3A4JA 3COTA 5CSYA 3LXCA 5CPQA 3S2LA 2NZLA 2BP1A 1KLYA 4XKYB 4D1JA 4JZ5A 1K3UA 1J79A 2VEFA 3UGVA 2PPGA 3B8WA 3WQVA 2QJHA 1NSJA 2G3MA 2C7FA 2I57A 1L6YA 4GBDA 2J7GA 1ECQA 3C0JA 1UIPA 2VRKA 5FF4A 4S3AA 1HFBA 4P8VA 4YNGA 5HK4A 2OGJA 3TUUA 2E6FA 3RM8A 3EZ4A 3AU6A 5KETA 5JBFA 3AS3A 3GKFA 4L56A 3DBPA 4NILA 3T2QA 3NDZA 4WLCA 1SZFA 4PTMA 3K8KA 3I3EA 2QPSA 2J9YA 2OQLA 4QIUA 1KBKA 2VFIA 1G7VA 1AQ0A 4F3HA 3FY1A 4GWEA 4W9TA 3RM9A 3APYA 3TXVA 1KGXA 3CL6A 4KFPA 4YYCA 3IAPA 3PJUA 2E0PA 3QV7A 1TTPA 2NT0A 1XPYA 3N2BA 4ICMA 3A21A 4H9TA 1JDFA 2PWGA 4I9MA 3OIHA 1ZS2A 1POJA 3VE7A 1R2RA 2JFEX 3P60A 3THUA 1B9ZA 3KTXA 4WGXA 3S2NA 1WKFA 3KW3A 2BY0A 3R2GA 4PCNA 3TQKA 1LBMA 3IACA 2EG6A 4IX0A 3L66A 1OFQA 5F2IA 1KFCA 3ARPA 3A3WA 1PEZA 4CD7A 2PD9A 4G2DA 3B03A 4RW3A 3PB2A 1KCXA 4O0ZA 2GGJA 3ZIZA 3FHQA 3GBEA 4JL2A 5AFDA 3QFEA 5HNTA 3LCLA 3LBOA 1DIKA 4JGDA 1CXHA 4GQRA 1RJQA 4S3DA 3WMCA 4KWOA 2Y8VA 4ZQNA 4IUGA 3WBAA 3VNJA 3M9YA 5FD0A 3UWEA 4MWAC 2QV4A 1W3IA 4POCA 4NG3A 3U0HA 1U5HA 2AAMA 2PEVA 5I3JA 2DW7A 1OB0A 5FCZA 3B04A 4IIGA 4F0RA 4ZOCA 2J8GA 4PUDA 3NL3A 4KWVA 4DAFA 1IXQA 3IUIA 3ATYA 3DFTA 3FA4A 3GY1A 1ZP4A 3WUEA 1PHQA 3CEUA 3V36A 1DJQA 8RUCA 1CGTA 4LB4A 3USZA 3QC3A 1OWQA 3QPZA 1P4CA 4HMNA 3S1VA 5C9UA 2GLKA 4IQEA 5BOEA 4GO8A 1Q6EA 1LG1A 2HQAA 4QLLA 3R58A 4TU1A 2YL9A 3VK5A 5MHBA 3SCTA 5U7SA 4FSAA 3TQVA 2Y24A 3N04A 3W2UA 3TN3A 1TVLA 2C1IA 4F40A 1ZLPA 2VO5A 4H9MA 4FIQA 3TSBA 2W4XA 5D9MA 8XIAA 5FL0A 4JNMA 2PTDA 3OG2A 4R7WA 3LHUA 1KM1A 1A0EA 2WSPA 4QJ5B 4OWGA 4U33A 5D30A 1OQFA 4PRRA 5EPDA 4FF7A 3S1GA 3EWYA 3TROA 1K9EA 3TP4A 1G94A 4F66A 4OQVA 3LCGA 3BXWA 3MCMA 4XIAA 4C65A 4JN6A 4XUGA 4MB1A 1XYMA 1KFKA 4X61A 2ZUMA 5E0KA 3NO5A 3KOWA 5M5DA 2ATMA 3PFMA 4GFIA 2GQ9A 4TMBA 4RPPA 2J24A 3FJ4A 4LVFA 3BTNA 1BGAA 5HOSA 1YXYA 1B3WA 3PJXA 3ZMRA 4LGXA 1IXNA 2J77A 5JU6A 2CLKA 2ZZ1A 3BQ6A 5FF3A 3CZKA 6A3HA 1ODZA 2E6DA 5EL1A 3WLNA 1SJCA 2O7QA 3LB0A 2IPWA 5DRCA 1I1WA 4OUEA 1R7OA 3PNUA 1W9VA 1UWUA 2ZZ5A 3G1RA 4IIFA 1ZJIA 1KTNA 1IR2A 3I68A 3TE9A 4B5WA 3G0UA 4CEUC 1EUNA 4Q8UA 7TAAA 3S9YA 1QK2A 2ZXAA 5E6YA 3KBSA 2QLYA 2CHRA 3GWQA 4LAOA 3LQLA 1B3XA 2VXNA 3LDVA 4GXMA 4GY0A 2DJXA 4IICA 3M44A 1A5SA 4YHEA 4KCVA 3PY2A 1L0PA 4R88A 5CZTA 3M41A 3RN6A 2G4JA 2DH3A 4TQTA 4Y7EA 1GQNA 1V6UA 4R9XA 3LCWA 2GUYA 5JH1A 1E51A 2ZVRA 1GEQA 4BWLA 3PPGA 2Q8LA 3MCOA 1BXNA 3RLVA 4IIEA 3LXAA 5FEPA 5LXXA 1FHLA 4DWSD 3GFYA 3ZT5A 1QI0A 5J5DA 3THDA 9CGTA 2W61A 1H63A 1KM4A 3VC5A 2A1YA 1O66A 2OEMA 5A6TC 1ZCOA 2REQA 3KLKA 1OBAA 3LTPA 3VVGA 3BLEA 1TCMA 3G1VA 4Q32A 1WB0A 3BCFA 4GQQA 3THAA 2OT0A 4HCDA 1EJVC 3N14A 1E0XA 4H7VA 4FALA 1UR1A 3TNBA 1GORA 3NYDA 4D6DA 3VUSA 2Z2UA 4AU0A 3SCWA 1MFUA 1M7XA 1GVIA 4P8WA 3G77A 2VVNA 1MXDA 4RLIA 2PP3A 2YGYA 4RUBA 5I3KA 2HK1A 1J12A 3ALFA 1LRTA 1XR2A 4KMQA 3GX9A 3Q94A 1HL8A 1HT6A 3RNDA 4CNTA 1PYFA 2BHUA 4ZXLA 3S8HA 1JPHA 2ZIDA 3AIVA 3W53A 1S1RA 1VS1A 2E9LA 5ABGA 1JGIA 4DJFC 1JYVA 3WNNA 4GYPA 3KL0A 3SGGA 2D20A 1IIGA 1C8YA 3G18A 3ITYA 5BOOA 4FNTA 9RUBA 4RNIA 2VURA 3TTQA 1FWCC 1W8GA 5H6HA 2P1FA 1ISYA 1E1CB 5I07A 3LS9A 1NFBA 3FSUA 4FX8A 4DM2A 1XLAA 4W93A 2C79A 4AYGA 2W91A 5J8LA 1W9PA 1R3WA 5HXMA 5CPMA 3CGTA 3MQTA 1QPQA 1MYRA 3K8LA 1WZMA 4XBSA 1FHVA 4CVWA 3WKZA 4CVUA 4AFYA 4FA3A 4YWIA 3WMBA 5I02A 3GDTA 3W1QA 5FL1A 1RBLA 1QAPA 4O28A 4L9YA 3W75A 1ISXA 3SO7A 1WOAA 2F6XA 3C2VA 2VEGA 1TG7A 3A3XA 4H83A 3H22A 1SU5A 4E4FA 2ON3A 3FYOA 2NSXA 5EMJA 1Q63A 4ZOBA 4RE2A 2WQPA 4QE5A 3P7YA 4FOUA 1AH3A 2F2HA 1AL8A 3KOFA 4Y2WA 2ZRWA 1VR6A 5C7VA 2O9TA 3VKBA 1Q4NX 1F05A 2JEQA 4D8AA 4UTJA 4L6HA 2YCIX 3Q2DA 1DVJA 1R3RA 4UTLA 3N9SA 3BMWA 3LLFA 2J7HA 4IMDA 3EA1A 4LUJA 3CBWA 4RNHA 2D3LA 3STCA 2YJQA 5DN1A 4UR7A 2V9DA 2VI0A 3WD2A 1AODA 1EJTC 2Y1HA 2V2CA 2GVEA 3IIZA 1A5UA 1CLXA 3T4CA 2XSXA 3AROA 1NP0A 3M64A 4AZ6A 1EHAA 3WQEA 2GQ8A 1ISWA 1V6TA 2O9OA 1I0BA 2VP8A 1MW1A 1GOOA 2IPJA 4JS3A 4UFLA 1O7AA 3DFHA 1XXXA 3V1PA 3TFXA 3ABZA 2VEKA 5EMYA 5CAKA 4X2PA 4JTJA 1EKOA 1C7SA 3ABRA 1XC6A 1DXIA 3CHFA 3W86A 2FGBA 3CTTA 4ZO7A 1GOQA 3ZVIA 2V5CA 1FX6A 3CMFA 3MUCA 1X1ZA 3SEPA 4HK7A 5T8GA 3E2SA 3NSMA 2DGAA 1I60A 2EBNA 1GZJA 1XLKA 1GVYA 1KCKA 1L6WA 2NWSA 2OKOA 1Z42A 1KB3A 3TZFA 4JTIA 1OY0A 4HPGA 3LHWA 4MUPA 4XZHA 1V93A 3BLFA 4V2XA 5AHFA 1DKWA 2CBVA 1G0CA 3MP5A 2ONEA 1YEYA 4MNKA 1IWBA 3OP2A 4AD4A 3B4YA 3V18A 3GC4A 4GVIA 4B2DA 4GUJA 3T4WA 2WHKA 4QAWA 3M7WA 3PP7A 1MDLA 1SFLA 5D02A 4M1RA 1UB3A 1DJNA 1QUMA 5H8PA 4JBRA 1P0DA 2ANUA 2J47A 3LSBA 1P6CA 4MKNA 3W7LA 1O12A 4HU0A 4P7RA 4EPKA 4QQUA 2OOFA 1OG0A 1PUDA 1UPPA 2VZUA 1PJ9A 3OB8A 1VBHA 3F4DA 3H2FA 5J5RA 4BQ5A 3E9AA 5I79A 3BOFA 3WJYA 2QULA 2WNWA 2YDRA 3RR4A 3QH2A 5GJNA 2YFOA 5U4NA 3WDHA 4O10A 3ZR6A 4PUJA 4K8EA 2R82A 3VNKA 1ONRA 1UR9A 4S1FA 3BICA 3WLKX 4EKJA 4FR1A 2HISA 1XHGA 4GYFA 2P10A 1AJZA 1JAEA 3ARUA 4YTSA 3QMTA 1KV5A 4DWDA 1HGWA 1CI1A 1RCXB 1E0TA 2ZXDA 1O68A 1PV8A 5CBBA 4UZUA 4TOQA 1F8MA 3G1HA 1VQTA 4W8BA 1G1YA 1K8YA 2ISFA 1PL9A 4IQDA 2RHGA 3YPIA 2Q71A 5DMMA 4JR5A 4HU8A 1EJWC 1R85A 1GG1A 1HKIA 1TA3B 2OLHA 3QHOA 2INEA 5C9RA 3WMSA 2YLLA 1NF0A 1YNQA 4WEVX 1G9HA 1HUVA 2WHMA 2B7PA 4C1LA 1GG0A 3N9KA 3GE7A 1W5NA 2WZEA 4LVDA 1EEPA 3CMJA 1MEHA 4H2HA 3BW3A 5HUPA 3MVIA 3EWWA 4ZB0A 3W7JA 4IMFA 3DN5A 1MUCA 4D8LA 4LUTB 3IJ7A 3K46A 3NUKA 1MXSA 4MB3A 4FXFA 4JFVA 4O19A 4H01A 4DLFA 3VD7A 2ZX5A 4GI9A 1UKTA 2VEMA 1XFBA 1NP2A 1SO5A 1GVRA 4BF7A 3EWBX 1OD8A 1UZ1A 3POCA 3CAVA 3VNLA 1YPFA 3R8RA 1H4PA 4C7DA 5DLCA 3CS2A 1OYAA 1UR2A 3TYDA 4RZ4A 4ILSA 1VLWA 1EYWA 4AH7A 2RJHA 2VEPA 4GVFA 1QATA 3C2EA 1KXVA 4MY8A 4BK9A 1JZ7A 3BC9A 1B57A 2F6KA 2WCGA 3NZGA 3GYCA 1Z41A 2ISSA 4WF7A 2DEPA 4Z2IA 3N1AA 1H49A 4H6EA 4HU3A 1CXLA 4TX6A 2HMCA 2YYUA 3MB9A 4IJCA 3DYMA 3GUGA 2CFFA 1KRBC 1KFEA 2W62A 4O4WA 4EOUA 4DUVA 2A5HA 3G2GA 3OBAA 1HP5A 2Q09A 3FS2A 1FDYA 8CGTA 1PZ1A 2CZEA 2HE5A 4PCSA 2XH4A 4Q7IA 2NV9A 4H7CA 5AYBA 2OJPA 5CZ0A 4ZTXA 2QXWA 4N4QA 1A5AA 4BI7A 4KRZA 2Q3OA 1EX1A 2RDTA 4B5TA 1X1NA 4DNHA 4AVNA 1W1ZA 1BXCA 1NTHA 1TPDA 1BD0A 4PMRA 4QITA 3LNMA 2XHYA 1NJJA 3O0KA 1I2PA 2OZTA 3W7DA 5I7GA 3IIXA 3ICJA 1UQYA 3LQGA 4H3DA 2PF0A 2F2KA 2PDYA 3RFAA 1JFXA 8XIMA 3W9ZA 1NOUA 1E56A 4C6PA 2YCLB 2G50A 3GFXA 4O1AA 2VZOA 3GKAA 3H21A 3W2KA 2C8NA 2IXUA 1JXKA 2HE8A 1FFRA 1WZAA 4X0VA 4BF9A 2I9EA 4RV8A 3CK5A 3W7EA 5BXTA 2X7VA 1A5KC 4X3ZA 5K4ZA 1RHCA 4JOMA 1G69A 2XSAA 5CSRA 5C54A 1MNZA 1W5QA 3GXMA 2ALDA 1NQKA 2ZA2A 1O5QA 3EXSA 4Q4RA 4F0SA 1KRAC 1D3CA 2NSOA 3C61A 2PE4A 2GVYA 5KEZA 3HQPA 3D46A 2ZX6A 3DG7A 4V15A 4NP7A 2PDIA 4Q8WA 3G6LA 3IV8A 4PL1A 2OLAA 2PDUA 4IOTA 4IP4A 3UW6A 1DIEA 2V5DA 3M0JA 3W26A 4ACZA 1H5VA 1VFLA 3TN5A 3PJWA 3CT7A 2WMIA 5HUOA 3CLWA 3MYOA 1KM5A 3UWQA 5HR7A 2J8FA 4IIHA 3RHGA 1ALDA 4CU6A 1LP6A 3EDDA 4A6GA 3PS7A 1I8JA 2Y70A 3OTRA 4LYQA 2PGWA 1W1YA 3GU9A 3OZYA 1ONWA 2OWXA 4P8XA 1IEVA 4X2RA 2J9ZA 1JCYA 1F4AA 1J96A 3AYSA 2JIWA 4GIRA 1KCLA 1B3YA 3Q58A 1UH2A 3PUGA 3UY7A 2FB3A 4F2BA 1TQXA 4KWUA 1TV2A 3GZAA 4GI6A 2XVLA 2J13A 2NXIA 2PU0A 1GTEA 4AEOA 2BOEX 3N4EA 2NQJA 1TRDA 3NPXA 4MNLA 3HM7A 3KHJA 2WZTA 5E6ZA 4CEXC 2ZVIA 3G1SA 3V4BA 1F3EA 4KF1A 1PCKA 3VIFA 2BFGA 4H9XA 3NPUA 3IARA 3R5EA 2Z29A 2P76A 4Q4SA 1Q7MA 1PSCA 4OUIA 4UOZA 5BXSA 2ESCA 3NM3A 1DIOA 4ZQRA 4W5UA 1KKRA 3XISA 2Z6IA 4JNYA 4C6BA 2GPTA 4H9YA 4DEFA 1M7OA 3AMLA 5C9XA 4Y8EA 3RDKA 4OHQA 3RCNA 2VUYA 1TX0A 4J1OA 3LZ5A 1XKJA 3V35A 1JYXA 1SJDA 3VYLA 4E8CA 2OZ0A 3B0PA 3R0KA 2GVLA 4G7FA 5A2BA 3FAWA 2NQLA 3WQ4A 3E3HA 4FLQA 2IQ0A 4AZHA 1UD2A 5CCZA 1QOQA 3GHTA 1QOXA 3RILA 1DQUA 2ZXBA 4K6AA 4Q8TA 1AFSA 3TC3A 3MV11 3VKJA 1C9WA 1DBTA 3II1A 3ZLHA 2OWWA 2YYTA 2A0NA 3T0AA 3Q4DA 4E5TA 1V02E 1OT2A 2Y88A 1PO9A 1WKEA 4JTGA 1E1FA 3U7BA 2IKHA 2C71A 4H04A 4HA4A 3B40A 1VJZA 1Y5VA 3OHMB 5I06A 4QS6A 5CC6A 4KW2A 4UNIA 1GJWA 4DUXA 1QHOA 3UZWA 4NJKA 3RU8X 2CZDA 4YCOA 3N6JA 3E2QA 2CLEA 3UJSA 2OEKA 4C6QA 4XZMX 2FLIA 3BSHA 3E0LA 4ML4A 3VKDA 5GNYA 1UUMA 2OZ3A 1SYTA 2RDWA 2X0HA 3UZ5A 1W2PA 1RQBA 2HCVA 3TCEA 3TDFA 2YXGA 1X1OA 4ZFMA 3HG4A 6CGTA 1RXOB 1V3HA 4JCMA 1JPIA 4GX8A 2WZIA 2BDQA 3CWOX 2DY3A 1FVPA 2XN1A 1J0IA 1VRDA 4DWSC 3OGSA 1MQPA 3T09A 3DFNA 2VFEA 4J35A 3WLSA 2OTDA 3C56A 4NI3A 4UMCA 4PFHA 1OYBA 5E1QA 3S5NA 1TPUA 3EOLA 1I1XA 5DX7A 5F4SA 1DYSA 1CIUA 3ZR5A 1S5VA 3UWVA 4IGSA 4RZ5A 2IPFA 4WOZA 3IRDA 3NEHA 1R3QA 2WWDA 3EMCA 3DHUA 2E67A 2Z1SA 3QW4B 4QJ4B 3MDUA 3ES7A 4RK8A 5MKGA 4FNUA 1JD7A 3H4WA 1JR1A 2B7OA 1F2JA 3O05A 3PPHA 5D8ZA 4J3VA 4J3SA 4H8NA 3K4WA 2YDQA 3UR2A 3QTPA 4YL2A 1BPLB 2IXVA 3FFSA 1XLEA 1VZWA 3KP1A 3H26A 4HSOA 2INZA 1FWSA 1XISA 4P5UA 1W9XA 4BKNA 1IWAA 4HCLA 3T81A 2OKTA 2W6RA 1IV8A 1NIUA 3OEXA 3W7PA 4GIAA 2FDSA 6XIMA 3ECQA 3QVQA 4ATWA 1T40A 2J27A 2QF8A 4UC5A 4C6LA 3GLCA 6PTDA 2L5HA 1GW9A 1XYCA 3ZT7A 3KXQA 1NY1A 2CLLA 1X98A 3GTFA 2E28A 4O1EA 4DB7A 4H6RA 4JFSA 3FXYA 2B0MA 5EFDA 2GJPA 4DO5A 4IG2B 3OA3A 3HQ1A 4Q4OA 4GUFA 3NA8A 2G3IA 3TQ0A 1HGYA 1RCQA 4G8TA 4J3UA 1FWWA 3V0SA 1U1JA 1BWVA 3HQOA 3PM6A 1VFHA 1FDJA 1E6QM 2E5CA 5XINA 3F4NA 3ANVA 5HMEA 1F5ZA 4OKDA 4FLRA 2VQTA 4NRSA 4GINA 2OT1A 3CT2A 3QPEA 3WLMA 2FQIA 4GY7A 3UYIA 2E9BA 3GVRA 3T1GA 3VKCA 2XVPA 1W6TA 2O9PA 1HKJA 3F2CA 2ZRXA 4BI6A 2DZAA 4H4IA 5D9OA 3GG8A 1EP3A 1OT1A 1V6WA 5M1TA 3AYVA 4UQDA 1JQVA 3H53A 2G95A 3HV9A 1FP9A 3NZRA 3AO0A 1RD5A 2ZUVA 4EF9A 3S9ZA 1W56A 4DJDA 2G4FA 5D37A 1KRMA 3RUBL 1XGZA 4HT3A 4X0NA 1WUFA 2QIIA 3KDOA 4N6FA 4UOJA 1TTQA 2WCSA 3KEHA 4DLMA 3N9RA 4MYAA 3S1XA 4A8RA 1RJRA 3VNMA 4Z1CA 4XTIA 5D38A 7ENLA 2CC0A 3W7OA 4TMCA 3OLDA 2QUMA 3G8EA 1N7KA 1UKQA 1DQWA 3DUGA 1S3HA 4F0LA 4UNKA 1O6IA 5HWNA 1RALA 4KWWA 4F4RA 5FA5A 3VIOA 2HZGA 4I6VA 2WZHA 1LQ0A 3FVDA 3MHGA 4CN1A 2BHZA 1IT8A 4WUIA 3UJFA 3CTLA 4DVOA 1Z69A 3ENLA 3PK7A 4R53A 3SCPA 1D8WA 1GYNA 4LW7A 1PXGA 1QO5A 3SRDA 3BMXA 4N9CA 2PWEA 4TV5A 1CEOA 1HKKA 1FP8A 4NKCA 3VU2A 3NZPA 3F2BA 2UBPC 2W92A 2CERA 3FGCA 3EB4A 1XJBA 3W7GA 4CN4A 1IT7A 1EXBA 4DRSA 5CH9A 1OCNA 4B3LA 3H7UA 4GZ7A 2Y5EA 4GKTA 3WF2A 3TTEA 4Z2LA 2FPYA 1JL8A 3QV8A 3MKCA 1J6OA 4CU8A 3GO2A 1K8XA 3P0XA 3N2CA 4K68A 3UR5A 3EB2A 4WDXA 2FKPA 1M9HA 1NDWA 1BYCA 1P6BA 3ZT6A 2PMQA 3TTOA 2VFFA 1A50A 4FLOA 3NQBA 2PDHA 1FXPA 3BK0A 4I9TA 5CPOA 1QBBA 1JULA 3NVTA 2WV8A 1HJWA 1FHUA 1VC4A 1QI2A 2PD5A 1UC5A 1WUEA 4REQA 3QYQA 4I8YA 3RLGA 1E5JA 1WZKA 5DY2A 4GA8A 1JPDX 2AQVA 4NZCA 3PZNA 3B06A 2XM2A 5A6JA 1QPKA 4M6UA 2VC6A 4HA3A 1ZPTA 2QW5A 1XLGA 2FHFA 2KX9A 3AC0A 2BODX 3B0XA 2CBJA 4M7TA 1U30A 3CAQA 1S2CA 4PSRA 1B4KA 2VHLA 1VB9A 4ZXOA 4S38A 4IMEA 4LCRA 3WNLA 1WE5A 2DZXA 2WOQA 3U5YA 4C7FA 1P43A 4HNOA 5C70A 3VO0A 1I75A 4HBKA 1V6VA 1E70M 3FKRA 3LPPA 3RPMA 1SZRA 3UWWA 1J5TA 2ZE0A 3TV8A 2QVNA 4N02A 4S39A 3M5XA 4LC8A 4L4OA 4HTYA 1IEXA 4JTLA 1X7FA 3PG9A 1ITCA 9XIAA 4RNFA 3P67A 1FUYA 3AWNA 4AWUA 3V16A 3SUSA 3ZJ6A 5EFFA 4D2JA 5ABTA 3SIZA 2EG8A 4N9DA 4ACZB 2VDIA 3AIQA 3VOFA 2IKGA 1FWHC 2VCBA 2WMIB 3K4DA 2ZZ4A 4EAMA 4IFKA 3I10A 4GMEA 3GHUA 5G2WA 3M07A 4HP5A 4QSHA 2EJ1A 4J28A 3W7KA 2UY5A 4YTTA 4PTXA 2JKPA 4E3TA 5HMDA 1MXGA 1CLVA 3HQNA 4O0QA 7PTDA 3AMKA 1CDGA 2WKLA 2D2GA 3CUHA 2J74A 1OCBA 2A2IA 5DF0A 4DELA 1EDGA 1KWGA 1Y7VA 4LAKA 5DMYA 5A5WA 3B8TA 1Q4WA 4XQ6A 1U2YA 2PLMA 4EK7A 4HOZA 2WANA 1ZBCA 3BANA 4B4HA 1AW5A 1Z44A 4W7VA 3UPBA 2HTMA 3R94A 3EKZA 1LOQA 5CPSA 5A8QA 4I7VA 1SZEA 5CAHA 1H1NA 3SY1A 4US6A 4PTWA 4J3TA 2WCAA 3G3DA 3NL5A 3TA6A 4JTTA 4XBJA 3ABXA 5DQPA 3CHCA 1BRLA 3MUAA 4YCPA 2QCHA 4KCTA 1AUSL 4DPQA 4AWEA 4ES4A 1ZNNA 1GOKA 2PDCA 5I2UA 2DZUA 4CQBA 2Y5JA 3ARZA 1FCBA 1DXEA 5K3VA 3A9BA 3DX5A 1TVPA 4Z2GA 1IT0A 1UJPA 3LI1A 4HTBA 4R7JA 4KFNA 1HX0A 2BB0A 2VFDA 3IK4A 2HROA 4CQ8A 3ID7A 3BV4A 1VF8A 2CCRA 1FRBA 3CIVA 4AIBA 1K9DA 4JTCA 3TJ4A 2DZPA 3FSTA 7XIMA 3SJ3A 1K4GA 3UG3A 3M0IA 3WF3A 3LG3A 4JEJA 2INFA 2QCCA 3QRHA 1ZHAA 1S3TC 1O5XA 2YSWA 3E0VA 3BO9A 1B3OA 6TAAA 3E38A 1CXIA 1KM3A 3VDHA 4OBRA 2H9AA 2QGYA 3BAYA 3E96A 3NQGA 5TBOA 4O1BA 2YX0A 3OQ8A 2RKXA 2VX6A 2R94A 2HDJA 1TIWA 3B9OA 1W3JA 5CG0A 3LU2A 2IQTA 2BHYA 3C2OA 2VVSA 3B3DA 5EBAA 2XH7A 4EP8C 1ELSA 3ARTA 3KE0A 3H7VA 2FVLA 3Q65A 3WQOA 2EPHA 4QEHA 1SMAA 2V69A 5I3FA 1OCQA 3ZZ1A 3WEZA 1IIHA 3W28A 4MAZA 3SCQA 3WFLA 4O1CA 1S38A 3LCXA 3A4WA 5I5RA 1ECEA 3NXFA 2CZ5A 5EMKA 4R9OA 3U48A 4AX6A 2AOSA 4HVXA 1R9XA 1XIDA 7REQA 1KR1A 5DT5A 4TTUA 2O92A 4JIEA 4JKKA 1GOWA 3UA3A 4AEFA 4LF2A 2E7FA 2YIHA 4FK9A 4W87A 1IZCA 1VBJA 3T7VA 3KZSA 3B8DA 5FIPA 3TQPA 1DWIM 1ZRQA 1UCWA 2HVMA 4GK8A 5FAGA 1RLCL 2C18A 2R24A 3AZRA 2EPMX 2WSQA 4Q8QA 4DZIA 4TX8A 3HF3A 3W6MA 4DJDD 5MKGB 4KIRA 1NQ6A 1TV8A 3QFWA 3S6DA 1L8NA 2QCDA 3BLDA 1UP0A 3G0SA 4HK6A 4LS2A 3MP4A 1QNRA 2R91A 4AXNA 5DBUA 4MPKA 1HVXA 1LLOA 3PWIA 4TUFA 2DZBA 1H51A 2CLFA 1FH8A 3TVAA 3ZJKA 2Z0IA 1V6YA 4YTUA 2A3CA 2NQ9A 3O6YX 3I6RA 2E4TA 4LPCA 1TX2A 3UNDA 5D04C 1UD4A 3JRKA 1P0NA 3LV6A 1EA9C 2C19A 2DV0A 2PRHA 4I7UA 4KGJA 1CGXA 4FXRA 4UTWC 3ARXA 3N2TA 4NUWA 4LY8A 2V81A 2AMXA 4JICA 1DTNA 4G1NA 1RD6A 3PVFA 1U83A 5BXRA 1GVQA 3F4WA 1Z32X 3QOMA 1LORA 4QRNA 1E5NA 3ANUA 3E74A 3SSZA 1WBJA 4NAFA 3L4XA 3HB9A 3FJ6A 1W54A 3NGJA 4AZCA 2PLKA 3PUDA 2ZDSA 4HYWA 2V2DA 5BRBA 3L2LA 5AYXA 5HINA 3WNPA 5HQMA 1FY6A 4V28A 1A47A 1OFPA 3MI6A 1XDLA 4MY9A 5EGRA 1G7UA 3EWXA 4JTSA 1OABA 3S1UA 4M8UA 1A5CA 2ZUSA 4YVPA 1A49A 3D3FA 1EOMA 5EKYA 4QE4A 4RL3A 3GU2A 2GQ3A 3S2CA 3W2MA 1O5RA 2FHCA 4AG0A 5DELA 1BSIA 1M1BA 3R11A 3D0CA 1RAKA 4J40A 3DYPA 4IZGA 4UMAA 3FDGA 1QWGA 2VGIA 4I9JA 3UCQA 3ITXA 4ATDA 4PTNA 2TRSA 1QPNA 3O2LA 8A3HA 4HNCA 2OPJA 3GVGA 3LRLA 1HN1A 1GZGA 2WPGA 1B90A 5JXQA 1FWEC 1K4HA 2WPBA 3SFWA 2F7FA 4BEUA 1TO3A 4XO7A 3BGAA 4LFYA 3DENA 1TREA 1FQ0A 2YDAA 3NO3A 3GHSA 1S39A 2OR2A 2DSKA 3BV7A 3FHAA 2UZ9A 4PRTA 3W81A 5HDRA 1NARA 1Q66A 2DQXA 2D22A 3SBFA 1R6WA 4GQ0A 1H41A 1Q3NA 3OZOA 3QSRA 1VKFA 3OVRA 4U10A 4CD4A 4FNQA 1HG3A 4D6FA 3URBA 2Y7GA 2D0FA 3GW0A 4UTHA 2POTA 3HN3A 4CQ9A 1ZBVA 3WFZA 3AICA 2CZFA 4ERAA 2CBIA 1LUCA 3WEOA 3FGCB 3GXTA 3LGGA 3QLDA 4MNJA 4LXFA 4CNSA 3F5JA 1E0UA 3OODA 5K9DA 3CUXA 5F2GA 1W9DM 2WLYA 1CECA 1N2VA 3UXIA 3NJ3A 4MFEA 2OYMA 2Z2BA 3N11A 3EKGA 2X41A 3L7RA 3W4RA 3RM4A 2BNJA 2FHBA 3OZPA 3CV6A 3R4IA 2QDDA 5AZ0A 3FKKA 5IHRA 4M19A 1R9ZA 2DJLA 4S2CA 4US5D 5C7HA 2DIJA 2PDWA 3TK7A 3IVSA 4GKLA 2FDMA 1S2TA 2NUWA 1W5PA 3N13A 3EEZA 4O50A 4DY1A 5CBJA 3EWDA 4CCZA 2VYOA 1JZ2A 4Y9AA 1MVYA 3VUPA 4LBRA 2XIBA 4MFDA 3S6OA 2NQHA 3WJXA 3SCNA 2Z4GA 4ZOAA 3TC7A 3UR7A 5DT7A 2OX4A 4IMGA 1TPVA 2DU2A 2V67A 4DXKA 1XBVA 3BLOA 2D0HA 1ZP3A 3IGXA 3NSNA 3NPVA 3VIHA 4JFTA 4O17A 1SGJA 1NWTA 3T44A 4JIQA 4Z1AA 1UZHA 2GFTA 1GQLA 3C3NA 1NM9A 1YXDA 1US2A 4M7SA 4O8AA 4E0CA 4JTEA 1FWBC 2C6QA 1A5BA 1EZWA 2VZTA 4K8GA 4M29A 4F0MA 3KUMA 4TTGA 1V51A 2OG9A 4OV4A 4HZ6A 4DN1A 3ZVHA 3KVMA 3TYZA 1KCZA 4MB4A 4MUZA 5TQLA 5BMXA 5MF5A 1XIHA 4LAZA 4MM1A 3NQFA 3NQ7A 3SCSA 1V03A 3V7PA 4Y8FA 4D8ZA 1EQPA 3JZEA 1E43A 5FOOA 1E9IA 3CZGA 1N8FA 2FFCA 3IGUA 3GNRA 3VCRA 4C5ZA 4NU7A 2QCLA 2YBUA 4PUNA 2BVWA 1DHPA 1A5OC 1EH9A 3BE7A 5AHEA 1I6NA 2HWGA 5EBUA 4L4PA 2BXZA 2DUXA 4GXPA 2ZOXA 2WVVB 1UD8A 3N2OA 4PCFA 3EX6A 3A4AA 4ADTA 4J27A 4WQ6A 4N6EA 1X6UA 1PPIA 3Q67A 2SFPA 4CNOA 2VX5A 1EBGA 4D6EA 3GQYA 3HJZA 1Y8BA 1CTNA 3VOJA 2NLIA 1NELA 2NW0A 1RQHA 3ABQA 1FXQA 5C8BB 2QAPA 2PI6A 3ONCA 2YCKX 2OZ8A 4JX4A 1MQRA 2WQDA 1OEPA 3AWOA 4DJED 2QMJA 3R79A 1R2TA 4NVTA 1ZU8A 3FCPA 3A5FA 2WMGA 3NYZA 3P14A 2WBKA 2OX1A 1BRLB 1TR1A 1GPWA 3THQA 1O4UA 3GNPA 3QV6A 1HKMA 3AMDA 1PKNA 3G1YA 4N4PA 3MWAA 2CZVA 5GNZA 3N3MA 2RJGA 3B8VA 3QGAC 1UP2A 1O5KA 1QNOA 5LA1A 4L6OA 4HOWA 3CPRA 3NDYA 4MHBA 1EIXA 4OVXA 5HQEA 1VYSX 3FJNA 2FZMA 1EJRC 1CXFA 1VEMA 5ABHA 5G1TA 1NFPA 2XVKA 3IS4A 3VINA 3DESA 2WO5A 5ABEA 2FGZA 1ESWA 2VD9A 3R12A 4E4UA 5F7UA 3T0CA 3SSJA 2ACUA 1AZ1A 4H7ZA 3H70A 3CPUA 1QBAA 4XKMA 1XWYA 1B3ZA 4Q8VA 3W7CA 2IS7A 2QJGA 3M1ZA 3L5MA 2GJRA 1XYZA 3LGDA 3IK2A 2H9AB 4IP5A 3WNMA 4QJ3B 2J7BA 5I03A 2E8YA 2D2HA 4O0KA 1GZ1A 3CC1A 2G96A 3M5YA 4KCUA 3H7RA 3LY0A 2PF8A 4U28A 3DXIA 5BCAA 2G3JA 5A8PA 5C9ZA 3H8AA 4CU7A 3W74A 5E93A 1MQQA 4B5NA 4RZBA 4ZQOA 2ZDRA 4E8GA 4WX2A 1L2QA 2GSJA 4Q3MA 1AQHA 2FZ9A 4PMZA 3L0KA 3W72A 3MMUA 2B4GA 3LX9A 3CO4A 3JU2A 1J11A 1R3TA 3GR8A 3D6NA 5I77A 7TIMA 1NWSA 4PBGA 1TVNA 2WBGA 2IKIA 4UFMA 7REQB 4QLKA 5JVLA 1KBJA 2E1WA 2AAAA 1BQGA 3MT1A 2POZA 5DRIA 4G7EB 3QOKA 4X63A 4KEZA 1ICQA 3N2MA 4JQ2A 4OU1A 1E0WA 1HJSA 2HEJA 5LNVA 2E6AA 3TONA 1SW0A 4B3ZA 1MRQA 1GKRA 4LRSA 4HJWA 3WQDA 3OVPA 4ACYA 3BH4A 2X1TA 1TV3A 2WKJA 2QCDB 2H3DA 3UJRA 1OK6A 4S3FA 2PCQA 2VFHA 3DEQA 5AN7A 2W63A 2J7DA 3S42A 3HGRA 3W1PA 3GXFA 3KVJA 5EY5A 2W66A 2V5BA 3W02A 2Y63A 1TCDA 2VX7A 3PULA 2WHJA 3OA5A 1B9BA 3R7MA 5D32A 4R7OA 4AVFA 3IJQA 3TYEA 2I5GA 4PUKA 1MRAA 3MMDA 4YVVA 3VIKA 3VIGA 1TJPA 2PDMA 5BZAA 1J93A 1I2NA 1KXTA 2QF7A 3GBDA 3KRZA 1ZENA 2Z27A 4GQGA 3HMJG 1EFZA 1V5XA 1P1MA 3DDMA 3ITCA 2WAGA 3W7HA 4GNKB 3A5VA 3QF0A 2GUUA 4XSMA 4NAFB 3AJXA 5CQ1A 1E1CA 1TZ7A 4GISA 4AZCB 5D2TA 2WHLA 4JY9A 1WAWA 2GGEA 2ZUWA 4C6FA 3TLQA 2WMFA 1KBBA 2PSNA 3CZLA 3T9PA 1GQIA 1W3NA 3PF3A 4KGLA 3TNOA 3WK1A 3SY5A 1HF6A 1S5WA 3QXBA 1EQCA 4MWAA 1PIFA 2V5LA 2PWUA 4A2SA 3MU7A 4JEQA 2PU1A 1JNDA 4LB3A 3NCOA 1UD6A 2ZRUA 3AUJA 2GL5A 1BFNA 2PS2A 2OLSA 3G1XA 1HL9A 1DPMA 1XGEA 2YZ5A 3N19B 3DBNA 3I7RA 1FCVA 3WIJA 4HNNA 3AIRA 1JI2A 4MLJA 3CAWA 2ACSA 5A6BA 2WMHA 2XG9A 4BCEA 1Q7QA 3SURA 3KRBA 4BA0A 2YR1A 1R9YA 1X39A 3HG5A 1GPFA 3WBYA 4YVXA 3TJIA 4C6KA 4H6QA 3E5PA 2AGKA 4FX6M 3GDRA 2Y4SA 3EDKA 4BI5A 2ZA3A 1W3KA 4X9SA 2R1NA 3TA9A 4LC6A 4P2VA 1QW8A 3UZXA 3AIEA 4RXFA 5AVHA 2PP1A 3W38A 4ALDA 4YWSA 2I5IA 3N6QA 4UUIA 4ZVJA 3E0IA 3LXBA 4UQ9A 4FX7A 3MWCA 1QWKA 5G1YA 4FNSA 4K37A 3HTWA 2GJNA 5LIKX 1D7FA 4JQAA 1RPXA 2XIIA 2AKMA 4D9PA 1V4YA 5A95A 1A3XA 2QCMA 1VLIA 4EAYA 4L61A 4JTFA 1TJ0A 1OK4A 3U9IA 1XI3A 1LUCB 5T9BG 3WCZA 1VAHA 4OZOA 3VAVA 4GCXA 4HMCA 3LSCA 4JDBA 3TC6A 4AW7A 4RDVA 1FWGC 1RSCA 2JEPA 3RITA 3L5AA 2PBGA 1V3LA 4QCEA 5D2YA 3BVJA 3GC2A 2PGEA 4GZEA 1UKOA 4C1NB 3N29A 4FOKA 3M47A 4U5IA 4UQEA 4EE9A 3OU8A 3PWGA 1A53A 3STPA 1XG4A 4O57A 1HTIA 3ARVA 1EC8A 2YLAA 4GLEA 4DJDC 1MW3A 3EDJA 3O7UA 4MSSA 1XYAA 3H2AA 1Q7ZA 3P5ZA 2YZRA 1QI5A 1TMLA 3BAJA 4NZ4A 3TW7A 5JIWA 2NUXA 5AHMA 2WJZA 2H90A 3IJDA 3NQCA 4C60A 1NFGA 2I7GA 3LV5A 4BS0A 4CQDA 5M17A 1UD5A 3LI0A 3SR7A 2OB3A 4DO7A 4WK9A 5IDZA 5LNWA 2YFNA 2A3EA 3S3GA 2ZX7A 5CEWA 3W2LA 1IF2A 5LNSA 2QDEA 2J75A 5D2WA 5TF0A 4HK5A 5IRPA 1R47A 3TEVA 1UMYA 3SCVA 1GGOA 4QAIA 1CLKA 3C0LA 3R1ZA 1RP8A 3CAKA 5A8NA 3D47A 3WH6A 3G6MA 1VBRA 1OC7A 1NWRA 1H3GA 1E55A 1JZ5A 4FHAA 3D5HA 3NEVA 1VYRA 3AXIA 2Y61A 4GQBA 4WSJA 3LHTA 4V33A 1VCFA 2PTXA 1H1ZA 3NQMA 3C0SA 4KH2A 5F1VA 4QGCA 3ZVHB 3AISA 3LYEA 1U1UA 3WUFA 2V3GA 3MZNA 1BWKA 4B15A 4E2DA 3R43A 2XN2A 1E9YB 4CD8A 2CXEA 1CENA 1OYCA 1TKKA 3PUOA 3WBEA 3MJYA 4TVUA 3B8UA 3UQNA 2V63A 1RZMA 1KM6A 1MSSA 1UPMB 1RK5A 1KM0A 1KQYA 1M41A 4JL1A 1ZAHA 1FKWA 4ERIA 3I3DA 4Q8PA 4ORIA 2BGQA 3H2EA 4MKVA 1KW1A 2RGLA 3QV9A 1LT8A 4NJHA 3MUXA 4F2UA 1OFRA 3K8MA 1PVNA 4R3UA 3BJFA 3E1F1 2CLHA 3HFTA 1LF1A 2G3NA 1V3KA 4S23A 4DJFA 3DERA 5LIXX 3A13A 1ME8A 2XH2A 1TA3A 2YCEA 2H3BA 1YNYA 3WENA 2EO7A 3QPYA 4YHGA 3AXMA 4QCFA 1H1YA 2ISDA 1JRBA 3SJNA 3L9CA 2OFJA 2VRQA 3M6DA 3PPFA 5E5CA 3E12A 1XIBA 2DT2A 2GWNA 4IM4A 2J6XA 2XGIA 1R8LA 3NPWA 4LUTA 1EOKA 2J8TA 4GD0A 4Z2HA 3RR1A 2LLEA 3NQ2A 3O07A 4DM1A 5CPNA 3GH7A 2Z28A 2ZTKA 2F9RA 3E2VA 3H55A 2KZHA 3DCPA 3SCUA 3BL3A 5A6KA 4PB3A 5XIMA 5FF0A 3VDCA 4U31A 3A24A 4RKAA 2DPEA 1PTGA 3CV2A 3G5EA 4UTMA 1H7RA 2V8ZA 3O1NA 3PN8A 2P50A 4JTDA 4AC7C 1W1VA 4J5NA 3RX2A 2GDVA 1BEUA 2HNEA 4D72A 4PA8A 1XLBA 2P8CA 2QYGA 3UZZA 3JUGA 3L2IA 3O63A 5FEWA 4Q8OA 3W1XA 1IEQA 1DJGA 1V3IA 1GYMA 1CWYA 4JTHA 2ACRA 2OO6A 4YPJA 2NVCA 2QJJA 4QSFA 1CYGA 5FESA 3S0CA 2YL6A 4GVGA 2BOGX 2P0IA 1P6WA 1UH3A 3WF0A 4NYYA 2ISWA 3ITVA 3E5BA 1XQKA 1YDVA 1M3UA 3O8AA 4XAPA 3EOOA 4PMDA 1V0MA 3WL0A 4GUGA 3V3WA 2V3DA 2J25A 2DORA 3QZEA 4J3XA 2AQOA 3N4FA 2VCCA 4JCLA 5CLWA 1VFMA 3MW7A 1VPQA 3WQGA 4EPEC 1KBLA 5AB3A 1DWJM 4NZ5A 5EMLA 3W70A 1CGYA 1FTXA 1TR9A 4L4LA 3IIPA 4NZ3A 5HWMA 1KV8A 2WC4A 4WHBA 5G4EA 5KZDA 1RBAA 1QI4A 4TXEA 2YCLA 3CL8A 2J4GA 3ZWTA 3A47A 2E6YA 3BURA 2F84A 4J3WA 1A3HA 3USBA 3MTWA 4FS9A 4MYXA 3WLIA 4H41A 2YL5A 3VDBA 4GYKA 5TAOA 1DWAM 3UZJA 2VQUA 5HMSA 3RK8A 2OYKA 3TTSA 4AAJA 2X30A 4IGHA 1ZJBA 1ZUAX 1QDSA 5I00A 1UA3A 3VD4A 4QNEA 4PZVA 1DEDA 1UROA 2QUVA 2A3HA 1JJKA 1EPXA 3IEBA 3T08A 3VCCA 1JPKA 2GJLA 1KXQA 4RX0A 3APGA 5K7JA 5LGZA 1Y5WA 2JBMA 5A6BD 2WC7A 3WLRA 4KKXA 3O3RA 1EJXC 2PZNA 1ZSXA 3HMCA 3FW6A 3NQDA 4MZYA 4HQVA 2GJXA 1K9TA 4TO8A 4UTTA 2XTKA 1QO2A 1IGWA 3GK0A 3TOPA 1OX4A 4INFA 1VH7A 1G4SA 3WNKA 1T41A 1OFEA 2Y2WA 1M68A 1E9ZB 1MZRA 5FKYA 4F9DA 1W32A 4W84A 4J4KA 4JKMA 4GG9A 2DDXA 4DYEA 2OMAA 1EWDA 4JHOA 4WKAA 5A3HA 2R9RA 1JXJA 3QTGA 4H9ZA 1ZBWA 1PZ2A 3UZYA 4PCTA 1LOLA 3IJIA 4B5SA 3A6OA 1JDAA 4NJJA 2B31A 1AMYA 1US3A 4E2OA 4GO9A 4K39A 1WBHA 5LIYX 5AHNA 4DJEC 3KZPA 1H62A 3AI0A 4NASA 5T91A 4ML9A 3CHEA 3FX4A 3WDIA 5E70A 1GHSA 1PZ3A 3VKKA 2XVNA 3C3UA 4ENLA 1UC4A 1M6JA 3LBMA 2NUYA 4MWAB 1R7AA 1BHGA 3TW9A 3BAKA 3WK2A 4O15A 2G41A 4N0RA 3AJ7A 4Z08A 1JUKA 3KHDA 3PBUA 3T0BA 4CCCA 6REQA 2NVAA 2VR4A 4Y9NA 5HPCA 5EB8A 1OINA 3SGUA 2O4QA 2V3EA 1XD1A 3V0UA 2KAUC 1ZAIA 2GZXA 4DX3A 1E4NA 5CJMA 2O0TA 4F9JA 1K7EA 4Q4KA 1XGDA 2XWEA 3WJZA 1YTKA 3DGBA 3OG3A 1SVDA 3MMWA 4PC8A 1UJQA 2YA0A 2WSKA 1BYAA 1UZ4A 3CZJA 1VFSA 3EPMA 4HA1A 3GNDA 2PWDA 5CLTA 4GYJA 2DIEA 2OXNA 3LGEA 3PTQA 4IUOA 4WVXA 4F48A 1QHPA 1T0OA 1WO2A 1VRXA 3M0ZA 1SUXA 1JF5A 1F7BA 2A7RA 3QHMA 3PG8A 5C5YA 2VT0A 4O8RA 1XP3A 1R30A 3PZTA 2C16A 3DU0A 1TWZA 2HNHA 4DNMA 3GHRA 3Q37A 4UB9A 4XD3A 1SJAA 4GNVA 1ZY9A 2B7NA 3R89A 3W01A 4MB5A 1E73M 4UCFA 2Y0FA 1NH6A 2QV5A 3NTYA 1EGZA 4NY2A 3KL3A 4AWTA 3M5ZA 3HV8A 4XG1A 2JE8A 3AALA 4HZ7A 2BSLA 3LOTA 1DORA 3B8IA 4YN5A 4ZE4A 2OQHA 1Z6KA 3SZ8A 2W27A 3C4UA 1ITQA 1XW8A 1L6GA 1XUZA 3W1MA 1I0DA 3UG4A 3LPOA 4DXVA 3U6WA 3GFZA 1XUUA 4IX2A 3SRKA 4QHRA 4IIDA 6ALDA 3NVDA 4A22A 3IJLA 3T2OA 2PTYA 1P48A 4NI8A 1AMKA 3AMCA 4AZBA 1VIZA 3PBWA 4AZGA 2DQWA 1PX4A 3GNXA 1R3VA 4TV6A 3RPDA 5B7YA 1OG6A 1KTCA 3S5SA 9XIMA 3BLIA 3BSMA 5FACA 1YE4A 1EGVA 3E0WA 5E9XA 5C71A 1YDNA 4GC4A 3DHPA 4R85A 3W29A 2HXTA 2HVNA 4UR8A 3AHZA 3B05A 4DBUA 4AHQA 1ADOA 2HPIA 3WO8A 1T8XA 2QGHA 4W7WA 3ABSA 4UFIA 2OU4A 5IXEA 2Z7GA 3SUWA 1XS2A 3L4TA 4LVBA 3BZGA 1ZL1A 3JS3A 3PAOA 3O16A 3NL2A 1R2SA 4DZ5A 3JVAA 3WZ0E 3MKVA 4IPNB 4JTUA 4LCSA 5F1UA 7ODCA 3WJSA 2ZRZA 4GOAA 3DYOA 4OBSA 1SO6A 4OGZA 3V75A 2YDSA 1XIIA 3MHUA 3T05A 4LV4A 1H7WA 4TX9A 4Z1BA 1YXCA 1W8SA 4HD5A 2ZC1A 4JNZA 1QT1A 2ZKMX 1D7KA 1A5NC 3CO8A 2FPVA 3TFCA 3P5YA 3UERA 4O52A 3QN3A 2OELA 1S46A 3HO8A 2GVGA 5CZKA 4IG2A 1IZKA 1X6LA 1MDRA 3VOHA 1LM1A 4GVHA 3WH5A 4A29A 4AMAA 3B9DA 3VILA 1XPGA 4E38A 1GJPA 5D2XA 4GPNA 2HS6A 1EHNA 4B5UA 3CL7A 4CKQA 3LEPA 5AZ1A 4RNJA 1TTIA 2BTMA 3PB0A 3W6LA 4U2ZA 1X8CA 2O56A 1RV8A 2J7CA 3AXKA 1QW7A 5GVJA 4I8DA 2JKEA 1FA2A 4IFRA 3CUGA 2Y7EA 4KFOA 3VX1A 4GCAA 1E6XM 3JZUA 3EX2A 3WFAA 4HCHA 2OSWA 2PRLA 5EA9A 4WY0B 3FA5A 4UFKA 1SR0A 3CZEA 5JMUA 1R0MA 1P1XA 4A8IA 1XBZA 1LQ2A 1AD1A 1XBYA 1QFEA 2X2YA 4DBWA 4IXHA 3P2VA 1JIBA 1S2VA 3IIOA 4UWMA 3WQFA 4F0HA 4KEVA 4XZIA 3KCLA 4J9JA 3O0FA 3WQWA 4LUSA 4LCQA 3G1DA 5D4YA 3LTYA 2TPSA 1BTMA 3EXRA 3GNNA 1QPOA 1CNVA 2VDHA 3WLHA 4AIOA 4Q8MA 1ZJHA 3KWXA 1VHCA 4PTVA 2BY1A 3ITGA 1AK5A 5H1WA 3TAOA 4DZHA 5M03A 2FTPA 3BQ5A 1BTCA 4I5UA 3EOEA 4UMBA 1KFBA 2QUUA 3FYYA 3C86A 1LL4A 4IWWA 4LAMA 3JW7A 4IHCA 2CLOA 1UWAA 5DCBA 1Q6GA 5ABFB 3MVTA 3CUJA 2ZZ3A 3IGHX 2QDGA 3AOFA 4JTRA 5C55A 4MZ1A 4DQWA 4XIMA 3W7IA 3LENA 3KOXA 4Q22A 4FOJA 1AH0A 2VOMA 3FDKA 4W89A 4CQCA 1MWOA 3BOLA 5AC5A 1A5LC 4GH1A 3TYBA 2TAAA 1GVFA 1BKHA 4LUYA 2NX1A 1DOSA 4JKLA 1C8VA 3CQHA 3W00A 3PZIA 4PBFA 1Q13A 4FI4A 3I65A 3DKJA 1GCYA 1TPWA 3AAMA 1GVEA 3BJSA 3W76A 4GIEA 3DFQA 2HPMA 3TOYA 4DBEA 4GX9A 3NWRA 2PA6A 1F3XA 3UJ2A 3QQWA 1BVNP 3S5OA 4AYSA 3K5XA 4FF5A 5BMWA 1BQCA 4N9EA 4W85A 1ME9A 3GTNA 3NZQA 2J88A 2WNQA 1OFBA 1LTDA 2FGLA 2Q8ZA 3CUIA 5F4WA 4PMQA 3VA8A 4A3HA 2W3ZA 3W1LA 1HXJA 3V5FA 2AGTA 2FZDA 1CB7B 4LWWA 1TUFA 2W9MA 1V0LA 4HA0A 1HO4A 2BASA 3ITLA 1FH9A 1FDZA 4IMCA 3IANA 1XLLA 2VD8A 5FJTA 2QIWA 4HIBA 4XTDA 3IVUA 2VGGA 3VOCA 4PMOA 3N25A 1IQ8A 1VCVA 1A3WA 3CUFA 1NF7A 3UPWA 4EPBC 4DBSA 1JVNA 2PWHA 3VZYA 2CHNA 3UXAA 1RY0A 1CT5A 3GH4A 3ZJ8A 2PC4A 4AXKA 1AH4A 4Q33A 2VM8A 3QR3A 1K77A 2JGYA 3S4TA 2YW4A 3KVKA 1YW1A 3PTMA 1B2YA 3GTHA 3CUZA 3A4XA 1CX9A 5G4HC 3UD6A 2JALA 1VD6A 4GZJA 4MADA 2V2HA 3BAIA 3P6LA 1UWQA 3ITTA 3VGBA 4M3PA 3UETA 2IKJA 2GJXB 4Q6XA 1OGGA 2C0AA 3G24A 4HHHA 4FXSA 1OX4B 4KIEA 3N73A 2W0UA 5C6MA 4FZIA 4XZWA 3VOGA 3W07A 2YXXA 2XFWA 1JF6A 1XC4A 1KKOA 1UBSA 5CZSA 3IJ8A 1TPC1 1P7TB 4UFHA 5F2LA 2ZQ0A 1GNXA 3L4ZA 3CJPA 3EA2A 2XVGA 3JR2A 1E4MM 4K1WA 4GH3A 1OSEA 4JHZA 1W9BM 2DSWA 2V82A 2G8ZA 4G5DA 3BG5A 4Q8NA 2PC8A 3HGJA 3GRIA 1EWEA 1FWJC 1RY8A 2WMJA 5A2CA 4DI8A 3PZUA 3EWUA 1SR9A 4QE1A 4JTAA 1TZZA 3AXXA 3T0DA 2Z24A 5J04A 3PZQA 4KESA 5IDIA 3W87A 1QNVA 1K1DA 1XRVA 1ADDA 5TNVA 3QQ1A 4AZ5A 2C14A 2RFGA 1AL7A 2EXOA 4B92A 1BG9A 5HJXA 2QEZA 1P0BA 4RCXA 3WSUA 3EB3A 4BF5A 3TMLA 1SSDA 1TMHA 1QNSA 2Y6ZA 2YB4A 3S5ZA 1C9DA 4IT1A 2ZUUA 3NQEA 1X96A 1JZ4A 1I2RA 4M6QA 4N9BA 4IGMA 3TSDA 3NDOA 1KR0A 5IFPA 1WDPA 4S3JA 3MJMA 2V3FA 1TJRA 5CZJA 2PDGA 2B7QA 2VEIA 3LLDA 6REQB 1NOWA 4ZGYA 4O4VA 4R5EA 3SM0A 3OLIA 1SO3A 4WR3A 3TMQA 4ZO6A 4AHOA 3K1DA 4S3CA 2CLPA 2V30A 3UNTA 3OOQA 1JDEA 4OBTA 3N18A 4PGLA 3LCFA 4N2YA 4S3GA 4HMDA 2ZE3A 5LGXA 5F2MA 2VFGA 1XKYA 3REQB 1ISZA 3PNZA 5TD4A 4M82A 4U5KA 3BMVA 3ZR4A 1NEYA 4MY1A 4Q6JA 2UV8G 4XUYA 4D6IA 4MF4A 2GDUA 4KRTA 1FBAA 2CHOA 4B2DD 1B3VA 3LTSA 2WJFA 1WZLA 1M01A 3B4UA 3M0KA 5RUBA 4B90A 2VZSA 3GM8A 4QS5A 4WSHA 1ZALA 1ONEA 2WVSA 1XH2A 1T99A 1XLDA 3IWPA 1G6CA 2XPKA 3EAUA 1XQLA 1R38A 1QMLA 3P80A 4PBEA 1PDZA 4CNPA 1MMFA 3SRFA 4UQBA 1V6XA 3R13A 4C6MA 2WWCA 5AC6A 1OM0A 4ERGA 3H2NA 4EF8A 1DJZA 2D69A 3WF1A 4QDPA 3AHVA 4A35A 4GI8A 4K7VA 3LM7A 3M0YA 1EYEA 3EXTA 4PMNA 4NJIA 3ERPA 1KFLA 2PLCA 1LLZA 4A05A 1V3MA 7CGTA 1MW2A 5AC4A 2BBFA 1UZDA 1LBFA 2YBTA 1J2BA 1NDYA 3GAKA 3N17A 4HNVA 1PE1A 3SECA 3VGFA 2DVTA 2QCNA 4XZNX 1S5MA 1ME7A 4C5YA 1K8ZA 4I6KA 2X1RA 5BYWA 5G4WA 2DP3A 2XISA 3G0XA 3ARQA 4PMVA 3SUVA 2A6LA 3F03K 4JIHA 3DH7A 2EEXA 4AD2A 1W3TA 4I5RA 1OF8A 3URQA 2ZX9A 3DHFA 3GH5A 1IZJA 1HNYA 1QXLA 1YX1A 3RLHA 2E8ZA 3NIYA 3VIMA 5E9AA 2X8RA 5CC3A 1V7AA 1FWNA 4ZQPA 4IQLA 5K9XA 3GVVA 1LJYA 4UQCA 4KERA 3CV1A 4WKFA 1L8PA 3OVGA 1OFOA 3AHXA 1LLWA 3LCIA 4YLWA 2RGMA 3TN4A 4QG8A 5H91A 3OO2A 4LV9A 1XSJA 3GTXA 3WH9A 3HZ3A 3SAZA 1EJ7L 2OSXA 3RCMA 1CCWB 1EGMA 3H4GA 3TR2A 3UXLA 3MANA 1P5BA 3TIMA 2ABAA 1V08A 2ADAA 3UR8A 1G4PA 1EJUC 3U3HA 3C6CA 4JPGA 2WK2A 1HKVA 2BY3A 3M5VA 2XU2A 3URAA 1U1HA 3LBCA 1YQ2A 4KS0A 3GDLA 3MS8A 2Y85A 5JIPA 2VZVA 3MZ2A 3UT0A 2HXUA 4JDYA 2HBVA 2ZBTA 3EEGA 2DZSA 2WNNA 4B9YA 5TIMA 4D1IA 4JQ3A 4URIA 3P61A 3WQPA 3CQKA 3H54A 3UFYA 3MC5A 2FPTA 2YA2A 4AHPA 2E09A 1Q85A 3L68A 4MJZA 3PBGA 5GNXA 4DUWA 4MLRA 1RJPA 2NX9A 2XH0A 1M53A 3VNIA 4AEEA 2VC7A 2O9RA 3B0YA 4GJJA 1WOBA 4AB4A 3WD1A 2GGHA 3W24A 1GYLA 2FH6A 4A8LA 2UY3A 3NR0A 1H61A 3XINA 4LAUA 1Y5XA 1E15A 3ARRA 1C92A 3L2MA 3RCYA 3KBNA 1GVOA 4TIMA 3TTYA 1H50A 4XVEA 1TWWA 2Y5SA 3W3OA 1KD0A 1TPH1 3CASA 2AL1A 1HP4A 4JIRA 3GDMA 2VUNA 2A3BA 2E9MA 3L4WA 5I6SA 4YMZA 5KZMA 3M43A 1C7TA 1Z7AA 3H24A 1Q45A 3C2RA 3UEQA 3TCSA 3W2NA 2PDBA 3T55A 2BXYA 3W23A 3ISIX 2EHHA 3OW1A 4FPSA 4ECLA 2FVMA 4LANA 4D6HA 4G56A 4NAEA 3AS0A 4IJRA 4L6DA 3IJ6A 5LXEA 2BV9A 5BU9A 2X09A 5D9PA 1C93A 3PBVA 3D3AA 4CUCA 1AJ0A 3VD9A 5AKQA 5HNRA 4AISA 3KFTA 2FMOA 4LUSB 1PYMA 3GAYA 1K6AA 5EYWA 3VD5A 2AL2A 3C2FA 5FJPA 3IIVA 2PCEA 1RQEA 4H8HA 3VGEA 1NAL1 1K02A 1PZ0A 2Z1BA 3SQLA 1KFJA 2XUCA 4QROA 5CBIA 3CV7A 4WSKA 3O6DA 4CD6A 2Y7FA 2ZFAA 4BHYA 3CQ0A 1LWJA 3CQJA 1O95A 5DANA 4GZIA 4KEMA 2F38A 1BYBA 3VIPA 5DEZA 4I3GA 3PBYA 3VIIA 2P88A 2A3AA 1EXPA 1WQ5A 4EXQA 1GWJA 1PTAA 4BQ4A 2VWTA 1F3TA 1DE6A 1R3YA 1Z8AA 1EA0A 3KBVA 1EEXA 4FXJA 1XLJA 4G6CA 3KL5A 1TPFA 3R8GA 1XV8A 4GBUA 5A6SA 4NL1A 1QW9A 4ADUA 4R34A 4LY4A 5DCDA 1LBLA 1MNSA 4QDWA 4GIYA 3N15A 1WKDA 2PTZA 5AC8A 4HZ8A 3ELFA 5JBDA 5DMLA 4XSLA 3M0LA 5BOFA 4RE4A 1Q6FA 3KDNA 3RJXA 4H2CA 2WM0A 3VC6A 2D24A 2AMGA 1HZYA 2RUSA 4ZSTA 5EMUA 3OGRA 3RIKA 5JBEA 1P0KA 3SADA 4LNCA 5FI8A 4LU0A 1QU4A 3WLTA 2XDFA 1XM3A 4HNTA 2E3ZA 3BW4A 2BVYA 3FJLA 4DZAA 1DWHM 4Y9MA 1E6RA 1Z48A 2G0WA 1YPXA 1N55A 3GIPA 4MGGA 1JG9A 1WX0A 3TJXA 2BZNA 4DO4A 1XLFA 5LNUA 3WQ5A 1TPB1 2B81A 4MJ4A 3ES8A 1PWMA 3MHFA 3K4AA 3PZVA 2PDFA 3M4HA 2V0TA 2VELA 2VGFA 1VCGA 2VR2A 3RRAA 3DGRA 2VOTA 2OO0A 3V5OA 3IAQA 3LM3A 4IPIA 4ZTYA 2AKZA 2JK2A 3S2JA 1EP1A 5E09A 5A8OA 3ANYA 2X16A 2A7NA 1FWFC 2OQYA 1RK6A 1QR7A 3NM1A 4A3UA 5CGTA 4L4MA 4Q4MA 4CN6A 4DWSB 1SW3A 4NXSA 3GG0A 2VENA 4WGHA 2WB5A 1XDJA 1TZ9A 1JCLA 1R86A 3MI2A 3DKLA 3PUEA 1JZ8A 1B54A 1XIFA 1PCWA 4Y6GA 2ZZ6A 1DWGM 3O06A 4WDTA 3B9EA 3LRMA 3INPA 3EBVA 4I90A 3T0TA 3CU2A 3MPGA 3ZLGA 3G3MA 5BROA 2PDKA 3IGSA 1TWSA 3U2EA 1HO1A 2Z00A 3H4XA 1YPIA 4QR6A 5DCEA 2YBVA 2PTWA 1TV5A 1TSIA 3KAOA 3T8QA 3APTA 2BVDA 4NZFA 4CNUA 3EKLA 3KTCA 3STGA 3W71A 1PKLA 3I7SA 1GUVA 2XFFA 4JN8A 1F6KA 3B9NA 2IQDA 2QQ6A 5BW6A 3VNDA 3SFKA 3CXOA 3AUOA 5C9WA 2ICSA 4ZB5A 4I9AA 5AVNA 1VPYA 4F2TA 4DUOA 2Y62A 4LVAA 2FJKA 1BVWA 4UTWA 4HYVA 5C2GA 1G5AA 3P62A 2WVVA 4A8NA 5HNUA 1V02A 5LHEA 1EC7A 3WQ8A 5I0DA 1C91A 4Z17A 4C6IA 3EX1A 1JPMA 3DG6A 1WDRA 4PUEA 3UVAA 2DSVA 2PP0A 4BEQA 1EC9A 1AA1B 1A5MC 2J79A 2NVDA 1W17A 1V8EA 4BWLC 2WLZA 3C2YA 5HULA 3AU2A 4HPNA 4G9PA 3VMNA 1OD0A 4M56A 3W7NA 2OEJA 3ZOAA 4ORMA 2C91A 4HSHA 3OVQA 3I3BA 2QNEA 4IPLA 4NZ1A 3GS6A 4LS0A 3TW6A 3W1NA 1UASA 1SFJA 5CKSA 5LZLA 1XLCA 2CIPA 2PURA 4CCDA 1W5OA 4A3YA 2TMDA 1LROA 5IHSA 2Q6ZA 4WY0F 5E0CA 1M7JA 1DJYA 4WZHA 3H23A 3IRSA 3QMSA 1L6FA 1B30A 3STFA 1OX5A 4QISA 3QMRA 1JZ3A 2PDJA 2FB2A 1DV7A 4RDWA 2NXGA 1WKYA 1BYDA 2A79A 4L80A 3VOIA 2JF6A 4LUIA 4CCEA 4JTKA 2E25A 2ZUNA 4PUUA 4UTTC 4N7QA 1E71M 2ZADA 3K30A 3AIWA 3NQ8A 4QQ3A 4Q4PA 3HPFA 5CC7A 2QS8A 1EIBA 4W7UA 3TYUA 4MTVA 4J2MA 3CIWA 1PHWA 4NHVA 1K70A 4QG9A 3T6CA 1XCWA 1BAGA 3O6AA 4IQJA 3TR9A 1W9UA 3W0KA 3OGVA 1JCXA 3TJLA 2CLMA 3OBEA 2X1UA 2QJNA 4ICCX 6XIAA 1ONXA 3KRUA 3BUVA 2QCFA 1ZAJA 1EUAA 1ZZMA 3CM4A 4GYPC 2VX4A 3N34A 2CESA 3POHA 1UA7A 3F1QA 1WXJA 2ZA1A 1V7YA 4ATLA 3BJTA 8TIMA 3VDAA 3H6OA 4X60A 2J7EA 5LA0A 4OOUA 3ONBA 2CU0A 1PX8A 4B5VA 2PGRA 4V1XA 1W1PA 4BY3A 3L12A 1PAMA 5FEXA 2H8ZA 3C0QA 2PZ0A 1O94A 2X40A 5LNRA 1C8XA 1JCTA 1XINA 2YL8A 1BF6A 1WDQA 2XFYA 1AD4A 3GG7A 1J2WA 4OT7A 1ML1A 3WDPP 4QG6A 1EDTA 3WDJA 1JQXA 3L4YA 4AY8A 2OYLA 1GOIA 3HGOA 3ZYZA 4G7EA 1J0YA 1X97A 3HPAA 4C6CA 5AY7A 4L1WA 3I4EA 2C0HA 3PZGA 1Y0EA 4JXCA 4YU1A 2FH8A 3AHTA 2AQWA 1IGSA 2OVLA 1RUSA 2QJIA 2WXDM 1X6NA 5D8WA 3G1AA 1UUOA 2WM1A 1LCOA 4XISA 2XWDA 1E3XA 2VRJA 1A0DA 2H6RA 2HVOA 3PTDA 5HNNA 1SJBA 3E49A 3UU0A 3F4VA 2NT1A 3TSMA 2Q02A 4RV3A 3PTKA 1QJWA 1TV7A 3OJGA 1VGAA 1VHNA 4C6OA 4AIEA <