4MUPA

Crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
284
structure length
284
Chain Sequence
RKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPGGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTNWPHNSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMIDOHYDROLASE
publication title Crystal structure of Agrobacterium tumefaciens ATU3138 (EFI target 505157), apo structure
rcsb
source organism Agrobacterium fabrum
molecule tags Hydrolase
total genus 101
structure length 284
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 5.4.1.4: D-galactarolactone isomerase.
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4mupA00
2ANUA 4F0SA 1NDYA 4GY0A 3TN4A 3PANA 2VC5A 5A6TC 2Z26A 3MDWA 5FSEC 3ORWA 4IGMA 2W9MA 1DPMA 2QVNA 4C6OA 2GZXA 1FWFC 2GWGA 3GIPA 2R1LA 4CQDA 3S2MA 1O12A 5FSDC 4XD6A 1EF2A 4B92A 3LS9A 2HBXA 1I0DA 3LGGA 3PNUA 1GKQA 4I6KA 4QROA 4TQTA 2Q01A 4UB9A 4DZHA 1RAKA 3HTWA 1FWIC 3UR5A 3GU2A 2HNHA 2R1MA 4DIAA 3KM8A 3E0FA 1KCXA 1HZYA 5HMEA 2FFIA 4KEUA 1PSCA 4LAKA 4GOAA 1BF6A 3ITCA 3GTFA 4ICMA 3SFWA 2VC7A 3TN3A 4LH8A 1P1MA 3B0YA 4IH3A 1POJA 4IFKA 3CS2A 1ONXA 3R0DA 4V1XA 4R7WA 1A5KC 4DO7A 5CH9A 4C6LA 4CNSA 3E2VA 4LANA 3RYSA 2O4QA 4QSFA 1WXYA 2BGNE 5AKQA 1POKA 4G2DA 4H9ZA 3LSCA 4J5NA 3RCMA 4F0RA 4GY1A 2EG6A 2Z2AA 3URQA 2VM8A 3OODA 3E74A 3WZ0E 4DLFA 3LGDA 1J79A 4GBDA 2Z28A 4RDWA 1YBQA 4EPEC 4H9UA 2OODA 1EYWA 3E38A 3NEHA 4H9XA 4XD3A 4IG2B 2GOKA 3IV8A 4HJWA 4E3TA 2WM1A 3OU8A 4G7EB 1FKXA 2Z25A 4GY7A 4ERGA 1XRTA 1V7AA 2ADAA 4QS6A 3S2LA 4C6PA 4LFYA 4WVXA 4V1YA 1A5OC 5E5CA 3DUGA 2YXOA 3QGAC 2VR2A 4EP8C 3OQEA 4C6EA 4KESA 4HK7A 4RE0A 1RA0A 1E9YB 4BJHA 4C65A 2DVUA 4CQCA 4C6KA 1EJXC 3ICJA 2PAJA 1O5RA 2ZC1A 3B0XA 3T1GA 3MPGA 1FWJC 3IJ6A 2RAGA 4KF1A 3RN6A 3NQBA 3TN6A 1NDZA 1NDVA 4LCQA 2R1KA 2R1PA 3UBPC 1ONWA 3URBA 3E3HA 2IMRA 2Z4GA 4LAMA 4C6CA 4H9YA 3LU2A 4QRNA 2I5GA 2HQAA 3BE7A 4C5ZA 1FWBC 3MVTA 3MDUA 4GYFA 5LXXA 3UR2A 3GU9A 1GKPA 3GG7A 3WMLA 3MVIA 4WHBA 1YNYA 4KERA 4ZSTA 1WXZA 5G4HC 4R88A 4D8LA 2Z24A 1UBPC 4KETA 4IGNA 4IFKB 5HMFA 3ISIX 1RJRA 2OQLA 3LSBA 4H9TA 4C6FA 1M68A 4EPDC 4KQNA 1J5SA 4XD5A 1M65A 2Z29A 4PCPA 3SO7A 3F2BA 1FWHC 4J35A 1KRBC 4PBEA 1PB0A 2DVXA 1NFGA 1A4MA 3FDGA 3QY6A 3DCPA 3GTXA 3A3WA 2YB1A 4H00A 2AQVA 1YBQB 3URAA 1R9YA 2FTYA 4C6DA 3F2CA 4AC7C 4CNTA 4C60A 4BY3A 3HPAA 2KAUC 3S4TA 4C5YA 4LCSA 1W1IE 1V79A 3QGKC 4EPBC 3HM7A 1RJQA 3MKVA 1J6OA 3LNPA 3AU6A 1XGEA 3A4JA 3AU2A 1A5LC 4HK5A 3C86A 4XAGA 1EJRC 4P5UA 3A3XA 4NG3A 4INFA 4H9MA 4PE8A 3GRIA 3T8LA 4ZSUA 4GXWA 1M7JA 5HMDA 1KRMA 2D2HA 1ITQA 2O4MA 4C6QA 1J6PA 4DI8A 2G3FA 4RZBA 1QXLA 2QS8A 1EZ2A 4RDZA 2AMXA 2E25A 3G77A 1XWYA 4H9VA 2GWNA 1EJSC 4CQBA 3IRSA 3IGHX 4DZIA 3S2JA 1ADDA 2Q09A 4C6JA 3QY7A 1FWEC 1I0BA 1V51A 2WJFA 4Z42C 1YIXA 2PLMA 4NP7A 2Z7GA 1P6BA 2E1WA 4UBPC 3MTWA 2Z27A 4G7EA 1FWAC 3GIQA 4KIRA 3B40A 4HA0A 1UIPA 1V4YA 4LAOA 3S2NA 2UZ9A 3IARA 2WJDA 3IPWA 2OGJA 4BKNA 3O0FA 3V7PA 3GU1A 3K5XA 4JOMA 3MJMA 4XAFA 3EWCA 3EGJA 3UF9A 2PUZA 4XAZA 4CEUC 4ERIA 4LALA 2F6KA 1IE7C 4IF2A 2YB4A 4KEVA 1KRCC 3ID7A 3WYZA 4RDYA 1K1DA 2AQOA 3QY8A 3N2CA 1UIOA 4LCRA 1ITUA 2OOFA 4F0LA 3AUOA 1EJUC 4LEFA 4RDVA 4PCNA 1JGMA 1GKRA 3F2DA 1RK5A 3GTIA 2FVMA 1R9ZA 4I6VA 2P50A 2I9UA 4OFCA 1EJVC 1FKWA 1K70A 1KRAC 3OJGA 4PBFA 4C6NA 2YZ5A 4IQJA 3DC8A 1FWCC 3JZEA 3FDKA 2FVKA 1A5MC 4EPKA 4YIWA 1NDWA 2P53A 1FWDC 4L6DA 4XD4A 1EJWC 2PGRA 1P6CA 4HK6A 4IFOA 1V77A 4DLMA 2CZVA 4NI8A 4B3ZA 4CEXC 3K4WA 4KEZA 4GC3A 1PTAA 3D6NA 4H01A 3E0LA 4C6BA 2UBPC 3OOQA 3RHGA 3CAKA 3PBMA 1UMLA 1S3TC 3EWDA 4WGXA 2Z2BA 2XIOA 4CNUA 2A3LA 3PNZA 3GTHA 3GUWA 3LY0A 2R1NA 4B91A 2Z00A 3NURA 4M51A 2Y1HA 2DVTA 2FTWA 2ICSA 4R85A 3T81A 1FWGC 3IACA 2WJEA 1PO9A 1RK6A 3FEQA 2VHLA 4C6IA 1A5NC 4C6MA 2GSEA 3LA4A 1XRFA 1E9ZB 4AQLA 2HPMA 3URNA 1R9XA 1ZZMA 3PAOA 2EG7A 2QT3A 4XAYA 1YMYA 4DNMA 2D2GA 4QTGA 1YRRA 3TNBA 3TN5A 3OVGA 2EG8A 4IFRA 1VFLA 2PGFA 2QPXA 3F4CA 1K6WA 4J2MA 4L9XA 3O7UA 4GZ7A 2HBVA 1RJPA 4B90A 4DYKA 4GK8A 4IG2A 4ERAA 3MSRA 2HPIA 1EJTC 4MUPA 2OB3A 2BB0A 4GX9A 3UPMA 1QW7A 4QS5A 4GX8A 3K2GA 2VUNA 4DI9A 2D2JA 3F4DA 1A4LA 1RA5A 3CJPA
chains in the Genus database with same CATH superfamily
2EKGA 1DQUA 2CERA 3M07A 4XZIA 4OOZA 4WOQA 1DPMA 3QEZA 3AIRA 1B4KA 4DYEA 4PYSA 1M1BA 5A8MA 3GDMA 2X1TA 1GKQA 4E8DA 4GCXA 5EMYA 4UB9A 3QW3A 2ZA3A 5HJYA 4E4UA 4GKLA 4ATWA 2FJUB 1MI3A 5L6UA 5AY7A 3M46A 2WCGA 2WC3A 4Z08A 1DIKA 2F84A 3N19B 3NPUA 1SW0A 1X1ZA 1IWAA 2P10A 5HMEA 4U10A 4O4VA 2J25A 3A23A 3APTA 3UVAA 4AD5A 2IPWA 4MG4A 4N9BA 2VFEA 1TPB1 7ODCA 1Q2SA 1XKYA 1XG3A 3MUIA 4Q8NA 3ITOA 5EY5A 2ZRZA 5CAKA 2EPMX 3IJQA 1G67A 4JN7A 2BS9A 3CPRA 2KZHA 3KTCA 5GNXA 1WXYA 4J5NA 1KM6A 3NQAA 1TV2A 2C3ZA 5CPNA 3E74A 3W85A 3KUMA 1NOUA 5CSRA 1G7UA 1P4CA 2ZZ6A 1OF6A 3TTYA 4FNUA 1GYNA 4Y6GA 3EX3A 4PTWA 2OODA 4N9CA 4YU1A 1QR7A 4UQCA 3CASA 5JUVA 3V0SA 3N25A 5LZLA 2GQAA 3V0UA 2ZDSA 3OU8A 4G7EB 4LS0A 4NJJA 2BVWA 2QPUA 1GOXA 3N3TA 4ZQMA 4K2SA 4A8RA 1OFPA 2E09A 3AZRA 3GIYA 5F2LA 4M24A 2C7FA 3NQMA 2PAJA 2OYLA 1LM1A 2IKGA 1ENUA 3CWHA 1XQKA 1E6QM 1ZBVA 3W7JA 2D0HA 1G4EA 5LHFA 3DGBA 1X6LA 4S3JA 1DE6A 1OT1A 3URBA 4YVPA 3ARTA 2W66A 3LU2A 2I5GA 1JCLA 1KM4A 1VHCA 2DH2A 4RNJA 3NTYA 3U2ZA 3MVIA 4KRZA 2CYGA 1R5YA 4ZSTA 1OFQA 3KVJA 4MAVA 3U7VA 1Q6QA 1KXVA 4JHMA 4ES4A 1BXCA 3LCGA 3N2XA 4EAYA 3NR0A 2A85A 3SDOA 5FAGA 3W1AA 3LSBA 4DJED 1F3XA 4XD5A 3CZEA 5DELA 2DT2A 3AOFA 3WH8A 3T08A 2NUXA 2BY0A 3P2VA 2D3LA 1KLYA 1SO4A 3A3WA 1PS9A 1XIJA 7CGTA 2CESA 3BV4A 2WHLA 4AMCA 1JYNA 1I2QA 1FWNA 3ZYZA 1JYXA 4KWVA 3ZZ1A 3VUPA 5A8NA 2Q6ZA 2NQLA 4JCLA 3KP0A 5EMLA 1MQPA 3M16A 4PMQA 4S3KA 1F6KA 1AH0A 4E2VA 3S47A 3LYEA 1U5JA 2QCDA 4WY0F 4XAGA 1EJRC 3N73A 4INFA 1P43A 2C1IA 3CWNA 4UCGA 3I3EA 3WSUA 3ZWSA 2X09A 2I16A 2A3EA 4LVBA 1V6TA 2FPTA 1QPOA 1OD8A 4C1KA 2Y4SA 3BG3A 2FGZA 4Y8EA 1UC5A 4P7QA 3WD3A 3FJ6A 4DWSB 3S2JA 1FFRA 6A3HA 3E2SA 1V5XA 1V51A 3QZEA 5D8ZA 4Q8TA 3TH6A 1WBHA 4LWWA 1RUSA 2FYMA 3GIQA 3GXMA 4CCCA 4HA0A 5FF0A 2P8CA 3E2RA 1OYCA 4MY9A 2X2YA 3KHDA 4PL2A 1C7SA 1X96A 3KBJA 3QN3A 1MNSA 2PUZA 3A5VA 3PBUA 4O18A 5E0KA 5FF3A 1TIWA 1K1DA 3DH7A 1ZS2A 3GXTA 3PULA 4H7ZA 1O5KA 5BCAA 3SBFA 4J3WA 2QGHA 2IQDA 3P62A 1TWSA 4HZMA 4PB3A 2X05A 1EKOA 5HJXA 4ROQA 5JU6A 2OT1A 1B54A 5HWMA 4G5DA 3M7SA 4PUMA 3W27A 3BO9A 2V3DA 3M44A 1P0KA 3NYDA 2P53A 3IEBA 1BYAA 5FJJA 2I56A 2FPVA 2PDPA 2J62A 3A4WA 2YXGA 4NU7A 2PE4A 3NZGA 3NNTA 2ZTJA 2WJZA 5DMLA 4ONVA 2PWFA 3SJNA 2TPSA 3WLJA 5F4SA 4Q4KA 3QLLA 3E5BA 2XSAA 4MFEA 4H6QA 1HNYA 1XDJA 2VZTA 4R85A 2NQJA 3SCQA 3RLVA 2OWXA 2GSEA 3DG3A 3LLXA 2A4AA 1L2QA 4N0RA 5FIPA 3SCWA 5CPQA 2DDXA 3LHTA 4GJIA 3NCOA 3MCNA 2O56A 4AD4A 1UD4A 4IGSA 4MSSA 4IG2A 1XRVA 4AD3A 3RMJA 1V0NA 1L6YA 4JFTA 4GX9A 4HCDA 2X41A 2F6XA 4ZO8A 3GC4A 4GACA 3S5SA 4O4WA 4D1JA 4X3ZA 4BI5A 2FH8A 5JH1A 1XISA 1XV8A 1J93A 4HA1A 3TLQA 5KTLA 3MB9A 3TCEA 3EOSA 4L56A 2E5DA 2O0TA 1EP3A 3WJZA 4BWLA 1PDYA 2WSPA 1NY1A 3GH5A 1J11A 4ZO9A 4MMWA 1E5JA 2OWWA 3PSVA 4KGJA 1IWBA 2UY4A 2NT1A 4Z0SA 3OHMB 2H3BA 2NLYA 5FF7A 1OABA 3BXWA 4TU1A 5IXEA 1XSJA 3NOYA 2VOMA 3EB2A 4NZ4A 4JL1A 3SFWA 4OOUA 3W9ZA 2VXNA 3NUKA 1ONXA 1IXPA 1B9BA 4V1XA 3W84A 4LANA 1R3VA 2PDFA 1H60A 1UB3A 2GGJA 4JYFA 4Q6XA 3EB3A 2EG6A 3W0KA 2VM8A 4X9YA 3KBSA 4OKDA 3FOKA 3Q67A 1Q65A 4L65A 2GUBA 1EXBA 1TQXA 3C2OA 1YQ2A 3KBNA 2NSXA 4HA3A 1XIGA 3B06A 3D47A 1A53A 2Z25A 3G6MA 4LFYA 4UQDA 2I7GA 1A3WA 3KVMA 2YCLA 1K9FA 2VDGA 2CXEA 3LM7A 1U22A 2PLJA 3GBDA 1W3JA 5GJPA 2CFFA 3VGBA 4CU7A 3M43A 4PMNA 2AKZA 3PTDA 3LERA 3LZ5A 4HQVA 1DQWA 3S1VA 3WLLA 1BSLA 1NDZA 2OZ0A 5DY3A 1ZCOA 4C7GA 3L2LA 4LCQA 4JEQA 2V5BA 1TMHA 4H41A 1X7FA 4AZCB 3QYSA 5IOBA 4FXFA 5CC5A 1X98A 3W73A 5D2VA 5FACA 3VKCA 3ZSSA 4M3PA 3VAVA 3EKGA 5GVJA 5CBIA 5BOOA 3EWBX 3VOJA 3WMLA 1ZFJA 3VIPA 4ECLA 2DZTA 5I3IA 4A3RA 3VMOA 2QJNA 1NWTA 1K6AA 3CZGA 3AMGA 3EX4A 2IQ0A 4IGNA 4IFKB 1FH8A 2OQLA 4AIBA 4M6QA 4H9TA 3HGOA 5M5DA 1Y7VA 4DUXA 3IJIA 4QXIA 1RD6A 3NM3A 1WAUA 5I78A 5AC6A 3EEZA 5DEZA 4PBEA 4Q8UA 3HA1A 4IHCA 4AAJA 3IUHA 2VRQA 5A95A 4X0VA 3TFCA 1OFEA 2X1IA 1DYSA 3DI0A 3LUTA 2PDGA 4EF9A 2VX6A 3DFQA 5KSWA 1VBGA 5TF0A 2Y62A 3V16A 3WD0A 5CC6A 3I10A 3LM3A 3EX1A 3P61A 1LL7A 1AZ1A 3KZSA 4IMAA 1OK4A 3KBWA 4N9DA 1DJHA 1UA3A 4YVXA 2Z2UA 4PRRA 4ZGYA 1IEXA 1J0IA 1QU4A 3SZ8A 5IM51 4IWWA 3A3XA 2GVYA 3T05A 4B5SA 4ZQCA 3GR8A 2AMGA 3O8AA 1JPDX 1WUFA 3PZQA 1XLFA 1QXLA 3OA3A 2JEPA 3ZWTA 5HR6A 5CXPA 1O94A 4FHAA 2J78A 4JTFA 2GSHA 1FWEC 1PJ9A 3KX6A 3O0KA 1P6BA 4S3CA 4AF0B 5TNVA 3FAWA 1EOKA 3W7MA 4YVVA 4YS1A 4UNIA 3WQ6A 4Y9AA 4AD0A 1MRQA 4AIOA 4JTSA 4JOMA 3VOFA 4EAMA 1V6YA 4XAFA 5CPLA 2WMKA 2PFHA 3PF3A 2E4TA 1LRQA 2IS7A 3O1NA 5BOFA 4F0LA 5JBEA 2P0IA 3B9AA 3T9PA 4UOJA 5A2CA 1IT0A 1H49A 3W7LA 2DIEA 2F8QA 5ABHA 4O0QA 1BKSA 2QQ6A 3W2JA 2PCQA 3OJGA 4JTUA 1UZ4A 4K39A 1W1ZA 3SGGA 4IQEA 4PUKA 4FR6A 3GZ3A 5G2WA 3WLRA 4G1NA 2PGRA 3I6TA 1O66A 3AS1A 4JNZA 1R86A 3EDJA 4FOJA 1IXOA 3LV5A 1UR2A 3CUIA 1BG4A 1JDCA 3CWOX 3Q2DA 3GBEA 4QEHA 2C15A 3N9RA 3VE7A 4QHRA 1REQB 1E43A 2DVTA 4EVZA 2FB3A 1AW1A 1DQXA 3W86A 3LHWA 3WLKX 3O2LA 5U4NA 4QISA 2GVEA 2BASA 1DKWA 5BOEA 3G3MA 3RR1A 2VI0A 2HE5A 3TQKA 3PJTA 1SO5A 3BG5A 1QWKA 4WGHA 4XZLX 1O4UA 2QF8A 2IKIA 4GK8A 3H2AA 1JR1A 1UZDA 2OB3A 1D7KA 3HMCA 1YPFA 3QR3A 4MKSA 1W8SA 1Q85A 2HXTA 2CLIA 2QKFA 2XZ7A 3NYZA 4S3FA 3ORWA 3ARRA 1VB9A 2ALDA 5M2FX 4BR1A 3HOJA 1R87A 5C5YA 4HN4A 3CGTA 3Q45A 5HAOA 2J75A 4D8ZA 3CHEA 3VILA 1VGAA 1XW8A 3TQPA 3C2RA 3FYYA 3RNDA 1RCQA 4GVFA 4ICCX 4AISA 1VRDA 4UXDA 3KM8A 4AHPA 3MCMA 2Y8KA 4FB7A 4QNEA 3V0TA 2G41A 1WV2A 4F48A 4LAKA 1CGXA 5G1YA 1W3TA 4PEKA 3THAA 4Q4OA 1C8VA 2HSAA 4M29A 1W5OA 3CEPA 4JYDA 4NAEB 3ZM8A 1UZ1A 4C7FA 1UWTA 3S42A 2WVVB 1E4IA 5AKQA 5HA7A 1DL3A 2Z1WA 3H7RA 3J7HA 5A6SA 3URQA 1D9EA 1LOSA 1TPDA 4RW3A 2C1GA 2BG5A 4DO5A 4V27A 4DZ5A 3MMUA 4J9JA 3AHVA 4LUTA 1RXOB 4GQ0A 1JDDA 4V15A 3MI2A 3THDA 4UMCA 2BY2A 4XD3A 3IV8A 2I5IA 3B8SA 3H55A 2VUYA 2FMNA 2NLIA 4Z2HA 4GY7A 2ADAA 3MUXA 2W6RA 4GHRA 5AHFA 4DRSA 4UNLA 4IJRA 1K8XA 4XUGA 1ZNNA 2DVUA 4C6KA 5IHRA 3G22A 1BYCA 3EOOA 4ZTXA 4R7JA 1HXJA 3T1GA 3UWQA 4B2DA 3AIEA 3SQMA 4LPCA 4OUEA 2RAGA 3RN6A 3NQBA 5I07A 3TN6A 2BVYA 2WZEA 8A3HA 1M03A 2YKKA 4NQ1A 1PCKA 2PDKA 2WMHA 4FX7A 5CC7A 1LJYA 4C6CA 2ZOXA 1DJIA 5AVNA 1S5WA 1UWSA 3TW7A 1HKKA 4X22A 1W9UA 1OB0A 2J4GA 1LL6A 4JIRA 2D69A 5A6MA 3W7QA 3GX9A 5FJTA 4ZOBA 1CLVA 1FWWA 1HL8A 1AMYA 4QEEA 4ASTA 1BHGA 5BZAA 1K8ZA 2ISWA 4FX6M 4GCAA 1SFLA 3W6LA 1LF1A 4JKMA 1SMAA 2O92A 4M56A 1WE5A 2QAFA 2O9OA 2YB1A 1TPUA 4UQAA 3W82A 1O6IA 4GUGA 1TWIA 1W5NA 4UZUA 4A05A 4O8RA 3WH5A 1Q4WA 3V75A 1JPKA 2D23A 1Z6KA 1H41A 1I45A 4ZQNA 3B9OA 2JE8A 3U8GA 1XCXA 2X30A 3DG7A 4IIHA 5LIKX 3MWAA 2ZZ7A 3O6CA 1A5LC 4PRWA 3DESA 2EHHA 1G6CA 1IXQA 1DJGA 5I3KA 4IMGA 1K7FA 1GOWA 1TTQA 1OGGA 4JQ1A 1ITQA 1JVNA 3MU7A 1XGDA 4ZQOA 2J9ZA 2OKOA 2Z0IA 1WXJA 1Y5VA 2GJXA 2XDFA 3R6IA 4JNMA 4JGDA 3IGUA 4RXGA 2DQXA 3KAOA 4D72A 3W01A 1KM0A 2EPLX 4A3YA 4UBPC 3QPEA 4BFAA 2ZTKA 1TKKA 1XIFA 3SURA 2QCHA 1VZWA 1WDPA 4AMAA 3GW0A 1UHVA 4O1AA 1WDWA 2F61A 3CUHA 5D2TA 1V4YA 3HG5A 2F7FA 3M0LA 5TIMA 2ZUUA 4W85A 1WQ5A 3K5XA 3F5JA 4GUJA 4UC5A 1FH9A 2F38A 2PRMA 2G4JA 1VP5A 2OX1A 1TZ7A 3WYZA 3EEGA 3D3FA 2QF7A 3QY8A 1S5NA 1JI1A 1XI3A 2GQ8A 2BDQA 4FMVA 4LEFA 3BZGA 2WWDA 3N18A 3GDRA 5I3HA 3W1PA 1YPXA 1B0IA 1UKSA 3WDHA 4CGTA 1CX9A 1R0MA 2VQUA 1B3YA 1TQJA 3WQ4A 4G1KA 4N2YA 3UPBA 3VDAA 3TSBA 3GO2A 3RJXA 1A0CA 4XB3A 5EMKA 1VYRA 4REQA 4GISA 4ML4A 3CBWA 1NDWA 3AMCA 3CC1A 3CM4A 4Q4QA 3KWSA 3WLMA 3T8QA 3L4TA 3ARUA 3WNMA 5FL0A 3E49A 1E6PA 4MB3A 4S2CA 3UXAA 2QCDB 2RGMA 3P3BA 4CN1A 2YDRA 3NQ6A 4W5ZA 4Y90A 3LPOA 4OBSA 1G1YA 4RNIA 3WDQA 4KRUA 2Y1HA 1PIFA 5G4WA 4DXVA 3O05A 1QATA 3T81A 1KTCA 4FXRA 3AALA 2QMJA 1CGYA 5CG0A 5IBXA 4BF9A 3NQ2A 3QV7A 2AL1A 2G3NA 4HIBA 2EG7A 1I9CB 4QG8A 2R6OA 3TN5A 3U4FA 3T0DA 5DY2A 1XF0A 2IQTA 4ZFCA 3MHGA 1UOZA 3RILA 6REQA 4QITA 2HPIA 5G1TA 1VFOA 3SRDA 3LI0A 4MFDA 2XTKA 1H5YA 2QJIA 4OV4A 3WENA 1BG9A 4QM1A 1LRNA 3CXOA 3C0JA 3W7KA 1RA5A 1H50A 3H2CA 3RM9A 1ISYA 1XSKA 6ALDA 3NSMA 1F4AA 2WNZA 3QXBA 3FAXA 1EO7A 5CJMA 3WX7A 1IHIA 2DH3A 5A3HA 3KTXA 1FCVA 2ONEA 4NUWA 5LNSA 3DYOA 2DZWA 3LGGA 3VZXA 1KO0A 3KS5A 3P7YA 4QROA 3TC7A 4NNAA 4O16A 3OVPA 4E4PA 3QW4B 3QYQA 2E28A 3HTWA 3SCPA 1XJBA 3UERA 3G6LA 4L1GA 4I5RA 1UP2A 2Y61A 5A2AA 1SZGA 3SFKA 1W9VA 2BOFX 2VNCA 1W9BM 2ZFAA 3MHFA 2ABAA 4K7VA 3WDPP 3IJ9A 3W70A 4GOAA 3HQPA 1TPEA 1UKQA 9RUBA 2J7DA 2XN0A 4JYEA 1TREA 1QASA 3AIWA 4NSBA 3CH0A 5IBXC 3DENA 4R7WA 5CAHA 2FTPA 1Z8AA 2PB1A 3LRMA 1UKOA 2ZX9A 2WK2A 2XVGA 3G8RA 3FKRA 4TV6A 3NVDA 5DBTA 2JGQA 3PZUA 5F7UA 5CBJA 2XH0A 2VC6A 3ZR6A 2QDGA 1E9IA 5ECVA 4IUGA 2YL5A 3V5OA 4IG2B 1FHLA 2V5CA 1PE1A 3ARYA 3CL8A 3IJ7A 1TWZA 4L61A 1KM2A 5E5CA 4FNPA 3G0UA 5MKGA 1DXIA 2R91A 3UWYA 4UR7A 2RFGA 3JS3A 4C65A 3IIOA 4M0XA 1GVRA 4QE5A 2C19A 1S1RA 1AK5A 5FJPA 3FW6A 4F9DA 5CCZA 1J0KA 3RPDA 3VNLA 3PUGA 1K8YA 5DT7A 3C3NA 1A47A 1BQGA 4B2DD 1Q45A 4PUEA 1YEYA 2R1PA 5EPDA 1ONWA 5BNKA 1PPIA 2GUUA 3UZZA 2DJLA 4HCLA 1JAKA 1G5AA 2ACQA 4D6FA 1Z44A 4GO8A 5TAOA 1QI5A 4XBKA 3I3DA 5LNVA 3OYXA 4YPJA 2DT3A 1GZGA 3KCOA 4GUIA 1P0NA 4GZEA 3CAQA 5G4HC 2C79A 1M01A 2DZAA 4A35A 1EA0A 1L2UA 3MSDA 1PTDA 1JULA 2VGGA 3K1DA 1AJ2A 2V8ZA 3UXDA 1QNRA 3W38A 4BCEA 5DMNA 5I03A 4X63A 4V2XA 4PCPA 3UPWA 2C91A 4DUWA 3S5YA 4F0KA 1KCZA 1YDYA 1KBBA 1VFMA 3BSMA 1TA3A 3VNYA 3H12A 1KFEA 3UZXA 4AC7C 1PKYA 3ZLHA 1UOKA 4Q4RA 3I3BA 1GYMA 3KRZA 2G50A 5C2CA 3WH9A 1J9YA 4XWUA 3LI1A 3HM7A 5T9BG 4GZJA 4RV8A 3UWVA 5C9UA 2YCLB 5FJUA 2H3DA 2VVSA 2VDIA 2IPJA 1TTJA 1D8WA 1VCFA 2OLAA 2MNRA 3W7NA 1KNWA 4LYQA 4HU3A 4X0NA 3VIOA 1AQHA 4HMCA 1KRMA 4CU8A 2NVDA 3WQWA 1KFBA 4NT0A 4QFUA 1E15A 2WOQA 3USZA 1B3OA 4UTLA 4K8GA 1XS2A 5ABTA 1S1PA 4FIQA 3MUY1 3W1TA 3E9AA 4WKFA 1XFBA 2V5DA 3N1AA 5FI8A 4B15A 5LGXA 3CH9A 1I0BA 4Z42C 4LUJA 3SM0A 1WX0A 2QJJA 4XVDA 4UTHA 3IVTA 1T40A 1N7KA 2UY2A 1UROA 5D8WA 1PXGA 3SCTA 2FKPA 5D38A 4DQWA 1Z32X 4QQUA 4XV0A 3GFZA 1DHPA 2OGJA 1XYAA 1W1VA 1UD2A 4HSHA 3UJFA 1E4MM 3P5ZA 4XAZA 2GJLA 4ADUA 2F6KA 1J10A 1TJ1A 2CBIA 2C0AA 4S2BA 1KRCC 4IQLA 3N14A 5B80A 5C6MA 1X8CA 4UWMA 2OOFA 4JBRA 5FKYA 4D6DA 1MMFA 3A22A 4N42A 4AX7A 1DTUA 1TX2A 3VIGA 1O7AA 1TZZA 3UGVA 5C71A 1UUMA 2X8RA 1VD6A 5REQB 2TSYA 4E2BA 2MUCA 2A7NA 5KZMA 1OBAA 2HWGA 2W61A 2JF7A 4UTUA 4WOZA 5GJMA 5E93A 1CCWB 3OHIA 1EUAA 2WMIB 4GC3A 4R7OA 1R3TA 4LY8A 2UBPC 3OOQA 1EH9A 3VUSA 3R8HA 3WEMA 1S3TC 2Q8XA 2A3LA 1U1UA 3SUVA 2ZZ3A 4FNRA 3E0VA 2Z00A 3OGRA 3DERA 4DBDA 5J5DA 3G3DA 3SIZA 4KWOA 4I7UA 2A3BA 1FWGC 1ZUAX 2WJEA 4BQ3A 3SEPA 2GGHA 3M5XA 3SN4A 4XAYA 3LDVA 4DNMA 2I1OA 4H3DA 3EA1A 2WHKA 2B7OA 2PTZA 3MZNA 3SW6A 2QHAA 5DT5A 2YL9A 3LPGA 2H8ZA 2IKHA 5BU9A 1QOQA 5A8QA 4MUPA 3KTSA 2I57A 1KTBA 3GHRA 1NDYA 5D2XA 3DI1A 2VC5A 2NV2A 4U2YA 4NHVA 3B05A 1R3WA 3KP1A 4HA4A 1VQTA 2V3GA 3TUUA 1IIHA 3CUZA 4JTIA 3S6DA 3STFA 3TYZA 3VZZA 2NQ9A 1GOKA 2JEQA 3S2MA 5I0DA 3AS0A 4KS0A 1C92A 3ARSA 3PFMA 4MTVA 3T40A 4F0HA 3GY1A 2Q01A 1H7PA 1R85A 2B81A 4A2SA 4GI4A 4DO6A 4UUIA 4BA0A 1QPNA 1KCXA 4ATDA 2CZEA 4M6VA 2DT1A 4MUZA 1QNSA 1BYDA 3M6YA 1KWKA 1SFJA 1S2AA 3ZT7A 5GQBA 3BARA 1JDAA 1VBJA 3B0YA 2XJ7A 1XKJA 3TAKA 1YW1A 4FLRA 3G1FA 1HJSA 5CH9A 1KTNA 3WBWA 3L21A 3MO4A 4X61A 4WJXA 1EUNA 5I00A 1GTHA 1F5ZA 1KGWA 5C9XA 5CBBA 3INPA 2Z2AA 3TTEA 1Q6CA 2VFDA 5K2ZA 1HTIA 3MP3A 3E2QA 1P0EA 4GH1A 5I3JA 3HJZA 1L8PA 2KX9A 2X40A 1SUXA 4KWUA 1UR0A 1R7OA 1ONEA 4U3CA 4LS1A 2B7NA 3W24A 1K4GA 1MWOA 4Y9MA 4C6PA 3CQIA 3VNDA 1JD7A 2OYMA 3G1XA 2GVJA 4N02A 2VR2A 3BOXA 2GJRA 3VCCA 1W1TA 1TR1A 2AGKA 2P3ZA 3W71A 1EJXC 3UNDA 3GNPA 4JXCA 2PDJA 4H8NA 5C7VA 4CD6A 3GKAA 4QNWA 1R3YA 1O5RA 3B0XA 3T6CA 4AZGA 2HVNA 1XH0A 2ZCGA 1YPIA 3RMEA 1B4EA 5IFPA 3WY1A 3RPMA 3UBPC 1FWRA 1V02E 4WIWA 3W29A 1ME9A 1OG0A 3RX2A 1H0IA 1X39A 4GI8A 4H2CA 3UR2A 3WNPA 3UR8A 5B7YA 3KL0A 4YCOA 2PC4A 4JTAA 2YA2A 3VGHA 3C0QA 1UH4A 1VEMA 1UBPC 3ALGA 3LHUA 3PZGA 4TV5A 1EWDA 3BCJA 1OM0A 2OLHA 4KQNA 3PTQA 3YPIA 3T0BA 3AISA 3LCXA 5MF5A 3F2BA 2NXIA 3OQ8A 3KE0A 2XN1A 2DVXA 4DJDA 2OX4A 1HP4A 3MP5A 2GDVA 3URAA 1TV3A 1K9TA 1TTIA 2ASHA 3FS2A 4JICA 3F4VA 2OSYA 4ZO6A 5ENLA 1HL9A 3OIHA 4XKYA 3CV1A 3KRSA 4NJIA 5C9ZA 1JCTA 3GAYA 3U57A 4ZBCA 1OVDA 4JTEA 3ZO9A 3CV6A 3PFRA 4O50A 4QG9A 4JQ4A 3C86A 4HJFA 4WCJA 1OIMA 4AD2A 4S39A 3GNDA 3PB2A 4MNMA 2G3MA 1AZ2A 3H8AA 2D2HA 1DJZA 4XISA 3LXBA 4IP7A 3G77A 4RPPA 4HYVA 4D6JA 1W3HA 2E6AA 4H6KA 1TCDA 3T42A 2CLEA 2VOTA 5CSYA 4FNQA 2J7EA 1R8LA 2CHOA 3BPWA 2J9YA 3KS6A 3M0VA 3AIUA 3STCA 3UW6A 4G9PA 3U7BA 1CTNA 3EA3A 2DUZA 3CTLA 3GVWA 4G7EA 3R94A 3B40A 1OGSA 1S5TA 2HE8A 1E6NA 4YL2A 3S2NA 1CYGA 2J24A 4G7FA 4LRTA 4ZTYA 2G3IA 4Z17A 2OEMA 3MJMA 4GPNA 4HU4A 2VWSA 1QBAA 3EGJA 4GMEA 2OVLA 3USBA 4DJDC 3HGSA 1D7FA 3ID7A 4RDYA 4YJ5A 3XINA 2XSBA 3G24A 4LCRA 3IIXA 3AUOA 3TV8A 2IXUA 4O1FA 3BCDA 4RE3A 1EOMA 3SAZA 1KXTA 1T0OA 3VX1A 1EEPA 1VEOA 3L23A 4POCA 2P50A 4F3HA 3CT7A 3TYCA 4Z1AA 3TZNA 3QBUA 5HPCA 1XLIA 4WY0A 4LTSA 4IXHA 2AQWA 3VIIA 2YZ5A 3L12A 1D2KA 1EZWA 1OFDA 3S9YA 3SY5A 1HGWA 1CIUA 1SFSA 4JY8A 1Q6RA 1FWDC 5HNUA 1NSJA 1P6CA 4UTKA 4ZE5A 2VEKA 3E0LA 2F9RA 1E4LA 4MJ2A 4UFMA 1EA9C 2DSWA 4CU6A 1FDJA 4H8HA 1IT7A 4PTXA 1P6WA 3A13A 2PZNA 3PBWA 3P93A 3GG8A 2GJXB 2VHLA 3S8HA 3LA4A 4CD4A 1E9ZB 4F2BA 3KEHA 1AQMA 4GVGA 2QDHA 1HJUA 3KXQA 3AC0A 3U5UA 2OQYA 1K6WA 4TTUA 2QR6A 2PWUA 1HO4A 2WC7A 4E2DA 4DF0A 1VHNA 2XH7A 4U5KA 1QW7A 2EPKX 3BG9A 3F4DA 1NOWA 1Q7ZA 1G01A 4F0SA 4N9EA 1ISWA 4IL0A 3L5LA 2OMAA 1RLDA 2ZUMA 4B5NA 2YW3A 3WLSA 4C6OA 1KKOA 3L0GA 4PA8A 3B8VA 4PB4A 2R1LA 4W7WA 4S3BA 2E77A 4GABA 3XISA 3P84A 2XH4A 2HBXA 4O12A 3BZJA 5F1VA 5FEWA 2ZIDA 1GG0A 1HG3A 2RJGA 5BYWA 3C0SA 1BGAA 4CD7A 4JS3A 3GU2A 4RZ6A 4B3KA 4DIAA 1F3EA 4C1LA 1H1ZA 3FXGA 4IIDA 4I7WA 2DFAA 2FFCA 1H1YA 1UWIA 3H53A 4J2PA 4J3XA 2ESCA 3UZ5A 4LU0A 3G1DA 1Y65A 5HK4A 2ZE0A 4OBTA 4BEQA 4F40A 1U33A 3GK0A 1ICQA 1HKJA 2R8WA 1LP6A 1ZBCA 4X9SA 3VPLA 1AH3A 4W5UA 3C52A 3PZOA 1XIIA 1MW3A 3WG6A 2VMFA 4QAIA 1H1NA 4F0RA 3WNOA 1XLCA 3BAJA 1JZ4A 4JKKA 4XZHA 3WZ0E 1TE1A 1O60A 2Q8ZA 1E0XA 2C16A 2WANA 3THUA 4IUOA 2EPHA 6REQB 1FHVA 4Y9OA 4A4AA 1JZ2A 1V3MA 1IV8A 3UY7A 1IYXA 1FKXA 1CB2A 4HVXA 4DYJA 3VM7A 3OQEA 1AODA 3C2VA 4C6EA 3PZIA 4IMDA 4MAZA 5CG7A 3ITYA 3WLOA 5D2WA 3FYOA 1XLLA 1F8MA 1EQPA 1TPVA 2VZUA 2ZC1A 2CWNA 3WQDA 4CN4A 4IIFA 1I1XA 4EK7A 1OEPA 1XC6A 4R33A 4MKNA 4NYUA 3UP8A 1J2WA 1DTNA 1R30A 4FXSA 3EDKA 4MY8A 4HPHA 1V6UA 4F66A 5ABFA 2PDQA 3HJEA 3BE7A 3GU9A 1XRSA 2JKAA 3F7JA 4AEOA 3UG4A 1WXZA 2F2KA 3NO3A 3LMYA 3STGA 4D8LA 1J18A 3VKBA 3PZVA 5HINA 1W32A 1ZBKA 3GXIA 3LB0A 1RJRA 4RW5A 4DXKA 4HBKA 5D04C 3WJXA 1ZGDA 4C6FA 1H7OA 3QR0A 3M1ZA 2VCAA 4D8AA 4MNKA 4IJCA 3OZPA 2OO6A 4RE4A 1ECEA 4IX2A 3LHZA 5A6KA 1ZALA 3GTXA 3FJ4A 2ZRUA 1R9YA 1GPFA 3MV01 2BP1A 4CNTA 3G1SA 1M41A 4Y7EA 5M03A 3GNRA 3NL6A 1GQLA 5T26A 3AHTA 2ZUWA 3SQLA 3S4TA 1A50A 4C5YA 3H4WA 1JAEA 2YFNA 1W1IE 3EX2A 3N15A 5DQPA 1T7LA 4GH3A 5MKGB 4JQ2A 3DGRA 1KBJA 3VINA 3N9SA 1UD3A 4W8AA 5AHEA 3C4UA 4Q4MA 3D0CA 4O1EA 1ICSA 3ARVA 2D2OA 1YXDA 4X2PA 1U5HA 3PR2A 2H9AB 4BQ2A 4A3QA 5BMXA 3W87A 3MT1A 4M1RA 4O0KA 2CZFA 4D6CA 4AC1X 3KOYA 3DFNA 1Z41A 2YDSA 3LLDA 3O6DA 1DWAM 2BY3A 5CSUA 4MLRA 3TP4A 5MHBA 5U7SA 4QBXA 4HPJA 1VYSX 3TQ0A 4MPKA 1KBKA 3M0MA 4KCTA 4NP7A 2Z7GA 4ZODA 3UCDA 4ALDA 2UWFA 4S3AA 3EA2A 4HHHA 2ZXBA 3W7OA 4NZ5A 1TWWA 1JUBA 4XTIA 3ZFHA 1UIPA 3ZLFA 3DIPA 2UZ9A 4GIAA 2PDXA 4PEEA 4AUBA 1GVIA 3U48A 4HGXA 1GVSA 3GU1A 1F4HA 3HPZA 2YW4A 4Q4SA 2OEKA 2G3JA 3EWCA 1F05A 1OX4A 5L9FA 4PMYA 4JTKA 1ISZA 4AFYA 4LALA 3CT2A 4LV4A 4IF2A 1CXLA 4PR4A 3ANYA 5G5IA 3RX3A 3WBEA 3HPSA 1GZ1A 1EX5A 1LT8A 1HT6A 1VFFA 5XINA 3S6OA 1GKRA 1M7OA 3GDLA 1TA3B 5BROA 3UFYA 4JZ5A 4OUIA 4F0MA 1DWHM 2BGSA 3RM4A 3C2FA 4YWIA 1JZ7A 1DOSA 2VURA 2GUYA 3DC8A 2B0MA 2HEJA 5BU6A 4EPKA 5FAJA 2B31A 2XWEA 4NF7A 1O68A 3NQ8A 3DU0A 4UIOA 1NELA 3OW1A 4QDMA 3QOMA 1UJPA 4WXYA 1EFZA 1JPIA 1D8CA 1KV5A 3BW2A 1OX6A 3N12A 4CNUA 5I77A 3B8IA 1M3UA 3GTHA 4QLJA 3P5YA 3AWNA 2QVHA 2WZMA 2Q71A 3ATZA 4TVUA 1ITXA 4M82A 4MVAA 2Q3RA 5D4YA 1BKHA 4QJ3B 5FL1A 4C6IA 1VR6A 3QF0A 4P61A 5I79A 3THCA 3CNYA 1ZZMA 1S5VA 2J9XA 3HG2A 1YMYA 2WSYA 2HMCA 5J5RA 4S3EA 1IGWA 4IFRA 1SR9A 2ZVRA 4NAFA 2W27A 2WLZA 4C7DA 3NDZA 1E1EA 3L4VA 4MNJA 2VTFA 4IT1A 3R79A 3NL3A 4RXFA 3K2GA 3JRKA 1VEPA 1VJSA 1DBTA 3M5YA 2WB5A 2O7QA 4GY0A 3UG5A 2VFFA 2DIJA 5CJNA 3L5AA 4QIUA 5FSEC 3RIKA 2J13A 3EPOA 1C29A 2W0UA 4H4IA 1DJQA 2X42A 3TR9A 3K8KA 3CAVA 3CL7A 1YTDA 4PMRA 2FHBA 4B92A 4EOUA 3WQCA 2Y5EA 4DWSD 4US5A 4FNTA 1RSCA 3W6MA 4QE1A 4UOQA 3LG3A 2PTXA 2QLYA 4GYJA 4GC4A 1FWIC 1NP2A 5I3GA 4NZFA 5EA9A 1HZYA 4C91A 1WZLA 1D3GA 3B8TA 4MDPA 1J4EA 1ML1A 1K3UA 2FFIA 4NKCA 3V5FA 4N4QA 3CIXA 3LOTA 3NOEA 3WH7A 1CXIA 4XVEA 3SCVA 2BMBA 5T9CE 2J8GA 6TIMA 4LAUA 4P8VA 4D6IA 1UD8A 1KB3A 4Q4PA 4KWSA 4JTLA 1CECA 2DSVA 3E2VA 1HKVA 1J0JA 3DKLA 1RVGA 1SW3A 4UFJA 3ARPA 3AUJA 3GR7A 3BV7A 3LHYA 2NQZA 2PD9A 4JAWA 4GBDA 2BWGA 1W1PA 4IPNB 4EWJA 1EYWA 3LBOA 3B0VC 1IT8A 1XLHA 5DANA 2F2HA 2P3EA 4KFNA 4JTRA 2VJXA 5EFDA 4UQEA 1ZJHA 3H7VA 1NWSA 1OC7A 4ERGA 2AKMA 3PBYA 4KCWA 4CD5A 3P0XA 1YDOA 3L2MA 2AL2A 3N11A 4J3TA 4HK7A 2XM1A 2BODX 3NQCA 5BW6A 3ZT5A 3H54A 3WQPA 5HNRA 2PWVA 3VCNA 4LNYA 4N7QA 1XLBA 1V0LA 2BSLA 3DOPA 5ECUA 3RDKA 1W54A 3WNKA 4JTHA 3R0UA 4FSAA 3H4GA 4W89A 3PBGA 3A64A 4J3SA 3MI6A 1AL8A 3AHYA 2PS2A 4GG9A 1RCXB 4HMEA 3QVQA 3FJLA 2ZXQA 1EXPA 4Q8QA 1DXEA 4Q6JA 4RCXA 4AX6A 2W67A 3BLPX 1QFEA 3WLNA 3RU8X 4PMDA 2OZ8A 4NJGA 4PSPA 2PTWA 2WMGA 3IUIA 3SRHA 1Q8JA 4KFPA 1V02A 4WSHA 5KZDA 1YNPA 1TUFA 1KRBC 1JFXA 4Z2JA 2XIQA 3G1RA 3TTQA 6TAAA 1AQFA 4PMJA 1OF8A 3GR4A 2FTYA 3F2CA 3GQYA 2O55A 4ZFMA 1KCKA 3W3OA 1QRQA 1QNVA 1GT8A 1OCJA 1XX1A 3U9IA 5AOUA 4LXFA 3HG4A 1W5MA 3VKDA 3BOFA 3QGKC 3TA6A 4YTUA 3AYTA 3U5YA 3WLHA 3MKVA 4NAEA 2WNWA 3ELFA 1MVYA 4LAZA 5H6HA 5A6JA 5CQ1A 1AA1B 3AICA 1UWUA 1SSGA 4ZSUA 2VT0A 1H3GA 2NX3A 2BGQA 4UTWA 1PV8A 2VEGA 5C2XA 3FN9A 4MYXA 2OR2A 3W83A 2PCEA 1EGZA 5CZKA 5DCBA 1YX1A 2X1SA 4RDZA 1G4PA 4O11A 4RX0A 1Q66A 2E40A 3GG0A 3XIMA 5A6AA 1JCMP 1H11A 2V30A 1FCBA 3T0TA 3WKZA 1ADDA 3VD9A 4C6JA 2EAWA 3DHFA 1I8JA 2I9EA 2FZNA 2A3AA 3ECQA 1U30A 4PFHA 3F03K 1LYXA 2WZIA 2GSJA 5B7ZA 3CL6A 1GK8A 3I65A 1ICPA 4XZNX 3QSRA 3VYLA 4EXQA 1EHNA 1S2VA 4D9PA 1EC9A 1HJWA 1CW2A 3ES7A 2QCNA 1CPUA 3VXGA 1M5WA 2VDHA 4JQ3A 2FPYA 3N9KA 4LVAA 1UA7A 1GOIA 1QWGA 3FK4A 3G5EA 5HQMA 3FVDA 3TSMA 1BD0A 1NH6A 1LG2A 2PRLA 3PY2A 4MJMA 1D3HA 4IIBA 3NXFA 1VIZA 3AMLA 1EDTA 2PDNA 1QPRA 3GTIA 1X7IA 4LVDA 3QQWA 5AHMA 1QO2A 3TONA 1ODUA 3UZWA 2Z1SA 2EGZA 4OFCA 3WFZA 2OFJA 3VMPA 1QMLA 2PA6A 1GPWA 1KRAC 4PBFA 5E9AA 3M47A 4XKYB 3ANUA 4N6FA 3AIVA 3LK6A 4GJJA 1EJWC 2UY5A 2WBKA 3TJLA 1XLGA 2PBOA 3VD5A 3GYCA 4LF1A 4HPGA 1WDRA 4UTWC 2XH2A 8XIAA 2V2CA 1QHZA 3TYBA 3PBMA 3W7DA 3MI3A 4WGXA 3GUWA 1VAHA 2EEXA 4ACZB 1V93A 3T44A 3S9IA 4O10A 1Q8AA 2XM2A 4LB4A 5AC8A 3VVGA 2GQ9A 1PHQA 2CXGA 1A0DA 3ABZA 4LC8A 1S2TA 1E1CA 3BMVA 3WJYA 3CQJA 3ZIZA 3H7UA 4R5EA 1SJCA 3KCLA 1EL3A 3EZ4A 3OVGA 9CGTA 1VFLA 5CZTA 3F4CA 5CLTA 4DYKA 4ATLA 4PSRA 1DV7A 3GHUA 1KXQA 4ZL1A 1BLIA 4EKJA 5CC3A 3B04A 3V1HA 1A5UA 1XBYA 5HBFA 2GVGA 3BL3A 2ALRA 2PF0A 3HPXA 3LENA 3TEVA 3DECA 3RITA 4W7UA 5CPSA 4IMCA 2FZBA 5IRPA 3ZLGA 3WUBA 3MDWA 4L6OA 3OTRA 4YN5A 4DB7A 5A94A 4IPIA 2OEJA 2GZXA 3VOCA 2J79A 4Q8MA 4B5UA 2V81A 4NZ3A 5XIAA 2BXZA 1NVMA 3UNTA 4EXAA 1W91A 2E5BA 3LS9A 1QUMA 3ZQ9A 1AD4A 3SCUA 1NEYA 2VO5A 4WY0B 3HB9A 3V18A 4JY9A 2PGWA 2NZLA 3ARWA 3CTTA 2R1MA 2YOCA 5A69A 3WDJA 1KM5A 2RHGA 1KCLA 1XP3A 1J96A 5A6LA 1VCVA 3WK3A 1W56A 5HNNA 2OGYA 3LTPA 3SSZA 1GG1A 3B9NA 1AL7A 3RRXA 3ITCA 1XPYA 3P14A 2QYGA 2ZRWA 3I7SA 3H22A 4HNNA 1JQVA 2D0FA 1XL9A 2QCEA 2PF8A 1GYLA 3CZ8A 3CUXA 1V3LA 4CNNA 3SGZA 2XINA 3LEPA 3NPWA 3RYSA 4HHMA 1T99A 1R2TA 3TMQA 5AHIA 1VENA 2FQIA 3MWCA 3LSCA 3NAVA 4B4FA 1QI4A 2Y7GA 1CNVA 3VOHA 1J79A 4RDWA 4V28A 5D32A 1KGXA 4MB1A 3M0HA 2NUWA 2EQDA 3NEHA 4JHOA 4GUHA 3BLDA 3FFSA 3ATYA 4E3TA 2XVNA 1PZ0A 2ZXAA 2V69A 1BYBA 1XYLA 3DHDA 3N04A 4LUIA 1HUVA 1RP9A 1EEXA 1WZKA 3G1YA 1W9PA 4K7YA 3STEA 1E6RA 3GYEA 4JFWA 3IGSA 1U83A 4PCSA 2FH6A 1OX5A 2D73A 1XDLA 3C8NA 2VEMA 1JNDA 2OZ3A 1F6PA 1YTEA 4NI3A 3O6YX 4ICNA 3MANA 3BANA 5EMMA 1KFCA 1VF8A 4XZBA 3L0NA 2JKPA 2NX9A 3IIPA 2XYLA 3IK2A 1MW0A 3MVTA 2Z1KA 4H6EA 3FSUA 3W2NA 1LQAA 1TPFA 3MC5A 1UYQA 5RUBA 4F8XA 4WHBA 5JMUA 4JIHA 2CBJA 3C0LA 3TVAA 4B5TA 4MPQA 1Y5XA 4Q33A 2PWDA 4KETA 3EXRA 4A21A 4DX3A 2FJKA 2OKTA 3W4RA 3WUFA 4GXPA 1E0UA 3RPTA 4FLQA 1JZ8A 3PWAA 1M65A 2VEPA 3DBPA 1CI1A 3SO7A 5A5WA 4J35A 3RO6A 4XX6A 1HF6A 4UQBA 3NQVA 4F2UA 4AIUA 3FDGA 3QY6A 4DEFA 3N2OA 1UQZA 4PH6A 2HDJA 2DZXA 3PPFA 3WQEA 3K30A 2WVSA 4RK8A 4Q3MA 2YJQA 4H8VA 4KWWA 4PUJA 3WLPA 4BQ5A 1P1XA 3DYPA 5A8PA 2VVNA 2E1DA 3UJSA 4QE4A 4NZCA 4AD1A 2J7CA 4C90A 1EP1A 3IV3A 3BC9A 1K7XA 4URIA 4WRHA 2YLAA 4K68A 4PTNA 1XLJA 4DY1A 3WBAA 3KOFA 3GXPA 2XUCA 3MCOA 5G2IA 4P7NA 3NIYA 3RCNA 4NNBA 4Z1BA 1GZJA 3G1HA 1FUYA 1BGGA 2QS8A 1EZ2A 3LBCA 3FLUA 4I3GA 3RLGA 6XIAA 2DU2A 4ILSA 3G0SA 1B2YA 5ABFB 2ZKMX 1Y5WA 2ISDA 1WA3A 3KWXA 1XYZA 4OV9A 1QPKA 1A80A 3IS4A 2V5KA 2PGEA 3UXLA 1W1B1 3NO5A 1NF0A 5FCZA 1Q6LA 3E5PA 1GUVA 3EOUA 4H1ZA 2OT0A 5C9WA 3QKZA 1BXNA 5CGTA 4L9YA 1FFQA 4FS9A 1XFCA 1U2YA 3SN1A 1QBBA 2IPFA 3BOLA 1TELA 2J6VA 5A2BA 1F2JA 3MA8A 3N2TA 1QK2A 2WCSA 1V08A 2ZC8A 1FDZA 2CZDA 4FEZA 1LBFA 4DAIA 1UUQA 1PKMA 2P1FA 3QM3A 3RJYA 3EYPA 4UR9A 3SUWA 1W2PA 2X1RA 2I9UA 8CGTA 5CGQA 3HMJG 1MW2A 4EXBA 1I2NA 5LHEA 3FSTA 2POTA 3W7HA 3HURA 3W02A 1YYAA 4JR5A 4NXSA 1AW5A 3W7RA 1US0A 1TUXA 3VIJA 1L6FA 4NI8A 2VX5A 1WPCA 4XBJA 2PU1A 1XLKA 2XISA 3EWDA 2NV1A 2PDWA 3N2BA 4AHQA 3GNNA 4OE7A 4XAPA 3WF1A 3GC2A 1H2JA 2ICSA 3P0WA 1RPKA 4PUDA 1WKFA 1NTHA 3M5VA 4QJ1A 3CHVA 7PTDA 3NM1A 5C2GA 2B7PA 3LTYA 1LBMA 3SECA 4B9YA 3PZNA 2VENA 3R8RA 1OY0A 1FA2A 4O53A 1KFWA 4O0ZA 2G5WA 4L9XA 3UY8A 2HBVA 1UKTA 5KEZA 5A6BA 1I60A 1VH7A 1XH1A 3K46A 3G2GA 2A3HA 1QTWA 3OG2A 2QDDA 1TTPA 3CEUA 3L5MA 3WDIA 3WQGA 1OX4B 1OT2A 2OPJA 2A5HA 1T5AA 4BWLC 6PTDA 3Q65A 1ZP3A 1EBHA 3GHSA 3CPUA 2Z26A 4IGMA 1FWSA 1FWFC 2BXYA 3WQVA 1JF6A 1TWDA 2QJHA 4AYSA 2BFGA 2VD8A 2LLEA 3CIVA 3UQNA 4XKMA 1CGVA 1BEUA 4MY1A 1OC5A 5HUPA 4UCFA 1O95A 4DZHA 2VFGA 1F3WA 1OZMA 2DT0A 4WQ6A 5D2YA 4RKAA 4HMNA 2WLYA 3FXYA 5FA5A 5H8UA 5EBAA 4XIMA 3VDHA 5IHSA 3RG6A 3P80A 5A8GA 3AAMA 4J28A 4HMDA 5LIYX 2XIJA 2TRSA 4DF2A 4EWND 3GDBA 2BV9A 2PDIA 1A5KC 1UP3A 4ZOCA 5KITA 3FCPA 1ISXA 3RM8A 8TIMA 2BGNE 1POKA 4J3ZA 3RCMA 4AG0A 2VWTA 5REQA 3NL2A 4N6EA 4D6GA 1GQJA 3WD2A 1DP0A 2Z28A 1R3QA 2OG9A 4ZB2A 1ZAIA 4NAFB 3SUTA 3GAKA 3WBXA 3W07A 3H23A 4BEUA 3SCSA 1MQQA 5KINA 2WMIA 2A21A 2WM1A 1RY8A 3A9BA 3S2LA 4WVXA 3TNOA 4J7RA 3LRKA 1FCQA 2E67A 4D1IA 4KESA 3VIHA 4GGHA 1V3HA 4WR3A 5HOSA 3WF0A 2XWDA 3CQKA 5C8BB 1W5PA 4FPSA 2BHZA 4P7RA 4Q7IA 4KRTA 1EC8A 4L9ZA 3SN0A 1TJRA 2BY1A 2V0TA 3GTNA 4QCEA 5EGRA 3SI9A 4TR9A 2WBGA 2Y5SA 3VNJA 4KEMA 2E6FA 3L65A 4HD5A 1VLWA 3PWIA 4QRNA 5CZSA 3O15A 3TK7A 1FWBC 2W3ZA 3MDUA 2BVDA 3L0KA 3R89A 1C7TA 3WK2A 4ZXOA 3GM8A 1Z9AA 4P7OA 5IFTA 1FBAA 1WOAA 2Y7DA 4JN8A 5AZ1A 5D9PA 2VGBA 2ZUSA 5HMFA 3RGTA 3WLTA 1A3XA 1W31A 4HU8A 2QGYA 3PJUA 1MQRA 2J7FA 3K4DA 4HYWA 1F7BA 4RZ5A 3DFYA 2DZUA 1DIOA 1J0HA 3QKEA 2B7QA 2DW7A 4XZMX 2HS8A 3HGJA 4B5WA 3AJ7A 3Q37A 4ZCWA 4PZVA 3C5QA 5C54A 4C60A 4BY3A 3VOGA 5LGZA 3NA8A 3A6OA 4HB7A 4P7LA 4EX4A 3PPGA 1GVQA 3PUDA 3QRHA 2AL2B 4JIEA 4AVFA 2FZ8A 3U0HA 1OCNA 1CLXA 1J01A 3LNPA 1UKPA 3DFSA 1CWYA 3A4JA 2EO7A 3N29A 4ZB0A 4WZHA 3G18A 2Y0FA 4NVTA 4B5XA 4JX6A 1TPWA 2E6DA 3RRAA 1WCGA 2PWEA 2O4MA 2DZVA 4LJ3A 3Q58A 4HNCA 3M6DA 3W1XA 1AW2A 1UD5A 1GTEA 2WAGA 1GHRA 4IJBA 3HG3A 1AJ0A 3KCJA 2D20A 3IRSA 3II1A 4AEFA 1ESWA 1KA9F 2O9PA 2VGFA 5GJNA 3M0KA 4F9JA 3NGJA 3R4IA 4LGXA 4UOZA 1MZRA 3U2CA 1QCWA 1IQ8A 4BF7A 1BFNA 2CIPA 3CZLA 3CIWA 3BW4A 2W63A 1BTCA 3OA5A 3GFXA 3KVKA 3LCFA 3NWRA 4LS2A 1EPVA 5G2HA 2WVUA 3U3HA 1CXEA 1UW9A 3VNIA 1XYCA 2DZPA 4CEUC 1GOMA 4XBSA 3T78A 3WQ8A 1VRXA 1FY6A 1NM9A 3NVTA 3BSHA 3IJ8A 3E12A 2A3CA 3R11A 4K1GA 3WO8A 1ITUA 3GDKA 4DJEA 4H7VA 4GA8A 4IMFA 1SVDA 3TDFA 4HPNA 4I90A 3W1LA 3TTOA 3UXIA 3GH7A 5D02A 4I6VA 1QOPA 1BXBA 1XSIA 2PP0A 2V5JA 7TAAA 4MADA 2V5LA 4KBXA 3DYMA 4IQJA 2PRHA 3QJAA 3EWXA 3ZT6A 5AC7A 1C8QA 4YHEA 4EANA 4XD4A 2NQ5A 3NZ1A 1QW9A 3CQHA 4UTFA 7A3HA 1QDSA 4I7VA 2FMOA 2GGGA 1Y8BA 3VDGA 4DPQA 1V3IA 4HSNA 3B8UA 1TB3A 4A8LA 1BSIA 1VYPX 1YXCA 3VNKA 4M51A 4A29A 1YHTA 2A7PA 3I7QA 1ZLPA 1QHPA 1A5NC 4C6MA 3P8IA 2Y63A 4GNJA 5FESA 3URNA 5LIWX 1TYGA 2Y8VA 2CLOA 3QPYA 4J3UA 4M6UA 3VGEA 3P81A 3M0YA 3FX4A 3MBDA 5EKYA 3O7UA 4GZ7A 4I9AA 4RNFA 1Q6DA 2VX7A 1KQZA 1CZ1A 3NJ3A 2R14A 3F4NA 1TG7A 1EJTC 4LQ1A 4WDTA 1WO2A 3JUGA 2G97A 2V6AA 1UPPA 2QW5A 4S3GA 2PSNA 1ONRA 4O1DA 4QS5A 1YLVA 2VUNA 4YCPA 1TVPA 2YYTA 1SMDA 2ZX8A 4DJEC 4AWSA 3EDFA 3DHPA 3UZJA 4Y8FA 3CJPA 1PWLA 1DWIM 2HRWA 5EU9A 2VRKA 2CKRA 3GIPA 3UEQA 1B3VA 4J1OA 2XVPA 3S1WA 1NP0A 1KD0A 4V33A 5FSDC 4HZ8A 4FXJA 4LYRA 1NU5A 2YDQA 3R25A 3TC3A 1GQKA 5LXEA 3T4CA 3PNUA 4TX6A 2OELA 5D9OA 1OFBA 4TQTA 3GNOA 1JYWA 2PEVA 3LQLA 4U5IA 1MDRA 3FGCA 4D6HA 4OZOA 2HNHA 3B9DA 4BZYA 1TO3A 3PC0A 1E72M 1GEQA 7ENLA 1LORA 3LRLA 5E0FA 5DLCA 3CAWA 1WBJA 2WXDM 1NFPA 5FF4A 5I7GA 2GK1A 4Q7NA 2NSOA 2Y7EA 2A79A 3UD6A 4MB4A 1P1MA 3S3GA 3BQ5A 4IH3A 1UJQA 3A3HA 2JQXA 1UC4A 4JHZA 3VKKA 4JIPA 5H8MA 1KW1A 1TX0A 4DXXA 3Q94A 2O4QA 3BGJA 1A5CA 1E1CB 1ITCA 4MDOA 4W9TA 1XBVA 5FJIA 4K37A 1US3A 4QLLA 3VDCA 2PWHA 3RAOA 2VL4A 3VX0A 1DHKA 2GJNA 1TRIA 3REQA 4EPEC 4A8IA 3DFHA 3QQ1A 3E38A 3WJSA 4R9OA 4ZA0A 4O8AA 1AVAA 4HJWA 3I7RA 3O16A 4UTJA 5HPOA 4WJ8A 4U33A 1V8EA 1DIDA 4NY2A 3W53A 4G6CA 7REQA 2G4FA 1WAWA 1OINA 2VGIA 5F2MA 2Z6JA 2XVLA 3POCA 1DORA 2FIQA 1FDYA 1LWIA 4IMEA 5M17A 1DE5A 2HNEA 4E38A 1SPQA 2HZGA 2ODOA 2WNQA 3S6TA 3O6AA 1TVLA 3ARXA 3SADA 1TJ0A 2Z1BA 1GVYA 3NXLA 3BLEA 4LVFA 4AHOA 4O1CA 1FP9A 4JX5A 4HNTA 5DX7A 3AI0A 4UQ9A 2R1KA 2ATSA 3BJTA 1RQEA 3HN3A 4I9TA 5AC5A 2ZXDA 5EB8A 3HBLA 3BLIA 3EOEA 4HNVA 1UPMB 2PPGA 1GKPA 2NVCA 2Q8LA 1G0CA 2DJXA 1LQ0A 2VP8A 1ZSXA 4TX9A 1UWQA 1R3SA 1C9WA 3ERPA 1GJWA 1XM3A 1G94A 4EPDC 1CGWA 3NG3A 2RKXA 3W1QA 3EXSA 1PB0A 3VM5A 1BWLA 1PZ1A 1OC6A 1MXGA 4WDXA 4IZGA 4CKQA 1JZ3A 2PP3A 4HOZA 3OZOA 2W5FA 4DO4A 3KRBA 3WMSA 2NWSA 3N6HA 1PHWA 3VO0A 3MUAA 2YR1A 4LUSA 4UFHA 4LCSA 4HNOA 4RL3A 1LUCA 5KZEA 4NJKA 4JN6A 1RJQA 2VCCA 4HTBA 1W3LA 1CGUA 3QV8A 3VGFA 3EMCA 2YFOA 4DBEA 1EIXA 1TRDA 1KKRA 3EBVA 3KW3A 1RPXA 2ZICA 2CHRA 2ACUA 1M7JA 4CQAA 1SSDA 1F3TA 2G3FA 2GWNA 1EJSC 2H8XA 3TYUA 5BXRA 2PD5A 3TJXA 3AQUA 2WNNA 2DSKA 3WNLA 5CPOA 5CLWA 3T0CA 5J04A 4KIRA 5I23A 2Q3OA 3WD4A 3IAQA 4PL1A 3M0ZA 2XGZA 2EPNA 1YE4A 3TW6A 4MJZA 1HO1A 2FZ9A 4MGGA 3BLFA 1XIEA 2QUTA 3E6EA 1CENA 3UJEA 1L6WA 2WKGA 1RQBA 2RGLA 3W2MA 3NFUA 2BHUA 3VKJA 5C9RA 3IJLA 4R34A 4OHQA 2CPUA 4HYRA 1JZ6A 3PSWA 3B03A 3NGFA 5LA2A 4PCNA 5IDIA 3JVAA 1SR0A 1UR9A 1DEDA 3PZ9A 5FEZA 4IPLA 2QCFA 5F2GA 4MJ4A 4YMZA 1R47A 5I02A 2DSUA 3TWAA 1I2RA 4E5TA 1T41A 2A2IA 4C6NA 4IXXA 2QNEA 2XFFA 3SR7A 2QCCA 3BJSA 3PPCA 3B3DA 4CCZA 1TV7A 4WKHA 3UGRA 3FHAA 4CEXC 2GGIA 3KDNA 1PTAA 4J4KA 1PL9A 3D6NA 4H01A 2Z2BA 5HNTA 2C0HA 4AXNA 2QXWA 3QHOA 1JG9A 4GUFA 2Y8UA 2P8BA 4Z2KA 2QV4A 1PZ3A 3RCYA 2QIIA 3PM6A 2HROA 1IEVA 1K4HA 4GFIA 1Q2RA 3AJXA 2JBMA 1B31A 3LV6A 2YA0A 2HVMA 3M0XA 3TNBA 4F2TA 1RH9A 4LNCA 5CKSA 1E6SM 4GVIA 4QDPA 2C14A 3HFYA 4MZ1A 1X1NA 4TMCA 1KFJA 1ZHAA 3RLUA 3H2NA 1MDLA 3MSRA 2DSZA 3OLDA 1KWGA 1OK6A 4O19A 4DBWA 3BSGA 3N6JA 2H9AA 4W4QA 3ABSA 1GWJA 3W28A 1XICA 1K7EA 4UZSA 3W7PA 1HJVA 4L80A 2QVNA 5FD0A 1E70M 1FOBA 1XYFA 1K02A 1Q3NA 3S1UA 2HXUA 1SM9A 9XIMA 3OGVA 2VEIA 2WKJA 3R13A 3UT0A 1K9DA 1X6NA 2GYIA 3HV8A 4LRSA 1THFD 1S5MA 1JPMA 3WF2A 3WFAA 2O9TA 2ZRYA 1KC7A 4D2JA 4O13A 2J7HA 1BVNP 2PURA 4GQBA 2R94A 4O54A 1H7WA 3PHAA 4IP4A 2NXGA 2FVLA 1I2PA 3OZMA 2QV5A 3DFTA 4ENLA 4LH8A 1W6TA 3IRDA 3UZYA 4ZQPA 2EKCA 1GJUA 4LYPA 1BQCA 1XH2A 4C6LA 4CNSA 3ITTA 3LMZA 3F5KA 3GE7A 1VIWA 3OVRA 3W76A 3UG8A 3KBMA 3O07A 3UA4A 5AYBA 3DZ1A 3HZ3A 3SY8A 4H9UA 2ZADA 3GDTA 3TROA 3GC5A 4BQ4A 4HNUA 3HGRA 3VA8A 1GEHA 4LT9A 2PTYA 1DJXA 4PMVA 1BRLA 2QUNA 4GIRA 3UESA 1KBLA 3M64A 2J6XA 2PODA 1IWPA 4OWGA 5LNRA 4AXKA 2X7WA 3FA5A 3H70A 4DM2A 4GIYA 3POHA 2H6RA 1UWAA 4JKLA 3RLHA 2JIEA 2FGBA 5K3VA 3VMNA 5LNWA 1RZMA 2GL5A 3GVQA 1MYRA 4I8YA 5EYWA 4I5UA 2VD9A 3CU2A 1E73M 4JTTA 1HVXA 1A0EA 1TV5A 4Y2WA 3TSDA 1WB0A 4LAMA 3EX6A 4UMBA 4H9YA 4W93A 7TIMA 3W75A 3IAPA 4H19A 3EKZA 1IEQA 4K8HA 1H7NA 1HKMA 4ZOEA 3ZXWA 1JXKA 3TR2A 3LPFA 3G1VA 1YNYA 4KERA 2PDCA 3CQ0A 1OQFA 1BAGA 1H51A 1UR8A 1XYMA 2Z24A 3PAJA 2W62A 2BX7A 2O9RA 2VKZG 1KGUA 1ZB5A 4J27A 4JDBA 2SFPA 1CXKA 3K13A 1A5AA 3P60A 4HNLA 1LROA 4IM4A 3R58A 1LLZA 2V38A 4HU0A 1NFGA 4J3VA 4HTYA 3GKFA 2JALA 3W6YA 4C6DA 2FGLA 4M81A 1E1FA 1OFRA 2WW5A 3K1GA 5D37A 1AUSL 3SUUA 4WSJA 3VD7A 3VCRA 4EE9A 5BXSA 3E0IA 2C8NA 4ZQRA 1MSSA 2BOEX 1GCYA 2VR4A 5M1TA 5F4WA 1XD1A 4AY1A 3NZQA 1SZRA 3TMLA 4GWEA 3UA3A 1JFHA 3UR7A 1NARA 3M0JA 1IF2A 3QSTA 2DGAA 4IX0A 3H2MA 5HDRA 1E3ZA 4JNYA 2CLFA 2E9LA 1DJNA 3TC6A 4P2VA 1LLWA 1IIGA 3R10A 3HV9A 4NX5A 1EIBA 3MZ2A 3AIQA 2FDMA 6ENLA 1EPXA 1S46A 2E1WA 2OOGA 3L7RA 3A4AA 1FWAC 2BOGX 3EMQA 1OGBA 1Z69A 1RQHA 4W84A 3M7WA 3B0UX 2G8ZA 1PBGA 1F8IA 2RDWA 1SJDA 3VNZA 1HN1A 4UNKA 1Q7MA 3UF9A 1OG6A 1LG1A 2D24A 4IGHA 4ERIA 4CNOA 4GJ1A 1ZPTA 3T07A 5D9MA 2XG9A 1R7AA 2ACSA 3N2CA 4I5XA 3D3AA 4FF7A 1K03A 3G8EA 3OP2A 3EPNA 3QHMA 3SRKA 1W3IA 5D03A 4DUVA 3GXNA 3TOYA 1W0MA 3D46A 4KCUA 3W26A 3DBNA 4HHPA 3QMTA 1FKWA 4GI6A 1XIDA 4IPPA 1QI3A 2Y24A 1ALDA 1FWCC 3TW9A 2D1ZA 1Q6GA 1XG4A 3GS6A 3FVMA 4KMQA 2PC8A 4I8DA 4IFOA 4AB4A 1PAMA 4B3ZA 1QOXA 2C6QA 4KEZA 2WHMA 2ZQ0A 4GGBA 1GONA 1XGZA 1W2VA 2PLCA 4L4PA 1JUKA 3WLIA 4Z2LA 1YTKA 2YL8A 4FOKA 2GPTA 1UH2A 1P48A 3NURA 4MZYA 3PUEA 2TYSA 4Y9PA 4ZZ9A 1SU5A 3AXMA 3T4WA 3A12A 1E55A 1KFLA 1PO9A 3DDMA 1S2UA 1V7YA 3Q4DA 1TVNA 4O28A 5D30A 1HGYA 3NQDA 2QT3A 3OBAA 1H0GA 2D2GA 1EGMA 1FHUA 2IXVA 2EG8A 1ZRQA 2PGFA 2QPXA 5T8GA 1E9LA 3SJ3A 2BTMA 4AY7A 4XIAA 4HSOA 1G9HA 3F5LA 4P8UA 2PU0A 3FA3A 2HISA 4U2ZA 4PUWA 3L68A 4LV9A 3DEQA 1JDEA 4G56A 4DJFA 3VIKA 3AYSA 4LF2A 1HW6A 4GX8A 4JFVA 4DN1A 4QJ5B 2X0YA 3FHQA 1ELSA 1WKYA 3LPPA 5FF2A 2ZUNA 2NW0A 1PX8A 3PANA 1ZJIA 5BWAA 3K4AA 1OYBA 3W7CA 3WJWA 1OSEA 1TV8A 3SY1A 3W81A 4IIGA 2QAPA 2WQPA 5TD4A 1A5SA 4PTMA 1BWKA 1E6ZA 3BLKA 1G7VA 2FZDA 2Z7KA 3MO7A 3WBYA 3AHZA 3FY1A 3EPMA 1E3XA 1US2A 3GW3A 5JBFA 3EWWA 3T09A 2J7GA 5FOOA 3W25A 5SWUA 4M80A 2C13A 3VC6A 1HFBA 2ZX7A 4AZ6A 1ZY9A 3UCQA 1N55A 4LW7A 1R2SA 3UYIA 2CKSA 4NXKA 1D3CA 1IZKA 4FLSA 2VZOA 3KBVA 5CZJA 3GVGA 3CS2A 3E0WA 3DG6A 1NJJA 3N6QA 5BXPA 3QOKA 4KT2A 1N82A 3NPXA 4Q32A 1GJPA 1NQKA 2CLHA 5EMUA 2OO0A 3OODA 4XSLA 1MXSA 1C8XA 2INFA 4WSKA 3N17A 1GQNA 3JW7A 1DWFM 3EOLA 1YBQA 3IIVA 5K4ZA 2H90A 4FP1A 4DJFC 1RR2A 2PTDA 2WSRA 4YWSA 1SJBA 3N4AA 1W8GA 1OCBA 4QS6A 4V1YA 1WDQA 4OVXA 3IK4A 3QGAC 4RLIA 2HJPA 3TYDA 4ACZA 5DCDA 1HX0A 4ADSA 1RA0A 4BJHA 2W91A 5FJRA 4JIIX 4PTVA 3HIJA 3WL1A 3ZJKA 3LCIA 3AFBA 1W9XA 1OYAA 4YTSA 1AQ0A 1XUZA 1SJAA 1PWMA 1XLDA 1JF5A 2ZZ2A 3WF4A 1FWJC 4GINA 4DBSA 4NX0A 4KF1A 3WF3A 5LKYA 3QFEA 1B3WA 3VTRA 2CCRA 4PRTA 1ADSA 3WD1A 1H5VA 1ZL1A 3FGCB 2Z4GA 2WYSA 1LRTA 1CBGA 1HKIA 1W3NA 2HQAA 5FEPA 1Z3NA 2ZA2A 1OHLA 1HL2A 2BBFA 2XSXA 1QAPA 4ML9A 4Z2IA 3HO8A 1UD6A 3NQ7A 5AYIA 2GK1B 4R88A 4GFSA 3T2PA 1X97A 3WH6A 3BTNA 1DWJM 2QPSA 2QCLA 3VGDA 1R6WA 1B3ZA 1WDDA 4HZ7A 1J5SA 5CSSA 1VC4A 4Q8OA 2Y7FA 1WNOA 4QGCA 3ABOA 4YNGA 1JD9A 4DELA 1RD5A 2BLEA 5E6ZA 4KFOA 1KLZA 3R5EA 4H00A 2PDUA 3D5HA 3REQB 1JCJA 1YKWA 5LIXX 3SSJA 1GORA 1J12A 4ZB5A 2Z6IA 1ZCCA 2V63A 1E0TA 3IGXA 1PIGA 1XXXA 1B30A 1BVWA 2UY3A 4L64A 7REQB 5C7HA 3S5ZA 1IEIA 1QVBA 4QG6A 3K8LA 4CUCA 1XGEA 4LUYA 2YCIX 3BAWA 3CZJA 4A2RA 5C55A 3DKJA 4L4LA 4GXWA 1LLOA 4RNHA 1P7TA 4C6QA 3KVLA 3VU2A 2XFYA 3LXCA 1XUUA 4RZBA 5H2ZA 4MWAE 4OGZA 3SB0A 4CQBA 2AAMA 3P8JA 2WZHA 1VCGA 3CHDA 4PB5A 1TMLA 2ATMA 4CLMA 1CDGA 3UETA 4WUIA 1OFAA 1JDFA 3APYA 3KOZA 2W4XA 3JR2A 3MTWA 3IJDA 4LYKA 1W37A 4W8LA 4DAFA 4NYYA 2ACRA 1CT5A 1PX3A 1FHDA 1GQIA 1XDMA 3ZVHA 4BKNA 4IQDA 4WD0A 3WQFA 2WVTA 1I6NA 5CPTA 1CLKA 4A3UA 4PMZA 1C90A 3DAQA 3EXTA 1XD0A 3MYOA 2GGEA 1M6JA 4XG1A 2E8ZA 4Z2GA 3WQOA 3CZKA 1SZEA 1UR1A 1JGMA 1TJPA 1EP2A 3M4HA 3BGGA 5E6YA 2DY3A 1RK5A 1UP0A 1JNEA 4GE8A 1R9ZA 2E9MA 2WWCA 3AS2A 3AO0A 4M5PA 5AHNA 4PFMA 4YXGA 4LUSB 2Q02A 3MY9A 3MV11 4JQAA 3TTSA 1S2CA 3FDKA 4W87A 4GYKA 1LUCB 4GRSA 2J66A 4U31A 2OQHA 1CGTA 1WDSA 1BVZA 3BQ6A 4L6DA 4TXEA 3TXZA 5HQLA 4U3AA 5F2IA 3OLGA 2QJMA 1J0YA 3LX9A 4MOZA 1IEWA 1OIFA 2CLPA 3WIJA 1T96A 3P67A 2D0GA 2OCZA 2XIOA 3N13A 3PNZA 3AXXA 3LY0A 4RJEA 3TFXA 1EBGA 4HPXA 1HKWA 3K8MA 3B8DA 5A1AA 3VD4A 3W7EA 1S3HA 2C1HA 3U4AA 1ZJAA 3ITVA 4CQ8A 2POZA 5AYZA 5I06A 2X16A 4O52A 4AEEA 1V3KA 4TTGA 4HT3A 4QTGA 2WV8A 4MF4A 2ON3A 3PBVA 2CITA 3GSMA 2J27A 3WNNA 4KPLA 3IANA 3AXHA 5I5RA 2HK0A 4NRRA 2R9RA 3PJWA 2D2JA 1DVJA 4DJFD 4LSBA 3CYVA 4LC6A 1IZJA 1CXHA 3HPFA 1GVEA 3TAOA 2XVKA 4OECA 3C6CA 5A6TC 1MFVA 1IGSA 1YDVA 3EMZA 3TCSA 4D71A 5I2UA 2GWGA 2WSQA 1SQ7A 1G4TA 1MO0A 3ZJ6A 5HUOA 4CQDA 1T8QA 1O12A 2V2DA 2VC9A 5BRPA 3W7GA 2REQA 1EF2A 4TO8A 1L6GA 2AGTA 2DPEA 1VPXA 1PYFA 1ZU8A 3PWGA 4I9JA 4CD8A 1O1HA 1RAKA 1M04A 4HKPA 3G0XA 1VFTA 3E0FA 4UMAA 2WMJA 2ABBA 1FQ0A 4O14A 3TOPA 4JCMA 1OD0A 5CGMA 2VC7A 2CWXA 4NILA 3TN3A 4W86A 3NSXA 3MKKA 4C1NA 3AIBA 4PCFA 4H7CA 3W23A 4L4MA 3MKCA 4DJDD 1TFVA 4GZIA 5GNYA 3C8FA 4HHLA 5JBDA 4H9ZA 2A6NA 1SGJA 3QH2A 2JGYA 3NZRA 3E1F1 3MBFA 2PI6A 3A24A 3IVUA 3QZ6A 1OWQA 1ECQA 3WK1A 4CVUA 4GQQA 2VZVA 1S38A 3U2EA 1M7PA 3DFOA 4H9XA 4JTJA 3WELA 4GYPA 4HOWA 3ZJ8A 1XRTA 1V7AA 4JD4A 2YZRA 1F9CA 4F79A 3BGAA 2JFEX 4GD0A 3CHCA 4MHBA 3RXZA 4PODA 4EP8C 1E40A 1N8WA 1Q63A 1QPQA 1PDZA 3ONCA 1SO6A 1M53A 4H04A 2GDUA 2YIHA 3MPGA 1B57A 1C91A 3IJ6A 2INZA 2XFWA 3KDOA 4CN6A 4YTRA 1UZHA 2J74A 4GQGA 1JYVA 3L4YA 4M7TA 4LY4A 1V6VA 2HV5A 3WL0A 3W72A 1V6XA 3GVRA 1YADA 5I3FA 3LZ3A 1Z7AA 2V3EA 4WJEA 3GG7A 3TYAA 1UG6A 3KL3A 4RE2A 2ZYFA 1LWJA 3MMDA 3FNDA 1JUEA 1R2RA 3H2OA 3MJYA 1RY0A 3QR1A 2NVAA 3MSGA 5BXTA 4WF7A 4JFSA 2A6LA 2YBUA 1T8XA 4G8TA 1I75A 4FIRA 3VD3A 3APGA 2YA1A 1L0PA 3OO2A 5DRCA 3GWQA 2WKLA 5JQ9A 1NQ6A 3PP7A 3O3RA 3WMBA 2WPBA 1A4MA 1Q5MA 3PG9A 3CUJA 1FXPA 1TIMA 2AQVA 4LBSA 4GYPC 2ZDRA 4Z1CA 2BXVA 1OADA 2FDSA 3BAIA 3KL5A 4S23A 2OSXA 3WQ5A 1Z48A 2X7VA 4B5VA 5DMMA 3MUZ1 1B3XA 1JIBA 2CLLA 4UTTA 5AECA 4ZMGA 1EC7A 2ZVIA 1BRLB 4IPJA 3BURA 1NF7A 3AS3A 3GVVA 4O17A 3AU6A 2CZ5A 3AU2A 1CB7B 1ZBWA 3JZUA 3MS8A 4P5UA 4O1BA 4L1XA 1OZQA 4DPPA 1PEZA 4R3UA 1YNQA 5HMDA 2GJPA 2OZTA 1G4SA 2V9DA 2QZRA 4DI8A 3N4EA 1KXHA 3S5NA 3VFLA 1XWYA 1ZJBA 4K1WA 1LWHA 3H2EA 4RV3A 3I6EA 4M19A 3ZR5A 3GB6A 3IGHX 3T0AA 1VKFA 4DZIA 4QX4A 3B8WA 3W1UA 2PLMA 3KOWA 3PB0A 4LX4A 2Z27A 4KH2A 5EL1A 1QT1A 2CBUA 3AROA 4JFUA 3COTA 1I1WA 8XIMA 1XLAA 4U28A 3LNMA 1KQYA 5F4XA 1FH7A 3DX5A 3AYRA 4PTDA 2PDHA 2I14A 1GGOA 4TIMA 2V82A 1L6SA 5I24A 3GUGA 1H7XA 3L67A 1AMKA 3V3WA 5I09A 4A22A 3TU9A 1UIOA 2IW0A 4M6PA 1ZP4A 2CC0A 3DFPA 2YX0A 3F2DA 2CU0A 3OB8A 3QTGA 2IUZA 2ISVA 1E0WA 3S0CA 4UTTC 1K8CA 1K70A 3B97A 1VBRA 2ZRXA 2CHNA 1SZFA 3FA4A 3FEMA 3NQGA 2FVKA 1QHOA 3BUVA 3HFTA 3VKAA 4JX4A 3PG8A 1F73A 3LXAA 2CZVA 4HOXA 5DCEA 4XO6A 5JIPA 1KM3A 3RHGA 2XIIA 3PUOA 1UMLA 1W1A1 4FALA 4PMUA 2A1YA 3LCWA 3MYPA 2DW6A 3RX4A 4X60A 5K9CA 5HWJA 3DN5A 1WZAA 3PS7A 3QPZA 4NZJA 1R3RA 2XPKA 3T7VA 1XRFA 1AH4A 4AVOA 4AQLA 3RUBL 1CEOA 3P82A 1NFBA 3N4FA 5LSMA 2E0PA 1LQ2A 1UR4A 2X0SA 4HP5A 1BTMA 1JRBA 4Q8WA 2WZTA 3TA9A 1XBZA 2J88A 3IWPA 5HQEA 5C0QA 1ME7A 1SFTA 4FAMA 3VE9A 3L9CA 3CMFA 3BLOA 2ANUA 4DZAA 1Q4NX 2W9MA 1WYIA 3IUDA 1FCUA 4D6EA 3BWWA 1LDCA 3CMGA 3U2OA 2W79A 1W5QA 3UWEA 3VNMA 1I0DA 2YPIA 4PC8A 1DWGM 2NUYA 3BMXA 4DF1A 1F76A 4M7SA 1QNQA 4AZBA 1MUCA 4GXMA 3NPVA 2V2HA 5LA0A 1XC4A 1GOQA 3W00A 2YLLA 2VYOA 1B1YA 1PSCA 4JTQA 4NRSA 6XIMA 5JXQA 2R24A 3GXDA 3HQ1A 3V36A 2YCKX 1H61A 1POJA 4YTQA 4XSMA 3KFTA 3R0DA 1PZ2A 3M0IA 2EBNA 2XZ9A 3IVSA 1JJKA 3FYPA 1WZMA 2XU2A 4J40A 2C18A 2GDQA 2GOUA 4QSFA 2J8TA 4KCVA 1JXJA 4OBRA 2OLSA 5KMYA 3NSNA 2YGYA 3LGDA 4MLJA 3UG3A 3W2KA 3GLCA 5I3DA 3QFWA 3MW7A 3M9YA 4I9MA 2I17A 4JDYA 3LD5A 2NWRA 1X6UA 3ZSTA 3DUGA 3MUCA 1HQTA 2ZZ4A 5AYYA 3QV6A 4QJ4B 1XR2A 1X8FA 2WM0A 3TE9A 4UFIA 4N4PA 2X1UA 1MNZA 4PMXA 3CLWA 3ABRA 2PLKA 4YHGA 2HTMA 3B4UA 1RBAA 4H2HA 2OJPA 3BAYA 3SCOA 1QW8A 3S1XA 3TZFA 3E3HA 2ZUVA 2IMRA 2E5CA 4TMBA 3S1GA 4LB3A 4MZ8A 5CEWA 3ZOAA 1LZOA 1VLIA 2V3FA 3A9IA 4XZ9A 3A5FA 2QULA 1TE6A 1B5TA 1O5QA 1HVQA 1K77A 1LTDA 3VFCA 3AZTA 3WK0A 4FOUA 5E9XA 1XHGA 4WXZA 2OU4A 3UJRA 2VRJA 4AW7A 2PDMA 5JH2A 1PIIA 4XUYA 3RU6A 1P0BA 9XIAA 3HU7A 3PZTA 1FWHC 1JI2A 3OVQA 4TOQA 4R53A 3MSYA 3EKLA 4ROPA 3P6LA 3NQEA 2QMKA 3DCPA 3TKFA 1YBQB 3R1ZA 4US6A 4OU1A 4AWEA 4RZ4A 4IISA 1X38A 2NX1A 3HPAA 2O7SA 3BMWA 4AY8A 1MEIA 1V79A 1QO5A 4Z0JA 1EYEA 4Z1YA 1OCQA 5G1MA 2OWCA 1JZ5A 3TIMA 1J6OA 5K7JA 4HK5A 1AFSA 1C93A 4PULA 2FLIA 8RUCA 3AZSA 2QUUA 4PE8A 4GO9A 4QDWA 4RR4A 5DFAA 2CBVA 4LEQA 1DJWA 4BS0A 3BAKA 1QI2A 5K9XA 4AH7A 2AMXA 3VZYA 5LYRA 3V35A 3LN3A 3N34A 5CZ0A 2TMDA 2CLMA 1W1YA 1EJ7L 4L5ZA 4A8NA 3VABA 5BRBA 2IKJA 4BK9A 5DF0A 3GG1A 2VX4A 1MZHA 3V4BA 1W3KA 4TVCA 3M41A 4W8BA <