4MWAB

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
258
Chain Sequence
NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDKVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 83
structure length 258
sequence length 259
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaB00
3TYUA 2DZBA 2E7FA 3TYCA 1AJZA 1Q7ZA 4O1FA 3TZFA 4DJFA 3H2CA 4DJEC 3H2FA 4DAIA 4S3DA 3H2AA 4S3EA 1TX2A 3TYDA 3H2OA 4G9PA 1Q85A 2OGYA 3H2MA 3MCNA 4HB7A 4C1NB 4NHVA 4DAFA 1F6YA 1AJ2A 2YCLB 3H24A 3H2NA 3H21A 1Q8AA 4NILA 4O0QA 4DJFD 4D9PA 4S3BA 2Y5SA 3H26A 3TYAA 2YCKX 2YCIX 4MWAA 3H22A 4S3AA 4PZVA 3TYEA 1AD1A 3BOFA 4CCZA 1TWWA 4DJEA 2VEGA 3MCOA 1TWZA 3TYBA 4D8AA 2Y0FA 4MWAD 2H9AB 4DJDC 1TX0A 3MCMA 2DQWA 4D8ZA 4O1EA 2VP8A 4C1NA 4DJED 4DJDA 2YCLA 3K13A 1Q7MA 3H2EA 4S3CA 4S23A 1AJ0A 2H9AA 3TR9A 2YCJA 3NOYA 3BOLA 2Y5JA 3V5OA 4NIRA 4S38A 1AD4A 4DJDD 1Q8JA 4S39A 3H23A 1Q7QA 1TWSA 2BMBA 3TZNA 4MWAB 2VEFA 3TYZA 1EYEA 4S3FA 4DB7A 4NL1A 4DJFC 4MWAC 4MWAE 5JQ9A 2DZAA
chains in the Genus database with same CATH superfamily
1W1B1 3RLHA 1A3HA 2XZ7A 3H4XA 4AIEA 4FXFA 1H49A 2BDQA 2OO0A 4W5ZA 2G4FA 2NXGA 1H0GA 3G8EA 1P0DA 2DFAA 3NQAA 2PU0A 4AUBA 1BTCA 3T8QA 3TROA 1KRAC 4OQVA 2J75A 3WH6A 3H7VA 1E9LA 2REQB 2XG9A 5CZTA 1VYPX 1F2JA 3CZ8A 4LVAA 3EDEA 2FLIA 3NQ8A 2GQAA 3WF1A 1D8CA 4JHMA 1P6BA 4ROPA 1PYMA 2GUYA 3S2NA 3RJYA 3CAWA 1HUVA 2VC5A 1LORA 3WBEA 3LTPA 4UTIA 2PC8A 3U2CA 2X1UA 3LXBA 4LU0A 4H8VA 1XRFA 1XYLA 3CUXA 3M0ZA 1DOSA 4HZ6A 2Q8LA 1OCJA 2DVXA 2NVCA 2PZNA 3AU2A 3F4DA 3GHSA 1G4TA 3OOQA 1UR8A 2ZADA 3PFMA 2V63A 1PX8A 3LXAA 4LXFA 4YNGA 3O6AA 1K70A 5E5CA 3LPOA 2BOFX 2FZNA 1EDGA 4HGXA 2XFFA 2J66A 5JBEA 5HQEA 3T0TA 3NNTA 4LVGA 4C6OA 5DLCA 4H6QA 3C2RA 1JZ4A 4IPLA 4ASTA 2AOSA 3CO4A 4V2XA 5IM51 3LPPA 4UMAA 2WPGA 4GHRA 1EJRC 1RJPA 1TX2A 1FTXA 4Q4RA 3QMTA 1NWSA 3CLMA 3BSGA 1JI2A 3AHVA 2D23A 1TTQA 2PLMA 1TB3A 2FJUB 1X1NA 3K4DA 3UJSA 5F4XA 1RALA 2XTKA 4UMBA 3WLTA 3E5BA 1S2TA 2WB5A 3E2RA 2D2GA 1DBTA 3BAJA 4IFKB 4MB3A 3PZTA 3TNBA 1G01A 3W00A 2VX4A 1MW2A 4Q7NA 1GQLA 1R3TA 1OCNA 3AS0A 4HPXA 2JKAA 3KTSA 1MEWA 5DXXA 1V4YA 2X1IA 2VDIA 1CB7B 4KGJA 1GOIA 1POJA 1IEIA 1P0EA 1QTWA 3B0UX 4KWUA 8A3HA 2G0WA 1S5MA 4JTUA 2CERA 5FJJA 5A94A 1TR1A 4NT0A 1QI0A 1VFUA 2VFIA 3KVKA 5EKYA 1R5YA 1V02E 1GJUA 2C6QA 1AW5A 3WYZA 1QNPA 5D09A 1Y5WA 3OGSA 4A3RA 1WUEA 1BHGA 3RPMA 4RCXA 4UR8A 5LYRA 3SJNA 3GXNA 3FEMA 3GXMA 1A5MC 5DX7A 4C90A 4QS5A 3GNNA 1CXLA 1KKOA 3ITTA 4A3HA 4E6MA 3CUFA 1MZRA 1J18A 2G3NA 1KM2A 3B8TA 3WLNA 1YTKA 2DZSA 1GYNA 3HPZA 2O7SA 2YZRA 1GCYA 3EOEA 3A21A 5AC6A 1L8PA 2ZVRA 1OX4A 4JIEA 5XIMA 4D6HA 1TPH1 4Q33A 4GE8A 4D9PA 1EF2A 3CH9A 4WDWA 3L2IA 2JGYA 3RXZA 5MHBA 1WZMA 3EB4A 3CUZA 4MADA 2C79A 1CGXA 2ACRA 4HMEA 1TTPA 3VFLA 5LHEA 1PZ0A 5G2WA 1IE7C 5T91A 3W70A 2NQJA 4R7WA 2XSBA 3BK0A 3I7QA 3REQB 1TX0A 4CQAA 3A23A 4GG9A 1HKMA 3W88A 3I65A 4LYQA 1YX1A 1RV8A 2CLKA 3ES7A 3FHAA 1I45A 5DN1A 3WFLA 1EKOA 2VELA 2R8WA 2GJRA 3PANA 3EA1A 1OWQA 1DHPA 2X1TA 3WF0A 3UPWA 3HGRA 3FIGA 1A5NC 4AZ5A 1LOLA 5CQ1A 1XLHA 3P60A 2E5BA 3F2DA 2OZTA 4ENLA 3CASA 4JZ5A 4DF2A 4MB5A 4HSNA 3KP0A 3NXFA 2QAPA 1TE1A 1ADOA 2VC7A 4DB7A 6REQB 3TQ0A 4UQDA 5LNVA 2TMDA 2Y1HA 1JXJA 1NU5A 4QAWA 2G3FA 1Y65A 2C1HA 1X6LA 3UXKA 1V79A 1XGEA 1PBGA 1KFCA 2NUXA 3U4FA 5HNNA 3UA3A 2Y89A 1H4PA 4RLIA 2J13A 2FVLA 3VOHA 1EZWA 5I00A 2ZRYA 4E2DA 1A0EA 5CEWA 3W28A 5DRIA 2D2OA 4IQEA 2GJPA 3NZRA 4FK9A 4XUYA 4L65A 4REQA 1Q5MA 4GRSA 1UIPA 1T8XA 1L6FA 5DQPA 1S2UA 4IIFA 4ACZB 4NZ4A 4E4UA 5D9PA 2WZHA 3I3DA 1HJQA 2PCEA 3P74A 1XISA 1ZSXA 1B4KA 2G4JA 3BJTA 2E9BA 2FFIA 1QW9A 4I6KA 5DF0A 3HFTA 1QBAA 2E8YA 3MW7A 1HP5A 3CC1A 4G5DA 3G1RA 1J79A 3EWCA 1AQ0A 1QPRA 3UNTA 1LF1A 2Y8UA 2FTWA 3BOLA 4DBWA 2OEMA 2HEJA 1NDYA 4IGHA 3WBAA 3BGGA 4PMUA 1F8IA 2VFEA 1ME8A 1V6UA 1GUVA 4O10A 3DESA 2X1SA 5AYYA 1UROA 1UKOA 3G1FA 4X61A 3SI9A 1NP0A 1CI1A 1C29A 4GC4A 4GFIA 3CEUA 1CW2A 2V5LA 3VKAA 2RFGA 1OSEA 3GAYA 3A4WA 3VAVA 2BASA 3H2FA 2YLAA 1E4IA 2VUYA 2HCVA 5GJPA 3UXIA 4MKSA 4JNYA 5AC7A 3NZGA 5C2CA 5IHSA 2WMFA 3TIMA 3CIVA 4FIRA 1XV8A 4FLSA 4HZ8A 3PHAA 2YCIX 4RX0A 1GEQA 1S3TC 3CIXA 3DIPA 3FYPA 3RITA 4UCGA 1PV8A 5C0QA 1XDLA 1AH0A 3W2NA 5KEZA 1KFBA 5C6MA 1E0VA 4GH1A 3L0KA 2ZDRA 3CT7A 1DIEA 1XLAA 2BLEA 4XZNX 4Q8MA 3TTOA 4AC1X 4DF1A 2E0PA 3W01A 5A2BA 3TSBA 2JIEA 4AMCA 3O63A 3S5SA 3VC5A 1PDYA 3NO3A 4BJHA 4KW2A 4AYSA 3CH0A 3UFYA 4MPQA 1PHQA 4HP5A 1DL3A 4XZHA 4V33A 3WNNA 1J96A 1KRBC 2WKLA 4PN2A 1POKA 4K1WA 1U1UA 1W5OA 2C91A 2WZTA 5A6MA 3QSTA 4CD4A 1SR9A 1IEWA 5C9UA 4QFUA 3CV2A 3BDKA 1T41A 3BQ6A 3G1YA 4LANA 4PBGA 4EAYA 4Q4PA 3N17A 4GUJA 1A47A 3WQCA 2ADAA 2QCHA 3WX7A 2AKZA 3GK0A 3RR4A 1KM4A 2VRKA 4L80A 2JKEA 2WSQA 4M24A 1WXJA 1KQYA 4KCUA 3UG5A 3DENA 3GD6A 1BYBA 1SJAA 3V1PA 1V6XA 2Y5EA 1QNSA 4L6DA 3KL0A 2F8QA 4FALA 3UF9A 3PTDA 3GHUA 3N2CA 3G8RA 3AXXA 2YFOA 4AD1A 1X97A 5CJ5A 3EWZA 2H9AB 6TIMA 2BFGA 2Z4GA 4D72A 2GPTA 3UCCA 1JZ7A 3LCFA 2NVAA 4X63A 3QN3A 3VE7A 4OECA 3W7OA 4HOWA 5A6BA 2ONEA 4JTIA 5G1TA 3H12A 4QE1A 3W38A 4ZQNA 4AWSA 3W2UA 2Y6ZA 2W0UA 4PMDA 3AIVA 3IGXA 1T0OA 3OA5A 1E3XA 1RBAA 3LOTA 3IIXA 4TVUA 3UU0A 2CCRA 3D46A 3NDZA 4JTRA 3MVIA 4US5D 2F84A 2DIJA 1JYVA 2QNEA 2YYUA 1YQ2A 3LPFA 1XIJA 3SGZA 1IEXA 4ZO8A 2CHOA 1TVLA 4A8RA 4DM1A 4ES4A 3NFUA 3LRKA 4US6A 1V0MA 2DGAA 2XIBA 5AB3A 1FKXA 1BSLA 1MQPA 1MW0A 4H1ZA 3CL6A 4RDYA 4NF7A 4H8NA 1KRCC 2BSLA 3W7LA 1U2YA 2ZWZA 4DBSA 4IMAA 2J6VA 3ARQA 1RQHA 2V5BA 5AHFA 1I6NA 1TA3A 4IQJA 4AISA 5JU6A 5FJRA 2NV1A 1UOZA 5ABEA 1QRQA 4V1YA 4L9XA 3GWQA 1UR4A 4A4AA 4O1EA 2VXNA 4BWLA 4QS6A 2H3BA 4IG2A 2V3FA 5F4WA 3GNDA 4RDZA 4AH7A 2VL4A 2VZUA 4QBXA 3SCNA 1SUXA 2OQHA 2F6XA 2VUNA 5CKSA 2W4XA 4PTXA 5EL1A 1E1EA 4GGBA 1JXKA 5CPSA 2BMBA 4U5KA 4MWAB 5LNUA 3QYQA 1FXQA 2HK1A 4ZFMA 4MB1A 1C92A 1RQEA 4HK7A 4C91A 3QHNA 4CQ9A 3WLPA 2DIEA 2VWSA 3DHFA 1RY0A 3L65A 3EKZA 2PTZA 3WLHA 4ATDA 4GLEA 3GE7A 3SADA 2INZA 2H6RA 1H09A 4WKHA 4C6DA 4HNVA 3AZRA 1FCBA 5TNVA 2BTMA 1XLBA 3E02A 3NPXA 4UQBA 3PPGA 1KBBA 4L1WA 2XFWA 1BVZA 2PDQA 5BXPA 3KS5A 1CGTA 3BG3A 3TC3A 3VKJA 2ISDA 3NVTA 1M7PA 1A5UA 1TRDA 1OF8A 3OB8A 2V0TA 1O68A 1ITQA 2B7QA 4YS1A 1Q6QA 4O12A 4UIOA 1V7YA 4AC7C 3GKAA 3EWDA 4DWSC 1ONEA 2QJJA 3THAA 2BHUA 4ZQRA 4H6EA 1C8QA 1KTCA 4M5PA 3SQLA 3ARZA 3E12A 4LAKA 2VEMA 3RPTA 1G4SA 3XIMA 1E70M 2ZA1A 4M7TA 3TC6A 4AYGA 3STFA 1V6TA 2QUVA 3RPDA 2CEQA 1B3ZA 1WPCA 4OBSA 3PUDA 3M43A 4F2BA 3DC0A 3U4AA 4AEFA 2KX9A 3MBFA 5HUPA 4ATWA 5JVLA 4JTDA 3UZYA 1OADA 4HNCA 3GVQA 3LERA 4FNRA 3QZEA 1WNOA 1KCXA 1VS1A 4L4PA 2Z7KA 3RU8X 4GA8A 4JL1A 1NWUA 1XLMA 1KFLA 4ECLA 3Q37A 3TAKA 2D2HA 4RJEA 5D8WA 2W6RA 5GNXA 4H9YA 1QW7A 2PCQA 1XIBA 3RR1A 3LA4A 2E67A 1F61A 3BJFA 1QO2A 4CKQA 4DN1A 1FOBA 2YW3A 5HUOA 2QQ6A 3L4UA 2REQA 5IRPA 3GFYA 2FIQA 1I2PA 2F61A 2XIIA 1JDCA 1KFJA 4DO5A 3KS6A 4XVEA 3W7GA 5HJYA 3GC4A 3HQOA 4OT7A 4IP7A 4WLCA 3PK7A 1O4UA 3CHFA 4EXQA 2BOGX 1QUMA 1RH9A 3PS7A 4LS0A 3SJ3A 3ABRA 4NYYA 1K77A 1NOFA 4FB7A 1Q3NA 3P8IA 1ISWA 2WV8A 2WWDA 1H7OA 3W4RA 2QCDB 4E2VA 1PAMA 1XH1A 5A6AA 3RCMA 1DJYA 3OVGA 4M1RA 1S38A 4KCVA 3M1ZA 3EOUA 2PFHA 1J0HA 2BWGA 3GLCA 3OJGA 3GYCA 3GNRA 4UOJA 1MXDA 4H04A 1LLZA 1E72M 4Q22A 5EMYA 3TYDA 1GHSA 1K03A 3FW6A 1K4HA 2X2YA 1JULA 4LY8A 3CZGA 4O11A 3FDKA 3BV7A 1XLKA 4IMCA 1DIDA 3ARXA 3EEZA 4CQCA 1PKNA 2EF9A 3GR7A 1SO5A 3MWAA 1K8ZA 3NJ3A 3MUAA 4XZMX 4ZXLA 5AC5A 1YBQA 1KO0A 1AQHA 1B3WA 1TKKA 1J0YA 1QAPA 2F6UA 2C0AA 3TYBA 3PAJA 4QE5A 2OPJA 3HU7A 3SUTA 4A3UA 2I57A 3IJ8A 4HKPA 4IX0A 3SFKA 1VLWA 1W9UA 2E3ZA 1HJXA 3T0DA 4FS9A 4IUOA 1YPFA 1EIBA 3OLGA 3EMQA 3CIWA 1W9DM 3W7IA 1G0CA 4UTKA 4K8GA 1IXQA 1MNSA 1JRCA 3UWVA 3WH7A 1JI1A 5I0DA 2FVKA 1MEIA 2EKCA 2E9MA 3FJNA 4ACYA 2V2DA 3MB9A 1EO5A 4H41A 4C6JA 3NPWA 3OW1A 2VZVA 1TPWA 4WJXA 4XAZA 2V82A 4GNJA 4HCDA 3DERA 3EWYA 1F3TA 3P5YA 4YTTA 2B31A 3WLIA 1T5AA 1T40A 1GPFA 3D3FA 3WD2A 4DELA 2PZ0A 3C2FA 1E6RA 1AZ2A 1EGMA 3LSCA 4H19A 2J6XA 2VVSA 2GDUA 4YLWA 3SUSA 2OCZA 4QLJA 2E6AA 1JDDA 1OBAA 4HN8A 3TYAA 3W7KA 1V3MA 5G1MA 1WE5A 1GQJA 3H22A 3EXSA 2JBMA 1A5OC 5FJUA 3O9NA 1H1ZA 3IGUA 4JBRA 4HHHA 4L6OA 4N42A 4HHLA 4EPEC 4X9SA 3LHUA 3TTEA 3QVQA 1FP9A 1MQQA 2P0IA 3OP2A 1SVDA 1KWKA 1EEPA 4L4LA 4JTFA 2GJLA 5DANA 2O7QA 3GYEA 1BFNA 1T6MA 3LM3A 4L61A 1C8VA 3LXCA 4M8UA 4NQ1A 1EPVA 3SDOA 2OZ0A 4ZFCA 1OX5A 2XZ9A 4YTQA 2A3BA 3RCNA 4DLMA 4LOCA 3S9ZA 1WP6A 2DSKA 2JFEX 3DECA 1FWHC 3VXGA 3TP4A 3OEXA 3MZ2A 4PC8A 4OKDA 3IWPA 1KR0A 9XIAA 1X1OA 2ZUUA 4LCRA 3GC2A 4DWSD 4Z1YA 3KOFA 1OQFA 4UTTC 3Q94A 3HPAA 3VM5A 4EWND 2QXWA 2E7FA 1G9HA 3C0LA 3V35A 3RMJA 2DSWA 2ZUNA 1PEZA 2RJGA 3EWXA 3FV9A 4H6RA 4QLKA 5C70A 3D3AA 4C6NA 1UD5A 1SU5A 1U1JA 2E6YA 3GSMA 2I16A 1V3HA 4R7OA 1I1XA 1EX5A 4HVXA 5FL1A 3LRMA 3MU7A 2NUYA 3ID7A 1KC7A 3B0XA 3VC6A 4B3KA 1VCFA 3M0VA 5I23A 4W8LA 3B05A 1LBMA 3LMZA 5C54A 1ITCA 1ONWA 1O60A 2PRMA 3PR2A 2A7PA 3QY7A 4J40A 1OJXA 3C0JA 3EKLA 3W7EA 3N29A 4ACZA 4ML4A 1EHAA 5AC8A 1OCQA 1UPPA 3LB0A 3HN3A 1JUKA 4LALA 4MJZA 3WIJA 3O8AA 5AOUA 3LDVA 2XU2A 4CCCA 4PMRA 1AVAA 3KEHA 2ZOXA 5TF0A 1P6WA 3TN6A 1ZZMA 1VIWA 1ESWA 2RAGA 5D33A 3WEMA 3WN6A 1ZAHA 4WY0B 4KH2A 3EX4A 3HO8A 5LNWA 3C3NA 2ZUVA 4WHBA 5T8GA 3OYZA 3TYCA 4OBRA 4R5EA 1E5JA 1NQ6A 3CB3A 2FTYA 3F5JA 2A3CA 4YWIA 3F4CA 1ISVA 4AZIA 3CLWA 4KMQA 4RDWA 4E38A 4PUMA 1TPFA 2NXIA 3PC0A 2G95A 4J3TA 2CBVA 1VIZA 3AZTA 4AMAA 5A6SA 3H2NA 1DYSA 2OXNA 4G7FA 3V5CA 3TC7A 4HT3A 2V2HA 2D69A 2XHYA 1CENA 2YCKX 2CLIA 3BICA 1KXTA 4RZBA 1I0BA 1F7BA 4W85A 2YL6A 1DWHM 1AD1A 2TSYA 4DWDA 4IPJA 2IPFA 4W89A 2QCNA 2G5WA 1ISYA 5BW6A 2GGEA 4L6HA 3W85A 4E8GA 4LUTB 4DEFA 1F76A 3CTTA 4AHQA 2A5HA 2VO5A 1SW3A 3M47A 3NPVA 4JAWA 3DGRA 1VJIA 3E9AA 4TVCA 1EJ7L 3AO0A 2ZKMX 4LRSA 4B4HA 1TCDA 2XH2A 3HMJG 3URBA 4H9MA 2WOQA 4U4MA 4XO6A 5CAKA 1P5BA 2A21A 2QPXA 4WUIA 3DX5A 2BHYA 5CSYA 1EJUC 1ZU8A 2F2HA 1DJZA 2Y2WA 3Q58A 1EWEA 4GQRA 1XXXA 1PX4A 4ZB2A 5FF0A 1WDDA 5IDZA 4YCPA 3VIFA 2W61A 5C8BB 2BS9A 3FSUA 1OABA 2BNJA 1SQ7A 2JEPA 4A2SA 1NF7A 5D04C 4AIOA 2DUAA 3FY1A 5H2ZA 1CEOA 1XG3A 3ZJKA 4XD6A 3L4WA 1J2BA 2NXHA 5HPCA 3A4AA 2INEA 1RJQA 4PUKA 3CUHA 1C8YA 2J79A 3ZR5A 3T2QA 4JNMA 4BHYA 1UKSA 1GTHA 2PGEA 5DT7A 2ACSA 3M46A 1QNOA 2YXOA 2G50A 1W1PA 4WOQA 5DELA 2R1NA 5KSWA 2TAAA 3VO0A 4NI8A 4DUOA 3W1UA 1QNVA 2R14A 4F8XA 1QT1A 4FLRA 2VI0A 3OQEA 2WMIB 3GZAA 2VP8A 4GBUA 2J7DA 5BRBA 2JGQA 4RKAA 4JX5A 2H9AA 3W23A 5DMMA 3VCNA 4J2MA 1E4LA 4X3ZA 1AD4A 4DF0A 4FI4A 4S2CA 2VENA 4IQDA 1OEPA 1JJKA 1UJPA 3FJ4A 4HBKA 4O15A 4ADTA 2PGWA 4KEUA 1VKFA 5AKQA 1FWSA 4I7UA 1W31A 4KFPA 1GGOA 3UZWA 3ZOAA 3DGBA 4RZ6A 2R24A 3N73A 1JF6A 1V3IA 3WLJA 4PUJA 4AVFA 1KA9F 2DU2A 4NX0A 5BRPA 2ZZ3A 3FFSA 1L2QA 4O1AA 4MZ8A 2QDHA 4W8BA 4IMDA 2NLIA 3JS3A 1ODUA 3NQEA 3TK7A 2FPYA 2WNNA 3FHQA 3ABXA 2YA1A 4H3DA 1GVIA 1TMLA 2G3MA 3ZJ7A 2QCFA 3CAQA 1JCXA 2QVNA 3MJMA 4P7OA 2C8NA 3C3UA 1VD6A 3QOMA 1E6ZA 3EDKA 4XZWA 1J6PA 1L6YA 5LKYA 4HN4A 1GJWA 2PD9A 1FP8A 1Q65A 1H60A 1BPLB 1VFMA 4OUEA 5CJNA 2OTDA 3A9BA 5FEPA 3UWWA 1H41A 3KOXA 3OVPA 1UP3A 4PB3A 1JIBA 4GIYA 1VHNA 3O0KA 4XZLX 2IPWA 4O16A 4LYRA 2PDNA 4GJJA 4P7LA 2PDPA 3FX4A 3GW0A 1L6WA 4GY1A 4X0VA 1XLGA 3W72A 3AMCA 3SAZA 1SSDA 4DX3A 1UPMB 4PTDA 2GUBA 2EO7A 3F03K 1PIFA 1VC4A 2V5CA 1UWIA 4MY8A 3UY7A 1GNXA 4H01A 1JD7A 5ENLA 3KWSA 4AXNA 3T8LA 1DJXA 4C60A 1OYCA 2DT0A 1M03A 1ZB5A 4GIEA 2PDKA 3VIMA 4IWWA 3CXOA 3MKKA 5FEXA 3VIGA 3VPLA 4PEKA 4HPGA 2WM0A 1VYSX 5D37A 1A0CA 3VCRA 1TIWA 3HIJA 4O4VA 3KLKA 3VDAA 4YMZA 1MSSA 3S46A 3L4TA 3AALA 4UTMA 1H5VA 3SY1A 2E8ZA 3ZVHB 1S1PA 1LOQA 2P50A 1OD0A 4DJDA 4R85A 3TJXA 1D9EA 1M7JA 2C3ZA 2WLYA 4GCAA 2ZX5A 3BLIA 3EB2A 2ICSA 3ALFA 3M4HA 4AF0A 4AXKA 1QHOA 1XLIA 2TYSA 3BH4A 2BY0A 4LQ1A 3MMWA 2YBUA 5FSEC 1XC6A 1M5WA 4C6BA 2YDRA 2XH7A 3VE9A 2E09A 4L64A 3CUIA 1KD0A 3P0WA 3T07A 4ZMGA 4YVPA 4R7JA 2YYTA 3R8GA 4XKYB 5LA1A 3APYA 1R8LA 1QOQA 3KM8A 2WCSA 4KESA 3RO8A 2YCLB 4QDMA 1W8GA 4DZAA 3DC8A 2WPBA 3PZOA 3RMEA 3SGUA 3T42A 3MUCA 3MQTA 1ZAJA 3PUOA 4WOZA 2ZQ0A 5D2TA 3LBMA 2FDMA 1GORA 1XRVA 1JGIA 3BQ5A 1OYBA 1W5NA 2QVHA 3DHDA 1GZJA 2PWFA 4W8AA 3CZKA 1NFGA 1Y0EA 2A1YA 3PSVA 4D6EA 4ORMA 1KGUA 1YHTA 1K7EA 3BSHA 4ZR8A 3ITLA 4NNAA 2MANA 2OYMA 2DQWA 5B80A 3LRLA 2VX6A 1WV2A 3B04A 2WVUA 2QV5A 3GX9A 3W1AA 1W37A 3LCGA 1MEHA 4G7EB 5GJNA 2OT1A 8CGTA 1DWAM 1HNYA 2VJXA 4V1XA 1IWAA 3NQGA 3TKFA 3W1RA 2HE8A 3NR0A 1Q6GA 1UHVA 1TQXA 5JH2A 1ALDA 2XVPA 3EDDA 3TZNA 4NJGA 3GQYA 1CLVA 2J7GA 4W7UA 2WHJA 5I07A 1KBLA 1PCWA 3S8HA 3F1QA 4U5IA 4N9BA 3T78A 2VFHA 1DWFM 1Q66A 4AIUA 2QCDA 3C2VA 2AAMA 3BAWA 2FFCA 4F2UA 4WKAA 5BMXA 2W63A 1NWRA 1F5ZA 3THDA 3DFPA 5CH9A 1C91A 3A24A 4ZTXA 4O0KA 1Q6LA 1HL8A 3S47A 2AGTA 3WD4A 2OKOA 4LB4A 4B5XA 3DBNA 3WLKX 3IGSA 3QGAC 1ICSA 4Y9MA 1QOXA 4JNZA 5FEWA 2IQTA 5I79A 5KMYA 3BAKA 2WMJA 4HMNA 4IIBA 3IACA 5CC7A 3UYIA 5I3DA 2GGHA 5A95A 4HU4A 3WQOA 4NZCA 1WZAA 1G5AA 2F2KA 1ECEA 4KWVA 5F1UA 4EAMA 3EOLA 3V7PA 1GONA 4O14A 3WLOA 3WQVA 3URQA 3CPUA 5REQA 1UB3A 1P7TA 1QATA 3QFEA 2J9XA 1GEHA 1BVNP 1VF8A 3OGRA 2GSHA 5BROA 2YCJA 3LV6A 1EC7A 1VCGA 2NWRA 1GQKA 1FWRA 4D1JA 3KAOA 3K8LA 3VDHA 4NSBA 1LCOA 1QK0A 3EWUA 1JCMP 4JIIX 4P2VA 3TN5A 3ORWA 1EGVA 4HHPA 3Q45A 1EWDA 1FFRA 1G6CA 3R0DA 2QUMA 1VH7A 4LRTA 3U2ZA 5TD4A 3I6TA 5K7JA 1VBGA 1OIFA 2FHBA 3M0HA 2PDGA 4A3YA 3FA5A 3VU2A 1XSJA 1RPXA 4IQLA 4KWOA 1XC4A 4GYFA 4C5YA 3MCNA 3TONA 1PE1A 4KERA 1O1ZA 1W1ZA 4O8RA 2NT1A 1JGMA 4IFRA 4MVAA 3S6OA 1UC5A 1OD8A 1J0ZA 1LUCA 1Y5XA 3UWUA 3WMSA 1X6NA 3WNOA 1R7AA 2DZVA 1C9WA 4TO8A 3MP3A 1BSIA 3TV8A 3I10A 1KCZA 2YL9A 1W56A 1DE6A 3KW3A 3W7NA 3RX2A 5KTLA 1B90A 3ARWA 2EPHA 2QCGA 1W3LA 2PMQA 4Q4MA 3TMQA 3G0SA 1QI4A 3S5NA 3TJLA 2Z1KA 2WSYA 2OQYA 3GTNA 5LZLA 2D2JA 3HPXA 3PPCA 2RGLA 1H7PA 4RE4A 2YSWA 1J2WA 1GVOA 1UD4A 3BLKA 3URAA 3P6LA 2I14A 5LA2A 2NQHA 3O07A 3NZPA 3MMDA 2P1FA 2FH6A 4QDPA 3KBWA 4QE4A 1Q6RA 1IWBA 2OX1A 3AHZA 5GNYA 3FA3A 5F7UA 3E96A 1RQBA 1TPEA 4QM1A 3TYZA 1HJWA 2CWNA 4CEUC 3TU9A 2CHNA 5K9XA 4GYPA 1LL7A 2RHGA 3GDRA 4PCNA 3QKZA 4IP4A 3RU6A 1QI2A 5D9MA 1W6TA 2QLYA 3GIQA 4FF7A 2XN2A 2IXVA 3DYPA 3F5LA 3D5HA 5A8PA 4CNPA 4CNTA 1F4HA 3BGAA 3WLRA 3IRSA 3S1UA 4B9ZA 2P8CA 1YMYA 3AMGA 4HYRA 5FI8A 3UR7A 4BZYA 3URNA 2AMXA 4RPQA 3WK0A 5C9XA 4O0QA 2F6KA 3LM7A 3OLEA 3NGFA 3IVUA 1FWDC 4J1OA 4GQQA 4XB3A 1JG9A 3EXRA 1LJYA 3VX1A 1WKDA 2VCCA 3I4EA 4F79A 4N7QA 2HXUA 1ZJHA 4K2SA 4JDYA 3IJLA 2VEGA 2ABBA 2DUXA 5IBXC 1XLJA 2PEVA 3MTWA 3D0CA 3ITXA 1JDAA 2BVDA 1KB3A 5I2UA 1KGXA 1GVQA 2O9PA 1YPIA 3GTFA 2BY3A 2ZVIA 4NX5A 2YA0A 2ZXQA 1TV8A 3N11A 1GKPA 1WCGA 5MKGA 5E9XA 1SZNA 3TX9A 2GSEA 2CITA 4GKTA 4UNLA 3SCUA 1OFRA 2HPIA 1HL2A 4Z2IA 3NGJA 3W83A 1E43A 4UTLA 2B7NA 1J5TA 3MO4A 4NZJA 3IK4A 5J8LA 2YDAA 5F2MA 3VGEA 1O94A 2IPGA 5C9ZA 1VPXA 1FWBC 1QPKA 4XKMA 4YHGA 4WEVX 2X16A 3T0BA 4LH8A 2PLJA 4MAVA 2WCAA 4WY0A 1QPOA 4AVNA 2WCGA 1TUXA 5HAOA 3WNLA 2X05A 3N9KA 2A3AA 1EOMA 3O15A 4FIQA 4JQ2A 1VR6A 2PDMA 4PRWA 2RH9A 4UWMA 3F2CA 3TNOA 1R9ZA 4KIEA 3QH2A 4IXXA 4J3SA 4DXVA 4GZJA 4B92A 4F0RA 3G3MA 5EGRA 1S2CA 3WDJA 3PJUA 1CXFA 3NIYA 4H9XA 3GG7A 4DWSB 3GTIA 2VDHA 3DDMA 1CGYA 2HBXA 3SY5A 1UKQA 1PVNA 1YNPA 3CQJA 4WIWA 1OVDA 5KZDA 2BHZA 2CLOA 2CKSA 3QR3A 4ZODA 5IFTA 4K1GA 1EJSC 4YHEA 3CHEA 4J5NA 1DVJA 1BWLA 1KLZA 3LGEA 4LUTA 1NWTA 1RHCA 1L9WA 3WZ0E 1OX4B 1W2VA 1FQ0A 3NQ2A 2B81A 3QKEA 4GVIA 2A4AA 2UY4A 3ZR6A 1M41A 4H7ZA 1KCLA 3W1TA 3XINA 1UR9A 3ITCA 1KCKA 3QY6A 2D73A 3N4FA 5AYIA 1QFEA 3IV8A 4FP1A 1MW3A 2Z7GA 1SYTA 3UA4A 4MZYA 4HNUA 5D2YA 1C8XA 3MBDA 4Q4OA 1HF6A 2WC3A 4GUIA 1WDQA 3VIIA 5D9NA 4QLLA 4OTKA 1EH9A 2INFA 1TZ7A 3W3OA 4E3TA 1UBPC 4IH3A 1U5VA 4M81A 4DYEA 3C0SA 3GR4A 4U31A 5C2XA 4DUVA 1G94A 4KEZA 4CVWA 3W7QA 3N19B 3PFRA 2EPKX 3L4VA 4O28A 2D0GA 1Z48A 4TUFA 1O1HA 2V3GA 3OA3A 4JDBA 1KBJA 4JFWA 3PVFA 3MSYA 4RZ5A 4QEEA 2Z25A 5GQBA 1W32A 1XDJA 4G2DA 3GH7A 1FWWA 1H7NA 5BMWA 1OFAA 1AUSL 5AECA 5HWJA 7TAAA 4ZO9A 1KWGA 1W9PA 5DY2A 1Q4WA 2DV0A 4F48A 2RJHA 3ATZA 4S38A 3VDBA 1WKEA 3A12A 3GDBA 3FKRA 5F1VA 4S39A 4B5VA 1OFBA 2HVMA 4M29A 2PBOA 3MDWA 2VFFA 3GH4A 1P1MA 3B9EA 1UZHA 3DG3A 1MRQA 5D30A 2DZAA 5E0FA 3LX9A 3L66A 3FVDA 1HKVA 1JZ3A 5CSUA 1QBBA 3E0WA 4MJ2A 2GZXA 4DZHA 1ZRQA 2J24A 4ILSA 5CPOA 4Q8OA 4XISA 3TQKA 4HB7A 2NVDA 3WLSA 3FA4A 2YPIA 3TXVA 5E6ZA 4NP7A 4GUHA 1JYNA 4JX4A 4I7VA 3WQ5A 2Q8XA 4W87A 4J7RA 1GPWA 3L0NA 2QKFA 1WX0A 5I5RA 3WEOA 3DFOA 4NZ5A 5H91A 3MUIA 3FEQA 4LJ3A 3DH7A 1GWJA 2DSZA 3OZYA 1S3HA 2Y0FA 3SRDA 3VGFA 1DEDA 2GWNA 3NUKA 1VEMA 4D2JA 1SZRA 3A9IA 1UKTA 1TMQA 3VMOA 1E51A 1S2WA 2VD8A 4IPNB 1EC8A 1PL9A 2ZYFA 1US3A 3DFSA 4LAOA 3GBEA 3MYPA 1JUEA 1A0DA 4LBRA 1XLCA 3CNYA 3BXWA 5D2VA 2D1ZA 2GGGA 3LCWA 4R53A 3S1XA 1SFSA 3W1NA 4FAMA 2BX7A 4XBKA 2DSVA 3CPGA 4UFJA 1DWJM 1Z42A 1V77A 4DJFC 2VTFA 1WAUA 3IPWA 1FWGC 3A47A 3EWBX 5A2CA 3A13A 4H4IA 4HPNA 4JFSA 4P8UA 4Q6XA 4NI3A 1XBXA 3USBA 1MYRA 4H9TA 3NURA 3SGGA 1EUAA 3A22A 3T2OA 1UA7A 4N02A 1R9YA 1THFD 4NVTA 3PZGA 3QPYA 3GG0A 3OIHA 4L5ZA 3N18A 1M3UA 3L12A 4PCTA 3QZ6A 2V30A 3YPIA 1J8VA 3CZEA 3OBKA 3N3TA 2W66A 2XGBA 4JQ4A 4S3AA 3K4WA 3T6CA 3RM4A 1TPDA 5D38A 3UZZA 4CCZA 2PTYA 2GGJA 5ABTA 2ZXBA 1AL7A 4PMJA 3GVRA 2E25A 2C1GA 2VRJA 3GUWA 5EFDA 3CMFA 3SSZA 3ARSA 3C2EA 2WHLA 4CQBA 5C9WA 3LTYA 4X2RA 3VDCA 1ZBKA 1A5BA 5KZ6A 3G1SA 2A3LA 2IMRA 2ZRWA 3OBAA 4O1DA 1YDNA 2E77A 3BL3A 1GOMA 3CWHA 1PTDA 3KOZA 1XM3A 4JN7A 1ML1A 3FJLA 4US5A 1EP3A 3T55A 1GKQA 1D7KA 1P1XA 1I1WA 1FHLA 4G6CA 4INFA 2IKHA 4J28A 3HA1A 4GIRA 1HP4A 4XAGA 4GQBA 5HK4A 3NWRA 4J2PA 1JYXA 4WDXA 1HIZA 3QW3A 3AIBA 3CM4A 1H7WA 4B4FA 4EK7A 3TVAA 1N8WA 3ARPA 1T99A 3VTRA 3NL6A 1TSIA 4DLFA 1LWHA 1XLEA 3ITGA 4O4WA 3M07A 3ANUA 3PZQA 1GOQA 4NAEB 3T08A 5I24A 1V7AA 4OU1A 4PE8A 3FDGA 1I0DA 1P0BA 4EF8A 1E9YB 1AMYA 4GZ7A 3DOPA 3Q65A 4GYKA 3MT1A 2WQDA 3ALGA 3ZT6A 3WL1A 1R86A 3BCFA 3QLLA 1HVXA 3PZNA 3UR5A 1UH3A 2Y61A 3VCCA 4Y9AA 1JR1A 2ASHA 4N9CA 5CXPA 4GI9A 3HGSA 4GQGA 3I4KA 4C6QA 4QGCA 3SCVA 2GWGA 3VABA 2OLAA 5C71A 1D8WA 2RKXA 3ICJA 3AIQA 4YJ5A 1LP6A 5FCZA 3S3GA 1I9CB 4AVOA 2FJKA 2EHHA 3KOWA 1NDWA 3IJQA 4CN1A 1AODA 3OBEA 1WOAA 1GZ1A 1JZ8A 1D2KA 3INPA 3CWOX 2WKGA 4G7EA 3EOOA 1TA3B 2Z1SA 1DIKA 1NAL1 1SW7A 5HULA 1D7FA 4PMNA 1BRLB 3WDQA 4I8DA 3WLLA 2HE5A 2WW5A 1NP2A 5EB8A 2H8ZA 3W26A 4DYKA 2OX4A 3GU2A 3B0PA 3BLLA 3MHUA 2YDQA 1AJ2A 3W1QA 4HK5A 4OIFA 4D71A 2XGZA 3R10A 4RDVA 2R1PA 5C7HA 1ZENA 1QW8A 3TWBA 4V27A 2ISVA 3W1PA 1X6UA 3SFWA 4JIPA 1EZ2A 2EPNA 4HOXA 5E0KA 3SURA 3SB0A 1R30A 3WF2A 1CCWB 2PAJA 1GVEA 1SZGA 3LU2A 5D8ZA 1A49A 1XLDA 4I9TA 4AAJA 5FEZA 4KF1A 2PDWA 3NZQA 2EG6A 3BZGA 1S5TA 1W54A 1XGDA 5AN7A 3HPSA 1DQWA 4M80A 4S23A 1HX0A 4P7RA 3DHPA 3T05A 2D20A 4JQ3A 1PB0A 3PF3A 2FB2A 4HSHA 1C9DA 4LC8A 2ZUSA 1W1YA 4DO7A 3RLUA 5I7GA 3GNOA 1GQIA 2J7EA 3DFHA 1RCXB 3UVAA 1CXKA 4C7FA 2VKZG 3EMZA 1L6GA 1UOKA 2Y7GA 4AD5A 2X0HA 2J7BA 1VB9A 4Q32A 3HG3A 1OF6A 3DG6A 1S2AA 3MV11 3KXQA 3LD5A 3S2JA 3EA3A 2OEKA 3IUIA 2QV4A 1LRTA 4JY9A 1LQ2A 3QR1A 4EE9A 2A6NA 4C6FA 1KFWA 3EEGA 4BF7A 4M6VA 1XGZA 1WA3A 3G1AA 1KXHA 1OFPA 1V02A 2OG9A 5B7ZA 2CLLA 1GOWA 2V81A 3M5XA 1EX1A 3KCOA 4DJFD 4ZB0A 4D6JA 4UTWC 3L23A 2PODA 1FCVA 2Y7FA 4AZBA 4BS0A 2VOMA 1G67A 3WDRA 4QG9A 3QV6A 3C8NA 3NO1A 1RSCA 1SSGA 2YKKA 4WY0F 3VUSA 1OG0A 2QUTA 2XM2A 4D6IA 1XICA 3MYOA 5HXMA 3QZAA 1EIXA 3H55A 3DZ1A 4D8ZA 1F8MA 3EX3A 5JIWA 3W87A 5J04A 4ZOEA 3FYYA 2C7FA 1IYXA 2QCLA 4JX6A 4QXIA 3W6LA 4ML9A 1X8FA 3OODA 1SMAA 4XZ9A 2FZBA 1A5AA 1AQFA 4TR9A 3BANA 8RUCA 1W3HA 2WWCA 3W7HA 1J6OA 3ZM8A 3PZUA 4PTNA 3TFCA 1OFQA 1E40A 1QR7A 3RHGA 2R6OA 1BGGA 2ABAA 3GHRA 2BXYA 3NEHA 2BBFA 2I9EA 4FPSA 1B0IA 1ZCCA 3A3XA 2RDTA 4RW3A 5CC3A 1S5VA 3VYLA 1D3CA 5HOSA 2OELA 2OR2A 1TYGA 3A5FA 1HT6A 2J8GA 2ZTJA 2ESCA 4AD4A 4GZEA 1SM9A 4RL3A 3VMNA 3VNIA 2J7HA 4MOZA 3OPSA 3TUUA 4O19A 1OZQA 2YX0A 4BKNA 2OODA 3AYTA 1TJ2A 3LBOA 2Z1WA 3N04A 4C1LA 3GFXA 1IEQA 4N0RA 2A79A 1U5JA 4PCPA 3S5ZA 4AWEA 1ITXA 3SIZA 2AMGA 4Q4SA 5AZ0A 2IUZA 1VBUA 2J74A 2WJEA 4WKFA 3S0CA 1QNQA 3E38A 1XYMA 4J3UA 3C2YA 4XO7A 4AZ6A 1CPUA 2G3IA 4WQ6A 2UY3A 5EBAA 4BI6A 1ME9A 4K8HA 4Z2JA 1PTAA 3W2LA 4XK2A 2V69A 5DEZA 3RDKA 1WDSA 3V18A 4XSLA 4QG8A 1BXCA 4FSAA 4IOTA 3MJYA 2WBKA 4CCEA 1X96A 4QCEA 2X09A 3G18A 2J25A 4IIDA 4E2OA 2YCEA 3GG1A 2Z24A 1B30A 3M0JA 4Y8EA 1YBQB 3WELA 4MWAE 1RR2A 5BU6A 3P82A 1NM9A 4MMWA 1JL8A 5T26A 5FF2A 3QV9A 2VZSA 1MVYA 2VZOA 4P7QA 4IL2A 4MJMA 1VP5A 1MZHA 1PCKA 4N2YA 4NHVA 3WLQA 4B91A 1FWFC 3V16A 3VDGA 3II1A 1Q63A 4W88A 2W91A 1OFEA 2W67A 5HNTA 4DXXA 4DHGA 3EYPA 4R88A 3P80A 4M6QA 2O0TA 3PBWA 3UESA 3MHGA 1TFVA 3H6OA 1JQVA 2ACUA 3O16A 2IKIA 4ICMA 3AHTA 1BWKA 4UCFA 1M7OA 4D8AA 1W3NA 3CUGA 1UWRA 4FNUA 4CLMA 5T9CE 3SCWA 4C1NA 1GKRA 3QJAA 4YCOA 1RY8A 2HNEA 4YYCA 3WQ8A 1GT8A 4DWSA 4KETA 4IJBA 5CC6A 4FX8A 1K9EA 4V15A 3AC0A 5C7VA 4A8LA 4RE0A 1Z7AA 3AJXA 3WKZA 3JR2A 1TVPA 3GB6A 2FZ9A 4EPKA 2XN0A 2VEFA 1FDZA 5KZEA 1Z32X 4HNNA 5FL0A 1SO3A 3U7VA 4ZGYA 2TRSA 1DQXA 1AMKA 4TX8A 5JH1A 1XD0A 1VRXA 3DAQA 2OLSA 5CG7A 5LXEA 3HGJA 4XBJA 1W3TA 2V5JA 5A6TC 1EQCA 3ZYZA 4LUJA 1NELA 5CZJA 1IR1A 3W29A 1H63A 3ENLA 2QS8A 2VVNA 3PB2A 2XVLA 4TQTA 3I3BA 1BYAA 3WQPA 2A0NA 3VNKA 3CUJA 4IJRA 4MZ1A 5C9RA 4ZVJA 2PURA 3WQGA 1JF5A 5BXSA 5M1TA 3W84A 3MSDA 4OUIA 5H8PA 2UZ9A 1KXQA 1RK5A 3MC5A 2JQXA 2NWSA 2WNWA 4I9JA 1ZJIA 2E1WA 4C5ZA 3GU9A 2Z6JA 2J7CA 3B9AA 4HK6A 3W73A 3K13A 4XBSA 1YDYA 3F4NA 5D32A 1AW1A 2Z00A 1QK2A 2NUWA 3IJ6A 2Z28A 3HB9A 1XCWA 5BRQA 3BJSA 1B54A 3WDIA 1V3LA 4K3ZA 3S5YA 3VIKA 4IJCA 5T9BG 3ARUA 4FNQA 3MMUA 1VFSA 1EYEA 2HS6A 3G3DA 3NSMA 3NL2A 1M04A 2O4QA 3MSGA 3UJ2A 5AVNA 3QY8A 3MKCA 4NNBA 3KBJA 3IAQA 7ODCA 3C61A 1OK6A 4FNSA 1XFCA 1AJZA 4JTQA 1EHNA 2UBPC 3QHOA 4LVFA 4HA4A 3SN4A 1V3JA 4IM4A 3QPZA 4WDTA 2ISSA 3R25A 4PYSA 3KCJA 5BNKA 3DI0A 3ME3A 2ZWYA 2PP0A 4IPPA 5M03A 3GDMA 1WDRA 4KKXA 3DFYA 4ZQPA 2QW5A 4ZL1A 4PUNA 5HQLA 3ABSA 2XFYA 4U2ZA 3DN5A 3B8WA 5CZSA 3HQ1A 3TLLA 1HJSA 1W3IA 1VBHA 2CHRA 4XG1A 3I3EA 5G2IA 4KRTA 1CNVA 3U3HA 4CU6A 1V03A 3NL3A 2W9MA 3HM7A 3PULA 3B8VA 3M5VA 2BGNE 3QPEA 3A6OA 2JE8A 4GX9A 1TJPA 3W2JA 4MLRA 1E0WA 1M9HA 4N4PA 4AZCA 3S5OA 2GFTA 1XBYA 1ZCOA 3S1WA 2Z2AA 3D47A 3W76A 2G8ZA 4EP8C 2GOKA 4ALDA 5HNUA 5CPTA 4B9YA 2AQOA 1RAKA 4KGLA 4WXYA 4O1FA 4K8EA 1HKIA 4JHOA 4DUXA 2VGIA 5A6KA 1O66A 1JPIA 2H90A 3SRKA 1Z69A 1E1CB 3VNZA 3T81A 5DMLA 4LT9A 4LEQA 2XGIA 2QAFA 3LYEA 3QTPA 4PH6A 4HU0A 3TTYA 1H2JA 3GDTA 1TZZA 3UR8A 2YL8A 2F38A 3EX2A 3ZJ8A 3QEZA 3RRAA 4HHMA 2WHMA 2FH8A 1TWWA 3IEBA 3GFZA 2VZTA 3G1HA 4B16A 2DW7A 5A6JA 4RE2A 4UC5A 5CG0A 3UXLA 4KIRA 1EDTA 3PWGA 3JZUA 4H83A 3TOPA 4DJED 3S83A 3T0CA 1HG3A 4DBUA 4EIVA 3QV8A 4PODA 5M3WA 3W82A 3QTGA 3S6TA 4DYJA 4GC3A 3UPBA 4GVGA 3QFWA 4R33A 1RD6A 2MNRA 3BAYA 2E6FA 1BAGA 2DZTA 3SRHA 1UR2A 2VGGA 4GQ0A 1TWIA 3VNJA 3IK2A 1XYAA 1IR2A 1KV5A 5FSDC 1SW0A 4PTVA 3LLXA 4E4FA 5DMNA 1N55A 4L9YA 1HZYA 4RNFA 5K2ZA 4D6FA 3AROA 4M0XA 3RUBL 3WJXA 4YPJA 2D22A 1A5CA 1Q7ZA 5E9AA 4D1IA 1EP2A 2NT0A 3WY1A 4CCDA 4UTTA 1SFLA 1YLVA 4CU7A 4GOAA 1VGAA 3VZYA 1JNDA 3T40A 3FXYA 4JTCA 1QU4A 3WL0A 3H8AA 2QCMA 4WXZA 4XIAA 3BLOA 3PP7A 1LZOA 1FX6A 1A50A 2V67A 1E15A 2ZX8A 1HXJA 3PBMA 3VI2A 5EFFA 4AHPA 4JYDA 2OSYA 3AMLA 1NFPA 4NAEA 4PA8A 3M16A 1Z9AA 3UCQA 2J78A 2X1RA 3MANA 1VRDA 3CHCA 4MY9A 1VQTA 4XX6A 1OFDA 1YW1A 3V0SA 3HG4A 4FXSA 4KCWA 1UD6A 2FPVA 4KS0A 4E0CA 4PSPA 3MUY1 5J5DA 3BAIA 4UB9A 3KBSA 1XWYA 3VGGA 1QI3A 1E73M 2ZRZA 5E6YA 3V5OA 1LT8A 2V3EA 2ZUTA 3O0FA 3TSDA 3EAUA 6A3HA 1IT8A 3I6EA 2OZ8A 1J0JA 4FX6M 5CLTA 1K8XA 4V28A 2D3LA 3H4WA 2SFPA 1U33A 1XUUA 1F05A 3TZFA 3OG3A 4TMBA 3VIJA 3KRSA 3FSTA 3UD6A 3WMBA 4C6IA 1AK5A 4HPHA 1BRLA 1GTEA 4HA1A 3N34A 3P84A 5DCEA 1QNRA 1ELSA 3DEQA 1TQJA 4MYXA 1EYWA 3UXAA 2V5KA 3O6DA 3WD3A 4UR9A 3ES8A 3GNPA 4QROA 3VINA 2MUCA 1NVMA 4FF5A 1VAHA 4PL1A 3DKLA 1XCXA 2XVKA 2YR1A 3AICA 3UW6A 1DHKA 1YKWA 3M0YA 4WSHA 5JMUA 1CB2A 4UOQA 3P93A 3KHJA 3P67A 4MNLA 5AHMA 3FOKA 4I7WA 1FHUA 4Z2LA 1HJVA 2BVWA 3CWNA 1BVWA 5AYBA 4C7GA 1W5QA 2CETA 5HANA 3FNDA 5CZ0A 4KWWA 5I02A 4Y90A 1TREA 5LA0A 3SCQA 1TWSA 3IVTA 4PMQA 4DO6A 4XAFA 3W25A 2CXGA 2GVJA 3W2KA 3W7MA 1ZTVA 3P14A 1EF3A 3I6RA 2QZRA 4Z2HA 4GGHA 2A3HA 4UUIA 5EY5A 1LLOA 1KM3A 4KPLA 3MY9A 4S1FA 2G97A 4NUWA 1GK8A 5AVHA 4JTKA 2WKJA 1LOSA 1FWCC 4WSJA 2J27A 4I9AA 3K4AA 4QNWA 2VQUA 3QV7A 2A3EA 4F0LA 5KINA 4LF1A 4BQ5A 2I7GA 4OOUA 3AIUA 4O50A 4AF0B 4W9TA 1JD9A 5CLWA 2Q01A 1DJQA 2VHLA 4LBSA 4FXRA 3FVMA 4CNNA 1W9XA 2DQXA 4KBXA 3THUA 4QEHA 3UQNA 3R43A 3IV3A 1EGZA 4WGHA 1FVPA 5DRCA 1C93A 5EMMA 2PWVA 1XLLA 4MWAD 2WQPA 2EPOA 4FOJA 4EOUA 2AKMA 4JN8A 1WZKA 1YDVA 3AYRA 3RCYA 5FKYA 3KL5A 3UGRA 2Q71A 2ANUA 1TIMA 4GXMA 3KTXA 2QIIA 1O5XA 3PUEA 3VNMA 1UC4A 1IZKA 1KTBA 3DCPA 1E9ZB 3ZFHA 1OFOA 1GG1A 2ZX6A 1A53A 3TMLA 5AC4A 4IPIA 4FNTA 4AW7A 1G69A 5C5YA 3FCPA 3DUGA 5EBUA 4TX9A 3AHXA 3ZSSA 3WBWA 4NG3A 3VIPA 1ECQA 3VK5A 2OSWA 1YTDA 4RNIA 1JZ2A 4H7CA 3R8HA 3M5YA 5K4XA 4PMOA 3AYSA 1M68A 3BARA 2HPMA 2W5FA 1ZAIA 5CPLA 1XJBA 4OV4A 3IJ9A 5F2LA 2XPKA 4X9YA 2POTA 1RP9A 1SFJA 3BVJA 3O3RA 3PBGA 4F9JA 1ZL1A 3VZZA 2XISA 1DV7A 2O55A 3NYZA 3B4YA 4KT2A 1PSCA 4PZVA 4F40A 3GW3A 3NM3A 4JOMA 4ZEPA 1CXIA 1V6VA 2C71A 2P3EA 2AL1A 2E5CA 1IXOA 3GS6A 1OC7A 3CHVA 3HJZA 1S39A 2R9RA 3QSRA 1M7XA 3MCMA 3N3MA 1CBGA 1WBJA 4QAIA 2YBVA 3RFAA 3MUXA 2RDXA 4GYJA 5DY3A 5LIXX 1ICPA 5AHNA 2WMHA 4HJWA 4GX8A 3WFZA 1C90A 3ZLHA 3KTCA 1OCBA 2J9YA 4W7WA 1R3QA 3NZ1A 2DEPA 3SRFA 3ZT5A 2P76A 3CS2A 1XKYA 1F6PA 1Z44A 2J62A 2QCEA 3PTKA 1NQKA 3RX4A 1B3YA 1IHIA 4UQAA 2XJ7A 1EO7A 3GXPA 2I9UA 4NXKA 1J10A 3EPNA 5BCAA 1SJBA 2OO6A 3G22A 4RK8A 3M7WA 3N2BA 5I3JA 5EPDA 3NXLA 5HMSA 5A8OA 3EXTA 3W7JA 4AEOA 3AWOA 3GBDA 2PDXA 3WF3A 4RR4A 5REQB 4U3AA 2PBGA 1FHDA 1P7TB 4QR6A 4YTUA 3BCJA 3H21A 1O6IA 4ROQA 3STGA 3UEQA 4M1BA 3H26A 4N6FA 4DBEA 1I4NA 4Q8PA 1UW9A 3BW2A 5I77A 3JRKA 3O1NA 4X0NA 1PZ2A 3W81A 4MKNA 3HZ3A 4CUCA 4WDUA 2WVSA 3P5ZA 2QDDA 5LXXA 4JFTA 2YB4A 2XFRA 1HVQA 4GI8A 1OGSA 4XZIA 4DIAA 1W9VA 3C4UA 3WUGA 1Q45A 3L4ZA 2YXGA 3U57A 4TV5A 3WG6A 4A21A 1PS9A 3NDYA 4UNIA 1XPGA 1M53A 1SMDA 5G4EA 4JQAA 1LUCB 1YTEA 4PUUA 1A80A 3AWNA 5HATA 4BQ4A 4PULA 1XD1A 1YRRA 3WMLA 5LNRA 1BTMA 4D8LA 3VGBA 1KFEA 4A35A 4L56A 3B9NA 5DCBA 3VKCA 4H8UA 4L1XA 2EPLX 4P5UA 4GPNA 3T4WA 3P62A 5CPMA 4BF9A 1GVSA 4A3QA 1P0NA 2VEPA 2IQDA 4IGSA 2OOFA 3GY1A 3A64A 3NDOA 4K6AA 3W1XA 1SJCA 1A5SA 1CGUA 1NFBA 3S2CA 4YU1A 1UUOA 2HMCA 4MUZA 2OZ3A 1JPKA 3W22A 4MDOA 4Q8VA 4AX6A 3LCHA 5CPQA 2D0HA 4O18A 1W8SA 1DP0A 2VR2A 1FA2A 3EZ4A 4DI9A 4LSBA 4L7ZA 1VFFA 2J8TA 3N15A 4RNHA 1BQCA 4PGLA 3R8RA 9RUBA 3LHZA 4LX4A 1MFUA 4TX6A 2KZHA 1H50A 4MHBA 3VOIA 2AQWA 3SY8A 1NSJA 2O4MA 2I5QA 4Y8FA 3MO7A 3OZMA 3VNDA 3DYMA 1HKJA 3ANVA 2H3DA 4GI4A 2D0FA 3FJ6A 1GOOA 3WBYA 2ACQA 3W71A 2HJPA 3A4JA 4WSKA 5I3FA 1X1ZA 3G2GA 4BI5A 3WQFA 2ZUMA 4R9XA 3E2QA 1IT7A 1UG6A 1VHCA 4E8DA 3HQNA 3H2AA 3WBXA 2OQLA 5A2AA 2GOUA 2OVLA 5FA5A 1C7TA 2PWGA 2DZPA 2QHAA 2QUNA 3LHVA 4DAFA 3TA6A 3MS8A 4UTFA 3ITVA 3H24A 1LM1A 3N6QA 4Z0SA 1HJUA 1KTNA 1WAWA 2ATSA 5MKGB 4KFOA 3B0VC 5IXEA 1LT7A 1XIHA 3ZQ9A 5SWUA 3B4UA 1EJXC 5EU9A 1E6NA 2V9DA 2C15A 2EPMX 2ZCGA 3G0UA 4JTSA 3E1F1 4KFNA 2Z29A 4UTJA 4B5WA 3ONCA 4F0MA 3CAVA 3LHYA 1V51A 1S2VA 2WSRA 2WC4A 3GHTA 1K9TA 3PWIA 4WD0A 1MO0A 3G1VA 1VENA 4G56A 3FK4A 1JRBA 1OIMA 4A8IA 3VFCA 1PO9A 2ON3A 3CQHA 1KM6A 1AQMA 1HW6A 4TXEA 1E5NA 4JHZA 3SIMA 1EOKA 3UXDA 3W02A 5E70A 5I6SA 1ME7A 2C14A 4NZFA 4ZQMA 2FB3A 1F3EA 4HNOA 4DVOA 1FUYA 4I5XA 3U2OA 5B7YA 5A6LA 5JQ9A 1CXHA 4FEZA 3V0UA 2XSXA 2VNCA 1T96A 4DPPA 1XI3A 3TA9A 3KE0A 1R7OA 4JQ1A 5FACA 1XYZA 1VCVA 1CZ1A 1SO6A 2PTDA 4M82A 4POCA 1EA0A 3W1MA 3TWAA 1UP2A 4QJ5B 3EDJA 4ICNA 1KNWA 1V0KA 2HK0A 3S9YA 2NX9A 1YADA 4AY7A 4LGXA 3LZ3A 1XF0A 2Q8ZA 4W7VA 1E1CA 1W1A1 3QQ1A 1EQPA 1XSKA 2L5HA 3KRBA 2DT2A 5HDRA 3MI3A 4AD2A 3EPOA 3UG4A 1FCQA 3LV5A 4XV0A 2W92A 3C2OA 1J0KA 3ISIX 1ZBVA 4S3JA 4LWWA 5LHFA 3H70A 3IIOA 2C16A 4E5TA 3QYSA 4Z17A 4EWJA 2YLLA 1JAEA 3AI0A 1XRSA 1FWNA 3UP8A 1XSIA 2C0HA 3KCLA 3EWWA 4EF9A 2PGRA 1CT5A 3E49A 2WLZA 1J4EA 3R0KA 4PCSA 3LK6A 4ADSA 3H23A 3NQBA 2DSUA 2QGYA 5HR6A 4AU0A 2CBIA 2HZGA 4MPKA 4WCJA 3M6DA 4NL1A 5HBFA 4CGTA 1U30A 3M5ZA 1V0LA 1JPHA 3B8DA 3LEPA 3LCLA 3B40A 5RUBA 4F4RA 4LBUA 3W75A 5IFPA 1UH4A 4GBDA 5G5IA 2E9LA 3B3DA 4YXGA 3EOSA 5LIUX 7TIMA 2OFJA 4Y9OA 5CBIA 4MNMA 3PZIA 1MNZA 5C2GA 5CAHA 3SQSA 1MW1A 4C6KA 1J93A 3GVWA 1B3XA 2PF8A 4L9ZA 2CW6A 4HMDA 1JCYA 4AD3A 1UYQA 4LVDA 2AL2A 4LVBA 2OKTA 3UETA 5HNRA 2GK1A 2QMJA 1TV4A 4NKCA 1PKLA 3OGVA 3ECQA 3LZ5A 2VOTA 3VOFA 3W7RA 4MTVA 4MGGA 3DHUA 4E8CA 4WR3A 3SW6A 3SCSA 2ISFA 5ECUA 1QDSA 2Z26A 3R7MA 4IMEA 2BB0A 3P7YA 4NNCA 1C3FA 4HPJA 1L0PA 2XIOA 3PTMA 5IBXA 4U3CA 3W27A 3RX3A 4YIWA 4EANA 4JKKA 3W37A 5DT5A 1XHGA 4AQLA 2X7WA 3KUMA 3P8JA 1UJQA 1JNEA 2QF7A 1GYMA 4H9ZA 4B15A 5CPNA 2TODA 1YIXA 1OC6A 2I5GA 2VDGA 4F0SA 1Q6CA 4GXPA 1MQRA 4BEUA 3W74A 2Z1VA 4GJ1A 4LAMA 3IJ7A 3UY8A 2EEXA 1BEUA 1T8QA 3DG7A 1KXVA 4CQDA 1R2SA 3SUUA 4GY0A 4JS3A 1ZALA 4DO4A 1I8JA 3TR2A 3EA2A 1VYRA 4P61A 5HMEA 1UD3A 4IUGA 3WDHA 4AHOA 4CEXC 4FNPA 5J5RA 1QOPA 5ABFA 1FWTA 8XIMA 4UZSA 4YVVA 4EACA 1FWJC 3BAXA 2ZE0A 2PDCA 4HA0A 2PP3A 3N6JA 5E0CA 1ZFJA 3ATYA 3F2BA 1XIMA 3CTLA 1HKKA 5TIMA 4NJKA 2GSJA 3QC0A 4OV9A 3NSXA 3TR9A 3C5QA 3LSBA 3TN3A 3K1GA 3WH9A 4OFCA 2TPSA 3KVMA 4HYWA 4FLQA 1NEYA 1Q7QA 3N4EA 2Y88A 3PN8A 5CGQA 4ZE5A 4C6MA 2ZA2A 4C6PA 3WD0A 1DTUA 3IIPA 2VR5A 1MDRA 3IAPA 1VPQA 2OT0A 2QCCA 5HINA 3RILA 1M1BA 3VVGA 3W0KA 2A7NA 3VOJA 2QJNA 2PWDA 3FGCB 1JZ5A 5IDIA 3GNXA 2PDJA 3OHIA 1RD5A 3MA8A 1Q8AA 1XYBA 4LC6A 3EB3A 3T1GA 2QR6A 1V6WA 3T09A 2O9OA 4L4OA 1L8NA 3WJSA 1PZ1A 4XTIA 2GJXA 1XYCA 3B03A 2DH3A 3RNDA 3TSMA 3ZS4A 5FF7A 1JDFA 3CB8A 1EC9A 5DBTA 4P7NA 2OEJA 1XX1A 4QCFA 3LGGA 3AXKA 4FR1A 2OOGA 2FZ8A 3AS1A 2X40A 3HGOA 1SPQA 2CNCA 3HF3A 2FGZA 1KM1A 3UJFA 2JF6A 2VC6A 3IARA 3R79A 1CIUA 1FKWA 4FZIA 2VFDA 1SZFA 3ITYA 3SQMA 3M0LA 5AYXA 5TAOA 4AZ7A 1NTHA 3LI0A 3PB0A 4LUYA 3ABZA 4CNUA 4K38A 3F4VA 2CZEA 2IS7A 4UQCA 1K8CA 3B8UA 3LG3A 4G1NA 2CPUA 4J9JA 4DI8A 3L21A 3PBYA 1IT0A 1WQ5A 5H1WA 7REQB 1NF0A 3E74A 2ZZ1A 4Z1BA 4Q8WA 1US0A 3WK2A 3L9CA 1BXNA 3BOXA 1UR0A 3KFTA 2PWUA 4QX4A 3MI2A 3H2MA 3S1GA 3R89A 3QC3A 3W1LA 4RZ4A 3OVRA 1OB0A 3AFBA 1KV8A 2WZEA 5JIPA 2FZMA 5I3KA 1W9BM 3G1XA 4ERGA 1DJIA 2GQ8A 3U9IA 2ZTKA 2VC9A 2V6AA 4UFLA 4Q7BA 1G4PA 3KVJA 4LUSA 3CL8A 1HGWA 5IOBA 1E0UA 2HS8A 3ZXWA 4DXKA 3OZPA 5I3GA 2Q3OA 1IXPA 1G7VA 2QUUA 4RXGA 1E6XM 3ABQA 1W2PA 3L2LA 3BZJA 1RUSA 4HNLA 4PFMA 1NH6A 2Z6IA 4ZB5A 3WD1A 4HJFA 1GHRA 3PBUA 2XIQA 3JUGA 2HV5A 1XIGA 2PRHA 3FLUA 5HWMA 1QMLA 3Q4DA 4H8HA 4CNOA 4ZE4A 2FGLA 2V68A 3A3HA 1G7UA 1GZGA 2WJDA 3ZWSA 1BWVA 4B90A 5A3HA 3K1DA 5D9OA 4GJIA 2E6DA 1OY0A 4F3HA 3DFNA 3WK3A 4O1BA 3TQVA 2FZDA 3I7RA 3CO8A 3KBVA 4GO8A 3M7SA 1TV3A 2IPJA 2VX7A 1LROA 2RGMA 4QJ4B 1Q2RA 3GVVA 5ABGA 4AIBA 2VURA 4JN6A 4DJFA 2WVTA 3H2CA 1AG1O 3O05A 2E28A 2I17A 3G0XA 3VKBA 4QTGA 3NO5A 1UH2A 3V0TA 3IJDA 4RV3A 4HMCA 3ANYA 2QMKA 1DJNA 4DM2A 3BMVA 3OYXA 1F73A 1I2QA 4DPQA 1HN1A 2X0YA 1EA9C 3KOYA 1E4MM 1JCTA 4LEFA 4O1CA 3RN6A 4YYFA 3UWEA 4IT1A 3BOFA 1F3WA 1K02A 3BMXA 4WZHA 1RCOB 1GG0A 4NAFA 3PZVA 4MJ4A 5I3HA 3DFQA 3RM8A 4B5TA 2VWTA 4D6DA 4MKVA 1BYDA 2D24A 4XQ6A 4C6CA 3ZLFA 4I9MA 1PDZA 3CEPA 3N2XA 1E55A 3SEPA 1CECA 2VR4A 4H2CA 4PL2A 1VFTA 1VBJA 4RW5A 1Y5VA 8TIMA 1Q6EA 3QF0A 4U33A 3R94A 4Z0JA 1XIDA 2Y4SA 3WNPA 2XN1A 3VIHA 2PD5A 6XIAA 5XIAA 3W86A 1BF2A 1FDYA 2POZA 4WX2A 4AG0A 3COTA 2OB3A 1JFXA 5BWAA 4I8YA 1JCJA 4JIRA 3WQEA 4RXFA 4B2DD 2NW0A 5FAJA 1XIFA 4D6GA 1RXOB 5ABHA 5I03A 4GWEA 1LYXA 2GUUA 2Q02A 1ZNNA 3VD4A 4I5UA 2ZRXA 4R27A 2DUZA 2CBUA 2FHFA 1FWEC 1W17A 1LL6A 3BW4A 3V36A 3C0QA 3I68A 3V4BA 2WZIA 5DO8A 4S3BA 3ARRA 4PTMA 1I75A 2G96A 2WHKA 3M6YA 4J3VA 1TMHA 3PNUA 4GH3A 1C7SA 3CQ0A 2ZC8A 2VCAA 1HO4A 3OO2A 5CCZA 3G1DA 1GOKA 3JW7A 1OYAA 4FX7A 2AGKA 1SFTA 2G3JA 3T2PA 2VEIA 2QGHA 2EJ1A 3P2VA 3VD5A 1JCLA 4AEEA 3MWCA 3MZNA 1ZPTA 4FOUA 4YWSA 4XVDA 3RM9A 3UERA 2G41A 1R3WA 3U8GA 2OWXA 1ONXA 2WNZA 4JY8A 5G4HC 2FVMA 3N14A 2FMOA 3NQMA 4NY2A 5LSMA 4XTDA 1F6KA 3ARTA 3VD7A 5CJMA 4WGXA 3F5KA 5D05A 3V3WA 4UTHA 1LWJA 2EKGA 2V3DA 1XINA 4C6EA 4JR5A 3N12A 2UY5A 3CJPA 4UFMA 3P3BA 2R1KA 2WVVB 4OHQA 1O5RA 1H7XA 3L0GA 3P61A 4CNSA 4OE7A 7ENLA 3H2OA 4K39A 4AZHA 3UZXA 3GRIA 4HA3A 5I3IA 1FCUA 3TJIA 1ZJAA 5FESA 3NA8A 2W62A 4K37A 3SCOA 4A22A 3E5PA 2ZXAA 5C55A 2YJQA 3LNMA 1VPYA 3LTSA 5HJLA 3BLFA 2OYLA 1ZGDA 2FQIA 3OG2A 4JPGA 1ZLPA 4YL2A 1LL4A 1U83A 2BY1A 3HURA 1DQUA 4QSFA 4K68A 3NQDA 4PMYA 1TWZA 3C52A 1U5HA 1ODZA 3KVLA 5KETA 2RUSA 2BVYA 2YGYA 4OJYA 3K46A 1OG6A 2QJHA 2IW0A 2VD9A 1RBLA 2J8FA 4I3GA 5EMUA 4N9DA 1A5LC 1JVNA 4FA3A 1RCQA 3N1AA 5LGZA 1P4CA 3GO2A 2QJIA 1R2RA 2RDWA 4DNMA 4UQ9A 1OZMA 1WDPA 1ZY9A 2NSOA 2PP1A 4S3FA 4RV8A 1F3XA 4IFKA 5F2IA 4D6CA 4Z42C 4O17A 1AH4A 2ZZ7A 1QWKA 1A3XA 2NX3A 4KWSA 2IKJA 5GVJA 1B2YA 1DE5A 3WJWA 1TCMA 3NL5A 4ONVA 1H5YA 2A6LA 3L4XA 3C56A 4PB4A 4Q3MA 2QIWA 3K2GA 3UNDA 1IWPA 3B8SA 3LCIA 3N2MA 1LRQA 3AS3A 1PPIA 2CLPA 5CGTA 4C1NB 4C65A 2ZZ6A 2ODOA 2NQ9A 4PUWA 3OHMB 4KEMA 1TR9A 3E6EA 4HNTA 1E0TA 3CV7A 1XG4A 1QXLA 3PJTA 2J9ZA 2PDFA 2RDUA 3HTWA 1WKFA 3E2VA 3O7UA 4UTWA 3WF4A 3CGTA 5K9DA 1L2UA 3CBWA 3VNYA 2BZNA 5K3VA 2BVTA 1XW8A 1J11A 1O12A 1OK4A 3GKFA 2DZUA 1OT1A 2AAAA 2DZWA 2F9RA 3AAMA 1EUNA 3RO6A 4JTJA 2VT0A 2WYSA 1CLKA 2O92A 3S2MA 3VGDA 2CC0A 2I56A 4CD8A 4QRNA 4I90A 3V5FA 6ALDA 1H1NA 1CYGA 1TVNA 2CWXA 2QEZA 3A5VA 5D4YA 1L6SA 2WAGA 2ZZ5A 3ZWTA 3BTNA 2PI6A 4JD4A 4OBTA 1FXPA 2YOCA 4P8VA 1J12A 3SCRA 4ZOBA 3T9PA 3CV1A 3QRHA 4BY3A 4UNKA 7CGTA 2DJXA 2QPSA 3S42A 4JKMA 3SM0A 3REQA 3AYVA 3IUDA 3K30A 5CBBA 4PUEA 4H2HA 3CQIA 3NEVA 1YE6A 2X41A 2CLFA 4AWTA 4HTBA 2PF0A 4M6UA 3OLDA 1ZP4A 4QJ1A 3AOFA 9CGTA 2WXDM 2YL5A 3JVAA 4AY1A 4DZIA 7A3HA 5JBDA 2BGSA 4O54A 1MI3A 2ZIDA 4UFKA 3R4IA 2R82A 4UFHA 5D2WA 3WDPP 1ITUA 1KM5A 4GINA 2FMNA 1S46A 1YXCA 3WO8A 1XDMA 2J88A 6REQA 2IKGA 3PJWA 4S3GA 4IXHA 1TV2A 4XD3A 4BQ2A 2GJNA 5AHLA 3IRDA 1R87A 2XVGA 2PB1A 1KFKA 1Z41A 1E1FA 1NY1A 1ZJBA 1PUDA 3N6HA 1V5XA 1VZWA 4P8WA 4FMVA 5JUVA 1B4EA 4JXCA 3SUVA 1RLCL 3AS2A 1RVKA 3KX6A 1GW9A 3UWYA 4E4PA 2WANA 1AJ0A 3QGKC 3SN0A 3PWAA 4MFEA 3AXMA 1GYLA 4PRTA 1JUBA 1XIEA 4ATLA 4LNYA 4O53A 2OMAA 1KGWA 3ARYA 1PWLA 1NOWA 1Q2SA 4XSMA 5FD0A 2CLEA 1MFVA 1R0MA 1XL9A 3AUJA 3ZZ1A 1J9YA 2GL5A 3LNPA 1MXGA 4OWGA 4YTSA 3KBNA 1M6JA 1M01A 1X38A 6ENLA 2YDSA 4UTUA 3U48A 1UMYA 1W3JA 1JQXA 2O9TA 3VOGA 1JDEA 2Z1BA 4TMCA 1PKYA 1B57A 1KLYA 4AD0A 1VFLA 4RE3A 1E4NA 3SN1A 1CXEA 1BD0A 3R0UA 3VMPA 4JFVA 4M6PA 3L5MA 3GU1A 4NYUA 3GXTA 1O5QA 2LLEA 2NV2A 4AX7A 4XD5A 4LV9A 4GISA 5HJXA 3W6YA 3RAOA 4JCMA 6CGTA 3DYOA 4AZCB 3EX1A 1TRIA 4NASA 2ZX9A 3RJXA 1QWGA 3WFAA 2R91A 4DJEA 1UZDA 1R47A 3PTQA 4B3LA 1IIHA 2ATMA 2PTWA 2XVNA 3B9DA 4BWLC 2IXUA 3ZVIA 1RBOB 3KP1A 3QMRA 2ZX7A 4Q8QA 2QPUA 3ZIZA 1ZBWA 3WQ4A 3C8FA 1RK6A 5JXQA 4HIBA 4Q8TA 4L4MA 2YXXA 1PIIA 2EGZA 1UQYA 1ICQA 1W3KA 1UZ1A 3BSMA 3GTHA 1O5KA 3QMSA 2ZRVA 4NJHA 4PEEA 3EKGA 1KRMA 4R34A 2BV9A 1OC5A 5A8QA 1UASA 1SGJA 5KITA 2WSPA 3JU2A 3KDNA 3E0FA 2FPTA 2GVEA 3TYUA 3R5EA 3GG8A 3QQWA 3VNLA 4JYFA 4DUWA 4WVXA 4EXAA 3Q67A 3MPGA 3S4TA 4O57A 1DJWA 1N7KA 1MWOA 4Y2WA 3BC9A 2HSAA 4M56A 1I2RA 1VLIA 1BF6A 2PUZA 4QG6A 1TUFA 5M5DA 1Y7VA 4H9UA 4AWUA 5L9FA 4Q4KA 2NV9A 3FGCA 2DT1A 2P53A 2WNQA 2PDHA 5AZ1A 1K1DA 4PMVA 2ZA3A 2OSXA 4XWUA 4OGZA 3HJEA 5GJMA 3ONBA 2WK2A 5D2XA 2HROA 3WEZA 1IGSA 5E09A 1NIUA 4O0ZA 3TQPA 3HG2A 3BW3A 4FHAA 1P0KA 2XUCA 1SR0A 1AFSA 1UIOA 4JIHA 4UQEA 3GIYA 4BR1A 3HG5A 3LQLA 3QW4B 1ZBCA 1BQGA 4WJEA 2NZLA 4J3XA 2J4GA 1UP0A 1VEPA 3WH8A 4PCFA 4BCEA 2WM1A 4J27A 1W5MA 3P0XA 3AUOA 4NXSA 2HVOA 2VYOA 4JTLA 3RF9A 4Y9NA 4P8XA 2JALA 4LW7A 4PBFA 4Y6GA 4DAIA 3H7UA 3ERPA 2EAWA 2WMKA 4Q7IA 1XBZA 2JK2A 2QDGA 4F0KA 4GCXA 4L1GA 7REQA 1N2VA 2ZBTA 1LLWA 1KQZA 1A5KC 2WBGA 1EJWC 4R9OA 1X39A 3DKJA 3WQWA 4CN6A 4HQVA 4H7VA 2XIMA 4GMEA 4UR7A 3WJYA 4Q4QA 3DU0A 2JF7A 1AH3A 1UR3M 3K8KA 3WLMA 3D6NA 2XIJA 3CYVA 1TV5A 4ZA0A 2NQLA 4IHCA 1AL8A 4LCSA 4MFDA 2GVGA 1G1YA 2VMFA 1Z89A 1GOXA 3PG9A 4MNJA 2G37A 1B9ZA 4ZO7A 3L5LA 3W6MA 3H53A 1H11A 5G4WA 4K7VA 1BXBA 2XWDA 4X2PA 5EMKA 1NDVA 1BLIA 4B5SA 3NOYA 1D3GA 4GI6A 4LTSA 2HXTA 4CU8A 3B97A 2BOEX 1B3VA 1R9XA 1O7AA 3CT2A 1UUMA 2Z1XA 2PPGA 3LCXA 2EQDA 1TPVA 5A6BD 3SUWA 3N25A 3MP5A 2QJMA 5HMFA 1EP1A 1YPXA 5FF4A 1LG2A 2HRWA 1FDJA 4GUGA 1VJZA 1K9FA 4KRUA 2XH0A 1CTNA 1REQB 6XIMA 5LGXA 4XAPA 3EDFA 3W9ZA 2BP1A 2P0OA 5KZMA 2ZFAA 3LS9A 1PX3A 4HTYA 2VEKA 2OGYA 5G2HA 4PBEA 4B3ZA 1SJDA 1OGGA 1UZ4A 3TW9A 3OLIA 4NILA 2DDXA 1YXDA 1B3OA 1I60A 3UVIA 2QF8A 3E0IA 4MWAA 3GR8A 5F2GA 1QHZA 4GO9A 1RLDA 1I2NA 3RLGA 3NCOA 2DVUA 1XR2A 1EJTC 4C7DA 3MSRA 3DXIA 1V6YA 4IMGA 1CDGA 1N82A 4PFHA 2W79A 5AFDA 1GW1A 2VQTA 3N13A 1NDZA 2A7RA 1KKRA 2PDBA 4UOZA 5HMDA 3L5AA 3HV9A 1MXSA 2ZXDA 2B7OA 1GJPA 4GACA 2DZXA 3NQ7A 3QHMA 4W5UA 3AMDA 5I09A 1EBGA 1BGAA 1FH8A 3PZMA 1E9IA 3HPFA 2JIWA 4J35A 2PU1A 2UY2A 4ICCX 4H00A 4TIMA 5BZAA 3CQKA 5FJIA 1PJ9A 1PWMA 3HQPA 4NZ3A 5K4ZA 2DZBA 3CPRA 2P5NA 4MSSA 5IHRA 3BCDA 3MP4A 1JCNA 3U2EA 4YTRA 4S3EA 2X7VA 3W24A 3G6LA 3UGVA 2C19A 4EKJA 1PHWA 1XUZA 5BXTA 3G6MA 3AJ7A 4OOZA 4JYEA 3KDOA 3KWXA 1TV7A 2DH2A 4MYAA 1SZEA 1XRTA 1PKMA 2C13A 3BLDA 3NQVA 3N9RA 3F4WA 3BWWA 5ECVA 2YA2A 1S5NA 2JKPA 3FAXA 3OVQA 9XIMA 3J7HA 3BUVA 1K6WA 2QJGA 3SZ8A 1WB0A 2DY3A 3VILA 4Y96A 5PTDA 1S5WA 3PNZA 2YBTA 3BG9A 3IVSA 5LIKX 4BF5A 5HQMA 1OX6A 3UJRA 4ERIA 1UWSA 3AU6A 3L4YA 1WBHA 1JAKA 3FN9A 2B7PA 4IISA 4Q8NA 1RZMA 2O56A 2BY2A 3PBVA 2D3NA 3PPHA 4ORIA 2PS2A 1UWAA 1EXPA 2V38A 1J0IA 1XYFA 3U6WA 4NRRA 1VFOA 3PM6A 3WUFA 2P3ZA 3VA8A 1K6AA 4UXDA 2CZDA 1XH2A 4YN5A 1H51A 2GVLA 2NSXA 4ZOCA 3N4AA 2OU4A 5EYWA 1WDWA 3M44A 4PR4A 3IIZA 3R11A 3Q2DA 4QHRA 5G1YA 3UWQA 1IQ8A 1LG1A 2DPEA 1UCWA 4Z08A 2WVVA 4PRRA 2ZZ4A 3R2GA 6TAAA 4S2BA 4B5NA 4BFAA 2Y5SA 2Y63A 2FGBA 2ZRUA 4F2TA 5CZKA 1HO1A 4GIAA 4UZUA 2VFGA 2Z0IA 3KL3A 2DORA 4ZQCA 3OQ8A 2QYGA 1H7RA 3O6YX 4JL2A 2VGBA 4XAYA 4TTUA 3TW6A 2PRLA 2QDEA 1F9CA 3LHTA 3WH5A 4AFYA 4OVXA 1X7IA 3HOJA 2P8BA 2CLHA 1RPKA 3WQ6A 3APGA 4PMZA 1DJGA 3C86A 4UBPC 1ZP3A 1OGBA 1QPQA 2X0SA 4WK9A 1A4MA 1JYWA 3UG3A 4A8NA 5DXYA 2Y5JA 2FHCA 3VX0A 1CLXA 2DJLA 2NQ5A 3CV6A 1QCWA 3SECA 4HCLA 5AY7A 1FWIC 1H62A 1Q8JA 3KRUA 3T0AA 3UBPC 4F0HA 2HNHA 2V2CA 3APTA 3N9SA 3ITOA 1K3UA 5BU9A 1KM0A 4Z1AA 3RK8A 2YW4A 4K36A 4DQWA 1XQKA 2PDLA 4LB3A 1P6CA 1DKWA 2I1OA 4DJEC 3QXBA 5F4SA 4W4QA 4W84A 5FAGA 1QVBA 3TH6A 4QQUA 2Y85A 3B06A 5TQLA 4N6EA 3NPUA 2O9RA 2XYLA 1YEYA 2ZZ2A 3E2SA 4GUFA 3NSNA 3SSJA 1Q6DA 4JTAA 1YNQA 2PLKA 1WXYA 2Z27A 4U2YA 3WENA 1R2TA 3A4XA 1UQZA 3BO9A 1TWDA 4BA0A 3L67A 4G1KA 2PLCA 4LF2A 3U5YA 4TTGA 2PSNA 3B9OA 3WQDA 1WO2A 4IIHA 2KAUC 5JBFA 2PWHA 3O2LA 4XUGA 1MRAA 4J4KA 1VBRA 1GVYA 3BGJA 4ZO6A 3POHA 3H7RA 7PTDA 1IZJA 2PGFA 3BG5A 3O06A 4LFYA 1BYCA 4TV6A 2Y7EA 3LLFA 4CD7A 5BYWA 5K9CA 1US2A 3GTXA 1B1YA 2I5IA 8XIAA 1R3YA 1BKSA 1OHLA 1R85A 1W1TA 2F7FA 2EG7A 3GUGA 2JEQA 2XM1A 5TBOA 4DY1A 1UBSA 2ISWA 2FTPA 5A8NA 1JFHA 3UT0A 1DWIM 1EDQA 2Y24A 1BG9A 3IIVA 3OIXA 3ZSTA 1WOBA 1FH7A 5M17A 3GZ3A 3AIEA 4IGNA 2BG5A 4O52A 3M64A 5LIYX 3GXFA 1DXEA 2HBVA 4Z1CA 3VKKA 1K7FA 3UPMA 4GFSA 4HOZA 4Q8UA 2V5DA 2XDFA 4EPBC 2CU0A 4LY4A 5E1QA 3LUTA 2BXVA 3AXHA 3LHWA 2DT3A 5HR7A 1DJHA 2ALDA 2E5DA 3TXZA 3QOKA 4DBDA 4JTTA 2FKPA 4A6GA 1N8FA 3RIKA 2PDUA 5A69A 2CXEA 1N8IA 3VIOA 4A2RA 4U10A 1GVFA 2OJPA 4QNEA 4ZSUA 2Y8KA 1B5TA 5U7SA 3AISA 4AZGA 1TTIA 4OZOA 5FJPA 2NX1A 1TPUA 1ADDA 2X2GA 1Q13A 3M41A 4LS2A 6PTDA 4F66A 1IGWA 3SR7A 2EXOA 3TAOA 2EBNA 1LQ0A 4Y9PA 3M0MA 2CESA 4H6KA 4M51A 3I7SA 2AQVA 4FOKA 3UR2A 3WMCA 3ARVA 5FIPA 3RLVA 1V0NA 3WCZA 4EX4A 3R1ZA 1Y8BA 3ZT7A 1CGWA 3AZSA 4IGMA 4RUBA 3NAVA 1MMFA 1FWAC 2GVYA 5FJTA 5FJOA 4EXBA 2Y8VA 1TELA 2E4TA 3B8IA 5BOFA 1OINA 3R6IA 2PDYA 4GABA 5HA7A 3KHDA 1FHVA 1UR1A 1E3ZA 5CC5A 4G9PA 4XZBA 3FXGA 1QJWA 1UKPA 5EMLA 1S1RA 3HFYA 4PUDA 5EA9A 3UZ5A 3R13A 1RVGA 2ZUWA 2QULA 4C1KA 1PYFA 5EMJA 2R1MA 5U4NA 1WKYA 3VD9A 5DCDA 3C6CA 1BKHA 1H61A 1Z3NA 4HCHA 3BE7A 3TCSA 2J7FA 5GNZA 2VCBA 1QO5A 2VGFA 2UV8G 3M0KA 4W86A 3PY2A 4BK9A 1V8EA 1MDLA 1JPMA 1P43A 3STPA 5CBJA 1VFHA 3LN3A 3DBPA 1D3HA 1DORA 3XISA 2B0MA 1EFZA 2PE4A 3NM1A 1X98A 2WJZA 2Q09A 4ZQOA 4ZSTA 3ZO9A 2Z2UA 1WUFA 3H2EA 2A85A 4IX2A 3L2MA 4TOQA 2P88A 2DW6A 4AB4A 4JICA 1MUWA 3LGDA 3NYDA 3SCPA 4QDWA 3QQ0A 4GY7A 4IIEA 1WZLA 3W53A 3WSUA 4ERAA 2WMGA 5I06A 2HVNA 3F7JA 4GVFA 1R46A 3QR0A 1JZ6A 4MNKA 4MWAC 1TG7A 3OU8A 4CD6A 2B4GA 3STCA 4J3ZA 4E2BA 1B31A 3TW7A 1Q4NX 3FAWA 3VGHA 5AHIA 3IS4A 3POCA 4IMFA 3TJ4A 1DPMA 5A1AA 1YXYA 4NJIA 4WJ8A 4GVHA 2YZ5A 1EB3A 3G77A 1T7LA 1ISXA 4JTHA 3CZJA 1RP8A 1XCFA 3GIPA 3QLDA 1AW2A 3GM8A 3ZLGA 1UWTA 1W5PA 4RNJA 3QGVA 1K7XA 3CHDA 3MHFA 3RG6A 3GH5A 2OYKA 3TTQA 1A3WA 1E56A 1JEZA 1LQAA 1Z8AA 2ZC1A 5DBUA 4DJDC 5LNSA 1K4GA 2V8ZA 4AY8A 1TJRA 4LCQA 1V93A 4IIGA 4MDPA 4LV4A 2OGJA 2W27A 1Q6OA 4KCTA 5H8MA 4JFUA 4I5RA 3TFXA 3UG8A 1WYIA 1TJ1A 3DI1A 3MMTA 1DIOA 4DNHA 5D03A 2XWEA 2WC7A 4JEJA 3TCEA 1EL3A 1O95A 1KBKA 1YDOA 3W7CA 3ELFA