4MWAB

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
259
structure length
258
Chain Sequence
NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDKVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 83
structure length 258
sequence length 259
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaB00
4O1FA 4DJDA 4DB7A 3H2FA 4G9PA 3TYZA 4S39A 4PZVA 4D8ZA 3BOFA 3H23A 1AD4A 4C1NB 2H9AA 2YCKX 4MWAE 2DZAA 3TYBA 2VP8A 3K13A 1AJ0A 3H2NA 2H9AB 3BOLA 4MWAC 3TYCA 1Q7ZA 3H2AA 3H26A 3MCOA 4CCZA 4C1NA 4S3FA 1AD1A 4DJED 1AJZA 3H24A 2YCJA 1Q7MA 1TWSA 1TWZA 3TYEA 4DJDC 2Y5JA 4S3AA 2DQWA 4NIRA 4DJFD 3TR9A 4S3CA 1F6YA 3MCMA 4NILA 4S3DA 3TYAA 3TZFA 1Q8AA 1Q85A 3H2OA 4D9PA 3TYDA 3H22A 2DZBA 4O0QA 4DJEA 5JQ9A 2BMBA 4DAIA 4S23A 1EYEA 3V5OA 3H2EA 4MWAD 4D8AA 2Y0FA 4NHVA 1TWWA 2Y5SA 4DJFA 4S3EA 3H2MA 2OGYA 2VEGA 3TZNA 3H2CA 1Q8JA 4S38A 4MWAB 2E7FA 4HB7A 4DAFA 3H21A 1TX0A 3NOYA 4S3BA 1AJ2A 2YCLA 4NL1A 1TX2A 4MWAA 1Q7QA 4DJEC 3TYUA 2YCIX 4O1EA 2YCLB 2VEFA 4DJFC 3MCNA 4DJDD
chains in the Genus database with same CATH superfamily
3SQLA 3MZNA 1WDSA 4PODA 3VKKA 2CIPA 2QDGA 1IE7C 2WZEA 1O1HA 1GEQA 3GYEA 1RVKA 1UMLA 2GUUA 2PB1A 1PDYA 3QEZA 1KBBA 4NY2A 5HDRA 3O06A 3TWAA 1AW1A 2GVYA 4AVNA 1ZBWA 2R1NA 1XP3A 1DWAM 4H7VA 1KQYA 3EEGA 3P62A 3A47A 4J5NA 2ZX8A 4IJCA 3AIWA 5A8NA 4K1WA 1KFBA 2NX1A 4LT9A 1E72M 4J3VA 2C0HA 1JCYA 3N2BA 1MFVA 3HTWA 1HGWA 5I3FA 2DVUA 1UBPC 2ZC8A 3WIJA 1EGZA 3PUEA 3UZWA 1U5HA 3ARYA 4P5UA 3FA4A 1GOKA 2H8XA 4F79A 3KOZA 2BHUA 5BXTA 2CLEA 3LV5A 4QDWA 3H2MA 5LIWX 4QTGA 3AS3A 1LP6A 3ITVA 1EOKA 1LROA 2W6RA 4BKNA 3BGAA 3E0VA 4L4PA 3BLLA 3CT2A 3R43A 5EY5A 2XFFA 3WBEA 3A3WA 5E1QA 1QBBA 4GBDA 3UZ5A 2FGBA 3B8TA 2JEPA 3AMKA 3C2VA 1N2VA 2QR6A 3PZTA 1EC9A 1EJSC 4PEEA 4M0XA 1PIGA 4X61A 4CCCA 4ADUA 3STFA 4B5NA 2J7EA 2EPOA 3V3WA 1DJGA 5FSDC 3P93A 4GXPA 4BS0A 4B5TA 1MQRA 4J7RA 4O1CA 5EMKA 5G1YA 4PUMA 3LXBA 2P3ZA 1A5KC 1O6IA 2VD8A 1ZCCA 3W7NA 2H9AA 3RLGA 3E74A 1KM5A 3SIZA 2DT2A 1QT1A 2E5BA 4MNLA 1K8XA 3L23A 1SO3A 1XLGA 4DWSB 2XGBA 1TB3A 3F5JA 1WDWA 3ABZA 4B92A 4UR8A 4A2SA 2PPGA 3K4DA 3QTGA 1A80A 4F0LA 4L80A 3UG4A 1K8CA 2ISFA 3BLFA 4WX2A 3ARRA 4BZYA 1PCKA 3VTRA 4K68A 3HM7A 1KR1A 1KV5A 2VR5A 2ZZ1A 4OTKA 2EPNA 3DBPA 4D8AA 5C55A 1EZ2A 1PPIA 2Q02A 3L4UA 4YIWA 1PKNA 2JKPA 1OWQA 4L6DA 2Y62A 3H4XA 1WKFA 4GIAA 3C4UA 4RZBA 5I3DA 5FF2A 3QHOA 3R1ZA 4LW7A 4UMCA 4E2VA 1DEDA 1YTDA 3MUXA 5HUOA 1AJ2A 4Q7NA 5A8MA 2BGSA 2J7GA 1Q66A 1QOPA 2F61A 1Q6DA 4Q8QA 5I2UA 4H6RA 5D04C 3V0TA 1EJXC 3PB2A 5TD4A 3WH9A 4MYAA 4KKXA 4OT7A 3MW7A 3H23A 3SI9A 1V02A 3ONBA 2ISVA 1TMQA 4LFYA 3K1DA 3WLTA 1DOSA 4C6LA 3PUDA 4F9DA 4ML9A 4HCDA 1R3QA 4O13A 2J7FA 3A21A 4C6JA 1OINA 1KC7A 2YCJA 2D2JA 4JQ1A 4OHQA 5DFAA 4U4MA 4NILA 3O1NA 3U48A 4S2BA 3NAVA 1ZALA 1LTDA 5C9XA 1DORA 4IQDA 3RMEA 3S5YA 1PTGA 3RFAA 3S2NA 1CXLA 1W1IE 1EBHA 1E3XA 2NV1A 1CB2A 3DXIA 2OGYA 2DSWA 3OA5A 1FWJC 2A85A 4DNMA 1KCXA 1BSLA 2WBGA 2A3LA 3BMVA 2GOUA 3CUIA 3QZEA 4AX7A 2YYTA 2E8ZA 2ZC1A 4C6IA 1XLMA 3IJ7A 4S3BA 3KVLA 4QJ1A 4JIRA 3UXKA 1OQFA 3T44A 3W7KA 4GJIA 3HN3A 4C6DA 3CQIA 1C3FA 1EGMA 4GKTA 2DSVA 2XIQA 2VWTA 1OYAA 4FHAA 4LYPA 4X2RA 4M6VA 3H4GA 1X97A 1TO3A 4W5ZA 3OJGA 3CIXA 3QH2A 7REQA 1AL8A 3MUY1 5T91A 1A3WA 3CAKA 3FA5A 3AISA 3L4YA 3MBDA 5E93A 2JK2A 2Y88A 1I45A 5KZMA 1M6JA 3MP4A 3S2MA 4L4MA 2G37A 4YYCA 5LNRA 4ZR8A 3KL5A 3U8GA 2D0HA 3W6MA 4K38A 4GUJA 1RK5A 4NX5A 3SUSA 3FW6A 4H7CA 5I06A 4C6MA 4AWUA 2DW7A 2Q6ZA 4DPQA 1WNOA 4EPDC 2XVGA 1J01A 3QY7A 2FZ9A 4Z1CA 2VGFA 2JF7A 4LUTB 2GUBA 4XZIA 3K5XA 1XCFA 3N29A 4PH6A 4NX0A 1TREA 1VH7A 3LCLA 2Y8KA 4GFIA 1B3XA 4QSHA 3QC0A 1QXLA 3LI1A 3N17A 3NUKA 3NO3A 4KIEA 4IG2A 3O7UA 4YL2A 2GJPA 4IF2A 5C2CA 2XIJA 4Y96A 2O9OA 4I9MA 4ROQA 3O6DA 4C6PA 3DDMA 1B2YA 4QR6A 3WJYA 1AVAA 4RL3A 1DWFM 3J7HA 4FZIA 3CM4A 5FF0A 4V27A 2PGEA 2NT1A 4UTLA 3BG3A 4HYVA 3L4ZA 3N4AA 4DF0A 1EF3A 1NFBA 3IV3A 1JRBA 2XPKA 4ORMA 5C2GA 1O7AA 3VOFA 5I3KA 4GVFA 2WMKA 4HPJA 4LB3A 3GH7A 1GK8A 2XH7A 4DJED 1XLFA 3D3AA 3UPWA 4RZ6A 3TQKA 3TYEA 3IVUA 3WZ0E 3KVJA 2RH9A 2QDEA 4X60A 4EKJA 4G7EB 3FHAA 4BWLA 1SFSA 1WOAA 3IWPA 2ZZ5A 1J0KA 4QQUA 2R14A 1NY1A 4HNCA 4D6DA 3R11A 4IMFA 3FHQA 2PWGA 1SO4A 1E1EA 1MSSA 3T2PA 3XISA 4DYJA 4MYXA 3N13A 1QNQA 1Z6KA 1WXYA 4CEXC 4MDPA 2Z1VA 3RHGA 1KTCA 3RR4A 1FVPA 4BI5A 3E1F1 1UJPA 3BQ5A 4YTTA 4MB3A 4AD5A 3N4EA 3QMRA 1UC4A 2HE5A 3ZVIA 2VFHA 2B7PA 1PCWA 2E6AA 1CB7B 4DJEC 4Q22A 5A8GA 2NSOA 3MSDA 3I7QA 4UFHA 5AKQA 3GUWA 1YBQB 3MBFA 1HXJA 1MEHA 1Q6GA 4GGBA 3EKLA 4ZBCA 5LA1A 3WFAA 1A5LC 1VYRA 2INEA 2GZXA 4GQ0A 4MJ4A 3UNTA 3QM3A 3VKAA 1ZAJA 4GGHA 3SGGA 4KCVA 4Q8WA 4OIFA 3FYPA 2YL9A 1IXNA 3B0YA 3K8KA 4U10A 5I07A 1NWTA 4C6NA 4LVBA 4XUYA 1HKWA 3TC6A 1XM3A 3UR7A 3NYZA 2WMHA 4J9JA 1ZRQA 4RV8A 1EWDA 3W02A 3TH6A 3AZRA 2VWSA 5XINA 4XAGA 3GWQA 4W89A 5EA9A 5K3VA 1X7FA 1XWYA 1CI1A 3DG7A 3GC2A 2E9MA 3GU9A 4QE4A 4J3UA 3GK0A 3TQVA 4B16A 3L0KA 2HPIA 4FX8A 2DUXA 3WLLA 1UOKA 4UQEA 2OKOA 2BXZA 2QHAA 8XIMA 3F7JA 3SGUA 1C7SA 4HB7A 3U3HA 4XVEA 5SWUA 4MHBA 2Z1XA 3B3DA 3SSJA 1QJWA 4EACA 3ZR4A 1V08A 1AFSA 4IGNA 3VNYA 3E6EA 2ZRZA 1Q6FA 4W88A 5U7SA 3RU6A 2CZDA 3IJLA 2EBNA 2X1IA 4AVOA 5EMUA 3RK8A 3S4TA 4JN8A 4FIRA 5EFDA 2BY0A 4IPLA 3CUFA 3WLPA 2ZX7A 4LBSA 4BK9A 1XLHA 2VO5A 3INPA 1KRCC 4Y7EA 1EA0A 4U31A 1T5AA 3LM7A 3W7OA 4UQBA 2GQ8A 1F8MA 4WGXA 1XKYA 1OYCA 2FIQA 1Q2RA 3QMSA 3RM4A 4UFLA 5HMDA 1FCQA 4RE3A 3THQA 2W9MA 3MTWA 3WKZA 3WQWA 3SQMA 3GXDA 3VM7A 1JJKA 4LB4A 3H7RA 3IK2A 1CXEA 3C0SA 1B3OA 1Q65A 4XAYA 3EOOA 1ZP3A 1FH9A 4FNSA 2HROA 3KAOA 1S2CA 3C3NA 4H00A 3W1TA 3C61A 3BARA 3EWBX 3IK4A 8A3HA 4JXCA 3PBWA 4FX7A 1ZCOA 3S6DA 4RXFA 4XBKA 1UUQA 1EL3A 3CAWA 3GDKA 3OODA 3MU7A 3EA1A 1IT8A 2G4JA 6TIMA 3VDCA 3WLQA 1M3UA 2D69A 4JPGA 5PTDA 1NM9A 4KEVA 4N4QA 4P8WA 3HQOA 2D3NA 3OHIA 4XZWA 1P0KA 3LRMA 3RXZA 2CWXA 2V3EA 4K7YA 1CZ1A 3CZKA 3NGFA 3UPBA 4ZFCA 3B06A 4PSPA 1CECA 2GSEA 4DJDD 1MW3A 3I7SA 5GJMA 1H7WA 3EBVA 4R3UA 4L4OA 3DFOA 1KA9F 5E70A 5C71A 3QGAC 2CW6A 2J74A 2RAGA 4GA8A 1ECEA 3GVWA 3W74A 4Q8MA 3BLDA 5T8GA 1GVRA 2NVCA 3WENA 3SW6A 1W32A 2C16A 2CKSA 2G5WA 2V6AA 2EO7A 3ZOAA 1A50A 3GKAA 1XRTA 3GFZA 3EXSA 4ZOEA 1RP9A 3W81A 1MEIA 4FOUA 3WDHA 3VCCA 2PGRA 2J62A 2WMIB 4QGCA 1TZZA 4JQ3A 1RCQA 5CPOA 4G1NA 1V7AA 2BVYA 4UR9A 4LS1A 3CHFA 1G0CA 5IOBA 3G1SA 4UUIA 3D46A 3D6NA 4Q7BA 1FDYA 2NXIA 3OZMA 1TSIA 3ZR5A 3ARVA 9XIMA 2ZKMX 4WF7A 3DENA 1MQPA 4K6AA 4DLFA 5AYYA 4Z1YA 1ONEA 4DJFA 4WDXA 1E9LA 3Q45A 5LA2A 4ZGYA 3OGRA 2PRMA 1BKSA 5HATA 5T9CE 1DIOA 3CPGA 3N34A 3EWWA 2TSYA 3NM1A 1LM1A 3SADA 5FAGA 2V2DA 2ZA3A 3NGJA 1R9YA 3THCA 4NAFA 3S1WA 4IQLA 4JX6A 3DZ1A 2QXWA 1ITCA 3UCCA 4PMUA 4A21A 1CXIA 1O1ZA 1QNOA 1Z3NA 1EFZA 5LNSA 4L61A 4E6MA 2E8YA 4IX0A 1DE6A 3WLOA 1OC6A 1E9YB 1JULA 3BL3A 2BOFX 4U33A 4AZGA 4AUBA 5D2VA 1HNYA 4C6FA 4WOZA 4S39A 1QI5A 4W86A 3M5ZA 2DZTA 3V16A 1PZ1A 4GI9A 3WQDA 2YFOA 2AQWA 1KBKA 3GLCA 4OV9A 3SSZA 4JFSA 4GACA 2VC5A 4GMEA 5HULA 4RNIA 1H2JA 3G0SA 2CLFA 4XAZA 4AD3A 3UW6A 2O0TA 3TR9A 5HK4A 4C60A 1XIHA 1JI2A 2V5LA 4TV5A 1FWAC 4FALA 4XISA 4GQRA 4D6EA 5HMEA 3W7CA 3AROA 4MSSA 2V9DA 5G2WA 2X41A 3A64A 4AWTA 1HKVA 1B9ZA 1UH2A 3WMCA 3WQ4A 1GOWA 1S2UA 1V02E 2UV8G 3FVDA 1Q6QA 3MWAA 1XHGA 3EOLA 1OG0A 4F0MA 2B7NA 5K7JA 1S39A 1JXKA 1L2UA 2EG8A 4M5PA 1ZZMA 5EU9A 2YFNA 3AHYA 1YTEA 2VXNA 5FJPA 3NDZA 4MKSA 5HR6A 4WD0A 4Q8OA 3NO5A 4WGHA 4ZA0A 2Q09A 1Q63A 3C2OA 1BKHA 4CN1A 3M43A 4FLSA 4D8ZA 4A3RA 2WVVB 4UTIA 4JTDA 3CJPA 3ZO9A 3NQDA 1DTUA 1L6SA 1VGAA 3IJ6A 2PDJA 5BXRA 2A2IA 2PTWA 3RPMA 4O4WA 3P81A 5DO8A 3IRDA 1V3IA 3VGEA 3SY1A 2QUNA 3VOGA 4NIRA 1WKEA 3GFXA 3GS6A 3OBKA 3T8LA 3SCWA 4HZ7A 3GUGA 3NQBA 2Y8VA 3NYDA 2QJIA 3ZSSA 4JTUA 2HBVA 4UCGA 2PDLA 4LYQA 3WQ6A 2NLIA 1VR6A 2ODOA 1H7NA 1H49A 3NR0A 1ZHAA 5HWJA 1UG6A 1HKMA 4JTGA 2DW6A 1UUOA 3UESA 4JR5A 3LXAA 3LLDA 1HGYA 3PULA 2Z28A 4U5KA 4PFHA 4DQWA 1OB0A 3BPWA 1UD4A 3Q94A 1SZRA 2XU2A 4WXYA 5DN1A 3QHMA 2HS6A 3A5FA 1VF8A 1OD0A 5FD0A 3RX2A 1V77A 1OX4A 5E5CA 1BYDA 4JNYA 1GQLA 1JD9A 2X16A 5CPTA 1GZJA 2GK1B 2CHNA 3GM8A 3W01A 2WANA 2V8ZA 1UKPA 1SJCA 4R27A 4H9VA 2Y24A 2VR4A 5CBBA 3L9CA 4JY9A 3DBNA 4DJDA 4DXXA 1K9TA 4QEEA 1QNRA 4YTSA 4HYRA 4G9PA 4ZSUA 3BW4A 5A6MA 4GUIA 1T6MA 4FOJA 4WQ6A 4DPPA 2ZVIA 1X8FA 3QYQA 4DI9A 3VIMA 2OEMA 4DX3A 3KP1A 5HR7A 5CZTA 3WH5A 4DUWA 2P1FA 3AYSA 3PWAA 4GVIA 2PURA 4M7SA 4XBJA 3EB2A 2J79A 5FSEC 3QV6A 3FK4A 5HMFA 3GIPA 4S3FA 3W07A 1B3WA 2Z27A 2DIKA 2GGEA 4HA4A 2CU0A 5A6BA 3N73A 2PLJA 2PDWA 4JIEA 8XIAA 3G3DA 4Q8UA 1DJWA 2BGNE 1W3JA 1WA3A 3FAXA 2A7RA 2I5IA 1DBTA 1ZU8A 3MJMA 2D1ZA 4PTMA 5DLCA 1RBOB 2XVNA 4E4PA 2EJ1A 3WD0A 3C86A 4MVAA 3P3BA 5FESA 4LUYA 2PUZA 4A8LA 2JQXA 1EUNA 1JZ5A 3HU7A 1BXNA 2EQDA 1LLWA 1VENA 5LGZA 3BURA 3B05A 4FXRA 4LNYA 5KITA 2PWDA 1KGUA 5HA7A 3HGJA 3UWYA 2G3FA 4D71A 1JL8A 8CGTA 4WJXA 4H9YA 5D33A 2YDSA 2QPUA 2WVUA 1HJXA 1BXBA 1AD4A 2C14A 4Q32A 5BCAA 5CPNA 1WZKA 4J3WA 1W0MA 4PMYA 1H0GA 5DQPA 4XD3A 2PDQA 3TQPA 1FCVA 4GY1A 2F6XA 3NVDA 2AGKA 1TPH1 3VO0A 2FTPA 2Z2UA 5G2IA 1DJQA 4WRHA 4ADSA 2GWNA 3BAIA 1DWGM 1ODUA 1QPKA 1NFPA 1LG1A 3ZXWA 4KFPA 1M41A 1XYBA 1X6NA 4XX6A 1KB3A 3VIFA 2ZUUA 4QAIA 5DT7A 3SCTA 3AIQA 1VBJA 5I78A 3UR5A 3WJXA 4L9YA 4MWAD 5DRCA 4ILSA 4O54A 4LUIA 1IWAA 1W17A 2PC8A 3QKEA 1XIGA 1Q4NX 4UTTA 2PD5A 4I9JA 2NQ9A 1XPGA 3TFXA 2YCLA 4JTLA 2R1MA 3OGVA 1RD5A 5CSRA 3BQ6A 1SU5A 2VEFA 4BI7A 4GJJA 1S38A 1RR2A 1B31A 1R9XA 1RQHA 2V5DA 1QK0A 1ZPTA 4ORIA 3EX1A 1SJDA 2IKIA 3KTSA 2QJJA 2XFYA 4F2BA 4R7WA 5H8PA 3M4HA 3M44A 3RLHA 1KM6A 4H9ZA 1P7TA 2CKRA 1M01A 1REQA 5DBTA 1XD0A 1B90A 1P0BA 4CD7A 5IHSA 1A53A 4H9XA 4MWAC 2H9AB 3E0IA 3M5XA 3LX9A 2ZWYA 2A6LA 1GVEA 1XYAA 2XSAA 1E6RA 3ALGA 2OR2A 2EG7A 4CQ9A 4GZIA 5GJPA 1Z41A 1XQLA 3BV4A 4F2UA 4Z1AA 1O68A 4LY4A 3GW0A 1R8LA 4RKAA 3WNPA 4KESA 5C7HA 1OX5A 3PZ9A 2CLPA 1VJZA 1GT8A 5IBXC 5A2AA 2FTWA 2VL4A 4UR7A 2WWCA 4XQ6A 3GXIA 1ADDA 4IZGA 4RXGA 3N15A 3QJAA 5BOFA 1TKKA 1GTHA 1E0TA 1VCFA 3FEMA 3L65A 3POHA 3GG7A 2I57A 1LL6A 2ZE3A 3FJ4A 2VRJA 3BXWA 2I56A 1XDMA 1BG9A 1R7OA 1QDSA 3AXKA 1W31A 3GW3A 4Y9OA 1WBHA 3VNLA 3DFNA 3P5ZA 1XDLA 3WLMA 3A9BA 1U30A 3WDRA 5LIXX 1LUCA 3G1HA 4GCXA 3FYYA 3BLEA 3W1MA 3UBPC 2WWDA 2FB2A 1MQQA 1BYBA 2P50A 1CYGA 3URNA 1QASA 2X1UA 3CWHA 3FJ6A 4U5IA 3KCJA 1OGGA 3DHDA 5F1UA 3I6RA 2DQWA 5CPQA 5DMNA 4IMGA 4DXKA 5D05A 3LG3A 4KERA 4N02A 2TAAA 1TCMA 4JTTA 4W8BA 4DHGA 4DZ5A 3JRKA 4QDMA 4JZ5A 1I1XA 1YIXA 1XDJA 2JEQA 2WXDM 3CB8A 5FJJA 4S23A 1E43A 4M7TA 3MUIA 3AI0A 3T07A 3EDEA 4GYPC 5A2CA 3PF3A 1O5QA 3W0KA 2A5HA 5D09A 3A13A 4HP5A 4DUOA 4O4VA 3LMZA 4JS3A 4BF5A 4CNSA 4US5A 1TPVA 3QN3A 5DMMA 3FYOA 1D3GA 1W1A1 5IDZA 3MHGA 4X9SA 3UCDA 1UR0A 1RP8A 3AJ7A 7PTDA 1OGSA 2QCDA 3NQMA 4HD5A 3NQGA 3WLKX 1CGYA 2O4MA 4PTVA 2WHLA 4D6CA 4LCRA 1TJ1A 1OVDA 3VGDA 2HDJA 1HN1A 1V4YA 1XIMA 2OELA 1BLIA 2YBTA 5F4WA 4ALDA 1EYWA 3DOPA 3OQ8A 2NV9A 3S1VA 5D32A 3GH4A 1WPCA 2QGHA 1SMAA 1R3YA 3SJ3A 1QPQA 7REQB 4LV4A 3QQ1A 2E09A 3ZIZA 3BAYA 2BVTA 3BZJA 2YSWA 5C9WA 5CH9A 2OSYA 2F2KA 4J27A 4W4QA 5HWMA 1IEVA 1FY6A 3GU1A 1VHCA 4HMNA 5DCBA 3UZXA 1Q4WA 3HPZA 3B0UX 5ABEA 3CV6A 3PTMA 5FEWA 3ZT5A 1E5NA 4K36A 1TCDA 4ECLA 4HHHA 4CN6A 4LY8A 3W7MA 1EB3A 3P2VA 3LEPA 4DELA 3LZ3A 2XIBA 1S5WA 2QPXA 5RUBA 3EX3A 1LJYA 2XIOA 2HK1A 3G3MA 4AMAA 2ZX6A 3GNNA 2F6UA 1J2BA 3RM8A 3CL6A 3NCOA 3POCA 1OZQA 3PB0A 1LDCA 2ZRVA 4V1YA 3TONA 2WNQA 4O53A 4MUPA 4IMCA 4ERAA 4BEQA 2I5QA 2FHFA 2XSBA 3P84A 1JQXA 1PYMA 4HSNA 2FFIA 3LYEA 4GY0A 2DZPA 3UEQA 3C0QA 5FKYA 3R25A 2FZNA 3KOXA 2E28A 4M24A 4C1NB 5IFPA 2XM2A 1K70A 3MKKA 1YXDA 1UIPA 3L7RA 1OFPA 3S5SA 4O11A 2ZZ7A 1NIUA 2BOGX 3U2EA 2QVNA 2G0WA 3K4AA 3LQLA 3TJIA 1SM9A 2HZGA 4JGDA 3MZ2A 5DXXA 3T8QA 3E0WA 3U5UA 3UXAA 3W25A 4OZOA 3N04A 5F7UA 1KFEA 2PZNA 4MPQA 3F4NA 4EVZA 4D9PA 4B9ZA 2VR2A 5I77A 5I3HA 2VEKA 4UTJA 2D20A 3UNDA 1W1VA 5HNUA 1JCTA 4M19A 3N2OA 3B40A 5AC6A 1LOLA 3O3RA 2YW3A 3DYMA 3ITCA 1NDZA 2PGWA 3VZXA 2MNRA 4HSHA 3IACA 3F2CA 1I0BA 1AUSL 1OCNA 3KS6A 5FACA 4KRTA 3KWXA 4JFUA 4P8XA 4C1KA 2XGZA 1ONWA 4NYYA 3AFBA 2GFTA 4MF4A 4HK7A 2HSAA 3RCYA 1BRLB 3LHWA 3WNNA 1R0MA 1BYAA 5EMJA 2QAFA 5LIUX 4WUIA 1HJUA 4Q4SA 2VOMA 1C9WA 3LHUA 4IIEA 3TN5A 3VZYA 2ZYFA 4QE5A 2FGZA 4Z1BA 2VTFA 3L4VA 2OSWA 4FPSA 5JMUA 1OEPA 3H26A 1CGUA 4W9TA 3ARZA 2FTYA 4S3AA 3IARA 5ABFB 4HOWA 5F2LA 3S5OA 2PU1A 2XG9A 3C8FA 3DC0A 4IJRA 1TA3B 2OSXA 3URAA 4FK9A 1LLOA 4FLOA 1C90A 3W7JA 1JPIA 2NX9A 4WZHA 3VX0A 1XBYA 4H41A 4AF0A 4ZEPA 1QTWA 2PWEA 3F5LA 2DGAA 3GAYA 1E40A 2XUCA 3FFSA 1BF2A 1DJNA 1YDOA 3SQSA 3PFRA 5D9OA 1ZAHA 1TX0A 3M0ZA 5CC5A 1KFLA 3W7IA 4AQLA 1EX1A 2I14A 4XKYA 1BGGA 3CEPA 3UWVA 3ATYA 2OXNA 4G5DA 4QJ3B 8TIMA 4AH7A 2J9YA 3SN4A 3LNMA 2YCIX 1G4PA 5BYWA 5FEPA 5FJUA 3WF3A 5KZDA 1Q6LA 1UIOA 6REQA 3JZEA 1JDAA 5J5RA 3C56A 4R88A 1GVSA 1E1CB 1US2A 1VCGA 2DORA 1K9DA 2AAAA 4MM1A 4YTRA 5LXXA 2WC3A 1TZ7A 3GVGA 4PUEA 3W7PA 2DDXA 2WKLA 3ZLGA 3LOTA 2XHYA 1W9DM 2OWCA 1IXOA 3H54A 4ZMGA 1Q7MA 1QW8A 1ICPA 1VBGA 4HNOA 2OX4A 4NXKA 4PBEA 2VUYA 1FDZA 4DO5A 1WKYA 1W3TA 1C9DA 1IGSA 2PBOA 1B1YA 5I3IA 3HO8A 3VNZA 4P7NA 1Z32X 1YE4A 5FIPA 3KBJA 4H7ZA 1JF6A 4PYSA 4AIUA 2W79A 3CASA 1FCBA 1UR3M 2V3GA 3BAWA 1L6FA 1DP0A 1UWAA 4HPNA 1KFJA 2UY2A 2PWUA 3APGA 3R79A 4HGXA 3LY0A 1GKQA 3P6LA 1X1ZA 1GQJA 2OZ3A 3FDKA 1TE6A 1D8WA 4GYKA 2CNCA 3UZJA 2G96A 1FH8A 3TV8A 2WW5A 1MXDA 1LBLA 3AYTA 3WLIA 1V51A 3ITYA 4LVDA 4Y6GA 3VXGA 3USZA 2J7CA 1TV4A 4UNLA 5AHFA 3WBYA 2P53A 9RUBA 5ENLA 1E0WA 5HINA 4DY1A 2Y7EA 3WFZA 4HNNA 3G1DA 1K03A 1R3SA 2O7QA 1M5WA 2VZUA 4R34A 4GQQA 3W1NA 3WD4A 3AALA 3ARSA 3AMCA 1BXCA 2YX0A 3M41A 3FIGA 4A22A 1UR2A 3QV7A 3AIRA 2BHZA 3PSVA 1QOQA 4UOJA 6ENLA 5AFDA 2CHRA 4RDYA 1XLEA 3HG3A 1GKRA 1EH9A 4AZCA 3E96A 3O16A 3M0YA 1GOXA 1CEOA 2O55A 3RX4A 5IRPA 3PN8A 5I5RA 3SGZA 4NI8A 1EDQA 4QG9A 3H2EA 1NWUA 1Q13A 3UYCA 4LRSA 4JICA 2X8RA 3ABXA 4LXFA 2E25A 4REQA 1XX1A 1JCNA 2I9EA 1DV7A 3TTSA 3WLJA 1S46A 3UG5A 3OYZA 4PL2A 3RR1A 1U5VA 4Q6JA 5FAJA 4MGGA 3SECA 4HOXA 3LPGA 1P1XA 4NRRA 1SUXA 3A4JA 1C29A 1JCLA 3I4KA 4YTQA 4C7GA 4J3ZA 1F3EA 3BLIA 1GVFA 4BF9A 2WJEA 2WKJA 3LHYA 4H8VA 4O14A 4I8YA 3G24A 4BF7A 3PZUA 1BFNA 4GIRA 1DE5A 2PDYA 4TQTA 1E6NA 2OVLA 4S3JA 1SW3A 2AL2A 1EEPA 1PO9A 3SRHA 4JFTA 1YDVA 4K8EA 5CLTA 3NQEA 4JFVA 2BSLA 1JZ6A 3RO8A 2C1IA 2JALA 1C93A 4MY8A 1RLCL 1D3HA 1QUMA 1I2NA 5D03A 3VFLA 1A3HA 4B4HA 1ALDA 2DUAA 3U7BA 2Q8LA 2HVMA 1V0KA 2O92A 3HV8A 1XFBA 3AO0A 4C6OA 3QR1A 3QZ6A 3R0KA 5M17A 3QKZA 4RW5A 4LAMA 3LCXA 4DLMA 1UA7A 1JNEA 1W5QA 5IXEA 2DSKA 3GNXA 4FOKA 5FA5A 3RO6A 3PJXA 1M7XA 1KCLA 5D4YA 3NOYA 2OG9A 3DESA 4PUKA 1EP3A 1V6XA 2W63A 2L5HA 4IX2A 4EWND 4EPKA 2BG5A 3M47A 4NL1A 2FMOA 4CD5A 4AX6A 3CO8A 1JZ4A 3ZLFA 3TYUA 1W3HA 2QULA 4HKPA 4N9EA 1XH2A 2V68A 5FI8A 3W4RA 2PDUA 1JPHA 4E2DA 4NZ5A 4Q7IA 1J0JA 3CV2A 1W1PA 4N6EA 2G3JA 1T7LA 1H63A 2OT0A 5DANA 2CWNA 1UKTA 2EAWA 1LWJA 1UJQA 3KHDA 2PTXA 2ZRUA 3VFCA 2A3AA 3BOLA 3TAKA 3FKRA 1GJPA 4GY7A 3GRIA 4GISA 5CPSA 4BQ3A 3N3TA 3HPAA 3WBAA 3W2MA 1UD5A 1P0NA 3GVVA 4BQ2A 1UCWA 2GVEA 1Z42A 5BNKA 2NQHA 3TZFA 5MF5A 3DFYA 4DIAA 2ZRXA 1DHPA 1KR0A 1X6UA 3PR2A 3NQVA 3TYDA 3WLSA 3FJNA 3EZ4A 4D8LA 4AWEA 3WF4A 1F76A 3UY8A 3M0LA 3NPVA 1F5ZA 3ZR6A 3PZNA 2JFEX 1UR4A 1H0IA 2VZTA 2F9RA 3L4WA 2AGTA 2RGLA 2FFCA 4AZHA 2Z1KA 4IIDA 2EKGA 2R9RA 4CLMA 3SDOA 1OFAA 3IIPA 3W00A 4GUGA 2POTA 2Z24A 2CLKA 3PPHA 2BBFA 4US6A 3HOJA 3S83A 3QFEA 1RA0A 1SGJA 2GGGA 3B8UA 4S3KA 1HFBA 4HJWA 4GC3A 3PG8A 4JIHA 3KCLA 4MWAE 2PP3A 3VK5A 3AWOA 3OBEA 4HCLA 3TXVA 2UBPC 3GHRA 1CBGA 3MO7A 4AYGA 1TIWA 1EIBA 3QQWA 4HNLA 2UWFA 4JD4A 3G1FA 1V7YA 2CEQA 3W7DA 4ZO8A 2YJQA 3G77A 4DBWA 3EPNA 1BSIA 1LBMA 2Z7KA 1I75A 3K8MA 5HJYA 4JTIA 1VRDA 4XD5A 1FXQA 3KBNA 1JZ7A 4H9UA 1J79A 4O1AA 3WO8A 3OZPA 4HZMA 3WH7A 3WCZA 1NAL1 1H1NA 1H62A 5DEZA 5L9FA 1DJZA 1ZBVA 1GYMA 2QLYA 1KCZA 1T41A 1XIDA 3DFQA 1CXHA 3EKGA 4HHLA 1NDVA 2XZ7A 4M51A 1O12A 1G94A 1JNDA 4IP5A 5LIYX 3WQOA 4IP7A 3AHTA 3A6OA 2P0OA 4ADTA 1QOXA 2ESCA 1PAMA 1RSCA 1IEWA 2AMXA 4LUSB 1P6BA 3LSCA 4ZOBA 4MNMA 4JQ2A 3AAMA 4KWWA 3MUCA 1ZJAA 2VFFA 3GR7A 1JVNA 1PKLA 3MWCA 2D2OA 4QP0A 3GDMA 4NZCA 3NZGA 3WLNA 2FZMA 3W2UA 1F07A 1PYFA 1DVJA 3QC3A 3SZ8A 1S3HA 3UJ2A 2FHCA 5K4XA 4CGTA 1K7EA 4V2XA 4LC6A 1BD0A 4HHMA 4OQVA 1EBGA 1CNVA 3VD5A 4XVDA 1ZQ5A 5D30A 1MFUA 2Y0FA 4GH3A 1JIBA 3CHVA 4LAOA 3RM9A 2GJXB 4CNUA 3GTHA 5M5DA 3TN4A 3OP2A 4NJGA 1B0IA 1AL7A 4XG1A 5ABGA 1MDLA 3KP0A 1MRAA 1W9XA 1N82A 5E09A 3G2GA 1ELSA 3WF0A 1W5MA 1SSDA 1FBAA 2GSJA 8RUCA 2YB4A 1V3HA 1OY0A 3RG6A 4FR1A 2FKPA 4W93A 2QUMA 2YXXA 2YCLB 3BSGA 4CNPA 2WCGA 1YNYA 3MMUA 1FUYA 3V36A 3LTYA 4PMVA 3W1LA 3AYVA 2B7OA 2FH6A 2XDFA 3RILA 2V67A 2QCHA 2TMDA 4Z1DA 1J96A 3R0DA 1QPOA 3GDTA 3CQHA 4PFMA 3SFWA 5HPCA 4B91A 4YHEA 1CGWA 4POCA 5CZSA 2QQ6A 3TCSA 2QV5A 3CYVA 2DQXA 3EYPA 4KH2A 3UJRA 3IIOA 3RMJA 1GG0A 2GDVA 2C91A 1YDYA 3W7HA 4AHOA 1FOBA 2CBJA 4O28A 1X39A 1UH4A 3OQEA 2REQA 4Q8TA 1P6WA 4DBDA 3LGGA 4MLRA 1N8IA 2NSXA 2YLLA 3CLMA 2OLAA 4W87A 1TVLA 4F48A 3Q58A 3ABSA 3QGKC 1EP1A 1IR1A 3ICJA 2XM1A 4Z17A 3ZWTA 3GIYA 1EGVA 1R5YA 4HN4A 5B7YA 4A35A 4B3KA 2PF0A 1H60A 1ISZA 3QF0A 1V6VA 1P6CA 4UTWA 3CUGA 2Z2BA 4PN2A 1ZAIA 2HXUA 5KTLA 4CCDA 3UWQA 3AS0A 1LYXA 3S1UA 3S5NA 2DJXA 3PBVA 3Q2DA 1DQXA 4WJEA 2PDMA 5LNVA 2HE8A 3A3HA 5AYZA 1W2PA 1WB0A 3G8EA 5D2YA 3HJZA 1FWWA 5C9ZA 1ODZA 1UZDA 4XSLA 4WEVX 4CVUA 2ZUTA 2PGFA 3LGEA 2PDNA 3S6TA 2O9RA 5H8UA 1NOUA 5BRBA 1A5MC 1LOQA 2E9BA 3L12A 2Z1SA 2O4QA 3VM5A 2Z7GA 3TC7A 3EB3A 3EAUA 3HMJG 6TAAA 1VHNA 3MC5A 1ZP4A 2EF9A 5E0FA 4L7ZA 4Z0SA 4RNJA 4XAFA 4C5YA 3WX7A 2ZX5A 4H04A 4YXGA 3EMCA 1VEOA 5I24A 1GJUA 3BUVA 4ZTYA 3LPOA 3EA2A 1Q8AA 1LLZA 2BX7A 4Q8NA 5D9MA 3WQVA 4I6KA 4PBGA 6XIMA 1SFJA 3L66A 3VDHA 3CTTA 2XZ9A 1A0EA 5J04A 4LCSA 2HTMA 4S3EA 3MYOA 3TMQA 4MB4A 5CGQA 2OX1A 4EWJA 4RE0A 5FF4A 1A4MA 3V5FA 4LF2A 1YXCA 2V2CA 3B9EA 1SQ7A 4H1ZA 1V3MA 5FF7A 4L6OA 3WH6A 2PEVA 5HQMA 1GONA 1D7FA 3BVJA 5K9CA 1FHUA 5FOOA 4P7RA 4YN5A 1C8VA 2W5FA 4GZJA 2X0HA 2V81A 2J8TA 2R94A 1K7XA 4J1OA 5T26A 4A3HA 2Z4GA 1XRSA 4LQ1A 4GZ7A 5EL1A 3WJSA 3LBOA 1NJJA 5K9XA 3W72A 3QSTA 3E5PA 4QS6A 3FLUA 1QWKA 1PS9A 2G3NA 1DWHM 3E2SA 4KGLA 4NZFA 3LCWA 3TDFA 2QT3A 1RPKA 1PB0A 1SR0A 1EQCA 2VOTA 4AISA 4S3DA 1QBAA 1XGEA 4HPHA 3NDYA 3VNJA 1AODA 1EPXA 4AWSA 3O05A 3L67A 1GZ1A 1XLLA 4EXBA 2YYUA 5JU6A 4YPJA 3M0MA 1K4GA 2F84A 3CAQA 1SZFA 3BE7A 4DVOA 5DXYA 1A5NC 2R1KA 1GGOA 3AICA 4MG4A 3FGCB 3VD3A 4Z2KA 3T0BA 3COTA 4MWAB 2YBVA 1KCKA 3QFWA 1C92A 1KKRA 5HANA 3STGA 2YW4A 3TSDA 3VIPA 1QHPA 1PJ9A 4I90A 3P80A 4E4FA 1VEPA 2FVLA 3S5ZA 4XIMA 3PPFA 2BASA 4NAEA 3LU2A 4RCXA 4D2JA 1H4PA 3NURA 2A7PA 1UPPA 3TMLA 2J75A 2Y7DA 4H19A 1FHDA 1XYMA 4WVXA 3UFYA 5JIPA 4TUFA 4UZSA 1ONXA 4M6UA 3SUUA 1TYGA 1E9ZB 4LEFA 3OW1A 3SB0A 2VC6A 4XZNX 4WKHA 4RNHA 3L68A 2POZA 1IT7A 2QCCA 2NWSA 4AY8A 4GNJA 1TWZA 2FDMA 5D9NA 3TLLA 3AHZA 3MB9A 1ZSXA 2ABBA 1LBFA 2ZX9A 2VCBA 5G5IA 3LLXA 3G1AA 3W83A 3WNMA 1SFLA 3WMLA 3IVTA 3II1A 4X0NA 3AOFA 4QRNA 3WF2A 4GQBA 3E2RA 3ITGA 4JL1A 4AY7A 2G3IA 1PVNA 2Q3RA 3BJFA 5REQB 1WZMA 2R82A 1RCXB 3WQPA 1WDDA 2ABAA 3IAPA 1A5OC 2JBMA 2ZZ2A 3UWUA 1A0DA 4UXDA 2IPGA 2J9XA 2OTDA 3TN6A 4ZVJA 4MMWA 5EPDA 4L1XA 3VD4A 3CBWA 5CSSA 1TV2A 3N1AA 3PTDA 3BJTA 4LF1A 3Q37A 1F3WA 4CKQA 1K9FA 1XYFA 4AFYA 1QW7A 3KRBA 4ATWA 2C1GA 4GCAA 3UT0A 3W37A 4HU3A 2IMRA 3TEVA 1W91A 1CLXA 1YX1A 3G0XA 3PVFA 2VVSA 3GXNA 3DC8A 4QNEA 3DH7A 3PP7A 1UP0A 2YB1A 1L8PA 3V4BA 2ADAA 3SRKA 3NL5A 3WDPP 3V1PA 3Q4DA 1VP5A 3SCUA 4WK9A 4GLEA 1Y65A 3LGDA 2VT0A 2VDGA 2R91A 1FWHC 3HFTA 2Z1BA 4HU4A 4NSBA 1KM1A 4UMBA 2E1DA 1E4NA 3PTKA 2PD9A 3LCGA 3U5YA 3W1QA 4H8UA 3QVQA 2ZCGA 4GJ1A 3WELA 2FGLA 3STCA 4QIUA 5TAOA 1DHKA 5BU6A 5ECVA 3KM8A 3EXRA 4GI6A 4LAUA 5AHNA 9XIAA 2EJAA 4N6FA 3N6QA 3GYCA 5BRQA 1WXJA 1LQ2A 4CQ8A 4MNJA 4TTUA 4LANA 5I3GA 3R10A 3PTQA 5BMXA 1UWIA 4A6GA 3PUGA 5I6SA 3I3BA 1QPRA 2BZNA 3RU8X 4AIBA 2C7FA 5F4SA 4JTCA 4H6QA 4W85A 3S2JA 4XZLX 3DI1A 1NF0A 1B3ZA 1EJUC 4TIMA 1C7TA 1W5PA 3KDOA 1CIUA 4HU0A 5FEXA 3W2LA 4TX9A 4IFKB 1TTIA 4GO9A 4YWIA 1ME8A 3QHNA 3AHVA 3CZGA 3ES8A 4C90A 1UKOA 2Y5EA 4EPEC 1PSCA 5C9UA 3ORWA 4ACYA 3V1HA 3S46A 3N4FA 4GXMA 3HPXA 1JRCA 4FMVA 3AU2A 1LT8A 1ENUA 5JQ9A 1XYZA 1YLVA 2Y70A 4QG8A 4KMQA 1OZMA 3EDJA 5ECUA 1KXTA 1PV8A 1TVPA 4NRSA 3BDKA 4QAWA 3CZ8A 5H1WA 4KEMA 3CMFA 6ALDA 4CU6A 1XLJA 1FWDC 3THUA 4BWLC 3VIIA 3OHMB 1XSIA 1IQ8A 1CLVA 1UD3A 4DXVA 4IH3A 5E6YA 5C7VA 2A6NA 1W8GA 1DXIA 2H3DA 2E4TA 4JKLA 1E5JA 4GIEA 2XFWA 3IGXA 4WY0A 1F6KA 4LPCA 2DSUA 3P8IA 2CZ5A 2O9PA 2AL1A 1XL9A 2PCQA 1ZB5A 2YA0A 5CC7A 4MPKA 3ANYA 1A5SA 5GNYA 1EO5A 3PS7A 1H7PA 1MXGA 1O4UA 1JPDX 4O12A 2VI0A 5F2GA 1ISVA 3I65A 3ZYZA 4NJIA 1JI1A 2Y5JA 4GNVA 3SCNA 3ZMRA 4XIAA 4HNTA 5HXMA 3DERA 3T6CA 4EF8A 4AZIA 2VX6A 2YR1A 3G22A 1H1YA 3L0GA 1NQ6A 2FLIA 2TPSA 1R9ZA 1A47A 1JZ3A 3LBCA 1VLWA 2O9TA 1THFD 1W9UA 1KRAC 1S2VA 4UTUA 2YOCA 3UYIA 1GQKA 2OLSA 3W28A 1QO2A 4DI8A 1R3VA 3MQTA 1FWEC 3H7UA 4Y8EA 4XZHA 1NVMA 2GGHA 1HX0A 5LA0A 1NOWA 3F2DA 2ZA2A 1HW6A 1DJHA 4UQDA 4TXEA 2DIEA 4LEQA 3WY1A 4UCFA 2X30A 1J9YA 4O57A 3BLOA 2VELA 4C7DA 4TTGA 1DL3A 2V3DA 4D6FA 3HV9A 3WSUA 3N14A 4ZL1A 4JHZA 4LJ3A 3PPCA 3IJ9A 2QCLA 3OVGA 5CXPA 4ES4A 3P14A 3ZVHB 2H3BA 1J11A 1YDNA 3TW6A 4RPQA 3BSHA 4G7FA 1TJ2A 3DECA 1RCOB 3V75A 2W0UA 4J3SA 4CUCA 2PCEA 5JBFA 3NVTA 1V8EA 3VNIA 3UG3A 3UCQA 3BAXA 4XB3A 1FRBA 4ZO6A 1WO2A 1U22A 1XLIA 2YXOA 2Y1HA 4J4KA 3JW7A 1NH6A 4G7EA 6A3HA 1OIMA 1XBZA 4GKLA 4S2CA 4CD8A 2F2HA 2F6KA 5K2ZA 2ATSA 4H8HA 5ABHA 3ANUA 4NJKA 3LB0A 1GW9A 2WPGA 3O6YX 2WMGA 1RQEA 2IKHA 1FWIC 5CC3A 1ZJBA 4PR4A 3VX1A 1GNXA 5C2XA 2QAPA 3M0KA 4U3AA 3CGTA 3NOEA 1P4CA 2VGIA 4OV4A 4O1FA 4OBRA 2IXUA 1IT0A 2DSZA 1JYXA 4HPXA 1MXSA 2XN0A 3E2QA 4Q4KA 3WBWA 3LRLA 1I2PA 3HIJA 4ZENA 2ZOXA 4K3ZA 2X40A 1E4IA 2J47A 4NI3A 2ASHA 3WD2A 1JDCA 1GOMA 5LNUA 2GJRA 3P67A 3VOJA 2W27A 3KUMA 4CQCA 3HQNA 4MADA 4B9YA 1ZTVA 4UFIA 1GWJA 4DJFD 3W86A 2GOKA 3C52A 4X9YA 5EYWA 1MNSA 5CBJA 1S5NA 3CC1A 3M0VA 1E6SM 2PLCA 5EFFA 4C6EA 5KMYA 4W84A 4FLQA 2WCSA 2VURA 3VPLA 1R3WA 4H3DA 2A3EA 1LQAA 5CG7A 1A5CA 4A2RA 2ZUSA 5JH2A 2ZA1A 5AYBA 3TAOA 1EXPA 3FOKA 4YNGA 3QV9A 1EKOA 5H2ZA 3TJLA 3LPPA 3A9IA 1BYCA 5AYIA 4PCPA 1JDFA 2OQHA 1P1MA 4IL2A 3CS2A 2PP0A 2BXYA 3MMTA 2JGQA 3SUVA 5M1TA 3EDDA 1EJVC 3HURA 3ARPA 4R9OA 1P0DA 3MVTA 4HA1A 1IR2A 2E68A 4K39A 3TW7A 2HVOA 1GEHA 2Y6ZA 4NZ1A 4Q4PA 4DJFC 4W7WA 3U2CA 2HNHA 4DBEA 3I3EA 1NSJA 4PUWA 2GQ9A 4ICMA 1OSEA 3W29A 4EX4A 5HJXA 3LLFA 3VKCA 4Q4RA 2PRHA 1X96A 3QR0A 1E0VA 1JF5A 3PJWA 4EE9A 1XD1A 2HS8A 1FA2A 1H50A 2YCEA 4XZMX 2E6YA 2D24A 1QPNA 1M65A 3GTXA 2LLEA 3LMYA 4JN6A 4TV6A 3TA6A 4NG3A 2E9LA 5CPMA 4ZO9A 3NA8A 1XIEA 2BLEA 3ITTA 3C2FA 3VD7A 3AXHA 1KXVA 5C8BB 4AD0A 3WDQA 4F66A 1HP5A 4LOCA 5GPRA 3URQA 3UA4A 3G1XA 3K2GA 1UROA 2XH4A 3LHZA 4BQ4A 1T0OA 2J9ZA 4PA8A 1G7VA 1UW9A 1JCJA 4HN8A 1QHOA 1H5VA 4TVDA 1MW0A 5B7ZA 1PZ0A 1R3RA 5FL0A 3TXZA 3EWXA 4N4PA 1U33A 2J8FA 1V6YA 2OFJA 3KOWA 4K7VA 4Q3MA 1UWUA 4QBXA 1KW1A 1E55A 3NEHA 3T05A 1C8YA 5HBFA 5DMYA 4LSBA 4XO7A 1TPFA 2PDXA 4QQ3A 3L21A 1YHTA 1YXYA 3VIGA 5CSYA 3K8LA 1FTXA 3CK5A 1XR2A 2J8GA 1BVZA 4NQ1A 4DB7A 1TQXA 3IIVA 2V63A 3CT7A 4AY1A 2AMGA 3O0KA 1BWLA 4UWMA 2AAMA 2ZXBA 4RDVA 1E3ZA 2WNWA 1E51A 2B4GA 4J35A 1PXGA 2W66A 4HMEA 3M16A 4NZ3A 1AA1B 3UD6A 3CH9A 1TPWA 1I0DA 3KEHA 1J0ZA 2VEIA 3TC3A 3EPOA 2Y85A 3DEQA 2YZ5A 1VFMA 3AIBA 4QS5A 2YL5A 3ABOA 3SFKA 3EMQA 4ERIA 3CNYA 3TNOA 4DN1A 3S6OA 1JZ2A 2WVTA 5AB3A 4W8LA 1JDDA 2V5KA 4P8UA 2W3ZA 3AHXA 2HQAA 2WMIA 2WJDA 2BNJA 2GPTA 3ELFA 1VPYA 3A22A 1B30A 1TUFA 1OABA 1US0A 5JBEA 1K6WA 4D6HA 1SYTA 4JIIX 2JIWA 2WHKA 4A3YA 3T42A 3HFYA 1ZUAX 4S38A 5HOSA 1R46A 2F8QA 1HL8A 3IS4A 3VGBA 5AHMA 4IGSA 4TX6A 5TF0A 1M03A 1IZKA 1UKSA 2GL5A 3WK2A 3BANA 4ZOCA 3MUZ1 1GOQA 3UZYA 2E5DA 1DKWA 3U2ZA 1OK4A 2FPVA 1IIHA 3HGRA 2XGIA 1KBLA 3EX6A 4MKVA 4B90A 1PWMA 5A6BD 3KX6A 3QGVA 2RGMA 5XIMA 3N6JA 2YCKX 2BS9A 3TYBA 3APTA 1FWNA 4HIBA 3VMPA 5DMLA 1GPWA 3VIHA 4A3QA 2KZHA 2NQ5A 1YEYA 1Q7ZA 1GZGA 1MW1A 4LVAA 3QW3A 3ZQ9A 1UPMB 4Y9AA 3ABRA 1NEYA 4DJDC 2BP1A 4TMBA 1YPIA 2WKGA 1YADA 4A8IA 1F6YA 3RPTA 3CHEA 4ZQMA 3OU8A 3W9ZA 1VLIA 3W73A 4ACZB 3AJXA 1J5TA 2OWXA 2DZSA 3GXTA 3NG3A 3GHSA 4LU0A 3KE0A 1OCJA 3QMTA 1EYEA 5G4EA 1UBSA 2Y5SA 4PUNA 4B3ZA 4JL2A 2VMFA 4UIOA 3UP8A 3T2OA 4KCUA 4ZTXA 3LRKA 4DO7A 3KL0A 4FB7A 3VOHA 1FDJA 4E4UA 4BHYA 4HBKA 2QJMA 4LBRA 5D2WA 3UXLA 3A23A 5C5YA 3HJEA 2WJFA 5G1MA 3BK0A 3T2QA 4H01A 1X8CA 1C8XA 4GINA 4WSJA 2H90A 4PMRA 2Y63A 3OLEA 1MYRA 3L4XA 3D0CA 3B8SA 1XH0A 3U0HA 1VRXA 4OU1A 3TSBA 1GG1A 3CPUA 4YYFA 1V3LA 5C70A 1C8QA 2J6XA 3RLUA 2X0YA 4JTSA 4V28A 3NPWA 2KAUC 5LYRA 4FNUA 3CYJA 3O8AA 4Z2IA 2OOFA 4N9CA 3WL1A 2PMQA 1BQCA 3QY8A 2WVVA 3DFSA 1QATA 2X1RA 4MJZA 4FXJA 4PUUA 2A21A 1KTBA 3T0CA 3T0AA 3DHPA 4QNWA 4GD0A 2NUXA 2NWRA 4DO4A 3PBUA 1JAKA 2FMNA 1H41A 1A5AA 1FP9A 2VZSA 1R2SA 3JR2A 1TV5A 4M6QA 5CJ5A 1Z48A 3PZGA 2INZA 3BTNA 3DKJA 1LRQA 1XIJA 3H6OA 3V0SA 1BVWA 1OFQA 1IYXA 1R6WA 2QMKA 2QF8A 1E70M 4RW3A 2VM8A 1IZJA 4O16A 2ZDSA 3MP5A 3XINA 3BLPX 3ECQA 3MSYA 1R38A 1ZL1A 3VD9A 2ZRWA 3CWNA 3I4EA 2GJNA 1IEIA 2NX3A 4F3HA 1QW9A 3SAZA 4EK7A 2GK1A 1ADSA 4KS0A 3RDKA 1HVQA 2QF7A 1TR1A 1FWGC 1Y8BA 3VCRA 2EPLX 4WSHA 4AHQA 2E6DA 4UTTC 1AJ0A 5B80A 1J6PA 1CXKA 5E6ZA 3E2VA 1R30A 2CBUA 3VNDA 1PTDA 4URIA 3NSNA 3H24A 4I7UA 3C5QA 2WCAA 1YPXA 2Z0IA 3BGGA 5LSMA 1BWKA 3GZ3A 2GUYA 5AHLA 1GVIA 2D2GA 3PNZA 1KNWA 5D37A 1E9IA 4H4IA 4MB1A 2OKTA 1LCOA 1OYBA 2XSXA 1EIXA 2NQJA 3LENA 4C7FA 5C6MA 4ZFMA 1LORA 5BXSA 3IAQA 1LL4A 3KCOA 3G1YA 1W1ZA 4IPIA 4F0SA 3BO9A 1VJIA 3VGHA 3F4VA 4QCEA 1UH3A 1CGTA 1V0MA 3NJ3A 1QI2A 4PRWA 4JYFA 4QHRA 4UMAA 3L5AA 5EMLA 3BG9A 3JS3A 4Q6XA 4YLWA 2WK2A 1TV8A 1V3JA 3GQYA 5BOEA 3ME3A 3T0DA 3AMGA 3ERPA 4PTNA 2FPTA 3PZVA 4Q4OA 4CQBA 4Y8FA 2P8CA 1U1HA 2H8ZA 5CAHA 4GVHA 3R0UA 1OM0A 4OVXA 3TYZA 1A0CA 1ISWA 2AQVA 2W92A 3SUWA 1WYIA 1LRNA 3CMJA 2DZXA 4IICA 2VYOA 3AS1A 4M29A 3W1XA 1F9CA 3UPMA 3ZM8A 3TX9A 2IPFA 2ZICA 3H55A 5T9BG 2ICSA 5K4ZA 3MCOA 1DYSA 1UQYA 5DY2A 2QZRA 4AXKA 1AJZA 1RH9A 5HNRA 1XLKA 5JBDA 4LNCA 4XWUA 3SCQA 5I02A 3AQUA 4YMZA 2WSQA 4US5D 3DIPA 4FF7A 2VVNA 3G6MA 5HNTA 1W5OA 1XSJA 4AZBA 4PTWA 4X63A 4V15A 4GX9A 3CZEA 1I2OA 2BMBA 1T40A 1UZHA 3AUOA 1L6GA 2GDUA 2W4XA 1ITUA 1L9WA 1J6OA 2WZMA 4M6PA 3RIKA 4O15A 2G3MA 3WQCA 3M7SA 4E5TA 3H12A 4I7WA 3H21A 3IVSA 4B5XA 1F4HA 2DZVA 3WD1A 4UFJA 4J40A 4ZQOA 4PB5A 3W70A 4JTHA 1RJRA 2ZUMA 2C13A 3RCNA 2V3FA 5H6HA 4GI4A 2PTYA 3TKFA 4ZE4A 3IGUA 3NNTA 3GNRA 2OYLA 3KXQA 2JF6A 2OYMA 4YVXA 4W7UA 3T55A 1TWDA 1HJWA 2QPSA 1QAPA 4O10A 2CLIA 1NQKA 2JGYA 3ZSTA 1VB9A 3IJDA 1KGXA 1KLYA 3KTCA 4V1XA 5TIMA 4MNKA 1FWRA 1UASA 5FJOA 3GC4A 1I9CB 1VFTA 1EC7A 2HV5A 4JQAA 3MMWA 2A0NA 3UQNA 2XVLA 3ITLA 3WQEA 2DVTA 1B5TA 3OZOA 1PHQA 1U2YA 4JKKA 3RGTA 1M68A 1EA9C 4V33A 2FQIA 3UGVA 4G56A 4TMCA 1NU5A 2PODA 4ZODA 2VQTA 3M64A 4PL1A 1X98A 3PC0A 3GU2A 3N25A 4NF7A 4O0QA 4C91A 4RDWA 1KM4A 4TO8A 3M9YA 5CAKA 1JEZA 1VFUA 3UXDA 1GYLA 5A2BA 3AC0A 4BI6A 2DEPA 1FX6A 1IEQA 5A69A 3W1AA 3VC6A 3JU2A 3KRZA 3NO1A 3LHTA 3F1QA 3W7EA 3FX4A 3CIWA 4JYDA 1UD8A 4QG6A 4P8VA 4JIQA 1WX0A 1JZ8A 1T96A 3PM6A 4OOZA 2FDSA 1JR1A 4CU8A 4MAVA 1ISYA 1HJVA 2WO5A 3GXMA 5L6UA 2AOSA 1UKQA 2C6QA 2ACRA 1F6PA 4QLLA 2OYKA 4YJ5A 5AC4A 2PWVA 2ZUWA 3EDFA 2G95A 1XQKA 2BV9A 3SY8A 4MZYA 4YHGA 1IIGA 1G7UA 1XUUA 1G9HA 2NLYA 4NU7A 1G4SA 1N55A 2D0FA 3M6DA 1IWBA 2CYGA 3TTYA 4A3UA 1YE6A 4WDWA 1V03A 1IGWA 3EPMA 5CG0A 3VDBA 3MYPA 4QJ4B 4AD4A 1BF6A 1EJWC 2Z00A 1XYLA 4CVWA 4CCZA 5G4HC 1V0NA 4F0KA 1AD1A 1ZENA 1V93A 3SCSA 2BWGA 4YTUA 5LHFA 4IT1A 1KXQA 3D47A 1A4LA 4WR3A 1XC6A 5TQLA 4LYKA 5CKSA 3CH0A 1G4TA 1TV7A 3I3DA 3TP4A 4Y2WA 3R4IA 2A1YA 2PDGA 1M9HA 5D8WA 1K9EA 5AN7A 3PAJA 1DQWA 4ONVA 1NELA 5A3HA 3U7VA 3PBYA 2VFGA 3CV1A 2UY4A 3VNKA 1VBRA 4ML4A 3IJQA 3V0UA 5MKGA 4CQDA 4HT3A 4M3PA 2CPUA 3RCMA 3T81A 3T7VA 3VNMA 1OHLA 2EGZA 1JD7A 5HJLA 3MUAA 1I6NA 2X7VA 3NXLA 1T8XA 4GHRA 4Y9PA 1DIKA 3TLQA 4ATDA 4NZJA 1H3GA 3NQ7A 2BOEX 3TJ4A 3M0XA 2EPHA 2E0PA 3UR2A 3PNUA 4ZO7A 1VYPX 4FA3A 3LV6A 3VU2A 2G97A 3SCRA 1AW5A 1Q6OA 3CIVA 2FH8A 3KLLA 4WY0B 4CEUC 1R7AA 1H51A 1VEMA 3EMZA 2WJZA 5F2IA 2ZZ4A 1QNSA 1FWBC 4IFOA 3M07A 1WOBA 5FJTA 3ZJKA 1CTNA 1EJ7L 2WV8A 2O7SA 4DYEA 2ZDRA 2FJUB 2ALDA 2VC7A 2YL8A 4NNCA 4E2OA 1T8QA 4E3VA 4XSMA 1XF0A 3GB6A 3NZRA 2YPIA 1EC8A 3W76A 1FFRA 4LWWA 3Q67A 3ANVA 1VJSA 4F0RA 2ZFAA 3O6CA 1WUFA 3OZYA 1W3KA 3QLLA 2Y61A 2ZE0A 3E02A 2WLYA 2NV2A 3WDJA 1F8IA 3ZFHA 4NHVA 4HMDA 4C65A 5A6SA 3L2LA 4QISA 4FO4A 3QPEA 3LUTA 3OGSA 5AZ1A 1VPXA 2HVNA 4LRTA 5IHRA 2DH2A 3F4DA 3DCPA 4PULA 2ZXAA 4XV0A 3BLKA 4BJHA 3KRUA 2CFFA 4QM1A 3W24A 3EWDA 3CHDA 3KBSA 2OZ0A 3PSWA 4PB3A 2OWWA 3W7RA 5C9RA 4R7JA 1M53A 4FNQA 4IPJA 4DF1A 3HQPA 3MY9A 1XGZA 5F4XA 4MAZA 1W3NA 4XAPA 2UY3A 2QUUA 2BFGA 4IIHA 5I3JA 2QIIA 1OFOA 3BCJA 4I7VA 4C1NA 2OB3A 2PP1A 1QRQA 3MS8A 5KINA 1AW2A 3RJYA 4UQCA 3PG9A 2R8WA 4KBXA 3WLHA 1WZLA 3BV7A 5BROA 5HPOA 4NYUA 4JTQA 1K6AA 2YLAA 1F61A 4CN4A 1KLZA 3QPYA 3LPFA 4JTAA 3K1GA 3KTXA 1E0UA 4KCTA 1N8WA 3KVMA 2HISA 5IM51 4IG2B 3BOXA 3BCDA 3EEZA 1W8SA 4LVFA 3PZMA 2ZTJA 3MVIA 3OO2A 2F7FA 2HWGA 4ATLA 4ASTA 1NFGA 3HMCA 1R3TA 2E77A 1NP2A 2EEXA 2D2HA 1X7IA 1M1BA 4AVFA 4WKAA 4GUFA 5IDIA 1K8ZA 2ANUA 5HMSA 4B2DD 1TTQA 1BHGA 3LSBA 1MVYA 2CCRA 2Q3OA 2OT1A 1TUXA 3NDOA 3WK3A 2HRWA 5DRIA 3BJSA 4KRZA 4KPLA 3RLVA 1BRLA 3W38A 2Z25A 3XIMA 5BZAA 1NDYA 3TCEA 4F4RA 3B0PA 4JX4A 2QCMA 1EHAA 3R8GA 2DZWA 3THDA 9CGTA 3MKVA 5AVHA 3JZUA 2FZBA 3QRHA 1G6CA 4KWUA 4DF2A 2Z1WA 3IRSA 2QVHA 3N3MA 3MHUA 1FWFC 2QCGA 3O07A 4FSAA 1L6WA 5ABFA 2RDXA 4DAIA 4C5ZA 2WLZA 4HTYA 4QROA 1TA3A 5I7GA 4WCJA 1QHZA 3ENLA 3QW4B 1S2AA 4GNKB 2Q8XA 1B3VA 3A12A 3WDIA 1JUKA 3HBLA 3DFTA 2AKZA 3G5EA 7ODCA 2NT0A 4B5VA 2EHHA 3KOYA 4JN7A 3W7QA 4B15A 4K1GA 3GBDA 5CQ1A 2XTKA 3EA3A 3S1XA 3GDBA 2Y4SA 1EDGA 4QSFA 1ECQA 3KBVA 3TNBA 2EPKX 4M1BA 1J10A 3UG8A 1RVGA 1TQJA 3C2EA 1PZ3A 2A79A 4JNMA 5GQBA 3WF1A 2HXTA 2VNCA 3VMNA 1J2WA 1RD6A 1J0IA 4KRUA 1VFHA 3LM3A 4JBRA 3O2LA 4ZCWA 1LRTA 4NKCA 4C1LA 1E1CA 1I8JA 4IOTA 1NP0A 3NQ8A 1RXOB 2PU0A 1Q5MA 1TZ9A 3MANA 1XJBA 1TPC1 1D3CA 4AXNA 4QJ5B 3CWOX 3B8WA 2ZXDA 1XKJA 3MCMA 1V3KA 1UQZA 3MA8A 1TV3A 4CU7A 2I1OA 3P0XA 4GK8A 4UQ9A 3W22A 1OFBA 3G18A 3EOEA 3GE7A 1HKIA 3GNPA 1MEWA 3C2RA 4HOZA 5DX7A 2NVDA 1KFWA 3NWRA 1CX9A 1B57A 3OPSA 3S2CA 3IJIA 1X38A 3O0FA 3R5EA 4DM2A 5D2XA 3M5VA 4MTVA 5A6TC 3B9AA 3CB3A 3DAQA 4JTEA 1BEUA 3VIKA 3SO7A 1ZNNA 3NTYA 3EKZA 1AZ1A 2YA2A 3NZ1A 2VQUA 1RLDA 1Z44A 2FZDA 4D6GA 4D6JA 4TVUA 3E0LA 2X42A 4P7OA 4JKMA 4FS9A 7TIMA 2H6RA 4WLCA 3OLIA 3UETA 1NF7A 3RRAA 1CT5A 5TBOA 1HJSA 3W71A 1T99A 1XS2A 4YU1A 1OC5A 1R2TA 3RF9A 1E6XM 3NZPA 4PMNA 1A3XA 1G5AA 4H9TA 4A4AA 4CCEA 2PI6A 1GHSA 4PUJA 4B5UA 4TVCA 3TROA 4Y9MA 3MI2A 6PTDA 4CD4A 5CZ0A 1ME7A 3EB4A 5A6AA 2GDQA 3IIZA 4BFAA 3WBXA 1KGWA 1OFRA 2VCAA 2PA6A 2QS8A 4XTDA 2DIJA 2V0TA 2VX5A 1Z9AA 2OGJA 1OK6A 4OUEA 5M2FX 4PMQA 2JKEA 4DJEA 1S5MA 1VQTA 4KFOA 3HGOA 3KLKA 3RNDA 3IV8A 1LQ0A 3BH4A 5DBUA 2CHOA 1OT1A 1W5NA 2FJKA 4NUWA 2HMCA 3ARXA 3CUXA 1PKYA 4DZAA 4EAYA 2OQYA 4DBUA 4ZXOA 1EDTA 2J7BA 3FXGA 3W1UA 3CU2A 3KZPA 1MUMA 1WAUA 3I7RA 4IUGA 2DU2A 2P88A 4F8XA 5M03A 1UA3A 3ABQA 4ZQCA 4GFSA 4Q4QA 3DHUA 2IQ0A 3ZJ8A 5CJNA 3PWGA 3I6TA 4I9AA 4PCTA 3MCNA 1H7OA 3NM3A 3L2MA 3OIHA 2ZQ0A 4HNUA 2DT0A 4B2DA 2Y89A 3P61A 1GW1A 3TOYA 2DT1A 3VIJA 1UD2A 1BTCA 1JPKA 3GNOA 3FAWA 4K37A 3VMOA 5D9PA 2YL6A 1JXJA 3BMWA 3VI2A 2VFDA 1FHLA 1S5TA 3R7MA 1KM2A 2ZUNA 2X05A 1HO4A 4QDPA 1VAHA 3W26A 3W53A 2SFPA 3VDAA 2YDQA 4W5UA 5E9XA 3PJTA 4YWSA 3AIEA 1EPVA 3S2LA 4LCQA 4MOZA 2J7DA 1SJAA 3LA4A 1YPFA 4C6BA 2PTZA 2OZTA 2PBGA 3W88A 2BTMA 3N2CA 1LOSA 3REQA 1PE1A 2A3CA 3H4WA 4I6VA 3NFUA 1CWYA 5A5WA 1TJRA 2F38A 4Z42C 2VZOA 3BCFA 5G4WA 2XH0A 4PUDA 4DZIA 1PTAA 4D72A 4G1KA 4LBUA 4NAFB 1AK5A 2IQDA 2DV0A 2B81A 4CNNA 3P74A 4GXWA 3KBMA 2BODX 2C18A 1DPMA 3LI0A 1Q8JA 2ONEA 1VIWA 2HPMA 3T78A 1DJXA 1KWKA 1EEXA 2YA1A 3QXBA 4DM1A 4GG9A 2NUWA 3C0LA 3DU0A 3R58A 4UZUA 3TTOA 3AMDA 2OMAA 2QJNA 2XN1A 3FVMA 3N9SA 3W75A 5JVLA 1M7OA 3CUJA 1Z89A 3QPZA 2B7QA 3A4AA 1VZWA 4NT0A 1M7PA 1V6UA 4OBTA 4FX6M 4E2BA 1MRQA 1W37A 4X22A 1PL9A 5KEZA 2D22A 4Q8PA 2OEJA 5TNVA 4JTJA 1O5RA 3S47A 1UP3A 3ARUA 3OVQA 3DYOA 3GBEA 1XINA 1CDGA 4MY1A 4TU1A 4MZ1A 3FV9A 5ABTA 3TK7A 4N9DA 4Z08A 3QLDA 1U83A 1GORA 1RJPA 3RYSA 3MT1A 3R6IA 1SO6A 5FJIA 1EHNA 4RDZA 2YIHA 4Q4MA 3N18A 1AH4A 3NQ6A 1UMYA 1WE5A 5DT5A 1F3XA 4XTIA 1EJTC 3AS2A 3WMSA 1TWWA 3VVGA 4ZOAA 2J88A 2WHJA 5KETA 3UVAA 3WQGA 5LNWA 4IHCA 3ONCA 4PCFA 2E7FA 4GRSA 2G8ZA 3W85A 4AW7A 1O60A 4GABA 1UWSA 2G41A 3G0UA 2GLKA 1W1YA 2OZ8A 5J5DA 3P8JA 2IW0A 4FXFA 5BMWA 1GYNA 1WDQA 4XKMA 3WEOA 4ICNA 5FCZA 2A7NA 3URBA 4RK8A 1TJ0A 2Y2WA 2PSNA 1MNZA 2NXGA 3NEVA 3T4WA 1P43A 2C79A 2GYIA 4G6CA 4LH8A 1VS1A 2FHBA 3B8DA 3KRSA 3R12A 4JTRA 4HVXA 2VENA 1JGMA 1K3UA 2AKMA 4XZ9A 3GNDA 5A6JA 4GUHA 1UOZA 1VYSX 5A95A 3VCNA 3N6HA 1EZWA 5AHIA 1SZEA 1ICSA 3LK6A 3TN3A 1K02A 1SZGA 1FH7A 3CL7A 4O52A 5I23A 3S9ZA 2ACSA 3O63A 5I79A 2WQDA 1HQTA 2J24A 4DYKA 2J6VA 1R2RA 2INFA 3GFYA 1VBHA 3MP3A 1VC4A 4A29A 2HCVA 2J25A 4XD4A 2OO0A 1ZLPA 1VPQA 1GQIA 2ALRA 2PTDA 3TWBA 2RHGA 1JG9A 2EPMX 3M46A 1IXQA 3WQFA 3EGJA 4D1JA 5CEWA 3BW2A 4IQJA 1E4LA 1OX4B 3ARTA 4N7QA 5C54A 3BGJA 5AC5A 5A8QA 1E15A 1NOFA 1X1OA 1KRBC 1I60A 4KW2A 3W6LA 3BAJA 4JHMA 2XVKA 4A8RA 2Z26A 4MIMA 2WBKA 3GH5A 5A6KA 1ZJHA 1S2TA 1CXFA 2BXVA 3W1RA 2WVSA 4TOQA 3OBAA 5JIWA 3SURA 3VILA 1Y5VA 1BTMA 2CXGA 3VABA 2CITA 4AZ5A 3ITXA 4KEZA 5CSUA 3NZQA 2ZZ6A 2DJLA 3U4FA 3VE9A 1TTJA 4CQAA 4M8UA 1BWVA 1MUWA 1RALA 4LUJA 4UTMA 4ICCX 1HJQA 4UTWC 5LXEA 4YCOA 2VCCA 3BWWA 3OOQA 3F4CA 2IPWA 3IPWA 3B4UA 4BA0A 4QLKA 3H2AA 1PX3A 1TMLA 4LUSA 4DUVA 4NP7A 4GX8A 2OEKA 3EDKA 2ON3A 3HGSA 4S3CA 2WSPA 3AUJA 3AXIA 4U2YA 2OJPA 4JQ4A 4ZE5A 3TYAA 3B4YA 1B4KA 3N12A 2NW0A 4MB5A 2RFGA 5EB8A 2GQAA 3TTEA 3RAOA 3I6EA 1SJBA 4H6KA 2R24A 1LT7A 1DJYA 1K8YA 1WBJA 4UFMA 3KL3A 1XRFA 4K8GA 2Z6IA 4I5UA 3ES7A 3P60A 1KD0A 1X1NA 3VA8A 2J4GA 1OCQA 1RQBA 1Z8AA 3N9KA 4RV3A 4A05A 2D73A 3BZGA 4AEOA 3ZZ1A 3CEUA 4EXQA 1W9BM 3EWYA 5A8OA 3GC5A 5I0DA 1MWOA 2GJXA 4GYJA 3N2XA 4PEKA 2WNZA 3WN6A 1KWGA 1Q7QA 1VD6A 3GIQA 3HG4A 1XIBA 1GVQA 2VC9A 3EXTA 1ZGDA 2GVLA 2ZWZA 1F4AA 5EMYA 1S3TC 4DRSA 1AQHA 2P5NA 4Z2GA 3W87A 4PZVA 4IPNB 4DUXA 1Q6RA 4KWSA 2YDAA 4OKDA 3B97A 1TPUA 5DCDA 3S0CA 2I7GA 4S1FA 1RUSA 2EKCA 3H2NA 5AECA 3GXPA 4TR9A 4O0ZA 3ITOA 4EPBC 3GR4A 4WKFA 3HG2A 4PBFA 1LZOA 1KXHA 4LGXA 3H53A 1RPXA 3OLDA 2OOGA 3BAKA 5CZJA 4IXHA 4RJEA 3VC5A 2DFAA 2TYSA 4AIEA 2Y8UA 2PFHA 3GSMA 2OO6A 4QE1A 3WK1A 3VZZA 1L0PA 1QK2A 1W9VA 3DFPA 3TJXA 3I68A 3M0HA 1XRVA 1D7KA 3U6WA 4IISA 3MSGA 1PWLA 1TIMA 4AG0A 2IQTA 2DZUA 5LGXA 1R85A 1ML1A 3GDRA 3GO2A 1HKKA 1IWPA 2B0MA 4OBSA 4B5SA 1YQ2A 3SBFA 5H8MA 3JUGA 2TRSA 4KWVA 2HNEA 5AHEA 3S3GA 3A4XA 2X2GA 4KFNA 3WK0A 4PRTA 2IPJA 1P7TB 5LKYA 3SM0A 3AWNA 1REQB 3UWEA 1XH1A 2CBIA 4YVPA 4IQEA 1UP2A 1Y5XA 2RKXA 3FNDA 1OFDA 4AIOA 4HZ6A 2DZAA 1G1YA 4UOZA 5C0QA 3QTPA 4NJJA 4UBPC 1YMYA 3KWSA 1PZ2A 1RZMA 2NZLA 1FQ0A 1MW2A 4DO6A 4RZ5A 5D2TA 2WZTA 1PKMA 1KM3A 4RX0A 3LZ5A 3QBUA 4JIPA 1CLKA 3B9DA 1H09A 3KHJA 3ZT6A 5BU9A 1QU4A 3NXFA 3Q65A 4U28A 3U57A 2WZIA 3H22A 1QMLA 2DZBA 4LAKA 1U5JA 3CMGA 5GVJA 3LCHA 4HMCA 2B31A 4JAWA 1QFEA 2X1SA 1KFKA 4JDBA 3VUPA 3V5CA 2BY1A 2WPBA 4I5RA 3HPSA 5I00A 4Z0JA 2X1TA 2C1HA 3V18A 3E49A 4OOUA 5CZKA 3LTSA 2FVMA 5MKGB 2PDFA 2ISSA 3W1PA 4AZ7A 4BCEA 5AYXA 4FXSA 4GC4A 3ISIX 5HWNA 3WLRA 4FP1A 2PDIA 1XLCA 5EMMA 5CJMA 4OECA 3G1VA 3PK7A 3UVIA 1LUCB 2VEPA 2YZRA 1E71M 3GVRA 4RZ4A 2DVXA 3G8RA 5KSWA 1XGDA 3ZS4A 1E56A 3C8NA 1LG2A 4K2SA 3A24A 1H7RA 4DWSD 4AC1X 2VFIA 2XISA 3HZ3A 4P7LA 2V38A 3SCPA 3K13A 2GGJA 4GPNA 4N9BA 3GG8A 1Q6EA 4MFEA 1SZNA 2DP3A 3K4WA 4DWDA 5CGMA 4AYSA 1R86A 3VGFA 7A3HA 4GO8A 3CO4A 2P0IA 3T0TA 3SJNA 4AHPA 4IXXA 3OLGA 1KRMA 4CNTA 4JTFA 4IGMA 3U9IA 3BICA 1UR1A 3CV7A 1IXPA 1GOOA 1AG1O 4HCHA 4O8RA 3WG6A 1D2KA 3FSTA 3LHVA 3WJWA 1VKFA 2PWFA 3H8AA 3WEZA 3D5HA 1VFFA 1W3LA 1WCGA 1K77A 2W67A 4BY3A 4WY0F 1FP8A 1GVOA 3T1GA 1FKWA 4OE7A 4JTKA 3OEXA 3TVAA 1RJQA 1SR9A 3CPRA 3FJLA 3FDGA 1ZFJA 4NNAA 3KOFA 3DG6A 4O50A 1KQZA 3TZNA 3UJFA 2QCDB 4HA3A 2E1WA 4DWSC 1GQNA 4HQVA 2WMJA 3W2NA 1W2VA 3DFHA 3W2JA 1RV8A 4YCPA 3FGCA 4FNPA 1L6YA 1LL7A 3NSXA 2J78A 1Z7AA 3C6CA 4RPPA 1Z69A 4MWAA 3F5KA 1Y7VA 2MANA 3W7LA 2CBVA 3GHTA 4GI8A 4NZ4A 1O5KA 3L4TA 3G1RA 3M7WA 1LWHA 2VGGA 5E0KA 4JCMA 3EWZA 3E9AA 1JYWA 2XJ7A 5G2HA 1HF6A 1JFXA 1Y5WA 2WSYA 1Q45A 4L9XA 2C0AA 3MV11 3CUZA 3NQFA 3EOSA 5HQEA 6XIAA 2C19A 1G4EA 1A5UA 3A5VA 1ADOA 4AEFA 4IL0A 1D9EA 3H7VA 5IBXA 3B8IA 3WFLA 3OYXA 1TJPA 4L6HA 1OCBA 4L1GA 3RJXA 3NIYA 4O1DA 5AC8A 1WDRA 3WEMA 3GDLA 4J3XA 1V6WA 3QV8A 4LX4A 2XN2A 2C3ZA 1N7KA 5I09A 4PGLA 1Q85A 1WXZA 2QDHA 4YVVA 3BW3A 3UR8A 1TTPA 1XC4A 5G1TA 1JCMP 1E73M 4Q33A 3VE7A 3CQJA 1P5BA 3KVKA 1V5XA 4RUBA 2PDHA 2GQ3A 1HZYA 3V7PA 3VYLA 1WKDA 3STEA 3GTIA 3ZLHA 1CGXA 1Q3NA 3PFMA 1HKJA 5REQA 3TOPA 4B4FA 1YKWA 4E0CA 3F4WA 1XYCA 3R8HA 1AZ2A 3NQCA 3OIXA 3IIXA 2PC4A 3FSUA 3U4AA 2X09A 5H91A 1YNQA 4CNOA 2JIEA 2VFEA 3OB8A 1V79A 4OJYA 4X3ZA 4HPGA 2C8NA 4AC7C 5HQLA 3ATZA 3HF3A 5D8ZA 2IXVA 1LWIA 4DBSA 1TFVA 2WSKA 1D8CA 1RY8A 4UNIA 1VFSA 2XINA 2QCEA 2VUNA 4GOAA 3SEPA 2P10A 4MJ2A 4M56A 3P5YA 1DXEA 1S1RA 1UWTA 4IGHA 4JY8A 1M7JA 4L1WA 4GYPA 3OG2A 4E3TA 1JPMA 4WDUA 1OT2A 3WUGA 5GNZA 2DPEA 1PX4A 2PDPA 4QX4A 1X6LA 2ZXQA 1PX8A 2P76A 5KZ6A 1QI0A 3TFCA 1UWRA 4IPPA 4GH1A 4ROPA 4AAJA 2WHMA 2VD9A 4HA0A 1WDPA 3SN1A 2RDWA 5FL1A 4X0VA 2X7WA 3M1ZA 3KS5A 5KZEA 1IEXA 1J0YA 2E5CA 4H6EA 1F2JA 1UZ4A 5AVNA 4DAFA 4OWGA 2WNNA 2FB3A 4AMCA 2CXEA 1OF6A 1DIEA 5JUVA 2NQZA 3IGSA 3I10A 3PZQA 4UC5A 1HIZA 4KEUA 5BW6A 1MI3A 4J3TA 1WQ5A 2IKGA 3JVAA 3MHFA 3AIVA 4XUGA 2VKZG 4JX5A 2BB0A 2WOQA 3LQGA 1XSKA 4F0HA 3BMXA 3LCFA 2CLMA 2W62A 2WM1A 3MO4A 2ISDA 4EF9A 2J66A 4UTKA 4E38A 4E8DA 1XFCA 4DWSA 2XIIA 3D3FA 1UZ1A 2R1LA 2CLLA 1JFHA 1PUDA 3B04A 3LDVA 1JYVA 3PJUA 3KDNA 2CLOA 2Y7FA 4XZBA 2V5BA 2IUZA 3IANA 4AEEA 2HJPA 2QYGA 4E8GA 4EIVA 3W3OA 2A3BA 3ZJ6A 1ITXA 2XH2A 2V30A 2QW5A 1J18A 1P0EA 3W7GA 4LTSA 2DY3A 2J77A 2Q71A 4JHOA 4KF1A 1J93A 5E9AA 4AF0B 4IFKA 4PMOA 2BHYA 4UQAA 1SW7A 1XUZA 1XLDA 3SRDA 2CZFA 1I2RA 1H11A 1UUMA 5AZ0A 4RE2A 2E3ZA 1F73A 5AOUA 2RJGA 3N2TA 3VINA 1Q6CA 1TPB1 1XBXA 3DG3A 2EXOA 3VOCA 4XKYB 1EX5A 4QEHA 4IIFA 3S42A 3T40A 1HO1A 2CESA 7CGTA 1GPFA 1FCUA 5F1VA 4BEUA 1PIIA 1MDRA 1EJRC 4GQGA 4C6KA 1B3YA 1L8NA 2V69A 4R53A 4WIWA 3HB9A 4H8NA 1ZBCA 4QCFA 3DI0A 6REQB 3W2KA 3C3UA 4PMXA 3SUTA 1F05A 3GD6A 3IEBA 1XIFA 4UTHA 3GAKA 1E6PA 3V35A 4DZHA 1QO5A 2WYSA 3DX5A 4HSOA 1JYNA 4KQNA 5CBIA 3EWUA 3BOFA 5D02A 1ESWA 1WV2A 1E6QM 1G01A 5CPLA 2A3HA 3UJEA 1V6TA 4LV9A 3CL8A 1AH3A 3MI3A 2TODA 1XXXA 2OODA 3NPXA 4EAMA 3AXMA 3B03A 1TE1A 1HT6A 2ACUA 3WQ5A 2VGBA 3E3HA 1W3IA 2G50A 4I3GA 4HU8A 1IHIA 4O17A 3AU6A 1EUAA 2EG6A 1HVXA 1ITQA 1YNPA 3IGHX 2GGIA 1OJXA 3MMDA 3M0IA 3ALFA 3AZSA 4ZB2A 1Q2SA 3FCPA 3OG3A 1FXPA 1OGBA 2ZIDA 4WDTA 1XW8A 4FI4A 3W6YA 5A6LA 1POJA 2QCNA 5E0CA 1E6ZA 3R13A 1QWGA 1G67A 2VX7A 3QQ0A 1EWEA 2HK0A 3GHUA 2VHLA 2O56A 3USBA 3N11A 1RBAA 3NQAA 2GVJA 4JEJA 2BGQA 4H2CA 3NL6A 3GX9A 5LZLA 1JGIA 2V82A 4ZXLA 2XFRA 3MV01 4ZB0A 4EANA 4FAMA 3S8HA 3IUIA 4R33A 1U1JA 4KWOA 4B5WA 4ERGA 1W54A 3T08A 4R9XA 1W6TA 3NSMA 1ISXA 2GSHA 1F7BA 3P82A 3L2IA 3H2FA 1N8FA 3OVPA 1LF1A 3MSRA 4LVGA 3W84A 3B8VA 2R6OA 3TQ0A 2QNEA 5I03A 2QEZA 2XVPA 2NQLA 3LN3A 1GCYA 4M81A 4U3CA 2XYLA 1GVYA 4FNTA 1O95A 4N0RA 2WSRA 2PLMA 1SSGA 4AZCB 1CENA 2Z29A 3GKFA 1KFCA 3ZVHA 3TW9A 2PDKA 5F2MA 3WD3A 4YS1A 3N9RA 4PMZA 1OX6A 3UGRA 2ZRYA 4PMDA 5A1AA 4REQB 4D6IA 4HHPA 1EOMA 3LERA 3REQB 4LUTA 2V2HA 3HQ1A 1QR7A 4GWEA 4KGJA 5JH1A 1DQUA 1XCXA 3LD5A 4Z2HA 4ZQRA 2VEGA 4DEFA 1L2QA 2MUCA 4Z2JA 1BG4A 2D0GA 4IM4A 1UB3A 4PCSA 2Y7GA 1RBLA 3SR7A 1KM0A 3DUGA 4Y9NA 2IKJA 5U4NA 4LALA 2QGYA 1TG7A 1AQFA 3NPUA 1H5YA 3WQ8A 5CCZA 1OF8A 1KKOA 4FF5A 1V0LA 5AC7A 5HUPA 2AL2B 3CQKA 1O66A 4LC8A 1ZS2A 4A8NA 1QI3A 2RDTA 1S1PA 4ZB5A 3C2YA 5BRPA 4J2MA 2I5GA 1RA5A 2J7HA 3F03K 1VBUA 4W8AA 3CQ0A 1XG3A 2WMFA 2D3LA 3RUBL 3LBMA 2PRLA 3PUOA 1HTIA 3UWWA 1XV8A 3SCOA 1NTHA 4TX8A 2DUZA 1HL2A 3DN5A 4I5XA 3KW3A 3K46A 3MJYA 2RUSA 1R47A 3CUHA 5M3WA 4IIGA 1SPQA 5GNXA 1UYQA 4QITA 3L5MA 4KT2A 3WUFA 1EQPA 1OBAA 2RJHA 4U2ZA 4F9JA 4PSRA 2NVAA 2VJXA 2QIWA 3FN9A 4DNHA 2ZADA 4PTDA 4L5ZA 4PCNA 1KTNA 2PS2A 1CGVA 4ZQPA 4H83A 3WMBA 2FZ8A 3TIMA 1TMHA 4G2DA 3C0JA 1JCXA 1B4EA 4LS2A 4LAZA 1YBQA 2Z2AA 4R85A 3VKJA 4M80A 1B9BA 4W7VA 4GYFA 4MKNA 4O18A 2BY2A 1UR9A 2OQLA 3W23A 4XBSA 2PE4A 4EP8C 3A4WA 2ATMA 1S5VA 3E38A 5MHBA 1XISA 3F2BA 3E5BA 2VDHA 4GIYA 4BQ5A 4P61A 4LS0A 4NJHA 1J12A 2KX9A 4OUIA 1FHVA 3P7YA 4IMAA 1CCWB 1XIIA 3FA3A 3GVQA 1Y0EA 1U1UA 2DH3A 3RX3A 4QFUA 1NWRA 4FLRA 3E12A 4H9MA 2QJHA 3QOMA 4PTXA 1F3TA 3VOIA 3DHFA 5FEZA 3DYPA 4IIBA 2BVWA 3OA3A 3BC9A 2P3EA 3ZJ7A 1YRRA 3H70A 1BQGA 1JDEA 4HZ8A 2UZ9A 4INFA 3B9OA 4PRRA 1TVNA 2QUTA 1DIDA 4L56A 4WSKA 3SN0A 3GXFA 4AU0A 4N42A