4MWAD

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
259
structure length
251
Chain Sequence
NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDKVRINKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 80
structure length 251
sequence length 259
chains with identical sequence F, H
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaD00
3H2EA 4S39A 3TYZA 2DQWA 3H22A 4S3FA 4S3AA 3V5OA 3H2FA 2H9AB 2BMBA 4MWAE 4DAFA 2VP8A 2H9AA 5JQ9A 4PZVA 2DZBA 4DAIA 4O0QA 3TZFA 4NIRA 1AD4A 2YCIX 2YCJA 1EYEA 4S23A 4O1EA 4DJEA 4CCZA 4C1NB 4MWAD 3K13A 1TWSA 4NHVA 3H2CA 4DJED 2DZAA 4NL1A 1TX2A 3MCNA 3MCOA 2Y0FA 4S3BA 1Q85A 4G9PA 4MWAB 3TZNA 1TWZA 2YCKX 1F6YA 4D9PA 4DJFA 4DB7A 3NOYA 4MWAA 4S38A 1Q8JA 3MCMA 3H24A 3TYUA 2E7FA 4D8AA 2YCLA 2VEGA 3H2MA 3TYCA 1AJZA 3H2NA 2VEFA 3BOLA 1Q7MA 1AJ0A 1TWWA 2OGYA 4S3EA 1Q8AA 4O1FA 2YCLB 3TYAA 1Q7QA 1AJ2A 1TX0A 1Q7ZA 4DJEC 4DJFD 2Y5JA 4NILA 4DJDC 3H26A 4DJDA 3H21A 4MWAC 4DJFC 4D8ZA 3BOFA 3H23A 3TYEA 4HB7A 3H2AA 3TYDA 2Y5SA 3TYBA 3H2OA 4S3DA 3TR9A 1AD1A 4DJDD 4C1NA 4S3CA
chains in the Genus database with same CATH superfamily
4L4PA 2J8TA 3AIRA 5G2IA 2FJUB 4TX6A 1F61A 1IXQA 1EC9A 4GBUA 2G97A 4C6IA 3BCDA 3W3OA 1JUKA 3G1RA 2QEZA 3O9NA 2DDXA 4PL2A 5A8QA 2XVGA 3S5SA 1KR0A 1KBKA 1S3TC 2B4GA 2PTYA 1VJIA 4X22A 2A3BA 4C90A 1ITQA 5CSRA 4KEMA 3VFLA 5JVLA 3UY8A 2D73A 4E2VA 2OLHA 8A3HA 5FF2A 1NWRA 2WBGA 2R6OA 2DUZA 9CGTA 4N02A 3NCOA 1NU5A 4YTSA 2B81A 3OGRA 4I8YA 3GYEA 1OFDA 2VX6A 4Z2LA 6PTDA 1Q6EA 5H8UA 2VCAA 1QNVA 3GXPA 2HPMA 1QI0A 1XCXA 2PLKA 4P8WA 2HXTA 3AUJA 1Q7MA 3QOKA 1UQYA 3PR2A 5D04C 1KKOA 3TWBA 4V1XA 2QUUA 4AYGA 4UQAA 1YNPA 5IFTA 3WK2A 2WNNA 4CCEA 5A8GA 3RAOA 3MHGA 2ZZ3A 5DMMA 1DXFA 3QN3A 2DV0A 3KDOA 2PC4A 3FVMA 4YTQA 5C54A 2W4XA 1ZJHA 4LXFA 3BL3A 5H8PA 3PFMA 1W2PA 4GLEA 1UR8A 3NQBA 4FR6A 2NV2A 4FK9A 2WMJA 3OLDA 4F4RA 2GVGA 2R1MA 4C1LA 2VURA 6TAAA 3MUIA 1XXXA 1UZ1A 3ZJKA 1LOQA 2VWTA 1FQ0A 4H9UA 1XUZA 3CZJA 4MJ2A 1P43A 4H83A 4R9XA 1WXJA 1ME7A 1WUFA 2QUNA 2X1IA 3GD6A 3LRLA 4K68A 1MZRA 4O0ZA 4QM1A 3SCUA 1T99A 2I5GA 3LB0A 1PKLA 3P8IA 2FPVA 5A6MA 5CC5A 4C6QA 3CK5A 1OY0A 3GHUA 2X05A 2Y0FA 5B7YA 4WRHA 2X7WA 4HCHA 1OG6A 1EKOA 2ZCGA 1E73M 2RFGA 3HGRA 2QQ6A 4XBJA 5KINA 3SAZA 3CAVA 5A94A 3EX4A 2PDUA 4WD0A 5F7UA 3CMJA 1G0CA 4H9MA 4NP7A 5D8ZA 1BG4A 1FFQA 3MT1A 4A05A 3CZKA 1YBQA 2BGQA 2QKFA 4GPNA 3K4AA 2EKCA 3BLIA 3LXAA 1DIKA 1UMYA 2X30A 2I9EA 4YLWA 2Z1KA 1A3XA 3WD1A 1UKPA 2LLEA 2X0SA 4PEEA 1KFJA 4H6QA 3EDKA 3QMSA 2ATMA 2Z00A 3W73A 3TLLA 5C5YA 3MI2A 1Y5VA 2VL4A 3KVKA 4QGCA 1F73A 3W7QA 3TYBA 3QV6A 3TLQA 4NNCA 1VFHA 2OODA 4S3DA 5SWUA 3A13A 3A64A 4UTJA 2BBFA 1IT0A 3EEGA 4OWGA 2Q01A 2V0TA 2AMGA 3DHFA 4ERAA 3I6EA 3DFYA 3EWZA 3F5JA 5EA9A 4FHAA 1Q4NX 5I3GA 4RNIA 2J9XA 3NYDA 4WEVX 4ZZ9A 3SECA 2IXUA 1VFUA 1XCFA 4M6PA 2INFA 1G1YA 2ZVIA 2DSZA 3STEA 2XISA 1O5QA 5G4EA 1WUEA 4J2MA 3RXZA 4DO6A 5ABTA 2PLCA 2BASA 4ZB0A 5FJTA 3BW2A 3DFPA 1X7FA 2IPWA 2W5FA 1E1CA 2NQ9A 2HJPA 1Q6QA 3MYPA 4POCA 4F2BA 2CHOA 4QEHA 4IPPA 2PP0A 4TTGA 1W9UA 2I5IA 1HQTA 2I9UA 1H11A 1Z7AA 5FJJA 4MF4A 1GUVA 5I3DA 3GHRA 3VGBA 4LCRA 1V93A 1AMYA 2TODA 5C7VA 4WVXA 2VD9A 3R8RA 1BVWA 4AF0B 4Z17A 3GNNA 1NWSA 3T7VA 4JN8A 1PKMA 2Y5SA 1LWJA 1QJWA 1LRTA 3ANVA 3S5ZA 4AMCA 5IOBA 3THCA 4YXGA 5I03A 3JW7A 2FGZA 4HVXA 5DCBA 2FZDA 1OK6A 3F4VA 4O16A 4S3FA 4AFYA 3HO8A 2HPIA 4PUJA 1W9PA 3WYZA 3W53A 3NEHA 4NAFA 5C9RA 3E3HA 2FZ9A 5I5RA 3BLKA 3GFZA 4PB5A 3EA1A 2AAAA 2R1KA 2HRWA 1XKYA 3VE7A 4OV9A 4AISA 1UZDA 1KD0A 4RDZA 4NZJA 1T40A 5BYWA 2VZSA 4BQ3A 3IVTA 1H63A 1SJBA 4MZ1A 1EB3A 1A3WA 3B4UA 3OBEA 1RQEA 3N2XA 4QJ3B 3BWWA 3CB3A 2ZRUA 3GQYA 4QDMA 1LBMA 3H2MA 3ZM8A 7CGTA 2R1LA 1YDYA 5D09A 5EMYA 2BFGA 3A12A 2VWSA 1JYNA 1CWYA 3EZ4A 3MWCA 1CCWB 3B8UA 1K02A 1AFSA 1KGWA 2GQ8A 5A8PA 3DC0A 3QTGA 1K9FA 1JYXA 5C2CA 1KKRA 3FK4A 2G3JA 4IHCA 4MWAC 4US6A 1LQAA 3VA8A 1SVDA 3QW3A 3P62A 2IPGA 4CD5A 2CC0A 1NARA 1DJGA 5F2MA 4ICMA 4HD5A 1HXJA 3QF0A 1RXOB 4NNBA 4Q32A 4GG9A 3VXGA 4F48A 3SW6A 5A3HA 3RLGA 1G4TA 1Q4WA 5FJOA 3ISIX 3UXIA 5EMUA 3NFUA 4WK9A 5HWJA 4P7NA 4UB9A 2HDJA 1X6LA 3E49A 4XSMA 4Q33A 3LOTA 1OC6A 1T5AA 2XN1A 3VDGA 3W7LA 4HYRA 4M29A 3HGJA 4HYVA 3TK7A 2OSWA 1XW8A 1DWJM 3AHVA 4AIBA 3BUVA 2WXDM 2DSWA 4HNLA 4YTRA 2QUMA 2CHNA 2VXNA 1QT1A 1R85A 3P60A 3ZJ8A 5A6BD 4IP7A 3S1XA 4AX7A 4UTKA 3WQ8A 2UY5A 2DIKA 2V30A 4H6KA 3FAWA 1OGGA 3BLFA 4L4MA 3PTKA 3QPZA 3WDIA 1VYPX 3WFAA 3LGDA 4BEQA 1NY1A 2GOUA 4P2VA 1XC6A 4DXXA 5BRQA 4DWDA 4U10A 2V2DA 3IV8A 1MDRA 2ZWZA 3L65A 1S5WA 3HMCA 1KWGA 2J9ZA 3E5BA 1LCOA 4DJFC 4GXWA 1EZ2A 2A1YA 3WL1A 1JF6A 2ZXDA 5BMWA 1OHLA 5EPDA 5E09A 4ZQCA 2FKPA 1PCKA 1PSCA 5F4SA 5LHFA 2PTXA 1UR4A 3FY1A 3H2EA 5BRBA 1OFPA 2OOFA 4UOZA 4X2RA 4HPHA 1E6PA 1WV2A 4FAMA 1KCKA 1AW2A 5CSUA 4O1DA 2FMNA 1E4MM 2G5WA 1EJSC 2C13A 3W26A 1ZL1A 4L1WA 3B9NA 1GVRA 3RLUA 2HVMA 2DZBA 2DW6A 1Z9AA 4FNPA 4O0KA 3PZIA 1EP3A 4GVFA 4GVHA 4YIWA 3UU0A 3NPXA 5I3FA 1W1A1 1K9TA 2EJ1A 4Y9PA 2DZAA 5EL1A 2WPGA 1Z3NA 2PS2A 4DWSA 1PZ1A 3O3RA 3PN8A 4W7UA 3ZQ9A 4BA0A 2DT3A 3GM8A 3TYUA 2PF0A 3CIXA 3VDBA 3P82A 1GQNA 4L9ZA 2X1SA 1OIFA 2B7QA 3TYCA 3QJAA 1Z48A 4HNVA 2PRHA 3GW3A 3H2NA 1ONRA 3UG3A 2P8CA 4FNUA 3WBYA 2IPFA 1GEQA 5HJXA 2OQYA 4ICCX 3CIWA 5EGRA 5T9CE 3TSBA 1FP8A 1B3YA 2O56A 3N2CA 5I00A 2W62A 2CITA 1ZUAX 1GNXA 1YE6A 5LNVA 4J2PA 1REQB 3SGZA 5C2XA 2P1FA 4ZO8A 2Z2AA 3KRUA 4K8EA 1KXHA 2I17A 3OIHA 4J5NA 1XPGA 5KZMA 3WH5A 1BXNA 2ZC1A 4KETA 2X42A 3SZ8A 5BNKA 1IR2A 1GTEA 2PZNA 4DBUA 1F76A 1SM9A 1FWJC 3P7YA 5AYYA 1XIBA 1G69A 2J79A 4DJEA 1XISA 2OWWA 4BCEA 3W86A 4JIPA 1PIFA 1N8IA 1KGUA 4EXAA 4U3CA 4NRSA 1H7WA 4JHMA 2FFCA 4OFCA 4QJ5B 2YCKX 2OX4A 2C79A 1G7VA 3W7NA 3S3GA 3EKLA 2GZXA 3LI1A 3RRXA 3OZPA 4GE8A 1PX8A 3KTSA 3KOYA 5A6LA 3RK8A 4H6RA 4XSLA 1FHVA 3O6AA 3GH5A 1MQRA 3HJZA 3ZR5A 2FB2A 3GVWA 5C7HA 5KTLA 2OXNA 3WMCA 4W5ZA 1ZTVA 2XIJA 5T9BG 3M0LA 4JNZA 2ZZ4A 4EVZA 1ECQA 4TO8A 3FSTA 3WDPP 1W1PA 3AIUA 1HZYA 1TR1A 3VUPA 4BZYA 4WY0B 2DJXA 3W24A 3BOFA 2QVHA 3P2VA 3ARXA 4RJEA 4Y90A 2Z2UA 4DYEA 3JU2A 4GH3A 1JCTA 3OBAA 5FEZA 4KESA 2VC9A 3AYVA 1OYAA 1EDTA 1GQJA 1KFKA 1QPNA 4U33A 2HK1A 4GRSA 3JVAA 2E5BA 3IIPA 1QPOA 3CEPA 5AC4A 1VFLA 3DIPA 4ALDA 1EGZA 1MZHA 1NSJA 3PTMA 1H5YA 5LIUX 1NELA 2O92A 4XO7A 2NX9A 2DT0A 3G1SA 3OLIA 3E0LA 1TQJA 4GZIA 3PANA 1UOKA 3IWPA 4WJ8A 3HPAA 1MVYA 3W1RA 3C2YA 1HUVA 1OX4A 3CL7A 3F2CA 2I7GA 4C7FA 3LTSA 5JIWA 1SFSA 4OVXA 2W0UA 4S2BA 4DQWA 1GZ1A 4M81A 3NL3A 2J75A 3AMLA 2KZHA 1J6OA 3R4IA 3DX5A 3GC5A 5A8NA 1Q6GA 2QCMA 3ES7A 4FOUA 3UXKA 2NUYA 3WK1A 1O94A 5A8MA 4OV4A 1W9BM 4O50A 4RNHA 3H8AA 4J3XA 1MDLA 4LW7A 5ABFB 1D3CA 2G37A 3TYAA 1JDCA 2PTDA 5HQMA 2B31A 1P0KA 1MW1A 3CNYA 4D6EA 3BLOA 3VKDA 4HOZA 3FYPA 4CNSA 3IIZA 2OT1A 4YS1A 4PH6A 4RUBA 3MMTA 1XLJA 3GE7A 4JTUA 3VKJA 3O06A 5EFDA 3EOSA 1C7TA 4WGHA 1SO3A 4DJDD 4UTUA 4OKDA 1GONA 4KGJA 1A5SA 4YL2A 3L4VA 4XZHA 4GKTA 3UG4A 1TPC1 1C8VA 1G4PA 3S42A 3TAOA 5AYIA 2OZ8A 3GDLA 4B9YA 3CAWA 3VGHA 1EJUC 3W7GA 1DXIA 1HJQA 1GVOA 2PWHA 2PC8A 2ANUA 1U83A 1ZPTA 4MJ4A 2A7RA 2H3BA 3RRAA 2ZZ7A 2YSWA 4B3ZA 2ZFAA 4R7WA 4NHVA 4KT2A 5E93A 3URAA 3URNA 3NM3A 4E2DA 3LHUA 3LBMA 5ABGA 1RSCA 3S5OA 4QAWA 4UTWC 1PYMA 2Y85A 2WWCA 2OJPA 2YBTA 3D5HA 3LPPA 3LD5A 3CZLA 3LXCA 1M3UA 3LNMA 4JS3A 3K8MA 4R9OA 4PMDA 4UNKA 4RZ5A 2PEVA 4OTKA 4X61A 5D32A 2ISDA 1CGWA 1Y8BA 1CXLA 7PTDA 1MEIA 3VMOA 3A21A 1XICA 4GVGA 3CZGA 3KP1A 1PKNA 3CYVA 3LHWA 3VIFA 5IM51 3CGTA 4Z2HA 1O5KA 3GTIA 3WLHA 3WLLA 4V1YA 4PBGA 4MB1A 2DQXA 3UWYA 3Q2DA 4HGXA 2BOGX 4ADUA 3WQ4A 1OT2A 1H7XA 1OCNA 1RJRA 2FPYA 1I1XA 1GW1A 3PBMA 1MQQA 1TJ1A 4V2XA 4O0QA 3GG0A 3MDWA 3U57A 3MO7A 3AROA 3NYZA 1O68A 3F5LA 4O57A 4BWLC 3M0VA 2VR4A 5MHBA 3ME3A 3TDFA 3LMYA 2HTMA 3RM4A 4XKMA 4IGMA 1P7TB 4F2TA 1MWOA 4MNJA 1EHAA 3ZLHA 3WD2A 1BSIA 3LV5A 5K9XA 3JZEA 3L4WA 3GH4A 1BWLA 5ABHA 2VGBA 2FZBA 2DSUA 4E3VA 4JTKA 4Z1AA 1XLDA 4WXZA 3E2SA 4WX2A 3GG7A 3BGJA 4Q6JA 4AWTA 1BXBA 3T2QA 1V3IA 6A3HA 7ENLA 1ZLPA 4JTHA 1YPXA 2VQUA 5XINA 3GDMA 3PJWA 1LLZA 3W83A 2YXOA 5HDRA 4E4UA 1EWDA 3MV01 1PZ3A 1BYBA 4GO8A 4YCPA 1RBLA 4HCLA 3BSMA 4DO5A 5C9ZA 1AH0A 3AXXA 1XL9A 2IKJA 3BE7A 3OZYA 1U5HA 5JBEA 1XDMA 2QNEA 4X9YA 2JIWA 4K7VA 3ORWA 2POTA 2V3EA 3TNBA 4UTMA 3CU2A 4ZB2A 4GQGA 1XGEA 4PUNA 4GXPA 4DJED 3VZZA 2QDDA 3TJXA 2J7GA 3UP8A 4IOTA 4AXKA 4ADSA 2YPIA 1MFUA 5C6MA 3P67A 2FH8A 1NDZA 3W1XA 3CUGA 2FIQA 3DFNA 2BGSA 1TCMA 4DZHA 1ALDA 1J11A 3W71A 1B54A 3L5LA 3GBDA 3ONBA 4TV5A 6XIAA 4WF7A 2DH2A 3DKLA 4J9JA 4JQ3A 4PMVA 1IHIA 4LB4A 2HMCA 3B8VA 4RPPA 3Q58A 4CNNA 2GJLA 4JTIA 4YWIA 1UWUA 5E0CA 4AB4A 1NQ6A 2GGGA 3PPGA 1V4YA 1PBGA 4W8LA 4PTDA 1ISXA 1X96A 4Q8WA 4ZENA 2IQDA 3KRSA 1TZ9A 3RPMA 3UWVA 3SN4A 2BHYA 4TU1A 1VEOA 3WQFA 5AOUA 2RJGA 1CXKA 2ZDSA 3SUWA 2A3LA 3OA5A 2SFPA 3MA8A 3QZEA 3B8WA 3DFSA 5JU6A 3PZTA 3HN3A 2C1IA 3F4DA 1UWAA 1X97A 5CPLA 2YCIX 3MO4A 1RY0A 2NSOA 2YL5A 3RPDA 2JIEA 2JF6A 2C8NA 4RR4A 2V2HA 4TIMA 3QXBA 1M04A 1KFBA 4KWUA 1ICQA 4Z1DA 1H2JA 2ZA1A 1J0YA 3ZO9A 3CPGA 2AKZA 1GW9A 5ECUA 4A3UA 1I0DA 2WHLA 4DB7A 4QEEA 3UA3A 8RUCA 5E1QA 3V5FA 2BNJA 1J96A 1G9HA 1R3RA 2A4AA 4K6AA 1OYBA 3GH7A 1K4GA 3UZXA 1PL9A 3CV7A 1YTKA 2VFHA 1W3IA 2WZIA 4IPNB 5HNRA 3M7SA 5GPRA 3UPBA 1QR7A 4KCTA 2OWXA 3LUTA 2X1TA 4MY1A 4LS2A 5AVHA 3JS3A 5AHLA 1AQHA 4ZOCA 4DM1A 4O15A 3CASA 1X6NA 1NDWA 3BJFA 2DZXA 3S6TA 2ESCA 2VC5A 3MZ2A 4FXJA 3RG6A 2R9RA 1X39A 1QK0A 3TSDA 1DTNA 4M6QA 3M0XA 1R7AA 3KWSA 3EAUA 4Z42C 3KBWA 1ITUA 3TP4A 3B0PA 1Q2SA 4D6FA 2DZWA 1LBLA 3D46A 1OB0A 3UCDA 3LRKA 1JZ2A 2UY2A 3OYZA 1RAKA 4DAIA 5ENLA 1IZCA 2F6UA 3I7QA 3CYJA 5AN7A 3VM7A 3VGDA 1C9WA 3CUXA 1XLAA 3H2CA 3GVGA 2WCAA 4J3VA 3MU7A 3AHYA 4UFHA 4BF7A 1FFRA 3B40A 3NR0A 3WLIA 3GIPA 3B0YA 2Q02A 4DBEA 1VPQA 1OFQA 4CU7A 4M8UA 4RXGA 4I9MA 4JTGA 3UNDA 2VUYA 2OT0A 4MPQA 1KTNA 1SW7A 1NWTA 2ZRYA 1UG6A 2F8QA 1EF2A 1I60A 2Z2BA 4LB3A 1GVSA 4TX9A 3E38A 4QBXA 3PG8A 1QPRA 1T8QA 1LL6A 4O1FA 1A4LA 1X8CA 4E3TA 4D6IA 1EP2A 1WDDA 2YXGA 4FEZA 4HJFA 4DUWA 2WC4A 1IIGA 2XN0A 2V67A 3TKFA 3NDYA 4WGXA 3WBXA 3GO2A 4QJ1A 1CLVA 4HZMA 5D9NA 1SO5A 4JX4A 4FB7A 3PZUA 3SUUA 3LENA 4HK5A 1E9YB 2CHRA 4RE3A 1U33A 3B97A 1JI1A 4H9VA 3CTTA 4E8GA 3SUTA 1EJWC 1MFVA 1YLVA 5JBFA 3NG3A 3W2KA 1G7UA 4IPJA 4LAUA 1GGOA 3RJXA 1ZU8A 2CLHA 2EAWA 3PS7A 2RJHA 4XK2A 2HE8A 4GX9A 5J5RA 1GOQA 2GWNA 2PDKA 4EIVA 3EKZA 4UC5A 3IJ6A 1I9CB 4FMVA 1OEPA 4FX6M 3VMNA 4H2CA 4CN4A 2VZTA 4TTUA 5FAGA 2IS7A 1VF8A 4HPJA 1IQ8A 5AC6A 5MKGB 2WMHA 4ILSA 3LLFA 4MUPA 1KBIA 1RQHA 2XM1A 4S2CA 4LUIA 3ZJ6A 4LV9A 4EPEC 1GPWA 4D72A 3LU2A 2VRJA 1CB2A 1H1YA 4LBUA 1QASA 5F1VA 4B4FA 3N73A 2YZRA 3P14A 4HPXA 2XWDA 4S3EA 1XIMA 1PUDA 1W3NA 3PWGA 1NH6A 2YA0A 1T0OA 5D02A 4NZ4A 4LOCA 4QNEA 2Z29A 4LUTB 1ZRQA 5HUPA 3XISA 3DG6A 4Z0JA 3VU2A 1XD0A 1UCWA 3S2LA 1UJPA 1XLIA 1JYWA 1AD1A 4FX7A 4I5UA 2Y24A 3PNUA 2C6QA 3WJWA 1RK5A 1E6NA 1O5XA 1UH2A 3ZSTA 3QY8A 2X09A 1YHTA 4OBRA 4TOQA 4PL1A 4MPKA 2XIMA 3LZ3A 1PX3A 2PGFA 2Q8ZA 3U8GA 1KQZA 3VCRA 4ERGA 3QQWA 4FXFA 4WY0F 2PU1A 1RJPA 3O0FA 3MVIA 4DBSA 1V6UA 3DYMA 4O52A 2J4GA 1O5RA 5A6SA 3GSMA 4MWAD 3EXRA 2E9BA 1TWSA 3W2JA 4A35A 2OYLA 5D38A 5FIPA 1OF6A 3CUFA 3R79A 3QV9A 3KZSA 1YNQA 4GY1A 2E68A 2O9RA 4XV0A 1W5NA 1F6YA 5H8MA 1H1NA 2QXWA 1JPKA 4HJWA 1SZEA 4MWAA 1XIFA 5K2ZA 1EX5A 5I07A 4W7WA 3I3BA 3SCWA 1AG1O 1LM1A 1RD5A 4FOKA 4L65A 3NQ6A 4C91A 2DU2A 5A6TC 4GOAA 5TIMA 1TVNA 4CU6A 7ODCA 3GRIA 1B5TA 1O95A 1KFCA 3W7IA 1TTIA 1KA9F 3HV8A 2ZTKA 4NKCA 3SR7A 3BQ6A 3W7JA 2E0PA 4NZFA 3GNXA 4ACZA 3LRMA 1R7OA 3V75A 1XWYA 3FVDA 1YYAA 1QWGA 2H8ZA 1KXVA 1VEPA 1XDLA 3MZNA 1KRBC 3CH9A 5F1UA 2ZTJA 4B2DD 4GVIA 3MMUA 3E6EA 4GIYA 2A0NA 1E6RA 3EBVA 1D7FA 3OQEA 3W1NA 3T40A 1GG1A 1BYAA 5C9UA 3PUEA 3FW6A 2GUUA 3RR4A 3CZEA 3ECQA 3W81A 4JL2A 1Z8AA 3ARWA 3LDVA 1F8MA 3SRKA 1O6IA 2J13A 1SQ7A 2WNZA 1IWAA 1TELA 3MWAA 3C8NA 2ZBTA 1EYEA 1TQXA 1OGSA 4ONVA 1T41A 4E38A 5DY3A 4Z08A 3WZ0E 3FJ6A 3EDFA 4HK7A 3EYPA 3SCTA 3AS3A 4NXKA 4JTSA 1JI2A 4IGNA 3BOXA 3VVGA 2ZUWA 3A47A 3C2RA 3MI6A 3H24A 3PF3A 3QY7A 4HTYA 2WLZA 3CC1A 1WPCA 3OLEA 3HOJA 1DQXA 1GEHA 5F2LA 3QC0A 1WXYA 2GJXA 3QGVA 4F9DA 2Q3OA 3WQGA 4E2BA 2ZIDA 1TWWA 5D2XA 2QJNA 2EPNA 3GDBA 4C6PA 2PFHA 1IXOA 3N34A 1U22A 3FXGA 1TJRA 3IIOA 4IQJA 4W5UA 3KX6A 3UR5A 2AQOA 3WELA 1XLLA 3C0JA 1RH9A 4X63A 1Y5XA 2QUVA 5F2IA 1HKJA 2OQHA 1WXZA 1OGBA 2PDMA 3DZ1A 2V69A 1EA9C 4YMZA 3KM8A 3WNNA 1UC5A 2HROA 4MZYA 1TRIA 3IGUA 3M6YA 4Z2KA 3W74A 1PZ2A 1W5PA 4DZAA 2ZX9A 1OX4B 1TV8A 3NEVA 3SDOA 1J12A 1DJQA 3WDJA 4EF9A 1H62A 2ZUSA 3O6DA 3NQAA 2PCQA 1XYCA 3GXTA 3H53A 4JICA 3PPCA 2P0IA 3ATYA 3I4EA 4W8AA 1NDYA 3BCFA 3PZQA 4RDWA 1PPIA 3URQA 4QQUA 1R30A 2CLMA 3LX9A 3VMPA 3HG2A 5GJNA 3W7HA 2OO0A 4XWUA 1L6FA 1QI5A 1TJPA 3GXFA 4BI5A 1PTGA 2JE8A 1DWIM 2VFDA 4RL3A 4FALA 1JXJA 1S5VA 3TVAA 2QPSA 3O16A 1E5NA 1ZSXA 1OWQA 1GT8A 1KXQA 4ZXLA 4MFEA 2JQXA 1R86A 3HFYA 3QY6A 4D6DA 3LM3A 2VM8A 2TPSA 1QI4A 4LRTA 1QPKA 2J6XA 4FXSA 4HB7A 3CUZA 3N17A 5CPNA 3F5KA 1GHSA 4AZGA 3C0QA 3DDMA 4GI8A 5EFFA 3R0DA 3U3HA 3VIPA 5LSMA 1KM2A 4IJRA 3H6OA 1JUEA 3NO5A 3GU2A 1JCMP 4GINA 3UZJA 1OCQA 4E5TA 3DUGA 1GYNA 1H09A 3OU8A 2C7FA 2A6LA 3GTXA 4PZVA 2A21A 1YXYA 2NX3A 3RF9A 1UWRA 4UMAA 1CLKA 4B5WA 2POZA 4HHHA 3NQMA 2CETA 4EXQA 1CI1A 3EXTA 4Z0SA 3URBA 2AAMA 4O54A 2OMAA 2OO6A 1F4HA 4WJEA 1WOAA 3C2VA 1FWEC 2G4JA 1V6WA 1E4NA 3N1AA 4FLSA 1CTNA 2CZFA 2C71A 3GAYA 3DECA 3NPWA 4KQNA 4GI6A 5E9XA 4Q3MA 3QHOA 5DCEA 1PZ0A 5CGQA 4XB3A 1M65A 2IKIA 4AF0A 2VFGA 2EGZA 4GKLA 1LRNA 4N9DA 4LNCA 3WQVA 2XPKA 2HVOA 1ZJAA 4JIRA 4J3TA 3GDKA 1PKYA 2EO7A 3SJ3A 4DJDA 3HMJG 3C2EA 2V8ZA 4AW7A 1V79A 2PCEA 5HQLA 1LG1A 5IBXA 4DHGA 4PE8A 2Z7KA 1VQTA 1KBLA 4WDXA 1WAWA 1V03A 3BAWA 4C6OA 3WNKA 1J0HA 2J62A 1UKSA 3N9KA 3GVVA 2ON3A 1JCLA 4S3JA 1UA3A 3WF3A 4GHRA 4JTRA 3NSXA 1AODA 3M6DA 1DTUA 1SZRA 3FEQA 4GWEA 2XGBA 2YJQA 4M5PA 1WX0A 3VTRA 4FLOA 1MW0A 3P93A 5EYWA 4MB3A 2YDRA 3U2ZA 1U1HA 3KHDA 5FI8A 5G1YA 4LF1A 5I7GA 3WNOA 3K4DA 4RDYA 3ARTA 1OCBA 3UXAA 5I06A 3NGJA 4H01A 4O8AA 4LYPA 1U5VA 1CNVA 3PUOA 4Q8TA 4GUIA 1XM3A 4DNHA 3W1PA 3VNLA 4RV8A 3VNMA 1E6SM 5HUOA 4GFIA 1FHDA 4PMYA 4P8XA 2IPJA 1JCYA 3MP3A 3WH6A 1QW9A 3R5EA 4QP0A 3AWOA 4AQLA 1FA2A 3CWHA 1XSIA 2J88A 2E5DA 3K1GA 4GUGA 1JCJA 3I7RA 4LT9A 4WKHA 3DFQA 3G6MA 3FCPA 4LRSA 3EEZA 3L0NA 3NO3A 3WH8A 1NF7A 1EBGA 5LGXA 4LEQA 1XLCA 2H6RA 2XJ7A 2V9DA 1LP6A 4TQTA 4OJYA 3GUWA 4F9JA 2GDUA 4QNWA 1QFEA 4UMCA 1IYXA 2OG9A 3W84A 2FH6A 3APYA 2DT1A 3D3AA 2QCFA 5HXMA 4C6CA 3F4CA 2ZRWA 4XZNX 5DMNA 2YCJA 2BY1A 3KXQA 3PZVA 1W56A 3VNKA 5BXRA 4JX5A 3ALFA 1MYRA 3LHVA 3OB8A 4Z1YA 3C2FA 3Q67A 1A5MC 4ACYA 3Q94A 4UOJA 4JZ5A 1U30A 4REQB 2PGEA 4R7JA 4H9YA 3QV8A 2O9TA 1IF2A 3ZWSA 2MUCA 2WYSA 4PB3A 1WYIA 2ZICA 1V6XA 1GWJA 5T91A 1RP9A 3JZUA 4BR1A 3IJ7A 4E4PA 3KLLA 2PDFA 4YVXA 5DEZA 4B90A 4RXFA 2EPKX 1NIUA 1SGJA 2XFRA 4JR5A 2JEPA 3AQUA 4AY8A 2Z24A 4LBSA 4H6EA 5BOFA 1PCWA 3A5FA 3UCCA 1Q6FA 1CXIA 4HSHA 3CL8A 3BAXA 1FWSA 1F3TA 3EWBX 4XZBA 3WQWA 2E8ZA 3WMBA 3T44A 2NXHA 1H7NA 1ZBCA 4PCTA 4FR1A 2NSXA 1AVAA 1TCDA 1Q6OA 1ADDA 3RMJA 5A8OA 5JMUA 1FDZA 6REQA 4J4KA 1JF5A 2DFAA 3W28A 3MP5A 3W38A 2V5LA 2JKAA 3MCNA 1HVQA 3DOPA 3EPMA 3VPLA 1OT1A 1J0KA 4DRSA 3PPHA 2ACUA 2BXZA 2HNHA 2INEA 3WEMA 1V3JA 3PJUA 1D3GA 1XDJA 4MTVA 3BMWA 2ZX8A 2UZ9A 3PSVA 1JNDA 1S5MA 4DBDA 1V77A 5HPOA 5CAKA 1DWAM 4UMBA 1LL7A 4INFA 5CJ5A 2EJAA 1HKVA 4H7ZA 2V6AA 4FI4A 2YOCA 3UNTA 4UOQA 4HU8A 1R3VA 2VHLA 3TUUA 4F0SA 2BVDA 2OYKA 1MEWA 2WHJA 3F7JA 4HKPA 3R0KA 2I14A 3EOOA 3GNDA 1R9ZA 5CZTA 1FWGC 4LUTA 3SN1A 1EOMA 3PZGA 3PBYA 1LL4A 2V81A 2ZUUA 4HNTA 1LT8A 2QT3A 2OYMA 2J24A 2PLMA 1DHKA 1GOKA 5DCDA 1LROA 4AC7C 3TONA 5G1TA 1K77A 1X8FA 3WLTA 1MUMA 2I16A 2E9MA 4JTFA 1ZJIA 1EQCA 4B2DA 1UMLA 3IUHA 4EANA 1GK8A 1Q85A 3GTHA 4I6VA 4ZODA 3FA3A 5LYRA 1TPEA 3RU6A 3T2PA 3HM7A 1Q66A 4A8NA 2BS9A 3P61A 4OE7A 4F8XA 2PD5A 4LUSA 4GA8A 4WDUA 2Y88A 4XZLX 2QCLA 4R5EA 3FGCB 2O7QA 3O05A 1UUMA 1WKYA 3OW1A 3VOCA 3WEZA 4RK8A 3PY2A 1JVNA 2OCZA 4GD0A 1F5ZA 1SSGA 3M7WA 3WF0A 4CQ9A 4QS6A 2GGJA 4HA3A 3WK0A 4MB5A 4DJFD 3NXLA 3VOGA 1KV5A 2PBGA 3EGJA 4P7RA 3UZYA 2J8FA 4CVWA 1UC4A 2A85A 2FLIA 3WQCA 3AZTA 2A7NA 3QRHA 1QCWA 1Z44A 4HA1A 3KVMA 2CLFA 3SQLA 4KFNA 3TYZA 1JIBA 2R82A 4V28A 2PDNA 4JKKA 2BGNE 4ZBCA 5HR7A 4AY7A 3ABXA 5EB8A 4KCWA 1JFHA 4Q4SA 3THQA 3PG9A 4A8IA 1A0EA 1XD1A 4D1IA 1B4EA 1IIHA 2HE5A 3VD7A 4HCDA 4N6FA 1EEPA 1JL8A 2CFFA 4TR9A 3CQHA 4RKAA 2BVYA 2PDGA 2AOSA 1EPVA 2AL1A 3BAKA 3W0KA 3AYSA 5AHMA 1W91A 1XKJA 4ZGYA 1W5MA 4JIQA 4K38A 4PR4A 3KLKA 3OZOA 3P3BA 3QSRA 3AWNA 3VX0A 3GS6A 3ZZ1A 4N4QA 5B7ZA 4Z2IA 3TU9A 1DJWA 4BQ5A 1Q6LA 5HNUA 3UEQA 4AEFA 3AHXA 1FDJA 4UFIA 3L0KA 2PP1A 3DKJA 3V0TA 1NM9A 2EPHA 3EB3A 4PMUA 4H19A 3BMVA 3GC2A 1XG3A 1BLIA 4MY8A 2J8GA 3WLJA 4NXSA 4N9EA 2C19A 4KKXA 2E3ZA 4GBDA 4BFAA 5I77A 2YX0A 4XAPA 1JULA 4KWOA 3EXSA 5IDZA 3GTNA 1FP9A 2GVEA 4QISA 3FAXA 2O55A 3W75A 3L23A 1VC4A 4C6NA 2EPLX 3T0DA 3MUXA 2QV4A 2ISFA 2CLLA 1QW8A 2NXIA 5RUBA 4N7QA 2BB0A 1J8VA 3GKAA 1JXKA 1I45A 2FHBA 3BGGA 4JIIX 2NQ5A 4G8TA 3BG9A 1KNWA 4C6MA 1V0KA 1FHLA 3EDDA 3BV4A 4LGXA 2B7NA 2WHMA 5CLWA 3S4TA 3MI3A 3BJSA 1XIEA 1B30A 2B0MA 1RA5A 2UWFA 1KCXA 3CL6A 2CIPA 1XGDA 1CX9A 4TVCA 4TMBA 3VNJA 1ONWA 1S39A 1JCXA 3OO2A 3HG5A 1PWLA 5DBTA 2E7FA 1ZCCA 2WM0A 2VCBA 4CQDA 3WQ6A 3GVQA 3KL3A 5AHEA 3TEVA 3VKCA 3TC6A 1RA0A 3ELFA 3IV3A 5HJLA 3E96A 4MY9A 5CPSA 3TXVA 3W01A 3SB0A 2HK0A 1TA3A 4KPLA 4D6JA 2VVSA 1V51A 1W1IE 3BLDA 3BK0A 4B92A 1AUSL 2J7EA 2IW0A 2DY3A 3KBJA 3MV11 4ZFMA 4C6DA 5DXXA 1J01A 1VHCA 4J3ZA 1A5CA 5FJPA 4BI7A 1YADA 4OBSA 2H90A 3R25A 2J74A 5D37A 3IK4A 4GYKA 2NV1A 5M2FX 1US0A 2VELA 4JGDA 3CO8A 4IXHA 1SJAA 3BG5A 3G2GA 1HTIA 1L6YA 5MKGA 1WP6A 1XH2A 3CB8A 2A79A 1N55A 1TVPA 4LY8A 3WMSA 4QITA 2EHHA 3UA4A 1VJSA 5A69A 2BWGA 2VX4A 3M41A 1J0IA 2DT2A 4IFOA 1OZMA 3CHVA 5GJPA 1EIXA 3QMRA 5DRIA 2YYTA 4AYSA 5FCZA 2D20A 4I9TA 1JG9A 1PB0A 3APTA 2NQJA 1OD0A 1QK2A 4O53A 3LCIA 2WM1A 1W1TA 2WSKA 2QAPA 3K4WA 4E4FA 2NV9A 4L80A 3FKRA 4I3GA 1ZJBA 3EKGA 1KM0A 1JDEA 2C1GA 4HNCA 4W88A 3Q4DA 2QCDB 1UUOA 4ZQNA 3M0MA 2GK1A 3S47A 1FWIC 1VD6A 4ZXOA 5M1TA 1M7JA 3T0BA 1E40A 3P80A 5HNTA 4HU4A 2BMBA 1TG7A 1TTJA 3N6HA 3QW4B 1ISZA 3MSDA 1WKDA 1AD4A 3F4WA 4JFSA 1G94A 2O4QA 3V4BA 3AYRA 3ZSSA 1XV8A 1VBUA 3IJ8A 4PMJA 4WY0A 1I75A 3BO9A 4CNOA 1GOIA 5TNVA 3WD3A 4H9TA 2XSBA 4H00A 4GCAA 1XLKA 2VX7A 4O1CA 3ONCA 3UG8A 4QTGA 3GVRA 4URIA 3LS9A 3UPMA 1TV5A 3CO4A 2CLIA 3NL5A 3V7PA 1M53A 1J10A 2V2CA 5FF3A 1ISYA 2QPXA 2I5QA 4LVGA 2RGMA 3UY7A 2OZ3A 4Q4QA 1VCGA 2A2IA 4G5DA 3L4YA 1ESWA 1XIDA 3HU7A 1VBRA 1TYGA 2QDHA 4LFYA 2QLYA 4HHPA 3DH7A 4PUDA 3HTWA 1FWWA 3KTCA 2G95A 4KH2A 1U5JA 4HN8A 4PUUA 1IR1A 2OTDA 2QJMA 3CS2A 3SURA 5CQ1A 2NZLA 1CGXA 1XLMA 1QNQA 5KZDA 2H3DA 4DBWA 2E1DA 3MVTA 4OHQA 1JEZA 3LMZA 1A0DA 1YQ2A 2E09A 1X1NA 2YGYA 4FLRA 4NYYA 4PGLA 1SJCA 4ZO6A 5D4YA 4FNRA 5T26A 3T55A 1JZ5A 1C29A 4ZQOA 2PD9A 2IUZA 5K9DA 3VGEA 2QF8A 1QATA 3VIKA 1HFBA 3G5EA 4IICA 1QAPA 4YCOA 4UCGA 4JTCA 3W1LA 4WHBA 5U4NA 2GFTA 2NWSA 1FCVA 1EX1A 1BYDA 3NOYA 4R7OA 2PGWA 1PDZA 4HQVA 4O4VA 1B3WA 2WK2A 1YEYA 1W8SA 5DY2A 3GIQA 4I5XA 1RZMA 2Y8KA 3AO0A 3NQ7A 2C0HA 2Y7DA 1IEQA 4O1AA 4PULA 3LERA 3MKVA 4IPIA 3WSUA 3UERA 3SBFA 1GHRA 2OELA 3UJ2A 3ITCA 3PUDA 3NSMA 4U3AA 3U4FA 3RX2A 1Q65A 4ATWA 3EX1A 1A49A 3VIJA 1E72M 3TMLA 2PSNA 1EJ7L 3GXIA 4PCPA 1K4HA 4NF7A 4MUZA 3CIVA 1P0DA 3WUEA 3YPIA 3QR1A 2ZX7A 1S2AA 3THDA 5E0FA 4IPLA 4PTVA 2XH7A 3GUGA 5FEPA 3B0UX 4EACA 3A4WA 3LSBA 5I78A 3NZPA 1XG4A 4Q4RA 1A5KC 3GZ3A 4C1KA 1SFLA 4JNMA 1FWTA 2Y8UA 3W85A 3QFWA 3R2GA 1S1PA 2MANA 5L9FA 4AUBA 3KE0A 3TZNA 1TB3A 4TUFA 1TV4A 1E0XA 4RZ6A 3WJYA 3OVGA 3IK2A 3WN6A 1E4IA 1TPWA 5LIYX 4B5XA 3R13A 2VMFA 1KV8A 2BHZA 2VX5A 4P7LA 3RGTA 5HAOA 1BVNP 2XSXA 1SPQA 2P5NA 4GO9A 1FX6A 2VDIA 3WENA 3BLPX 3RUBL 4JY9A 3L66A 4AZHA 3N3MA 1MI3A 1UZHA 5C70A 1E6XM 4DYJA 1Q5MA 2E77A 4QDWA 3USZA 4IX0A 2ZZ6A 4GC3A 1A47A 2PDXA 3W7DA 1LORA 2VJXA 3AXMA 3OIXA 2ZE0A 2Y70A 3OHMB 3IGSA 3I4KA 3MJYA 4BY3A 3CJPA 3PM6A 5A2BA 3GW0A 5H6HA 4G7EA 3M0KA 4XTDA 3WUBA 4QG6A 3N4AA 5M03A 3GB6A 1US2A 5A1AA 4H41A 4MWAE 4MYXA 4RW3A 2YFOA 4OOUA 1JCNA 4MOZA 1I2QA 5I3IA 4XAYA 5J04A 1QBBA 1NFBA 3G1HA 4H1ZA 1A53A 1XSJA 1PHWA 1KFLA 1MNSA 1TR9A 3O6YX 4YVVA 3KOZA 5CC6A 4F0HA 3SQMA 1CGVA 1JPDX 5FL0A 3F03K 1YW1A 5DF0A 3UXDA 4Q7NA 2FVMA 1CXFA 3GXNA 1ODZA 1SMDA 3N04A 3CQ0A 3T08A 2WVSA 2ALRA 5IBXC 3M0ZA 1HL8A 5AC5A 1TMQA 7TIMA 4QXIA 3QSTA 2OOGA 4U5IA 2OGYA 1XPYA 3R10A 2WNQA 3U0HA 2W66A 4GNKB 1KC7A 4PUEA 3SCPA 3AJXA 3E9AA 4MJZA 3KRBA 2ZUNA 4YWSA 3SY5A 3UPWA 3G0XA 2PTZA 4IIFA 2R14A 4FNSA 5DANA 1EDGA 1Z41A 3WLKX 2XIIA 1UD6A 3MSYA 4MDPA 2WMGA 4GIEA 2OEJA 1SFTA 1K8CA 4K37A 6XIMA 3ZVIA 5AHNA 3BZJA 3GXMA 3V5OA 4GC4A 2ZVRA 1DQWA 2VC7A 3QR3A 3M0YA 4HOXA 1TUXA 4S1FA 3P74A 4NZCA 1JAEA 5KETA 4GI9A 5DT5A 5C71A 2X2YA 4Y6GA 3MHUA 4XZ9A 3RO8A 2NQLA 2Z4GA 1KLYA 3LK6A 2FZNA 3W87A 3R94A 1DYSA 3VD3A 3N13A 3W25A 2D2HA 1LF1A 1VIWA 2V5DA 3DI0A 1CT5A 4KWSA 3V1HA 2FTWA 3RX3A 4XD4A 4D9PA 1C91A 1US3A 1OQFA 5AC8A 1FCUA 3S5YA 2ZA3A 1E9ZB 4KFPA 6CGTA 1S2WA 1SR0A 3TV8A 2W3ZA 3EMQA 3GR7A 4PA8A 5CPMA 3MYOA 1OINA 4FOJA 3BW4A 1E0WA 2Z1VA 3AHTA 3F2DA 3M16A 3FJ4A 2D0GA 1HJWA 5I23A 3U5UA 2UV8G 5KITA 4UR7A 3B0XA 4CEUC 2XIOA 4H8HA 2GGEA 3CHFA 2BY3A 3VD5A 3EA2A 3TWAA 3SIMA 3BH4A 3TTQA 3T4WA 2HWGA 5JBDA 2D2OA 2Y62A 2E8YA 4ROPA 3I3DA 3ZIZA 2PZ0A 2WJZA 1B3OA 3AOFA 2WQDA 1QUMA 2IQTA 4PTWA 3C2OA 1LJYA 3B4YA 3TTEA 1EC7A 2PDWA 3W1UA 2WKLA 3PBVA 4X0VA 1JZ8A 2G3MA 1R2RA 3VYLA 5CJMA 3VM5A 1J6PA 2C14A 4DUXA 2VR5A 1IXNA 1VS1A 1J9YA 3DYPA 1VIZA 1GQLA 1ECEA 4Q8PA 3LGGA 1AL7A 3NZRA 1NTHA 3KEHA 1TSIA 2ZRZA 1KRMA 4K8GA 4Z2GA 2VOMA 2YA1A 3A4XA 4F2UA 1AL8A 2QCHA 1E3XA 3KBSA 8XIAA 1JZ7A 2WVUA 1HJSA 3VFCA 1XYLA 3TFCA 3ZOAA 3N2BA 4A21A 4Q8MA 5KMYA 1RBOB 1RPXA 4K36A 2PURA 3W7MA 2EG8A 5HWMA 4LWWA 3C0LA 3AIEA 3DHUA 2D24A 1W3TA 3M07A 4OIFA 3D3FA 3G8EA 1TIWA 4MFDA 4PRRA 3UFYA 3BV7A 4UUIA 3PFRA 2NT1A 3ZYZA 1DIDA 3NURA 4KGLA 4Q8QA 2ZE3A 5C8BB 1PIGA 2GJNA 4QS5A 4BJHA 1QO2A 2PDJA 4M7TA 5CPOA 5CZSA 3TYDA 1M5WA 2XIQA 3IJLA 1AQ0A 1VYRA 4LY4A 1YMYA 4LU0A 2DPEA 4BS0A 4OZOA 4LTSA 4A2RA 2DZTA 1XYMA 1EPXA 1E70M 2YW4A 1J93A 1FWFC 1NFGA 4AD5A 1G01A 4H8UA 2Z1BA 4GJIA 1WDWA 2EG7A 2ISVA 9XIAA 4ZO7A 1OD8A 4O8RA 1BRLB 1M41A 2XFYA 1FWDC 1R2TA 3UVIA 3LHZA 3PBGA 1WE5A 3D0CA 3SCVA 3LNPA 3WBAA 1P0EA 2A3AA 3QC3A 4Y9MA 4W86A 2DUXA 1N82A 3K1DA 5D2VA 2QJGA 1W5OA 1VGAA 1V3LA 1VCFA 1KCZA 2VCCA 5CEWA 2CZVA 1FTXA 2DUAA 4MAVA 2Y89A 4V27A 1KRCC 1UH4A 3W4RA 4JAWA 3LHYA 5LKYA 3NQVA 3SSJA 1KFWA 4GYPC 4XO6A 3M47A 3HF3A 2FPTA 3FGCA 1E51A 1XFBA 3BXWA 3RCMA 3VC6A 4Q8UA 1TA3B 4I5RA 2QHAA 1OF8A 3SY8A 4GYFA 3N11A 1FXPA 1M1BA 4JKLA 1ELSA 4FX8A 3PSWA 3GZAA 3GBEA 4JTLA 4AD4A 1O7AA 1UKTA 3A24A 4FO4A 1IZKA 1UR9A 2VEKA 2E6YA 5D2YA 3H2OA 3N6JA 3NZ1A 5LNWA 1FH8A 4HU3A 3AZSA 3S1WA 1ME8A 1TPH1 2XH0A 2WPBA 1C7SA 3VOFA 4HT3A 2GSHA 5CLTA 4DZIA 3N29A 3BGAA 3UJEA 3MP4A 3W1AA 3O7UA 1S2TA 3WEOA 1Q45A 3OGVA 5F4WA 5CXPA 3FA4A 1L2QA 1RCXB 5H2ZA 5AYXA 2RKXA 4LSBA 1L8NA 5JH1A 3GLCA 3W82A 3MUAA 3SGGA 4D71A 1ZBVA 4MHBA 2Y61A 1ZGDA 1DJZA 3CQKA 3LQLA 5CZKA 4GUHA 1JZ6A 4GXMA 1SSDA 2V68A 1P1MA 2GDQA 1I8JA 3NTYA 5G2HA 4O4WA 4XQ6A 5CBIA 4FNQA 3I6TA 1V7YA 3FHQA 4FP1A 1DXEA 1VFTA 4PB4A 3VDCA 3ARYA 1TRDA 1XX1A 4AY1A 5CGTA 1W5QA 4P5UA 4DO7A 1M7OA 1RALA 4IL0A 3WUFA 4AHQA 3B9AA 2HEJA 1V6TA 3JRKA 1RK6A 2TAAA 3OVQA 3OEXA 2DZPA 4FA3A 1CGTA 3TNOA 2JF7A 2J7DA 5K3VA 3VNYA 4R3UA 4HN4A 4S39A 1DIEA 1K1DA 2O9OA 2YIHA 2E25A 4L1XA 3M46A 3FEMA 2A3EA 3AISA 4A8RA 2VGIA 2FDSA 4ENLA 1OADA 1EUNA 1NOWA 2CWXA 1TPUA 4L5ZA 3G6LA 2G41A 2W61A 5IXEA 4AHOA 2Q3RA 2WV8A 3A22A 1N8WA 4EPBC 3S2NA 1K6AA 1ZCOA 4O19A 4OT7A 4QE5A 3L2IA 1W3LA 3UBPC 1A5LC 3KBNA 3MKKA 3GXDA 4L7ZA 1F4AA 3OGSA 1BYCA 4LYQA 4P7QA 4WCJA 4AH7A 3H54A 4PMNA 1EBHA 3IJQA 4DXVA 1LQ2A 1KW1A 1KFEA 4LAOA 1S2VA 4CEXC 3TQPA 3GHTA 4LAMA 4IG2A 1E55A 3N9SA 2G3IA 1M01A 2FTPA 5C55A 3C8FA 3EOLA 4JIEA 3UGRA 3GDTA 1YE4A 2CZDA 4M19A 3S46A 3MPGA 3ID7A 1AQFA 3R7MA 3TW7A 4MADA 3KOFA 3BURA 1MW3A 3W7PA 1WA3A 3C3NA 3KBVA 5DBUA 4O1BA 3IACA 3CTLA 1TV2A 5REQA 3WBWA 1X7IA 1IWBA 1FDYA 4J3SA 4LALA 5BXPA 2H8XA 3UT0A 3DENA 4LEFA 2WKGA 2ZKMX 4IMEA 3EX3A 4XAGA 3EA3A 3PJXA 4TVDA 3VOHA 2GJPA 5T8GA 9XIMA 3UZWA 2JK2A 2ZQ0A 4KWVA 1MW2A 2XVKA 1EGVA 1IEIA 3N25A 1F2JA 3OLGA 4S3BA 1F07A 2NVCA 2ACQA 1E0UA 4FNTA 4LVBA 2JEQA 3A3XA 2GWGA 4HZ6A 4ZL1A 4ZA0A 2Z1WA 4JYEA 1ENUA 2J77A 1KQYA 3T42A 3UW6A 3E0WA 1DJXA 5IDIA 3GKFA 4JTQA 5EMLA 2DZSA 1UROA 3AS1A 2WSYA 4JKMA 3NQCA 1RD6A 3HG3A 2X16A 2PWGA 1FWBC 4ZQRA 3K8LA 1J5TA 3ZT6A 2PWUA 3BMXA 2P3ZA 3CBWA 4CCCA 3TYEA 1B3ZA 3TTSA 4UFJA 3EWCA 4DO4A 2B7PA 3PVFA 2Y63A 1E0VA 3KOXA 4UR9A 4MM1A 2CKRA 4RE2A 5HATA 1TPFA 1W3KA 1HIZA 3DXIA 1GJUA 1S38A 3EX2A 4W7VA 2L5HA 4MG4A 3OVRA 3N14A 3IGXA 1M68A 2E6FA 3MBFA 2QCGA 3UXLA 4PFHA 4MAZA 4IUGA 4GGBA 2O9PA 3IVUA 1RJQA 4AX6A 1XC4A 2WJEA 7REQA 2CNCA 4F0KA 1BXCA 2OLSA 1IV8A 3O6CA 4KBXA 4BF9A 2CXGA 4B5NA 2D2GA 2FFIA 3L2MA 3G0SA 3M64A 3L0GA 2WSPA 5PTDA 4GFSA 3UZ5A 1POJA 4AVFA 5LIXX 1DJNA 4H9XA 3CHDA 1PHQA 2VNCA 3S2CA 4DXKA 4CD7A 2BVTA 3VABA 3ZLFA 3SI9A 1W0MA 1THFD 2FVLA 1VCVA 4QRNA 4JL1A 2W6RA 1WDSA 4CGTA 3S83A 1ZQ5A 4GQBA 3HPSA 1H51A 1I2PA 4LS0A 1MSSA 2VFIA 2XGZA 3M0JA 5BW6A 3L21A 1AJ2A 3LCWA 3PZMA 3LGEA 1GYLA 4XUYA 2Z28A 4AD3A 4JDYA 2CBIA 3JUGA 3W1TA 2B7OA 4Y9AA 2F6KA 3STCA 4NYUA 1EIBA 4PBFA 4X3ZA 3G8RA 2NUWA 2Y8VA 1MUCA 3C5QA 3W72A 1H49A 2CW6A 2O4MA 1K8XA 1DQUA 4C1NA 2YKKA 3Q37A 4AC1X 3DI1A 4XBSA 3EB4A 4E8DA 5H1WA 3W00A 4PTNA 2D22A 2OGJA 3WQDA 4CD4A 3TSMA 3SY1A 1B90A 1S1RA 4I8DA 1SZNA 3I68A 1KGXA 3UR2A 4IFRA 2AL2A 5HK4A 3GG1A 3AMKA 1K8YA 1PXGA 4UNLA 2DEPA 2YLLA 3IUIA 2WC7A 3HURA 4JQ4A 4CKQA 1JDAA 3FS2A 4A3RA 1F9CA 4HMDA 5DXYA 5EY5A 4ATDA 4IZGA 1NJJA 1A5AA 2VGGA 1B9BA 4QROA 4W89A 1AZ2A 1RLDA 1CPUA 3TN6A 1VH7A 1SW3A 1X6UA 1O66A 2YDQA 1K7XA 1TREA 4HPNA 4O12A 3LV6A 1LQ0A 2DVTA 3IAQA 2J6VA 1UH3A 3RIKA 1E4LA 1TWIA 4GQ0A 1D8WA 4GUFA 1KR1A 5HNNA 4L61A 4OECA 2QIIA 1IEXA 3TQVA 2PDPA 1O12A 2VEIA 4UCFA 5CZJA 4IGSA 3LSCA 2XUCA 2DVXA 2G3FA 3N4FA 2V82A 1JDFA 5FSEC 3A9IA 3E12A 5A95A 2PDBA 1FWRA 3LYEA 2ABBA 3VIMA 2IKGA 4IWWA 4GH1A 1UR1A 2PF8A 2VEMA 3COTA 2F61A 3GK0A 2OZTA 2X1RA 4WLCA 1WZMA 2D1ZA 4UXDA 2Y7EA 4UTFA 5JQ9A 3VAVA 1B2YA 3WMLA 3V16A 4R33A 2VR2A 9RUBA 3ITVA 4A22A 1P5BA 1J18A 1UB3A 2I56A 1G67A 4PN2A 2Z27A 3MJMA 4ZR8A 4TVUA 3EDJA 3LN3A 3EPNA 2X40A 4FSAA 5IHSA 4MLJA 1A5NC 4P8VA 3ARPA 2PI6A 2QR6A 1S46A 3TFXA 3W70A 1GJWA 4UFLA 3E0IA 2IKHA 4C6BA 5I79A 2PA6A 3QMTA 1XLFA 1DKWA 3I7SA 2XHYA 3W2NA 3NWRA 5C9XA 1Q6CA 4K1GA 4XZIA 4IIGA 2YBUA 1BSLA 1J4EA 1UD2A 1CLXA 4LVFA 3FIGA 5K7JA 3P6LA 3ZT5A 1X98A 1W54A 1MRAA 1K03A 3ITYA 1RPKA 2OSYA 2P88A 4I6KA 4NAEB 5AHFA 1N2VA 5CJNA 1JYVA 1MXDA 1DHPA 3P0WA 4IM4A 2PTWA 2VUNA 2VDGA 1JRCA 1WZAA 5AYZA 4GZJA 4S3AA 1SMAA 2O7SA 2EPOA 1YKWA 5AZ0A 4W87A 1E9LA 3RU8X 4RE0A 3WG6A 5LXEA 2PPGA 2PDIA 3G1AA 2HXUA 3LCHA 4JD4A 4C5YA 2AL2B 3L4UA 5EKYA 2HQAA 1W8GA 1HKIA 4NL1A 2WZTA 2A5HA 1ADSA 3OBKA 4G9PA 4G2DA 1TPB1 3W23A 3H7RA 1AZ1A 2R8WA 3U4AA 5C2GA 3POHA 5CKSA 1VPXA 4R88A 2CLKA 2Y4SA 4ECLA 3IS4A 1FKWA 1W1YA 4M1BA 1GKRA 2X0HA 4CQCA 3AMCA 4JN6A 4Q8VA 1KTCA 3EDEA 1OFEA 4D2JA 4DF2A 3OYXA 6REQB 1W6TA 3XINA 3FFSA 4REQA 5XIMA 3UVAA 3A5VA 3G77A 4R27A 3U9IA 3MSGA 1XH0A 5BMXA 4LNYA 3DC8A 3VKKA 1UBSA 4J35A 1GZGA 4L6DA 4ML4A 1V0LA 3NO1A 5TD4A 3WDRA 1EOKA 4XZWA 5M17A 4CQBA 1DIOA 1NVMA 4I9JA 1GQKA 1HF6A 2PBOA 2F38A 3LG3A 2DQWA 3KDNA 1E43A 3SGUA 3SSZA 2VD8A 1KWKA 1DJHA 3PAJA 1V7AA 3R89A 4AZ7A 3ITGA 3NGFA 5D9MA 4RE4A 1J79A 4GABA 4S3KA 8TIMA 1EO7A 4J3UA 1HGWA 2DSVA 3W6LA 2PWFA 5HWNA 4D1JA 3BJTA 2HS6A 4YJ5A 2GGIA 4H2HA 1YXCA 4NI8A 5FKYA 2AGKA 1H4PA 5IHRA 1TWZA 4F66A 4DUOA 2CKSA 4DI9A 4K3ZA 3UQNA 5FA5A 3TOPA 3PB0A 4N9CA 1BTCA 3W1MA 4PSRA 4NUWA 2REQA 1MEHA 4UZSA 3T1GA 1I4NA 2QYGA 4E6MA 1EA0A 5CCZA 1EJVC 5AC7A 3W6MA 1V6VA 3QLLA 5HR6A 5GNZA 3RN6A 1DOSA 4U2YA 1W32A 3DN5A 3B04A 4NRRA 2OFJA 3OJGA 4R34A 2YBVA 2F84A 3BLLA 5DFAA 3B8TA 4E2OA 2ZRXA 3V0UA 1AA1B 3QR0A 2XSAA 5I2UA 2BXVA 4TMCA 1XQLA 1UHVA 3NSNA 3VOJA 4F3HA 4M3PA 5DMLA 3WLQA 3VIIA 3WF4A 4GY7A 1TTQA 3SFKA 3AS2A 1HJVA 3C6CA 1VFOA 2YDAA 4WZHA 3IJIA 3FJNA 3USBA 4PFMA 1MMFA 2BZNA 4IFKB 1F6KA 4MIMA 1DVJA 3LY0A 1UA7A 3KP0A 1M7XA 4GGHA 1SU5A 5M3WA 1HL9A 3BZGA 4EWND 5K4ZA 4C7GA 1UWSA 4ORMA 2Z0IA 2NW0A 3UWWA 3V35A 3TA6A 4WXYA 2DGAA 1EO5A 1TX2A 4L1GA 2CBUA 2PDYA 4GCXA 4HSOA 3C52A 1S2UA 2X1UA 2VYOA 3ERPA 3VI2A 3SUVA 2BTMA 2VFEA 2D69A 3CHCA 1JD9A 1VBHA 3E5PA 3REQA 1XYAA 3FLUA 1A0CA 4UR8A 1N7KA 1IE7C 3A4AA 3SADA 2R91A 3H7UA 1J2BA 2P8BA 2WNWA 1O4UA 2F2KA 4J1OA 4JTEA 1V8EA 1G4SA 1DORA 4IP4A 4IIEA 3OP2A 4KERA 4RNJA 4K1WA 4WSKA 1ZALA 1BRLA 2CLOA 4C60A 4W93A 3HGSA 5CGMA 3INPA 1LRQA 3M5ZA 1ZP4A 4L4OA 4Z2JA 1LDCA 3VNDA 4DZ5A 3B3DA 3BLEA 3TE9A 3FX4A 2WVVA 1YPFA 1P1XA 3W07A 4DF1A 2QCNA 1SW0A 3KOWA 3LPOA 5HOSA 2QMJA 2HNEA 1C3FA 3AIWA 5AYBA 1XIIA 3WQEA 1GCYA 4EE9A 2BX7A 2TSYA 3IAPA 3MUZ1 1YXDA 4CD6A 3T09A 3W1QA 3WLRA 3G22A 4NZ1A 1R9XA 2G50A 3ZWTA 3SN0A 2Y6ZA 1NWUA 3KL0A 4K7YA 4MNMA 4QE1A 3CQIA 4AZCB 1B4KA 3EWUA 1EUAA 2YZ5A 4CU8A 3EWXA 2PRMA 4N42A 3TJLA 4N2YA 3AIVA 3LCGA 1UR3M 4IF2A 2NX1A 1C90A 2E4TA 2WSQA 4LC8A 4QLLA 1L2UA 5J8LA 5HQEA 3GNPA 3VIOA 1S2CA 1Q63A 1XYBA 3RMEA 3JR2A 3KCOA 1XBXA 3FYYA 1NEYA 2QVNA 5AB3A 4CVUA 3W2UA 2ZZ1A 2AKMA 3WLNA 1TV7A 4DWSD 3STPA 3TTYA 2CXEA 5K9CA 1L9WA 2PRLA 2QJHA 1HKKA 4M7SA 2QDGA 4NASA 3RDKA 2G96A 4QSFA 3RJYA 2PU0A 4AIOA 1E1EA 1ZBKA 4J40A 4NVTA 3G24A 5EMMA 3S9IA 2WMKA 1R5YA 1L8PA 5E0KA 2X7VA 4IG2B 5BWFA 4F40A 3PPFA 4WUIA 5I02A 2XG9A 4CD8A 1VFFA 1E0TA 4EP8C 1E1CB 2Z7GA 4UZUA 1QI3A 4AD2A 3TZFA 3MUCA 4XZMX 3ZR6A 1QNSA 3K2GA 1EEXA 3LTPA 3FHAA 5ABEA 1KBBA 5A6AA 2Y7FA 1Z69A 4HTBA 2FZMA 1OVDA 1VFMA 1XQKA 1QRQA 2V3DA 4P61A 4ZTYA 4B5TA 4W9TA 1ODUA 3NM1A 1F3EA 4X0NA 2F7FA 3DBNA 3KBMA 2XVNA 3QFEA 4AIUA 5LXXA 4PRTA 4UTIA 1NOUA 1UW9A 3SQSA 3UF9A 4AZ6A 5JH2A 3HQOA 3W76A 4ZE4A 1AW1A 1H7RA 1GORA 3IJ9A 2VZUA 3WQOA 3M5VA 2C1HA 1KLZA 1A5OC 3AUOA 4O18A 4JOMA 2QJJA 2YCLB 2ACSA 3BG3A 3KHJA 3AYTA 3OG3A 3HPZA 1MQPA 3O07A 2P50A 1FXQA 1ISVA 4NILA 2OEKA 1PVNA 3W2MA 4ICNA 2XWEA 2WJDA 5E9AA 1E56A 3PHAA 3F4NA 2JBMA 1DBTA 1UKQA 1E6QM 1TPVA 3ABZA 4NJGA 4I90A 1BGAA 1JRBA 4Q4MA 2WVTA 3M0IA 5D9PA 2NXGA 4F79A 3GNRA 3ZXWA 2GQ3A 2QV5A 3B9OA 1Z89A 4U28A 4QE4A 3AI0A 1VHNA 1S3HA 2FHCA 1WDPA 2GUBA 2JGQA 3U7BA 4K8HA 3WQ5A 5CPQA 4HZ7A 2CLEA 3OA3A 1E5JA 4WKAA 3GYCA 1GVIA 1JZ3A 4C1NB 4DWSB 1XIJA 2XM2A 3A9BA 3I3EA 3MCOA 2E6DA 4JFVA 1A5UA 2V5JA 2Z1XA 3GHSA 3WDHA 3GFXA 3KZPA 4MDOA 2XH2A 1HP5A 1BEUA 3S6DA 2OLAA 2BXYA 5AECA 1HT6A 4DF0A 1R3QA 4C6FA 4Y8FA 1PS9A 1R3TA 1AJZA 2BY0A 1V6YA 4EPKA 5AY7A 2DH3A 4JFWA 4GACA 4X60A 1DJIA 4UTTA 3EWYA 5FJIA 1RHCA 4MVAA 4ZVJA 3PWAA 3ZR4A 1VLIA 3FSUA 3ABQA 3W2LA 4YYCA 2Y5JA 4Y8EA 3TW9A 5AKQA 2BY2A 4H3DA 4YHGA 3Q65A 3CV1A 1ML1A 3AALA 3GIYA 5L6UA 4ZOBA 3T05A 1UZ4A 4DNMA 1HNYA 1PJ9A 4MNKA 5KSWA 1PEZA 2D0FA 3K5XA 3QKEA 1PTAA 3POCA 1F3XA 5F4XA 4A3YA 3ARRA 4QFUA 3U6WA 3LPGA 3R1ZA 5I3HA 4ZTXA 2C16A 5FOOA 2A6NA 4LH8A 5A6JA 5KZ6A 1I6NA 5E70A 5G4WA 3RHGA 4Q8NA 1X1ZA 3VE9A 1R46A 2VEPA 1VRXA 3VINA 3AZRA 2PMQA 3K30A 1SFJA 2Y1HA 2XYLA 4Q4OA 3AU6A 5HMFA 4WOZA 1XLGA 1XYZA 2WMFA 5IFPA 4XIMA 3BAIA 2E9LA 1L6SA 3GC4A 1GPFA 3TX9A 2BDQA 1ZB5A 2PE4A 2VEGA 3GG8A 4QJ4B 2A7PA 1JGMA 2J7FA 3G3DA 4YHEA 5K4XA 4QG9A 2GSEA 3DESA 4HHMA 3WQPA 4J28A 1I2NA 1RCQA 3TA9A 3V36A 1R38A 3R58A 1A5BA 5ECVA 1C8XA 3C86A 4Y7EA 3B9EA 5AHIA 3DFOA 2VC6A 4RZBA 2ODOA 3WFZA 3MANA 3QV7A 1JAKA 4D8LA 1OG0A 2ASHA 4LUJA 1SUXA 4HOWA 3P8JA 3NPVA 2FJKA 4HA4A 4AZCA 3EMZA 1B3VA 4GYPA 5LA2A 1W1VA 1VFSA 3SRHA 3L5AA 3F1QA 5CG0A 5HPCA 1QHZA 2RAGA 3W7EA 2Z25A 3FOKA 4UTLA 1PAMA 4GZ7A 4R85A 3H70A 1LWHA 4IMFA 3VX1A 1ZY9A 3W02A 3TH6A 4GNVA 3UG5A 2WZHA 3NZGA 1IZJA 3PBWA 3G1DA 3WF1A 4PUWA 1PDYA 3TJIA 4GX8A 5E6ZA 2OZ0A 2WVVB 1SYTA 1CXHA 2WSRA 2GQAA 4IIHA 1UD8A 3W7CA 3CWNA 5GVJA 1QDSA 1XLEA 4PEKA 3QKZA 1C8YA 4NAFB 3VGFA 1XRTA 2YLAA 1W37A 1Y5WA 4LV4A 3MB9A 4UQ9A 2BSLA 3ARVA 4WKFA 4WJXA 5LIKX 4E8CA 3O15A 1DE6A 3M9YA 3H12A 1Z32X 3U48A 1UP2A 3N12A 2W92A 4IT1A 4UBPC 4EF8A 4J7RA 3CT2A 2QCCA 3SCSA 3D6NA 3E02A 4AZBA 4CQ8A 4RCXA 2YL8A 2IQ0A 1HKMA 1RVKA 1OYCA 3UETA 1EH9A 3BTNA 2FHFA 1ZFJA 1J5SA 3ENLA 3M5YA 4MKVA 3WH9A 1GG0A 2QIWA 1GKPA 2QZRA 4EK7A 3WJSA 4ZFCA 2PDQA 2CBJA 1SZGA 2W63A 5C9WA 1E6ZA 3ARSA 4ZQPA 3QGAC 3CXOA 5TF0A 3CQJA 2XIBA 3MQTA 3H2FA 4J27A 2WANA 2XINA 4B5UA 1WDQA 3OODA 1NP0A 2JFEX 2ZZ5A 1V02E 1K3UA 1UWTA 3CMFA 1FCQA 3PULA 2GYIA 3EWWA 3QOMA 3ES8A 3OVPA 4AXNA 1XI3A 2CLPA 3C56A 2NQZA 2ZXBA 1CZ1A 2WJFA 2ACRA 4LF2A 4QIUA 1J0JA 3QGKC 3KUMA 2YB1A 3NDZA 1GOOA 4ZOAA 1VRDA 2VEFA 2XN2A 3SM0A 2D2JA 1KM5A 1R47A 2TYSA 1AJ0A 2QUTA 3K8KA 5G2WA 1QOXA 1R9YA 3IIXA 4U4MA 4UTHA 4Z1BA 3N9RA 1ONEA 4KWWA 3T9PA 1EDQA 2C18A 4DJEC 3R6IA 5LA0A 5DLCA 3H26A 2GJRA 1P6CA 1LYXA 4GJJA 5CG7A 4ZO9A 4IMAA 4NJKA 1F7BA 3V3WA 4L56A 5DMYA 2V5CA 3BDKA 2AQWA 3SFWA 3KCJA 3NOEA 4HU0A 2V63A 5FL1A 3RCYA 4O10A 1FWCC 4U2ZA 3EWDA 2XFFA 2CWNA 3IIVA 1QWKA 4UWMA 3WNPA 5LZLA 2QMKA 3S2MA 3S0CA 1UD5A 4AZ5A 4PMOA 3S9ZA 1KXTA 3LQGA 1RVGA 7A3HA 4B5VA 4H4IA 3KS5A 3CLMA 4E0CA 1R6WA 2PDLA 2DSKA 4DLFA 1Q2RA 3ARZA 5BXSA 1C93A 4Y2WA 1HN1A 3LCLA 2EF9A 1BAGA 1WKEA 2WMIB 1MNZA 1IGSA 3WLPA 1UKOA 1D2KA 1B3XA 3LLDA 1RP8A 4UTTC 3M0HA 3VK5A 3IJDA 4NQ1A 1UP3A 4QQ3A 4DELA 1ZS2A 4PCFA 5D30A 3C61A 4FS9A 2J27A 3NQEA 3FN9A 1UJQA 3RX4A 2FDMA 3II1A 4GNJA 5LIWX 4H9ZA 4FZIA 2X8RA 4ZSTA 2D3LA 1RUSA 2YA2A 1NQKA 1F74A 3ITLA 1OC7A 2VENA 4DVOA 2XVLA 5I24A 4OOZA 1HL2A 4L6OA 5G4HC 2VGFA 3ITXA 4OBTA 3LPFA 2CPUA 4S3CA 4EAMA 3DG3A 4GIAA 3RFAA 5BU9A 2D23A 1FKXA 2GVJA 2FTYA 3GR4A 1TJ2A 2QF7A 4NX5A 5HJYA 3SUSA 2AGTA 1CENA 1U1UA 4D6CA 1JGIA 1K9DA 3I10A 1JQVA 4HNOA 4JNYA 1XIHA 1HVXA 3QPYA 3L5MA 4CN1A 4QCEA 2VRQA 4XIAA 1RLCL 1T7LA 3MS8A 2NWRA 3D47A 4LCQA 3W7RA 1KO0A 1W17A 4RZ4A 3PK7A 1B31A 1OBAA 1EJTC 1B0IA 1H0GA 3PTDA 4IJBA 1VAHA 2JALA 3H4GA 4DJFA 4N6EA 3Q45A 1WKFA 2KX9A 4Q4KA 3QM3A 1FRBA 4LANA 1JPIA 4HPGA 4ZEPA 1Z42A 4HMCA 1CB7B 3OPSA 4AAJA 2Z6JA 2OKOA 1JZ4A 8CGTA 4RPQA 3WUGA 4YPJA 3T6CA 3TC7A 3S9YA 3HQPA 3LZ5A 3E2VA 5FAJA 2WMIA 3UZZA 1BQGA 4M1RA 1WOBA 1Q7QA 4NSBA 4G7FA 2VOTA 3P81A 3S8HA 3VDAA 1OIMA 1KTBA 4ZCWA 1KM4A 4DJDC 3MY9A 5H91A 3SCRA 2G4FA 5J5DA 3QVQA 4D8ZA 1LLOA 1H61A 4HBKA 4W4QA 1UASA 1ITXA 5D33A 4MKNA 2OU4A 4AVOA 3UWQA 3H4XA 1XLBA 3U5YA 3WD4A 1HJUA 2ZXAA 3TCEA 4ES4A 3BVJA 3N2TA 3AXHA 3VOIA 3J7HA 1EXBA 1GJPA 1NDVA 2JKEA 2VKZG 4AEEA 1JQXA 2GDVA 4D6GA 4A3HA 1RBAA 2VP8A 1FCBA 3BC9A 3ANYA 1AH4A 4HNUA 2W91A 2RDUA 1I0BA 4G56A 5TBOA 1UP0A 4JXCA 3BPWA 1JPMA 1LG2A 4PTXA 1UWIA 3NAVA 2VO5A 4MGGA 3WK3A 3NZQA 4KRTA 3AIBA 2J7HA 2P3EA 3QYSA 1ZAIA 1V3MA 1K7EA 2IXVA 2GK1B 1TO3A 1XGZA 3TXZA 4W84A 2OX1A 3KS6A 5FD0A 2NVAA 3KW3A 4EPDC 3BICA 2X0YA 3RR1A 1L0PA 1K70A 2ZRVA 4GZEA 3DGBA 3R12A 1Z6KA 2BOFX 4LQ1A 3V5CA 4NI3A 4ZQMA 3SRFA 5HBFA 3BSGA 3LBOA 4OQVA 2OWCA 1A80A 1G5AA 4C5ZA 1E9IA 1XBZA 2J66A 5I6SA 3C4UA 4JCMA 1DE5A 3QQ0A 3WL0A 4YN5A 1P7TA 3UJSA 1TE1A 2RDWA 4QLKA 1UYQA 3KFTA 3MUY1 4U31A 2CZEA 1YNYA 1ONXA 5CSYA 1V02A 4KEZA 4R53A 4O17A 6ALDA 1F05A 3GFYA 5GJMA 2HS8A 1GOXA 4H7VA 1YBQB 4TV6A 3UYCA 1SJDA 1VJZA 3UWUA 5DO8A 3WBEA 3CMGA 4O11A 4MJMA 3AIQA 1FWNA 5D9OA 3UCQA 4JHOA 2ZUMA 2VI0A 4BQ4A 5BOOA 3CAKA 5FJRA 3RLVA 4H8VA 4X9SA 1BFNA 2IMRA 3LBCA 3MHFA 2FVKA 5E6YA 1YIXA 4S23A 2CESA 4DPQA 1HO1A 3ZVHA 1GVEA 2RGLA 2EKGA 1AH3A 3LEPA 3UJRA 5BOEA 4B9ZA 3IGHX 2KAUC 4FLQA 1CBGA 4A2SA 1UD4A 4QG8A 2V3FA 2HBVA 3OQ8A 5BZAA 1QMLA 2OEMA 3MCMA 2RHGA 1ICSA 1H50A 1IWPA 3A6OA 3T4CA 1KB3A 1XUUA 1D9EA 3N3TA 1XS2A 4C6JA 4F0RA 1DEDA 4JDBA 4DPPA 1Q8AA 2BG5A 4A4AA 1XYFA 1UR2A 3CAQA 1TX0A 3XIMA 2WZEA 3L4ZA 3DERA 1V08A 3VNZA 1ME9A 2OKTA 4AVNA 1BKHA 4XVEA 1K9EA 4JCLA 4DN1A 2QCDA 1IT8A 1DWFM 3WLSA 5TAOA 4Y9OA 3A23A 1E1FA 3QQ1A 4XVDA 3CLWA 5LNSA 2WLYA 3MBDA 3LHTA 1Q6DA 3WD0A 3NJ3A 3S6OA 1XFCA 2WCGA 3T0CA 2YYUA 1TV3A 1JFXA 5I3KA 3S2JA 5DN1A 3PB2A 1H0IA 4Q6XA 2ISWA 4CUCA 1LUCA 3BARA 4HSNA 4HHLA 5CSSA 3SCQA 1WBJA 1GVQA 1LWIA 2EBNA 1QOPA 1O1HA 3N2MA 4IQEA 2CYGA 3ARQA 2W9MA 1P48A 2EPMX 3VZYA 2GQ9A 3H55A 3LCFA 4LJ3A 1FWHC 3STGA 1DP0A 1XR2A 3S1UA 3ZVHB 1TE6A 1EGMA 2P0OA 3TN4A 2YCLA 3T8QA 2TMDA 1EL3A 2CCRA 3FXYA 4PBEA 5HMSA 4QX4A 5CC7A 5E5CA 3KWXA 1QNOA 1CYGA 4RDVA 4XUGA 3N2OA 3PP7A 5FESA 1FHUA 4A3QA 2E40A 3E1F1 4JHZA 3HJEA 6ENLA 1D7KA 3I6RA 1HW6A 2NQHA 4JYDA 4G6CA 3RYSA 1R87A 3PJTA 3MTWA 4V33A 3EPOA 3TIMA 4NX0A 1TUFA 3H23A 5DRCA 4LC6A 3B8IA 3DCPA 1UPPA 1CEOA 4JFUA 4N0RA 1POKA 1XHGA 2YB4A 1UOZA 4AEOA 2AMXA 4JEQA 3W7OA 1QHOA 3RITA 4LAKA 1G6CA 4PC8A 2Y7GA 2VQTA 5A2CA 3QH2A 1TFVA 3ITOA 1PV8A 3BANA 4UFMA 2CERA 1WBHA 3T0TA 2BLEA 2I57A 1QU4A 4J3WA 4CCZA 1YTDA 1J2WA 1M7PA 4MWAB 4PSPA 3ZLGA 2QGHA 5ABFA 5CBBA 2XGIA 3NUKA 4BF5A 4YYFA 3L4TA 1F8IA 3PZ9A 1Q8JA 1REQA 4EKJA 1FH7A 2INZA 2Q6ZA 4N9BA 3UD6A 1BPLB 2QDEA 2WZMA 3L9CA 1Q6RA 3CT7A 3NPUA 1EHNA 1JPHA 2QAFA 4US5D 1K8ZA 1CECA 2W67A 3B9DA 1KM3A 3DGRA 1M9HA 2PP3A 2Z6IA 2WB5A 4M80A 4FPSA 2G0WA 2J47A 4ZB5A 2TRSA 4HA0A 3R8HA 4M6VA 4OUIA 3WLMA 2ADAA 3CUJA 5HINA 3VD4A 1EP1A 3H4WA 4JQAA 3STFA 1WDRA 3M1ZA 1JUBA 5BU6A 3E74A 1ISWA 1EC8A 1ICPA 4KCUA 4IIBA 4UQDA 4JFTA 1R0MA 3L12A 3C0SA 1Y7VA 2CZ5A 3L7RA 3QHNA 2P53A 5LHEA 3G1XA 4DM2A 4QCFA 1OM0A 2ZDRA 3CM4A 2DIJA 2J78A 1H7OA 3LXBA 3I65A 5AFDA 5LGZA 1PIIA 4DY1A 1I1WA 3VCCA 2C0AA 3CWOX 2HZGA 3HIJA 3NL2A 2PDCA 2GPTA 1V3HA 5G1MA 4JQ2A 4EX4A 2YFNA 2ZOXA 1VYSX 3OOQA 4XBKA 4M24A 5GNXA 1GQIA 2HVNA 1TWDA 4B91A 1QBAA 1QW7A 4V15A 4HMNA 2HSAA 1OX5A 3HQNA 1EXPA 3AXIA 3MSRA 2OVLA 3R0UA 1LT7A 1K6WA 2WQPA 3TQKA 2QS8A 3VKAA 3SCNA 4LUSB 3G1VA 3NQFA 1KM6A 1BQCA 2PGRA 2Z26A 3WJZA 5U7SA 2XTKA 4HIBA 3EB2A 4KIRA 3VILA 4DYKA 3P84A 3A4JA 4ZMGA 1DL3A 3QEZA 1YTEA 3ZS4A 2UY4A 3LLXA 4MKSA 1XRSA 4XD5A 3P5YA 4IUOA 3THAA 4PCSA 3TJ4A 3F2BA 4YVPA 1QOQA 2BP1A 2Q8XA 5C0QA 2ATSA 1GOMA 1JDDA 5EU9A 1L6WA 1AW5A 1K7FA 4AZIA 4YU1A 1TZ7A 1V5XA 4PYSA 1SZFA 2QCEA 4WSHA 1HJXA 3EX6A 2V3GA 3NQDA 5A5WA 2ZX5A 3QZAA 3H7VA 1ADOA 5FF4A 3O1NA 2VVNA 3PZNA 3NL6A 3CZ8A 5D05A 1PX4A 4O13A 3AICA 1B57A 3O63A 2UBPC 1TPDA 3K13A 4AU0A 1BWVA 1PWMA 5BRPA 4ZOEA 5AVNA 3OTRA 4HMEA 1VP5A 1R2SA 4LAZA 5JXQA 5D2TA 3B0VC 3KVJA 3QHMA 1JD7A 1KBJA 5CAHA 4LBRA 2RDXA 1IXPA 2EG6A 3U2OA 4EAYA 3BSHA 4LX4A 4AWSA 3TMQA 3BOLA 1RR2A 4QR6A 4G1KA 1BF2A 3U2EA 5JIPA 1GKQA 4ASTA 3IANA 4RV3A 3LA4A 1IGWA 2VT0A 1XJBA 2I1OA 2NVDA 4RW5A 2GVLA 1W9VA 5GQBA 3WJXA 1AMKA 4ERIA 4A8LA 2HBXA 3RM8A 1D3HA 1ZENA 1UWQA 1BWKA 1KCLA 1U2YA 3G3MA 4GISA 3AS0A 1HP4A 1IT7A 4LYRA 3TTOA 2ICSA 3TC3A 3M43A 4JBRA 2HV5A 2C3ZA 4O14A 2FZ8A 1WZLA 3BQ5A 1UR0A 3AJ7A 4WIWA 3WNMA 1LOLA 4MB4A 2PWVA 2GVYA 2NLIA 3UJFA 4QAIA 4UIOA 4BWLA 3FDKA 4I7UA 5CC3A 3HPXA 4H8NA 2WO5A 4PMRA 4BI6A 4C6KA 5BCAA 3U2CA 3KRZA 4ML9A 3BAJA 2DVUA 3AFBA 4FXRA 3UESA 3LM7A 3CUIA 4Y9NA 2E1WA 2XDFA 3ITTA 2ISSA 4TXEA 2YW3A 3CPUA 1OX6A 1JR1A 4FIQA 4XG1A 4ZSUA 1J0ZA 4IQLA 4L64A 3TROA 4NJIA 2PWDA 3N6QA 2RH9A 1VENA 4FIRA 5DT7A 1QNPA 2F2HA 3W9ZA 1KM1A 4EWJA 1Q13A 3ARUA 2R94A 2GSJA 4F0LA 2G8ZA 2Q71A 4NT0A 3BCJA 2P10A 4DEFA 3T78A 1QHPA 5MF5A 3FDGA 4JYFA 4M51A 5DQPA 1DV7A 2EXOA 5EBAA 3PZOA 1AK5A 1V3KA 3PWIA 1P0NA 2DP3A 1GVYA 4IISA 3IUDA 4XKYB 4IXXA 1H5VA 1W31A 3TW6A 5FEWA 4AIEA 4JN7A 2A3CA 3IVSA 2DZVA 3EMCA 4QSHA 1W9DM 3GU9A 3W6YA 7REQB 3B8DA 4GK8A 3G1FA 3DHDA 4L9XA 3CUHA 2P76A 4KFOA 2AQVA 4P7OA 4CLMA 1UPMB 2YXXA 5FSDC 1VPYA 4UNIA 1Y65A 4NIRA 3CH0A 2YR1A 3CV6A 4JTTA 4MYAA 4NG3A 7XIMA 2VDHA 1O1ZA 3S1GA 1R3SA 1I2RA 2V5BA 1OFRA 2E67A 1OFBA 4B16A 3ALGA 3IRDA 1ZHAA 3RILA 3WDQA 3RNDA 3DFHA 2XZ9A 4KF1A 4UFKA 2VFFA 3U7VA 3WY1A 1X38A 4M56A 4C6LA 5KEZA 2NT0A 1HGYA 3GX9A 4G1NA 1ZZMA 3T07A 1RCOB 3CPRA 4MZ8A 5BXTA 1A50A 6TIMA 1VR6A 4AD0A 3G0UA 1WAUA 4H04A 4C6EA 3N18A 3B06A 4BHYA 2OQLA 1X1OA 1R8LA 3E0VA 1LLWA 4W85A 4N4PA 3MW7A 4XAFA 2DZUA 1MRQA 1E71M 4NNAA 5DX7A 2BV9A 2GUYA 4XISA 2VZVA 4ORIA 2WWDA 1TKKA 3IARA 5DELA 3DU0A 4L6HA 1M6JA 2OSXA 1VLWA 4GUJA 3S1VA 1DWHM 3K46A 2EQDA 1FOBA 1TJ0A 4B3LA 2OPJA 5FJUA 2BVWA 2A3HA 2GLKA 2Y5EA 1HX0A 2XFWA 5HMEA 3QYQA 4NZ3A 4TX8A 1N8FA 1OZQA 4O1EA 3FA5A 3TN3A 1XCWA 1P6BA 2WW5A 1XBYA 3DHPA 4NJHA 4MNLA 3WLOA 4KMQA 2PLJA 1TMLA 3V18A 4D6HA 1LBFA 1V0MA 4PMXA 4GMEA 1QTWA 4JIHA 2BODX 3NQGA 4GYJA 1S5TA 4I9AA 1MUWA 1WB0A 4GQQA 5CZ0A 2BHUA 5LA1A 2F9RA 5I0DA 4PMQA 3SEPA 2VZOA 3AHZA 1TIMA 3LCXA 4ATLA 4NY2A 4L4LA 2WHKA 1EF3A 1S5NA 1QVBA 3IRSA 4PMZA 1EZWA 5FEXA 2RUSA 3PBUA 1XINA 2DJLA 4DLMA 3TR9A 4ACZB 1TVLA 1VBGA 4XX6A 4MLRA 4FF7A 5LNUA 1HO4A 4WDTA 3NXFA 5HULA 1CW2A 2CU0A 3OHIA 4LPCA 3GAKA 1W3JA 4LUYA 3R11A 4YTUA 2H9AA 3KCLA 3O0KA 4DIAA 5HA7A 2VRKA 3UWZA 2OR2A 1GVFA 3WKZA 4Y96A 1QPQA 3T8LA 2HISA 2UY3A 5AZ1A 1OABA 3DAQA 4IMGA 3ICJA 3A3HA 1YDNA 2PODA 1H3GA 3ZT7A 1EYWA 4X2PA 3L68A 3VCNA 4K2SA 4B5SA 4HNNA 3CV2A 1ZAJA 3W27A 3RLHA 4IMCA 5CPTA 1LUCB 2FGLA 4D8AA 4HP5A 4WQ6A 1GOWA 2F6XA 5FF7A 1PE1A 3LTYA