4MWAD

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
259
structure length
251
Chain Sequence
b'NEMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDKVRINKVEAVVNAAKERGIPIRIGVNAGSLERHILEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVKVARELLKSFGLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 80
structure length 251
sequence length 259
chains with identical sequence F, H
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaD00
4MWAB 2YCJA 4NILA 1Q8AA 2DZAA 1Q7QA 4DAIA 1Q85A 1EYEA 4MWAD 3TYUA 4S3FA 4D8ZA 4D8AA 4DJED 2Y0FA 3BOFA 3H23A 4DAFA 5JQ9A 2H9AB 1AD4A 3H2OA 1Q7MA 3TYZA 4S3AA 1TX2A 4S39A 2OGYA 3H2MA 4HB7A 4DJFA 2YCLB 4O1EA 1Q8JA 4O0QA 3V5OA 4S3EA 4S3BA 4DB7A 2VEGA 3H26A 2BMBA 4C1NB 3MCNA 4PZVA 3H21A 4DJDD 4MWAA 3MCOA 4DJEA 1AJ0A 2VP8A 4DJDC 3TYBA 2Y5SA 4O1FA 3H2AA 4NIRA 3BOLA 3TZFA 1AJ2A 1TWZA 3TYCA 3TR9A 2H9AA 4MWAE 3MCMA 2Y5JA 3H2NA 2E7FA 3TYAA 4S38A 3H24A 4D9PA 3H2CA 3H2EA 4S23A 1AJZA 4S3DA 4G9PA 1TWWA 2YCLA 3TZNA 2DQWA 3NOYA 3TYEA 2DZBA 2YCKX 1Q7ZA 4DJFD 1AD1A 4C1NA 2VEFA 1TWSA 3K13A 4MWAC 4DJDA 3H22A 3TYDA 2YCIX 4S3CA 3H2FA 4DJEC 4DJFC 1F6YA 4NL1A 1TX0A 4NHVA 4CCZA
chains in the Genus database with same CATH superfamily
3UXAA 3WUBA 2EG6A 1FWJC 2O4MA 2OKTA 5TNVA 4R53A 3QFWA 3VDBA 5I3IA 5K4XA 1H0IA 4LALA 1J11A 4IGMA 5DQPA 4MJ4A 2OG9A 1OHLA 3PZNA 3ZJ7A 4NAFA 4ACZA 4MFEA 2HNHA 3GG1A 3UJSA 4KETA 4ZTYA 4FXRA 3S5OA 2EG7A 4R88A 2Y89A 2X0HA 4KEUA 1LG2A 1DIEA 2VCBA 4XK2A 4GNJA 4MDOA 3ANVA 1TZ7A 4N6EA 2A5HA 4F2UA 1OFOA 4QXIA 2WLZA 3CZKA 3TROA 4MJMA 3CS2A 3RG6A 4UNLA 4RV3A 1HKKA 1SO6A 4AZBA 2ZWYA 2R1MA 4LX4A 1VR6A 3TSBA 3PG8A 5HNNA 1RCXB 4O0KA 4PBEA 2HE8A 1QU4A 4NU7A 5BOEA 5KINA 3PZOA 3BLPX 3LHWA 1GNXA 1VHCA 1X39A 2EHHA 1MQPA 2IUZA 1DHKA 4CD5A 1YX1A 2XIOA 2BP1A 1PPIA 4AEEA 2WNZA 3ZFHA 4YTUA 1I0BA 2G4JA 4DJFD 1AD1A 1FFRA 3NURA 4ECLA 4ONVA 3E2VA 5LIYX 4I7WA 4CQAA 1Z48A 1DBTA 1PUDA 4D6HA 4K7YA 3K8KA 4RPPA 4EWJA 1WX0A 1GZ1A 1WKYA 3S46A 1WP6A 4E38A 1MZRA 3C5QA 4Q4QA 4M6UA 1QMLA 3II1A 4EPKA 1Y8BA 2FIQA 2FYMA 4HJWA 4O17A 3ITTA 4S3AA 1XQKA 3UR2A 3LD5A 4WQ6A 4QHRA 2PWDA 4DF1A 3R1ZA 2XJ7A 2D3NA 1DORA 5BOOA 1FTXA 1V4YA 2PRLA 3QEZA 3UXIA 2F84A 4OV4A 1ZNNA 3MY9A 3RU8X 1LUCA 3DHUA 2WNNA 3U7VA 1REQA 3OGVA 4XKYA 3P6LA 1V08A 3PBVA 2J13A 4AB4A 3OVQA 4MIMA 1KM4A 3W2LA 5H1WA 3ARQA 3B0VC 3TTEA 1UR3M 1V0LA 1AMKA 4FI4A 3W01A 1A5SA 1A4LA 5AHIA 1NWRA 4JIHA 5CZJA 1HO4A 3VC5A 3BMVA 5F4SA 3EKZA 3QTGA 4XO7A 5A94A 3IJ7A 3O0FA 3UR8A 1XYFA 3S42A 3QF0A 1Q6EA 1JFHA 4ML4A 1ONWA 2F2KA 4AY8A 1E4LA 2FZ8A 5DF0A 1ZAIA 5I78A 2QJHA 1IR1A 1UWTA 2QS8A 4JHMA 3TSDA 4JX4A 1BSLA 3R0DA 3TXVA 4FXSA 3W6LA 1EWDA 3W81A 2GYIA 3GH7A 3ZS4A 1HGYA 3CMFA 3CUFA 1E0WA 3LTSA 3AHVA 2WBGA 1M7XA 3T7VA 5CZSA 3W22A 1K1DA 3IJLA 3GY1A 4GIYA 3N2BA 3R2GA 4NI8A 3W6MA 4PTNA 1C90A 1OC7A 1BXNA 1DJQA 2DZUA 3F2BA 3N14A 3FW6A 1JVNA 3BH4A 4QG9A 1RPXA 4F0SA 4JL1A 2ODOA 2PSNA 4EXQA 2Y24A 2Y8KA 2Z2BA 3G1YA 2PP3A 2CLFA 2FGLA 1XLGA 4RPQA 4HBKA 2V38A 3TWAA 4I8DA 1JEZA 4Q4SA 1UC4A 3OA3A 2VC6A 1TUXA 1XLBA 2AQVA 1KC7A 3WLOA 1R3YA 3N2CA 3VCCA 3W7RA 4GYPA 3O2LA 4LAKA 4U2ZA 4DXKA 1QBAA 1NDZA 1FCVA 4Z17A 3RLGA 3UY8A 3PG9A 2NQ5A 1XIJA 3QZAA 1XIMA 4U31A 3ZJKA 4WXYA 1FHLA 3AIQA 3IJDA 4HN4A 3E0WA 1DWGM 4AISA 5DMLA 3R43A 4TVUA 1UD5A 1TV2A 1POKA 1YLVA 3UXDA 1B57A 2F2HA 4NZ5A 2VQTA 1IZKA 3TC3A 2JE8A 1C93A 1JI2A 2HE5A 5I06A 3PB0A 1JFXA 2RKXA 3PNZA 1UZ4A 3KOWA 4MWAB 4WRHA 4B5WA 3MHFA 2TSYA 3GU1A 4TX8A 2C1GA 1FP9A 4A2RA 1P6WA 5LIWX 2Y0FA 1OD0A 1VYPX 3OO2A 3LRMA 2YOCA 3VIHA 5A6BA 3W1LA 1EX5A 1K9EA 2VRQA 3JR2A 2DFAA 5JH2A 1D7FA 1XHGA 3UZWA 1GQJA 5SWUA 1BG4A 3OLGA 4HP5A 2Z24A 1VRDA 1YTKA 3RLHA 2YLLA 1V79A 4JGDA 5AHFA 4NYYA 2WWCA 3DUGA 3A24A 4POCA 4AMAA 3FKRA 1A5CA 1UBPC 3BDKA 3UP8A 3WO8A 1JXKA 3STPA 3T0DA 1XRFA 1XGEA 1ZZMA 4V33A 4JQ1A 5D38A 3KW3A 1YXCA 6ENLA 4ZR8A 3MHGA 1MQRA 5E1QA 2E9MA 4IG2B 2HK0A 3WELA 3H2NA 3SCSA 2V2CA 3RITA 4EF9A 1HG3A 1KM6A 3H2EA 1K7XA 4B5XA 2QUUA 3I65A 3WLMA 2OLAA 3LNMA 2GK1B 3E3HA 3CWNA 2A0NA 2DZBA 4C5ZA 1NDVA 4UFMA 4AF0B 3S9YA 1K03A 3U9IA 1OFRA 5A6AA 2CZDA 5LXEA 2PDQA 3TAOA 4GZEA 3ZXWA 4A3HA 3PSVA 1ZJAA 4ICMA 2QAPA 1LRNA 1UUMA 1GVRA 3G3DA 1IF2A 4A6GA 3EXRA 4HYRA 3E2SA 1LRQA 5LGZA 3BLFA 5C6MA 4JS3A 2E1WA 4Q6JA 3PULA 4DO4A 7TAAA 3AIEA 2AGKA 3ATYA 3GAYA 1Q6GA 1J93A 1W8SA 2GFTA 1GYNA 5HBFA 4H2HA 4B3LA 2XDFA 1DQXA 1OVDA 2YA2A 2A2IA 3KBMA 3FYPA 2D23A 4IIHA 4B92A 3L2LA 3WQWA 3RGTA 4J3VA 3NGJA 4IPPA 1F5ZA 1MUMA 3R8HA 4FXJA 4ML9A 2NQHA 3BAIA 3I7QA 2UZ9A 1FWEC 4CD6A 3TN5A 3LXBA 3K8LA 2NXIA 1IXPA 2YLAA 3JUGA 4NZJA 1O7AA 1PKNA 4PTDA 5FJRA 2VFEA 4DXVA 4JIPA 2OB3A 1GJWA 3W53A 2P0OA 2DT3A 2PWVA 3SBFA 1CENA 4X0VA 3W1PA 3WH6A 4JNZA 3IRDA 4G7FA 1UP2A 4GKLA 1CNVA 3G6LA 4S3FA 1PX8A 5E0KA 3S2CA 2Y8VA 4PMRA 1HL9A 3W7CA 1BQCA 4DJED 4KCWA 4PN2A 2OX1A 3VTRA 1E9LA 1M5WA 5B7ZA 2XFYA 1Z7AA 3KTXA 2DJXA 4DBSA 3CU2A 2V8ZA 1S46A 3VIPA 3G8RA 4AD4A 1EXBA 2GDUA 3MP3A 4N9CA 1GYLA 2VI0A 1BG9A 3SRDA 4PMOA 3D3FA 1W3TA 3GXMA 2MNRA 3RPTA 4RLIA 4J7RA 1OZMA 2G5WA 3LCGA 2PDFA 4L4OA 3LBMA 1EDTA 1HJXA 3WLIA 1CLXA 3SDOA 1XPYA 1TCMA 4QS6A 1OK6A 3GXFA 4J3UA 2QLYA 3GW3A 4O0ZA 3WN6A 3VNLA 2C13A 2Z29A 4GK8A 4NJJA 3E49A 2C18A 5CPOA 3IGHX 4O53A 4MTVA 3BLIA 4WSHA 3APTA 2UV8G 1QNOA 4X2PA 2CBJA 2VM8A 3MMTA 4QDWA 4GH3A 4PL2A 3K13A 1SUXA 5I6SA 2ISWA 5HWMA 5DRIA 2CESA 3TW6A 3R89A 3UQNA 1W1ZA 3NQ2A 3L4WA 5AN7A 5C55A 4K2SA 1S5WA 5BXSA 1VBJA 5A69A 4IUGA 2BVTA 4IIBA 3AOFA 1DXFA 3PZVA 1JNDA 4NUWA 2O9TA 4JL2A 2H9AB 3DKLA 4QITA 1KCLA 4GVIA 3W7OA 3DENA 2QJIA 1SFJA 5CPNA 4KS0A 2D2JA 4KCVA 3DHPA 3EOLA 2D0HA 4OV9A 3B8TA 3MUAA 3G1DA 3Q37A 5DCEA 2ACRA 3ATZA 2FPYA 1W1B1 3SI9A 1W9BM 2W0UA 1XV8A 1IGWA 3S5YA 2O56A 1LWHA 3WDPP 4PEEA 3UW6A 4DZHA 2V5CA 3NL6A 3P81A 4HMDA 1SYTA 1MXDA 2IPFA 2QCLA 1OX6A 1KRMA 5A6JA 2BDQA 2MUCA 5CGMA 4WDXA 5G5IA 1JULA 1TJRA 3TK7A 3KBJA 4MNJA 2ZVIA 5KZMA 1E72M 3LDVA 2NWSA 3NIYA 1KRCC 9RUBA 4QJ1A 3H8AA 1XYBA 3S9IA 4Z2LA 2HVOA 3CH0A 1QNPA 3KHJA 8RUCA 1ZBKA 4GI4A 1EDGA 3EWWA 3B4UA 5T26A 4H01A 2ZTKA 2VELA 4NNCA 3UPWA 3GDBA 2GOKA 3BSHA 1Q63A 1TKKA 2CCRA 4GQRA 4C6DA 3HMJG 1N8WA 1Z41A 2BXZA 1Q8AA 4QG8A 2ZX7A 1FWBC 3W88A 5HMDA 5D04C 4JD4A 1I2QA 2DSZA 3E0VA 2Z27A 3BMWA 1QOQA 3OQ8A 3L4ZA 3K1GA 4L64A 4FB7A 4PFHA 2WYSA 4L80A 1TG7A 3FN9A 5HMSA 4KKXA 3CZEA 4PL1A 3UG8A 2GJPA 1IYXA 4CNUA 4AHPA 1SW3A 4JN7A 4Z1CA 3RHGA 2RHGA 4S3EA 3SRFA 3T08A 2DSKA 1WNOA 3A3HA 3EEGA 3U6WA 2BGSA 3W4RA 1S5NA 4BI7A 1I9CB 1M41A 1W5NA 2FQIA 1E6RA 4P7RA 3T4WA 3UPBA 1TTQA 1JAKA 1X38A 2EJAA 3PAOA 4HQVA 4AEFA 5I23A 1HJVA 1PL9A 4L1WA 4NIRA 1OC6A 4I8YA 4Q8UA 1AJ2A 3SECA 1BLIA 3QY7A 3GVRA 2ABAA 3WNNA 4MB4A 1F6PA 2DZXA 3ITCA 1JYWA 4EE9A 2B7NA 1JCMP 3BPWA 1JQVA 1JCJA 4K37A 5CZKA 1VEMA 4JY8A 2CIPA 4O13A 2INFA 3WBYA 2CLIA 1KW1A 4HVXA 4J3SA 3W1XA 4QCEA 3RIKA 5CBJA 1AQMA 3QW3A 3NXLA 5D32A 2J47A 2ZIDA 1C8XA 4PRRA 3NDOA 4JICA 2WVTA 1XR2A 2ZQ0A 3PZGA 4YL2A 1NU5A 1EJWC 1LOSA 2ZA3A 1UQZA 3UR5A 2WMFA 1TMHA 4IPNB 2J7GA 4JTKA 4CU8A 2Q02A 2DQXA 1KD0A 3ZLFA 2VX6A 1K7FA 1JPHA 3IAPA 2VOMA 5H91A 4C6EA 3R8GA 4JHOA 1OFQA 5CZTA 2PDPA 3APYA 2Y7FA 3U2OA 2FZ9A 4UTUA 1AA1B 3LPPA 3G8EA 2BASA 3ITXA 4RUBA 2QUTA 4LUJA 2ZUWA 4DF0A 1QI0A 3WD1A 1B4EA 1Q4WA 4JTUA 5HQMA 5HPOA 1P7TA 2GGGA 2CLOA 2QJNA 4FX6M 4URIA 1DWAM 3EMCA 5G1YA 5B7YA 1G67A 3SSJA 4AYGA 2ZRVA 3FSTA 4CN4A 3MDWA 1WUFA 3TONA 3LCIA 3E6EA 2WSYA 5E9AA 3URNA 4ZEPA 1KCXA 2OJPA 3WEZA 1KV5A 2A79A 1QAPA 3TR2A 3BQ6A 2FVKA 1MI3A 4C6PA 3CUXA 1TJ1A 1SZFA 3QGAC 5FAJA 2FZMA 3MP4A 2A3LA 2FVMA 4RE2A 4M0XA 2DDXA 3LXAA 2RFGA 4IMAA 3EA3A 1HZYA 4XX6A 3UXLA 5J8LA 4F8XA 4YVPA 2E09A 4LUTB 4Q8TA 5A8GA 4JTDA 4ES4A 3QMTA 1FRBA 4QAWA 2RUSA 4AVNA 3RUBL 2PTZA 4UTTA 3O0KA 3AUJA 2GVGA 3I10A 4BWLC 1A0DA 1H1YA 3ABSA 4JFWA 2EGZA 4LNCA 1EGVA 1SO3A 3VABA 3VIGA 3UERA 1B3YA 3F4NA 3L5LA 3OW1A 4QTGA 3JRKA 3UZZA 2GSEA 1QBBA 2G97A 3SQSA 1AMYA 1WZAA 3GXPA 1MUWA 2YBUA 3C86A 2W4XA 4TVCA 3VGGA 1UCWA 1OD8A 4XD4A 1D3HA 3HFTA 4Q8NA 3W7KA 3GAKA 1WZLA 3MU7A 1X1ZA 2I9UA 3GC4A 2PGEA 4GBDA 1SM9A 3GVQA 2BVDA 2WMHA 4AHOA 3LLFA 1YNQA 1HL2A 3BSMA 3IAQA 2FFCA 3L0GA 4P7QA 3HPAA 4F66A 3P8JA 3DIPA 4C1NA 1NFPA 2OX4A 1M53A 2E25A 3GKFA 1I2OA 3LV5A 1HP5A 1LQ0A 4UTHA 1N8FA 3QV8A 2VZSA 1VJIA 3F4DA 3WQOA 3EDDA 1RXOB 2ON3A 4NL1A 2GGHA 5LNRA 2REQA 3WL1A 4ZO8A 1EB3A 3A23A 2Y1HA 1HJSA 5AVHA 2BVWA 1UQYA 3RJXA 2QJGA 1TV4A 4TTUA 2XIIA 1P4CA 1TV7A 4ZODA 2VFHA 3H7UA 3HA1A 4JIEA 1A80A 1A5MC 3WLTA 1VCVA 1A49A 4YJ5A 4MNKA 4OOUA 1VLIA 4HNOA 2V0TA 3H2MA 1H7OA 3A6OA 1GOQA 3FJLA 4Z08A 2OELA 1YPXA 5IFPA 1H1ZA 3CMJA 1TPDA 3P84A 1XP3A 4N9BA 1AUSL 1R30A 3IJQA 3VDCA 4PZVA 3AUOA 3I4KA 4ZFMA 4GC4A 3WD3A 1SO4A 3VKDA 1SR0A 1RBLA 1W3KA 1H63A 1U5VA 1GCYA 1CGUA 2BTMA 2Z1WA 3GX9A 1S5TA 1QATA 3WDQA 2XH0A 5LHEA 1Z44A 3WUGA 3MBFA 4H7CA 2WHLA 3OVPA 4GCXA 3SGZA 4PUWA 1UR1A 4LVFA 1O66A 3BJFA 4IGSA 1TPC1 4HZ7A 1LL6A 4NNBA 2P88A 1P6BA 1QFEA 1E6XM 5L9FA 4PA8A 3A21A 3I3EA 4WEVX 4W86A 1WZKA 3LGGA 3ARUA 1O60A 1N8IA 3OGRA 1PWMA 2W66A 3MI3A 3QKZA 4IFKA 3BGGA 4BEUA 3BCDA 4E2OA 4B2DA 2GWNA 2JEQA 1R86A 4JQ2A 3A47A 3IIXA 2ZWZA 4QQUA 3E0FA 2VZVA 3TJ4A 4HHMA 2OTDA 1HFBA 3L5AA 3QLDA 4FOUA 1GQIA 3C0SA 3WH7A 1EHAA 1CGVA 3SFKA 1E6PA 4KMQA 1QPRA 1H4PA 4IF2A 7CGTA 1LQ2A 2WHKA 3OZOA 1HP4A 4WJXA 3UJ2A 3BG9A 4D8LA 4TUFA 2QPXA 3WF4A 1YDOA 1SJBA 4W8AA 3PAJA 2ALDA 6CGTA 4X9SA 4DWSD 5HNRA 1WO2A 1E6SM 1RALA 1LLOA 1XLHA 5K9DA 3P2VA 4C6QA 1C8VA 3WMSA 2PWFA 2VZOA 2WSQA 3W1RA 1BTCA 2H3BA 3NPUA 1CEOA 1NWTA 4B3KA 4DWDA 5B80A 3L65A 3C2YA 3L0KA 4NHVA 3C4UA 2O0TA 1TVPA 2HVNA 2YFNA 1GHSA 4EKJA 3QZEA 4ZXLA 4HCHA 1SZRA 1A47A 3TC7A 3DC8A 1VH7A 3B0XA 3CO4A 5U7SA 1JPIA 3WQCA 4EACA 4C6NA 3ITGA 2XH2A 5JQ9A 2PD9A 2P3EA 3GNOA 1XG3A 3DGRA 4RW5A 4ZO9A 3GYCA 4YVXA 3VX1A 3FOKA 2FHBA 2VGIA 3TQVA 2DEPA 1H62A 4UTLA 3AJ7A 1QNVA 2J74A 4QNEA 1NH6A 3GIPA 4JTHA 3ZJ6A 1UZHA 1VKFA 3CPRA 3VZZA 4QJ4B 3RLVA 4F2TA 2RH9A 1NWSA 3VOHA 3IJ6A 3M0YA 3GFZA 5KZDA 2J25A 4H8HA 4IPIA 1EA0A 4B2DD 3VOJA 1PCKA 1MEHA 2J9XA 2V2DA 3ICJA 7ENLA 1SO5A 3RCMA 4AZHA 3AICA 3RILA 4BY3A 3CAQA 4KPLA 3SCOA 4ZFCA 3QVQA 4UMAA 1KA9F 4HYWA 4Q22A 3WCZA 3ITVA 5M2FX 1T8XA 3ARRA 4M81A 1F8MA 1QPOA 1R8LA 2D2GA 1J12A 2ZRXA 3BCFA 3XIMA 1EZ2A 2QJJA 1DVJA 4YTSA 3UD6A 4PMVA 4Y9OA 3QOKA 2ZBTA 1KWKA 1W1IE 1W5OA 3EWBX 3TQPA 4ZBCA 5U4NA 1J6PA 4KEVA 4C5YA 4EWND 4IX0A 1B3XA 3C0JA 4ZENA 3RXZA 5C9ZA 3KBVA 3WLLA 1PX3A 1NDWA 1GEHA 1PZ1A 1RA0A 4WOZA 2PUZA 3AWNA 4AEOA 4IP7A 4PCTA 2QF7A 3LPGA 3UZYA 4H9TA 3MCNA 1NM9A 3BG3A 4IP5A 4ERAA 2MANA 4M82A 4DJDD 3G22A 2J7FA 1PS9A 1VHNA 3W75A 1F07A 1TTPA 2E9LA 3APGA 3IWPA 4JOMA 3O6CA 4DXXA 4DZ5A 5C9XA 2A3HA 4Q4OA 3NOEA 3A4XA 4ERGA 2QCCA 3GFXA 5IHRA 1EGZA 2ATSA 4PUJA 4NAFB 2GVYA 4YN5A 4ACZB 4RR4A 1J2BA 3MTWA 2OWXA 2CERA 5D9OA 1G7UA 4MSSA 2VD8A 2Y85A 1RZMA 4I9MA 4O1DA 2G3FA 3WDHA 2ZFAA 4Z42C 5F2LA 4HN8A 3HQ1A 4HGXA 1E70M 2XUCA 1CB7B 1VAHA 1FCUA 4L6OA 1VBGA 4UFHA 5CPLA 2HDJA 5KITA 1IE7C 1HKIA 3NNTA 4GUJA 3KE0A 4LJ3A 2IPJA 3S5ZA 3VFLA 1UR9A 1V3IA 2ZUMA 4YYFA 1EJXC 4UMCA 5I3HA 3O05A 1VYSX 3P61A 3CWHA 5I3FA 1EJSC 1XLAA 2I17A 3GTHA 5K2ZA 1RA5A 1H7RA 3PJTA 2OSXA 4K3ZA 4W9TA 4H9MA 4HA0A 2X0YA 5DX7A 2XGBA 1A3XA 2GQ3A 3TTOA 1EQPA 1KLYA 3FYYA 2GJXA 5CC7A 4HIBA 3TIMA 4HK7A 1PZ2A 3NEVA 1EO7A 3PVFA 4C7DA 1XXXA 4GISA 3OYZA 2JALA 3QGVA 4B15A 4HU4A 1XPGA 3BO9A 2A21A 1K8ZA 4GXWA 4W85A 1U1UA 3HPFA 5A5WA 4I3GA 3VPLA 2PDLA 4YIWA 1WUEA 6ALDA 1I60A 4GY0A 1B3ZA 3R12A 5JBDA 4JN6A 1FKXA 4B4HA 1J9YA 4LBRA 3WJXA 3CB8A 1V3KA 1DJWA 3QMSA 4A8IA 3EOSA 3QXBA 3P93A 1LUCB 3EAUA 3N4EA 1I1WA 1REQB 4XKYB 2E6DA 3OBAA 4FOKA 2Q3OA 1MRAA 1EYEA 2CHNA 1XLFA 2J66A 4P7OA 2DZSA 2NT0A 2OYLA 1VIZA 2GSHA 1BEUA 4DN1A 3ANYA 2V5LA 4XAZA 2D73A 5HK4A 1EOKA 5BW6A 1WQ5A 3LLDA 2NZLA 3ANUA 4S39A 1V3LA 1ZTVA 1ISVA 4FNQA 2NLYA 4Q4KA 3PFMA 3IANA 3TEVA 3W3OA 3R25A 2FB2A 3KOFA 5A8MA 4OHQA 3N04A 1LTDA 3H21A 2OO6A 2GPTA 4IUOA 4K1WA 5CQ1A 4WX2A 4ATWA 5AHLA 3PM6A 5AHEA 4FS9A 1WAUA 1SFLA 4XAYA 5BROA 2O4QA 4IX2A 1ZHAA 5HJXA 1I4NA 2IPWA 2ZE0A 4MNMA 4J40A 4W7VA 1Q2SA 3FY1A 4H83A 4FSAA 3H4XA 4MZYA 3S47A 3W2UA 1QO5A 1XLDA 3FA3A 4UQ9A 1G4PA 2J62A 1LM1A 3J7HA 2CWNA 4NRRA 1XJBA 1HO1A 3NPWA 4GI8A 3AYVA 1VBUA 4I9AA 3SB0A 1A5LC 4FNSA 1CLVA 2QCEA 4DJEC 1O4UA 3W85A 2NQZA 1TX0A 2G8ZA 2AQOA 1RQBA 5E5CA 3SR7A 1GG0A 2VTFA 2CLKA 2PU1A 1XLEA 4DM1A 2VUNA 3A13A 4M56A 3PUDA 5C0QA 1KXTA 1C8QA 3GNPA 3DN5A 1S3TC 4QROA 3TTYA 2EJ1A 4XV0A 2G3MA 2AL2A 4L6DA 3PZIA 4B3ZA 5EKYA 2YL9A 3COTA 3H26A 3HV8A 2Z7KA 2VVNA 1PWLA 3NG3A 3FGCA 3TX9A 7ODCA 3L4VA 2OSYA 4DELA 2QVHA 1GEQA 1UIPA 4Z0SA 2DUAA 5BMWA 1ME8A 1AG1O 3P0WA 4JTQA 1P0DA 1T99A 4LV9A 1F76A 1ZBWA 3AS2A 5KZEA 4A3QA 1ZAHA 2ASHA 1DIOA 4J3TA 5FJUA 2Q6ZA 3U5UA 5JVLA 1OZQA 5CGTA 4FP1A 4NQ1A 4HD5A 1C9DA 4Y8FA 4LF2A 3W23A 5C54A 7REQA 1PJ9A 2OYKA 3FDKA 2D20A 2D3LA 1XUZA 4LUSA 5I02A 1B3WA 1J0HA 1NP2A 4L9XA 3SIMA 1DJXA 1TA3A 4UXDA 1UWIA 4Q7BA 4GO8A 1GVSA 3W84A 3N3TA 2C14A 1DWJM 4HPXA 2JK2A 1KFJA 3OLIA 1DJYA 4E6MA 4ASTA 2YA0A 5C2GA 1XH0A 1K6AA 3TYZA 2NX3A 2C71A 5BXPA 4YS1A 2AKMA 4TX9A 1NFGA 4FOJA 3VOIA 2HEJA 2PDCA 4GHRA 3UEQA 2HSAA 4FMVA 2JFEX 4WHBA 3WG6A 2DV0A 5CJ5A 2D0FA 4F4RA 1W3JA 4NZ3A 3WQ5A 2QCDB 3W73A 3N9SA 4MB1A 3H7RA 4C90A 3F4VA 4RKAA 1E9YB 4I90A 4PB4A 4M51A 1G7VA 1JRCA 1RVKA 3VZYA 2OQLA 3EWDA 1L6GA 3VI2A 2X1RA 1W37A 3UY7A 5I07A 1GT8A 1O6IA 1JJKA 4ZQCA 4GUIA 4PTMA 5IRPA 3L7RA 3RMJA 5FEWA 2Y61A 4JX5A 2ZRZA 3ZR6A 1UWRA 1ZB5A 5FL1A 1AK5A 1TE6A 3G77A 2VEFA 1C7TA 4GUGA 3FAXA 1UP3A 1O5KA 2ZXQA 1UB3A 3S9ZA 4ROQA 5FEXA 2QYGA 3GHUA 1R7OA 3M0MA 5IBXC 4IJCA 4H7ZA 3AAMA 1LBFA 4GQ0A 2HV5A 1CGTA 3AU2A 1B30A 3SY5A 2QIIA 1K3UA 2P8BA 3IGXA 3VGDA 3F7JA 5EGRA 1G69A 2OYMA 3DESA 2DJLA 4GFSA 1BFNA 3NUKA 4N9EA 2AAAA 4MJ2A 2YSWA 1JYNA 2W79A 4H3DA 4WR3A 3DI0A 3LSCA 1PEZA 3RM8A 3W72A 4H9ZA 1A4MA 4CN1A 4DBEA 5FJJA 2VXNA 3PPGA 3CM4A 5D2TA 2W62A 4DIAA 5A6KA 5DFAA 4EAYA 2RAGA 1H41A 3SUUA 4G9PA 3CO8A 1JL8A 3VKKA 4TXEA 4I6VA 4ZQMA 3QSTA 4F0KA 4AX7A 1S1PA 3VIFA 4MKVA 4F0LA 4QJ3B 1WKEA 3LHYA 2VVSA 2BGNE 2OEMA 2Y2WA 1GK8A 1NAL1 1E4NA 4NXSA 4QLLA 4UFIA 3GNRA 3GWQA 1V02A 1R9YA 3PANA 3D3AA 3CHCA 5AFDA 3E9AA 5D2VA 1J0IA 3UG4A 3SFWA 4DYKA 2P76A 1XFBA 3SQLA 3H2OA 2ALRA 1BYCA 2HQAA 2XYLA 3W37A 1OCJA 1YPIA 1E1EA 5AB3A 1EPXA 4LGXA 3P14A 1VFFA 3PBWA 1SPQA 3SCVA 3A12A 4TTGA 4B5VA 2ANUA 3W25A 2XH7A 2Q01A 3VD7A 4X9YA 3ISIX 4GZ7A 2INEA 1F8IA 1QHPA 3DHDA 5M3WA 5C7VA 5KMYA 2G37A 2UBPC 2YZ5A 1GOOA 1P0BA 2QW5A 4PUDA 1JDAA 1CTNA 2FH6A 3W0KA 4REQA 4RNIA 1ZP3A 5AYBA 2PURA 1E73M 2QGYA 3L5MA 2H6RA 1TCDA 2I56A 4GX8A 4FX7A 4JNMA 3KVLA 5CAHA 4M6VA 3GUGA 1BHGA 4XAPA 3XINA 2VNCA 3K4DA 4Q8MA 4QIUA 1H5YA 3L12A 4N4PA 1G1YA 3S1XA 1U30A 2P50A 1A50A 5HMEA 3T0BA 4R9XA 5CCZA 2XG9A 2ZZ4A 3WLQA 3LGEA 3N4FA 2HVMA 2V6AA 1VBRA 2Z6JA 2ABBA 2H8XA 3K2GA 5D9PA 1R3RA 2EPKX 2WMKA 4ORMA 2PDKA 2WMIA 1JUBA 1CGWA 2Z4GA 1E71M 3OGSA 3KP0A 4DPPA 3U7BA 2J6VA 3B03A 2ZYFA 3GTXA 3DC0A 4NX0A 2XIJA 3M5ZA 1FHDA 4LUYA 4W89A 4EPEC 3R5EA 4LTSA 1KXVA 3NM3A 4S2BA 5AY7A 3LRLA 5TAOA 3EKLA 1G4EA 4IQDA 3PPFA 5AC7A 1QNRA 4KGLA 4PTVA 1UOZA 1E0XA 4GNKB 4P5UA 1FHUA 1G94A 1EX1A 2V5BA 3THDA 3M44A 4MB3A 3BAXA 1UWSA 3AHZA 1TMLA 4P8VA 3IUHA 1F74A 4L9YA 1Z3NA 1PV8A 3V5CA 3QV9A 3BURA 4K8HA 1VLWA 3W27A 3N9KA 1LBMA 3MSYA 1RSCA 3S6OA 4OU1A 3V0UA 1UKSA 4KIEA 3TTQA 2Y63A 3DYMA 2OVLA 1V6VA 3LMZA 2OKOA 4H9XA 1RP9A 4V2XA 4JTAA 1U22A 4KRZA 5CKSA 4G5DA 3VILA 3UCCA 3K4WA 5EMUA 3BG5A 3B0PA 3DZ1A 3GH5A 2A3BA 2C1HA 2XSXA 3WH9A 3I7SA 4LCQA 3GIQA 5HOSA 2OPJA 3UCDA 1GPWA 3NSNA 1TFVA 2EAWA 4RL3A 3VIIA 1XLKA 3LCFA 2FFIA 3KZSA 3M64A 1XIFA 3CL7A 1QWKA 1JGIA 5CLWA 5GJMA 4F48A 5BWFA 1F61A 4G56A 3V5OA 2VR5A 2VRJA 2VR4A 1QT1A 5DEZA 4RZ6A 1XGZA 5I3JA 1TRDA 3I4EA 1FH8A 1PZ0A 1F4AA 3LHUA 3BXWA 1KB3A 1JZ4A 3BL3A 4JEQA 1IEQA 1R85A 2VP8A 2F38A 3QOMA 1NY1A 2NV9A 3ELFA 4I7VA 1JZ2A 5DY2A 3NL2A 3WF0A 3ZR4A 2QZRA 2Q8ZA 4ATDA 3QHOA 3B8WA 1UMYA 3T0TA 3KBNA 1PX4A 4TOQA 4H04A 4IPLA 1NWUA 3W82A 2YL5A 1A3HA 1QXLA 3FLUA 2PPGA 4DY1A 3UU0A 3WFAA 2CEQA 2IMRA 4S23A 4Z2KA 1W1A1 4GQQA 2R9RA 3WJSA 3KOZA 4P2VA 1FOBA 1Z6KA 1H11A 1UIOA 3RDKA 3PTDA 1LL7A 2EG8A 1VENA 3QFEA 1BAGA 2A3AA 2PDWA 1YRRA 3W83A 1XLIA 1NP0A 1ICPA 4H6RA 4I5UA 5FL0A 3KDNA 1P7TB 4PTXA 4X2RA 1EC7A 3IVSA 3UWYA 3N12A 1K8YA 1BWVA 2XGIA 3CUGA 1OCNA 3VX0A 5LIKX 3WDIA 3MMUA 2QCNA 1EP1A 4E0CA 2WJDA 3RF9A 3BE7A 1UMLA 3C56A 1XINA 2CLEA 1RP8A 3E12A 1RQEA 4I5XA 2JKPA 1UR0A 2Z26A 1MEIA 3WLJA 3WSUA 1D8CA 3QW4B 4RXFA 3PBYA 2YCEA 3ENLA 2Y70A 3N9RA 6REQA 4DWSC 4UOQA 4L5ZA 3RX2A 3MZNA 1DQUA 2PTDA 4WJ8A 1NQKA 4HPNA 2XVLA 4MYXA 1DPMA 4UMBA 4B9YA 4JQ4A 3N18A 1JF6A 3E5PA 3BGAA 3USBA 4RZ5A 1LOLA 3F2CA 3GE7A 4LYQA 3QKEA 1BVWA 3IPWA 4S3CA 1OY0A 4OJYA 3SY1A 3W7IA 2FTYA 2FDMA 4M3PA 3MV11 1YYAA 2X1SA 4KWUA 1BF2A 3BMXA 3H6OA 1SMAA 1IQ8A 5E6ZA 3W71A 1B0IA 4E4UA 3H23A 1V0NA 3OLDA 3QZ6A 3B9AA 3M7SA 1ITQA 2DVUA 3GDRA 1FCBA 1UR8A 3DG6A 3H4WA 2FB3A 4R9OA 2NSOA 3RN6A 3NSMA 1P48A 5CLTA 5G4WA 2QHAA 4D6IA 3W7PA 5FCZA 4TO8A 4MZ8A 4XD6A 3A3WA 4C1NB 2HXTA 1EIBA 3Q58A 4MAZA 2BBFA 2XVPA 1D3CA 2Z1BA 4L56A 3AISA 2REQB 1LF1A 3EMQA 2PGFA 3TDFA 4AWUA 4Q7IA 1S2WA 4D6EA 5XIMA 1TZZA 4PUEA 2WVSA 3CL8A 5EFFA 4NSBA 4ZQRA 4PR4A 4JN8A 1UROA 3G1FA 5DCDA 4MWAE 1KBBA 3UJFA 3CYJA 6A3HA 1LZOA 2I5IA 3U57A 4UFJA 5DBTA 3SUWA 4CCDA 1YW1A 3VE7A 3U4AA 4M1BA 1I1XA 3BZGA 3VFCA 1TWSA 4UTWC 3W2MA 1ALDA 2O92A 2YCIX 4GYFA 2A3EA 1NTHA 3AALA 4NP7A 3PUEA 2DT1A 1BQGA 2DIJA 1HKVA 2YDAA 1JNEA 4ZXOA 4MY8A 1W0MA 2J7BA 4LF1A 4M80A 4GINA 4LS2A 1ZJBA 5C71A 4UOZA 1WDDA 3WLHA 4RE3A 3LHZA 5AHMA 1B90A 1U83A 4HB7A 2VEIA 1W54A 4U33A 4LSBA 4ZMGA 2PBOA 3ARTA 1Q8JA 3TOPA 2VGFA 5CPTA 3MI6A 2WZIA 3FKKA 4AQLA 2HCVA 3ZLHA 4PBFA 3AXMA 3NPVA 4GQGA 1XLMA 3U48A 1HL8A 3ALFA 2GOUA 1XISA 3LCWA 5LA2A 2QF8A 1OFBA 5F2MA 4O1FA 3G1RA 4KRTA 5FJTA 2CWXA 4IFKB 3R4IA 1UOKA 4L61A 7TIMA 2Q09A 2Y8UA 3UWWA 5I3GA 1TIWA 3S5SA 2O9RA 1FWRA 4GIRA 1KLZA 4IMFA 1EWEA 4N02A 4IM4A 3PK7A 2WNQA 3TJXA 2CZVA 3WUEA 2XPKA 1KKOA 3ZSTA 5LNWA 4AWTA 1H7WA 5K7JA 4PUKA 2V3EA 3GDLA 1T6MA 1IR2A 5DMMA 2OU4A 4MM1A 1F3TA 2QCGA 4H9VA 1BVNP 3AC0A 3CPGA 4KESA 2ZZ2A 3DOPA 3CK5A 4UR7A 2DORA 3OB8A 5EBUA 3QJAA 4X60A 2XSBA 4C6KA 1ZCCA 2CBIA 1D9EA 1H61A 3JW7A 4OFCA 6TIMA 2VDGA 3KOXA 5TQLA 3WF1A 3O06A 5EMMA 3WLSA 3POCA 4LU0A 5D4YA 5LA0A 4UZUA 4PMNA 2FHCA 3LBOA 5G4HC 5EMYA 4LV4A 3T1GA 3DH7A 4PCSA 3ES7A 1OADA 4BF9A 3VVGA 1PIIA 4X0NA 5ABEA 1QW8A 2C6QA 3MVTA 4US5D 1LT8A 2PLJA 3NZGA 4YHGA 3UWVA 2DIKA 3A9IA 1EA9C 2Y6ZA 2YDQA 3ARYA 3LENA 4JQ3A 2E3ZA 2QV4A 3UA4A 1SR9A 3GR8A 3OP2A 3V5FA 3WQ8A 1U5HA 1TV3A 1XWYA 4ILSA 1B2YA 4ZO7A 2A3CA 3LN3A 1XH1A 4FK9A 1XCXA 1O1HA 3T2PA 3HFYA 2YZRA 3QBUA 3O1NA 3CTTA 1CXIA 2ISDA 4NJGA 2HPMA 3HGSA 4YNGA 5GJNA 2I16A 5IFTA 1JDDA 1DIDA 1MW2A 4IHCA 2GZXA 3P80A 3E38A 3CUIA 4AU0A 2YXGA 1X1NA 1IT7A 1IZCA 3B06A 3PPHA 1QI5A 2RDXA 4JIQA 1TX2A 2WJZA 4DJFA 2VHLA 1NELA 4NJIA 2X8RA 3PUGA 3P74A 4CEXC 4EIVA 3B4YA 1PCWA 4AAJA 3P7YA 1HJUA 3IIOA 1V0MA 5EY5A 1FWTA 1ZUAX 3ZQ9A 2CPUA 3KCOA 3ZVHA 1RPKA 5T91A 5G2IA 4D1JA 2VJXA 2FJUB 1F3WA 3BJTA 5D37A 3R94A 5D09A 3JS3A 4BEQA 1H7XA 1O5XA 4AZIA 3VUPA 5EPDA 1I2PA 1G4SA 3BOLA 4J2MA 2YW4A 3ME3A 5M5DA 4S2CA 2Z00A 1Y5VA 5CPQA 1J10A 3RMEA 1YE6A 2G41A 3QHMA 2BG5A 2QCHA 4WY0A 2FH8A 3BLLA 1GQNA 2DW7A 3E0LA 3T8LA 3KM8A 1EYWA 3U2ZA 5HDRA 3EB4A 5E09A 1JYVA 1A3WA 2Z2UA 1IWPA 3M6DA 1R2RA 3EX3A 1OT1A 4ICNA 4OZOA 3S0CA 2W27A 2Z7GA 3T55A 4QRNA 3LEPA 2ZC1A 2PD5A 4HA4A 1UR4A 3ORWA 9XIMA 4A8NA 4UNIA 3A22A 2W92A 3S5NA 4JX6A 2FGZA 1AH0A 5A6MA 3CL6A 2VC5A 2IKHA 3R79A 3VO0A 3P5ZA 3N17A 5DXYA 4C6BA 1MNSA 2FTWA 3CBWA 1H0GA 1E4MM 1FDYA 5CXPA 3OBKA 5DO8A 4K36A 5JXQA 2G4FA 4HZMA 3T07A 1HX0A 4A3UA 3KWXA 1MVYA 4NKCA 2VT0A 4S3KA 4IQEA 3VA8A 2V9DA 3H2AA 3LZ5A 3E0IA 4KWWA 4RDZA 3UZXA 1Q4NX 3R0UA 3U0HA 4LEQA 1Z42A 3MCMA 2VUYA 2IQTA 4DUOA 3CAKA 2WAGA 4RE4A 3V16A 4E8GA 3KHDA 1UKOA 3VNKA 3PZQA 4DVOA 3Q94A 1UJPA 4K7VA 4CNOA 1TE1A 1SW7A 2BLEA 3DFPA 1ZBVA 2OGJA 4DLFA 4BI5A 2PF0A 1PVNA 2IS7A 3M9YA 1GW1A 4LFYA 3A4JA 1F3EA 1E40A 3M1ZA 3C8NA 2DSVA 2GJXB 1WZMA 1EIXA 4MWAD 1FVPA 4R27A 3IEBA 2DZWA 3EWXA 1TZ9A 2WCAA 1ODZA 4HMCA 3VIOA 3T42A 1XBZA 2HISA 3SEPA 2YGYA 3W6YA 3STFA 3AI0A 3GFYA 5E9XA 1W17A 4TIMA 1W1PA 1RLCL 4HNNA 4XZ9A 3WIJA 3SIZA 3C2RA 3LTYA 2X2GA 4OVXA 3DFNA 1CXLA 1YDNA 4M7SA 3SUVA 4FNPA 4QEHA 4XZBA 1K7EA 4LVBA 4QLKA 1AZ2A 2V82A 1CXKA 2ZZ5A 3EA1A 4BQ3A 2ZUUA 3W02A 3B9OA 4AZ5A 3OHMB 3MUCA 2G3NA 2V67A 1UKPA 5JIWA 3QHNA 5HR7A 2BXVA 4UTFA 3B05A 1BYAA 1J18A 3N6HA 4G2DA 3VGBA 1W5MA 1EUNA 1DE6A 3GR4A 2VEMA 1QO2A 5FF0A 3G2GA 4NVTA 1GWJA 1G5AA 1B1YA 5EFDA 4A22A 3OIXA 5ABTA 3N34A 8A3HA 1XIHA 3SZ8A 3TN4A 4GRSA 5TD4A 3R58A 3C6CA 3E2RA 4ROPA 3TJLA 1VQTA 1GVIA 4GVHA 1V93A 3W1TA 4B5TA 3NAVA 2O9PA 2PCQA 3GO2A 3MVIA 3MS8A 3QYSA 3GC5A 3CZLA 1E0VA 3C8FA 2QQ6A 3L4XA 1V6XA 3VCRA 4HCDA 4HPJA 1WE5A 3PBMA 1YTEA 4FPSA 4NZ1A 3QGKC 5FIPA 3QTPA 4DB7A 2WSKA 3TOYA 2PCEA 1F4HA 2RGLA 5EA9A 1R3TA 2PRMA 1B9ZA 2C19A 4NXKA 3ZT7A 1YPFA 2DPEA 2ZZ7A 5BOFA 1XG4A 5I24A 4XTIA 4UTIA 5ECVA 3NTYA 4I9JA 1UWUA 3BAWA 1KXQA 4D6GA 1XSJA 2G50A 1MYRA 3D46A 3WJWA 2OLHA 3MKKA 1EGMA 2Y62A 2WC3A 3VUSA 1KCKA 3LLXA 3OVRA 5BRBA 4U2YA 1UD4A 2HNEA 3TA9A 3VNJA 5BXRA 3TLLA 3PWIA 1DYSA 3S1VA 1MXGA 4CUCA 2A7RA 2AL2B 2PGWA 1EHNA 4HNCA 1DJGA 1AQHA 2D0GA 3FS2A 4Y6GA 3EB2A 1J8VA 2QPSA 3FGCB 5C2CA 1J4EA 3CUHA 3E02A 1XH2A 3V75A 1L2QA 3QPYA 1M6JA 1J0JA 1YNYA 3ZOAA 3VIJA 4H9YA 5BCAA 3SCRA 3H12A 2R94A 2CXEA 2CITA 3MUXA 2POZA 3C3UA 2FDSA 1VFMA 3PJUA 3UJEA 4ZOCA 4GXMA 2QCMA 2FPTA 4IOTA 4AD3A 4EVZA 3F2DA 3ITOA 1GG1A 3NZQA 4IJRA 4A8RA 4MKNA 1H2JA 3LNPA 1I75A 4HNVA 3AIWA 3WBXA 7REQB 1IWBA 1LWIA 2TODA 3BW2A 3GNNA 2R24A 4FALA 4LUSB 3KS6A 1XYCA 1BGAA 5FACA 3B9EA 4GJ1A 4A3YA 4DJEA 1TA3B 1DKWA 2JF7A 3KCJA 4WIWA 3TNOA 1WBJA 2DVTA 1R46A 4M6PA 1KGWA 3TQKA 2EKCA 3FHQA 1MW3A 4FX8A 4BS0A 1L8NA 3L4YA 2E6FA 4DO6A 4QP0A 1Q65A 2XWDA 1ONEA 1RCQA 2J79A 3HTWA 1RD6A 5DMNA 3LPFA 2YCKX 4PMUA 4AZ7A 1CZ1A 1NOWA 2GWGA 1ICQA 3DFQA 4WDWA 4J27A 2F6UA 4C1LA 3OZYA 3H2FA 4H8NA 3W7QA 2P10A 3GU2A 3MJMA 3R13A 4F9DA 3NQCA 3CT7A 1TR1A 3A64A 3LS9A 2PC8A 3E96A 1YHTA 4QJ5B 2BOFX 4ZCWA 3U2EA 1K4HA 1SSGA 2UY2A 2O7SA 1QPKA 2JF6A 3M5VA 4GIEA 1WXYA 3M0JA 2Y4SA 3S1WA 4PE8A 1TQXA 2H8ZA 2V3DA 3THAA 1TUFA 3GTFA 2PLMA 2R1PA 3K5XA 3FEMA 1TMQA 1XCFA 3CC1A 4GZJA 4HPHA 1PKMA 2ZRUA 1GQLA 1VFOA 1XYAA 2P1FA 2VWSA 2CBVA 4C7FA 3UBPC 1XRTA 1QK2A 4WVXA 1PDZA 4ATLA 4OTKA 3W87A 4PCFA 4GLEA 5BZAA 2XM2A 2QDHA 3PTKA 3NO5A 3VDGA 1YTDA 2ZUTA 3WZ0E 3TN3A 4WSJA 4L4LA 3ABXA 1M01A 2XFFA 3ABZA 3Q4DA 1G0CA 3BAYA 1CW2A 3F5LA 3T0AA 3EX4A 1C92A 2BS9A 4QBXA 4AUBA 1EKOA 3WY1A 4R7OA 1XX1A 3WK2A 2I57A 3TV8A 3UWQA 1A5KC 4V28A 3HG5A 4H8UA 1XIGA 4O1BA 4N4QA 3SCPA 3HPSA 3P8IA 3OTRA 4MHBA 4UQDA 2RDUA 1OABA 2V3GA 2WNWA 1FY6A 2XSAA 4HYVA 4Q8WA 1RLDA 3E2QA 3QR3A 4KCTA 2WW5A 1K02A 2PF8A 4ZA0A 3LCXA 1OG6A 4JFSA 1UASA 4C65A 4FNRA 4CQCA 2TRSA 3AO0A 5CSSA 1ISYA 4ADUA 4UQEA 2E5BA 9CGTA 3GH4A 1SVDA 4PMZA 1SGJA 5FSEC 2DVXA 3B40A 3FCPA 5GNYA 1ZALA 3KDOA 4WKHA 4B91A 1S3HA 3AYSA 4C6OA 1CGXA 3GVWA 3TZFA 4Y9AA 2O55A 4AZCA 3FYOA 2OWCA 3NQEA 1BYDA 4NG3A 3LV6A 2C79A 5IBXA 3WMLA 3T0CA 4OGZA 3K30A 4TU1A 1DP0A 1VPXA 2J9ZA 2V69A 4JR5A 2CLPA 1RK6A 3M0VA 2F9RA 1P0EA 2ZUSA 2OZ0A 1EF3A 4MPKA 1V7YA 1V6WA 4N6FA 4ZE4A 3SJNA 4M7TA 4A2SA 4RDWA 2PFHA 2DZVA 2CBUA 4QLJA 1FWNA 3T81A 1GOKA 4O4VA 2BHYA 1R3WA 2WWDA 3TMLA 1RR2A 3ABOA 1ESWA 1O94A 1AL7A 1XIBA 1T40A 1QCWA 3INPA 4IIDA 1CT5A 4QG6A 3VD9A 3NA8A 4REQB 4RX0A 1ZJIA 2CC0A 4P7NA 5J5RA 1OGSA 1WV2A 3FJ4A 2PWHA 4FLSA 1QPQA 3ES8A 3PY2A 3KL5A 5D8ZA 3NPXA 4HSOA 4W7WA 3CT2A 1TWDA 4EP8C 1HKWA 3VKBA 1Q6RA 3F4WA 1U33A 3G1SA 1VFTA 4HZ8A 3AZSA 3GZAA 5LIXX 2W5FA 1GOWA 3ABQA 4Q6XA 4AD2A 3PN8A 1EPVA 2WMIB 3CUJA 4D1IA 3VOFA 1AFSA 3G1HA 3W86A 2J4GA 3MO4A 3REQA 2F6KA 2PWUA 5HWJA 4GBUA 3CLWA 1R3VA 1J96A 1EDQA 1MEWA 2UY3A 3ECQA 2GGJA 3DCPA 3DI1A 5GJPA 3STEA 3AROA 5LZLA 3BW4A 4ZE5A 3W70A 4UOJA 1CI1A 4FIRA 3UGVA 3BGJA 3GQYA 3S1GA 2BY1A 1HF6A 2XISA 2DUZA 3B0UX 1TPUA 2I9EA 3CTLA 3M5XA 2J75A 1RBOB 3N73A 3MA8A 3TAKA 1XC6A 1VCFA 2GJLA 4UTMA 3ARWA 3HZ3A 5C9UA 2XIBA 3EBVA 3QSRA 4JIRA 1DJNA 3DXIA 4UNKA 1VP5A 3S2LA 3SJ3A 5HJLA 4LW7A 2E1DA 4K39A 3FXYA 3EWYA 4D6FA 1JD9A 4LAMA 4GE8A 1RJQA 4N9DA 4HMNA 3GW0A 4TV5A 3UVIA 3U4FA 1VBHA 1DWHM 4ORIA 4BQ5A 1M03A 3ONCA 2ZOXA 3DG3A 3PZ9A 1M7PA 1HTIA 3G1XA 1OF8A 2V2HA 2J6XA 1EC8A 1KTBA 3VD4A 5LYRA 2VFFA 4UZSA 5CAKA 3CB3A 3TYBA 4BZYA 5I09A 5DN1A 2PC4A 1J5SA 4Y90A 1KM2A 4O28A 3OZMA 3VE9A 5AVNA 4JEJA 4LVAA 1M04A 4BCEA 4BK9A 4XUGA 5AECA 3NQAA 4XG1A 1KGXA 3WF3A 1WOAA 4JKKA 2WVVA 2PEVA 2YXOA 3PZMA 2BSLA 3QC3A 3ZT5A 3NQBA 1FWFC 3VAVA 2X1UA 3QLLA 1O1ZA 4W8LA 5CG0A 1RY0A 1JRBA 4R7JA 1LDCA 3BQ5A 4ZGYA 1WAWA 1KFLA 4OT7A 1CECA 3VDAA 4JFVA 1XFCA 3GIYA 4E2VA 3M43A 3W07A 3IS4A 1Q66A 2GL5A 1UKTA 2W61A 5FAGA 1K9FA 3OHIA 5CSRA 4AX6A 3NYZA 4Y7EA 2V5KA 2F61A 3QYQA 1S39A 3I6TA 4LXFA 2VFDA 3LPOA 3W7EA 3W24A 4O1EA 1MDRA 2IQ0A 2ZE3A 4S3BA 1KFCA 5GPRA 4RNHA 5HPCA 1B9BA 2D2OA 3CUZA 4H6KA 2FZBA 5DT7A 2F8QA 2VMFA 3VKJA 3OVGA 3EEZA 4LANA 5CEWA 3TCEA 2HWGA 3T2QA 4D6DA 4D71A 1SMDA 1WDRA 4LOCA 3TKFA 1FFQA 1RH9A 4LCSA 2ZRWA 1ITXA 4LRTA 1T41A 3LHVA 2D24A 3GSMA 1FHVA 3WF2A 2X40A 3NQDA 1W3IA 3DBPA 4N7QA 4V27A 1AJZA 1X97A 3MPGA 1W1YA 3ZIZA 1X7FA 4L1GA 1LG1A 4O54A 3NO1A 3WQ6A 1X96A 1B54A 1VEOA 2YYTA 4JTSA 4CU7A 4O8AA 2GVEA 3GVVA 4GA8A 4GOAA 2EPHA 4CCZA 1JCNA 2YYUA 2ATMA 4C7GA 4CCEA 2QGHA 2Z1XA 5ECUA 4MAVA 6REQB 1ME7A 1ZFJA 4HNTA 1G9HA 2GJRA 2IPGA 1EF2A 1YEYA 4IFOA 1R38A 2D69A 3FJ6A 1K77A 2HJPA 1U2YA 3ZVIA 4GY7A 4C6IA 3SCTA 1MW1A 2VENA 3DAQA 1ZCOA 3PUOA 2VC7A 3V36A 2C7FA 2R1LA 2XVKA 1PKLA 2VEGA 4XVEA 4UFLA 3IVTA 4TVDA 4MMWA 4IMDA 3CV1A 5AC6A 2Y88A 3W7HA 4F0HA 2XH4A 3VNDA 4KEMA 1OIMA 2Y7GA 1HVQA 3RR4A 2Y5EA 2FJKA 2QDGA 3THCA 3IK2A 1HKJA 1GJPA 1RJPA 1TWZA 2OSWA 4DRSA 2VX7A 2EBNA 1X8FA 2YBTA 4HHLA 4Z2JA 1RVGA 4K6AA 1VRXA 3QQ1A 3BCJA 3V1PA 1OFEA 1OEPA 1MQQA 4E5TA 5E6YA 3STGA 1R9XA 3NOYA 3SSZA 5ABHA 2ZZ6A 5GQBA 3MUY1 4LVDA 2DT2A 3ERPA 4Z0JA 2PA6A 1KM5A 1PHWA 4F2BA 2GSJA 1PYFA 1K6WA 3HPZA 4D8ZA 1PTGA 3T44A 4QE5A 3O6AA 3LI1A 1EEXA 1V0KA 1TRIA 3MI2A 1SZGA 4FAMA 4A21A 4FA3A 1XIEA 1G6CA 3BICA 3ZYZA 3GXNA 4B16A 2X0SA 1LROA 5JIPA 3B3DA 5CC5A 4PYSA 3WJYA 2KZHA 4DWSA 5H2ZA 3S3GA 4QSHA 3W76A 4Q8PA 3G0XA 2ICSA 1T96A 1C8YA 3ABRA 1A5UA 4LAZA 4X61A 4KFPA 3GG8A 3NR0A 3MT1A 1S2AA 3N2XA 3KX6A 4LC6A 2WK2A 3WJZA 1CLKA 1OCQA 2V81A 1KQYA 2ACUA 2P5NA 3S1UA 3W26A 1TVLA 2BY2A 4XZWA 3KZPA 3UR7A 1YDVA 5HUOA 4PCNA 3W2NA 2BY0A 2CFFA 4AYSA 1V6YA 1DIKA 4H6QA 1EXPA 1Z69A 3R0KA 5AC4A 1HKMA 2IKIA 3TWBA 5IHSA 4C60A 1FWDC 4QS5A 4Y2WA 6XIMA 4W7UA 1TTJA 1BYBA 1JPMA 3P5YA 5M03A 2VZUA 2X30A 4PODA 3H2CA 1Q6CA 4OBTA 5HWNA 2OWWA 2QULA 1BWKA 2WMJA 3TVAA 1O5QA 3WBEA 1PZ3A 2E77A 4JXCA 5A2CA 3CEUA 2YB1A 3LQGA 3TNBA 2A6NA 4H6EA 3VMNA 3QPZA 2AQWA 5I00A 3KAOA 3BAKA 3LY0A 5FEZA 2E67A 3AYRA 4XZHA 1QPNA 3MANA 4CNTA 1IEWA 1NJJA 5E70A 1FX6A 2ZX9A 4W84A 4DNMA 1XM3A 4GC3A 3R10A 1M7OA 2VX5A 3LHTA 2J8FA 4JKMA 1ZSXA 2X1IA 3PZTA 4GGHA 3UWEA 4Z1AA 4UTWA 3E1F1 2Z6IA 1GW9A 1GGOA 2GVJA 3GDMA 5FESA 2X09A 1E55A 3CV7A 2OLSA 4FZIA 1Z9AA 1ADSA 5T9BG 3I6EA 4UFKA 4WJEA 1D3GA 1S1RA 3L21A 1KXHA 4OWGA 4JZ5A 5DANA 1ZGDA 4XD3A 3T6CA 4A8LA 2GQ9A 4LAUA 4MG4A 2OEKA 3WEOA 1B31A 5A2AA 3CXOA 3MUIA 1M9HA 2RJHA 3R7MA 1I8JA 1NF0A 5BU6A 3GM8A 4FR6A 3AHTA 2W3ZA 2PTXA 4MWAC 4DJDA 4W87A 3WLNA 1KM0A 3F5KA 1UZ1A 4JFUA 4Z1BA 1PTAA 3TA6A 3VK5A 2R91A 3OG3A 3HJZA 5HINA 3B8DA 2PWEA 3GYEA 3KOYA 3ZO9A 2EPMX 2DZAA 4AWEA 1ME9A 4G8TA 4NNAA 3ITLA 2XTKA 4WDUA 4JCLA 3GKAA 4PB5A 3EX1A 5G4EA 1KFWA 1E9ZB 4UR9A 2WO5A 4L1XA 5FJPA 2Q71A 1W2PA 1FXQA 1OYAA 4BFAA 3PP7A 3G0SA 4YTRA 4Q8OA 1KNWA 4IXHA 2DU2A 5C2XA 4NZ4A 2DZPA 3LYEA 4EPDC 5D02A 2XVGA 4P61A 2BMBA 1TV5A 3RNDA 2J7DA 4XSMA 4DNHA 1C29A 4M29A 2XIQA 4IISA 4S1FA 4X3ZA 5CJMA 3M16A 2CKSA 3AS1A 3HG2A 3CWOX 3IUIA 4DUWA 3AIRA 3HMCA 1R9ZA 4NASA 5DCBA 1QI2A 3SCUA 1SFSA 1L0PA 4IT1A 1KO0A 4GH1A 1EH9A 5A6TC 3A4AA 5HXMA 1NQ6A 3UESA 4S38A 3B8UA 4F79A 3OA5A 1BWLA 1X1OA 4Z1DA 1BTMA 1XKYA 1TR9A 1YADA 2ZX5A 4GYJA 1X6UA 3URBA 3FIGA 1KR0A 3L4UA 3N29A 5AOUA 3G1VA 5LKYA 1JZ5A 1JZ3A 1TPWA 1EBHA 3QY6A 3ZVHB 1YBQA 1WBHA 5FSDC 1IEXA 1UWAA 4K8EA 1ITCA 1YDYA 4AIOA 4LY4A 1EBGA 2WCSA 3MJYA 2HS8A 1AH3A 2WQPA 3M0KA 4MKSA 5HANA 3VNYA 4A35A 4O52A 2PDGA 4Q8QA 1FDZA 3LI0A 3Q67A 4WY0B 3TH6A 4DUVA 2V30A 1AQFA 1GVFA 1BXCA 1H7PA 1B5TA 5DELA 3TTSA 1GJUA 1AVAA 1XLLA 4G1NA 2G96A 4IMGA 3V35A 2YXXA 3VM5A 3MO7A 3P3BA 4AD5A 3HGRA 5FA5A 1ML1A 1U1JA 4QE1A 3BLDA 4PMJA 2WLYA 2Z1VA 5FEPA 2AAMA 4UR8A 4XIMA 2PDHA 4UTKA 4MVAA 1E56A 1RHCA 3CIWA 4IXXA 3AS0A 2NQJA 3T78A 4PSPA 1UYQA 4GIAA 2ZDRA 3LM7A 1OG0A 3M41A 1E1FA 1CXHA 1GOXA 2L5HA 1J79A 4KQNA 3AU6A 2P0IA 4BQ4A 4EOUA 3A4WA 1JPDX 1U1HA 3EWUA 4I9TA 5BRPA 4KRUA 4IMEA 3NZRA 4HNUA 1XKJA 3N19B 2PLKA 2WSPA 2ZZ3A 4J4KA 3IGSA 2J7HA 2VD9A 1Q5MA 4O15A 4AXNA 3MZ2A 4O12A 3UA3A 1Q2RA 2JEPA 4OECA 5A1AA 1W8GA 2YB4A 2NXHA 2CLLA 2QIWA 3PNUA 3PSWA 2XZ7A 2HRWA 2QCDA 3ZT6A 4LQ1A 1UA7A 2YDSA 1JXJA 4IWWA 5TF0A 4ZZ9A 1EJTC 2NQLA 4BR1A 4Z2IA 2AKZA 1UR2A 1O68A 4ZSTA 5BRQA 4ZQPA 3WQFA 5IXEA 1JI1A 3HOJA 1ZP4A 4YWIA 4GMEA 3KTCA 3DBNA 3OOQA 4EK7A 1W9VA 3GS6A 4Q32A 4U3AA 4CVWA 1KFEA 1MFVA 4CQ8A 2IW0A 1EOMA 1KTCA 3NQ8A 4JFTA 1V03A 3WNLA 1Y0EA 1KM1A 1OGBA 3W7NA 1I45A 3LUTA 1YQ2A 3BZJA 4DO5A 2IXVA 4X63A 3T9PA 2PMQA 2BV9A 3BV4A 1QUMA 1FKWA 2R14A 5A6BD 1ZL1A 4PULA 4C1KA 3UFYA 2C8NA 3NQMA 2G3JA 1YE4A 1RJRA 3EGJA 1OK4A 4W4QA 3MMWA 4O57A 1V3MA 1XBYA 1X6LA 2VO5A 3H54A 4GQBA 1E5NA 1JCLA 3VXGA 1VIWA 5DY3A 3TSMA 3PS7A 3Q2DA 1AH4A 3DFYA 2WHMA 2WZTA 4XZMX 1O95A 2J77A 2XU2A 4OIFA 1OINA 1J2WA 2WVUA 1ZENA 4W93A 1JZ7A 2BZNA 4GNVA 2JGQA 3GXDA 5K4ZA 4HU3A 2R1NA 4LS0A 2R1KA 1KBIA 1FWHC 1GTHA 4PGLA 3VIKA 1AODA 4JTJA 2WXDM 3C3NA 4G7EA 1UD6A 4JYEA 4Q8VA 3FDGA 3A5VA 1OYCA 2ACQA 3LCHA 3VOGA 1F6KA 1FDJA 2HTMA 3KVKA 1A5NC 2ZKMX 3D5HA 5F1VA 3VYLA 4HK5A 2PP0A 3MMDA 1BRLA 1DTUA 1U5JA 2EKGA 4JHZA 5T8GA 3NJ3A 5H8UA 2INZA 2YL8A 4BF7A 1ENUA 3PWGA 3MQTA 2ZA2A 3TR9A 4MNLA 1JUEA 3QM3A 4W88A 4RXGA 5JMUA 3GUWA 4CGTA 1IEIA 3C52A 2UWFA 3POHA 2PDNA 4O14A 1QK0A 2ZRYA 1DXEA 3GXTA 1VF8A 1OWQA 2DQWA 2IKJA 2OZ8A 4DX3A 1UJQA 2Y7DA 3WMBA 1KKRA 3TFCA 3TYDA 1DXIA 2HROA 1PXGA 1QW7A 2OOGA 1GZJA 1EZWA 5D2WA 3W1AA 1IXNA 3C0QA 3V0SA 1XDMA 3EZ4A 3FVMA 4H7VA 4XIAA 4D72A 3KP1A 4C91A 4Z2GA 2BHUA 5M1TA 3FA4A 1FWGC 3I3DA 5BU9A 4AD1A 1TSIA 3N6QA 1EEPA 2E5DA 1AD4A 1DE5A 1E15A 2E0PA 4H9UA 3OIHA 2EXOA 3DERA 4NAEA 3WLKX 4PEKA 1ZLPA 3D6NA 4N2YA 3N4AA 4K8GA 4AFYA 1CGYA 1RY8A 4DI8A 4LYRA 1PKYA 4CD7A 3R11A 2OQYA 2PWGA 3IGUA 3HB9A 3GU9A 4DI9A 1LP6A 1L6WA 1P6CA 3EDKA 1EC9A 1O12A 4HU0A 2PDMA 1CPUA 4ZQOA 2ZX8A 5FD0A 2TPSA 4MF4A 8TIMA 3NXFA 3PBGA 3HO8A 2JIEA 4QDPA 4HK6A 1PIGA 3MUZ1 4TX6A 2OOFA 2GGIA 4HOXA 3P0XA 1F9CA 3PPCA 2QDDA 4GACA 4JQAA 4KFNA 2WB5A 1NOUA 1L6FA 5BYWA 4UWMA 3L67A 3GDKA 4JDYA 5FOOA 3L9CA 3R6IA 3KRZA 4PMQA 2VZTA 4XZNX 4QEEA 4XBKA 5F1UA 4BI6A 1L2UA 4OKDA 1BF6A 4LCRA 5E93A 1JQXA 4DHGA 5BMXA 3WDJA 3RLUA 4GKTA 4AIEA 3PJXA 5FF3A 2PODA 3ITYA 5GNXA 3N11A 1YIXA 3IIZA 3RU6A 1BKSA 3UG3A 2DUXA 3ARXA 3LGDA 4ZOBA 1IEVA 2CZFA 5BWAA 4GABA 3MC5A 3TJIA 3BLOA 4R34A 3RPMA 2R82A 1CB2A 1EQCA 5CZ0A 1IGSA 1VZWA 1XBXA 3AS3A 4O1AA 1OCBA 4AD0A 3PC0A 2NX1A 1ADOA 1FUYA 3N2OA 3AXIA 3IV3A 3KRSA 2OR2A 1E4IA 3VGHA 4MUPA 3TQ0A 4AY7A 4DYJA 1I2RA 2FVLA 2VDHA 5ABGA 4F3HA 3S83A 4RCXA 1D7KA 3QRHA 1HUVA 2QCFA 5DBUA 2E6AA 4XISA 3NGFA 5F4XA 1WXZA 4O8RA 1B4KA 2ZXDA 3CGTA 2XFWA 2CW6A 2PDYA 3Q45A 4H2CA 1XLJA 3AMDA 1B3OA 2FLIA 1ISXA 4MUZA 3C2OA 4IQLA 4ERIA 4OOZA 2AMGA 3O6DA 4LYKA 5AYZA 2E8ZA 2YCJA 4HNLA 1KM3A 4GG9A 4AVFA 1QI4A 1Q85A 2GUUA 1BVZA 1ODUA 4I7UA 4F0MA 1E1CA 2DSWA 2FPVA 3SCNA 4D8AA 3KRUA 3TUUA 3C2VA 2R8WA 1Q6FA 2PRHA 4DAFA 4YCPA 1Z32X 3NDYA 3TCSA 3CZ8A 3HV9A 4V1XA 5CJNA 3W7DA 4H4IA 3NQ7A 5CC6A 4LRSA 3HF3A 3F4CA 1K70A 4BQ2A 3W9ZA 3Q65A 3HQPA 1K8XA 3W38A 5A8OA 2BODX 3PZUA 2Z1KA 3H7VA 1R3QA 1XRVA 4CCCA 3MDUA 1MO0A 2XN1A 3RRXA 2EO7A 3T4CA 3AJXA 2NT1A 3M0HA 2Q8LA 3BLEA 1UP0A 5D8WA 3G6MA 4KWOA 2A6LA 3P62A 5I77A 1LWJA 3NQFA 1FH9A 1DWFM 5EYWA 3KS5A 4Z2HA 3URQA 4HA1A 2W67A 2VFIA 1C91A 2B7PA 2WV8A 3VDHA 5CBBA 3MHUA 4N0RA 4E3TA 3HPXA 4HHPA 3VC6A 1H1NA 4PC8A 4HSNA 5PTDA 4AW7A 3G18A 3LZ3A 4J3ZA 3GHSA 4WD0A 3F03K 4MYAA 1E3ZA 1H49A 4J1OA 2EPOA 1ZY9A 4YTQA 4JDBA 3KBSA 2VRKA 1KRAC 1BGGA 1K8CA 3SY8A 5AZ1A 4Q4MA 1VS1A 4YYCA 4LPCA 2DZTA 4AZCB 1QI3A 1V6UA 2ZCGA 5A8NA 1KR1A 3L0NA 3MSGA 3WMCA 1DJHA 1V5XA 4TMBA 1TPH1 4EXAA 1FQ0A 5AYYA 5G1MA 3CNYA 3HN3A 1OF6A 4R5EA 2WBKA 3AIVA 1I0DA 2J78A 1V8EA 3FEQA 4CU6A 2PDUA 3HQOA 3KWSA 1HW6A 3W1MA 1RBAA 3OODA 2FGBA 3BC9A 1XC4A 4X22A 1S5MA 4GPNA 2ZC8A 1SJAA 1DTNA 1R7AA 2NV1A 4IQJA 4KIRA 3TE9A 5LA1A 2VGGA 1H5VA 3CZJA 1ADDA 4J28A 3HG3A 1W32A 2GUYA 5K9XA 5T9CE 5I5RA 3UNTA 8CGTA 1JCXA 2BVYA 1H51A 4FXFA 4AIBA 2OQHA 1XD1A 3XISA 4QDMA 1NVMA 3FSUA 4GCAA 4S3DA 1ZQ5A 3BW3A 4G1KA 5D2XA 2ZXAA 5XINA 1N82A 2GQ8A 5MKGA 2HK1A 2QJMA 1ICSA 4CLMA 1Q13A 4V1YA 5MF5A 5I3KA 3WFZA 3VZXA 4E3VA 4J2PA 2RJGA 3VIMA 3GD6A 1KBLA 3OU8A 1UH3A 3UYIA 4DAIA 2QUVA 5FJOA 2RGMA 3AXHA 4IFRA 4L6HA 3NWRA 3W7JA 5CSUA 1PB0A 2BHZA 4NY2A 3REQB 1QVBA 3WD4A 4EF8A 3FA5A 4ZOAA 3DHFA 2X41A 4U3CA 1QJWA 3O6YX 3QQWA 2AMXA 1DHPA 1SFTA 4CKQA 5TBOA 1V51A 3WDRA 2LLEA 1QOXA 1E5JA 2V68A 2Z0IA 1XRSA 1IIGA 1UC5A 4FF5A 3D0CA 1Z89A 1CBGA 2I1OA 3EX2A 1IXOA 3MCOA 3GB6A 3QPEA 3DGBA 1OX4A 3MBDA 1UD2A 2YJQA 4HOZA 4KWVA 1Q3NA 1KRBC 2HBXA 1E3XA 2ADAA 3DFSA 3GVGA 2VWTA 3ARPA 4UCGA 2WPGA 2D22A 3AZTA 3M5YA 1SQ7A 5D05A 2J8GA 1NDYA 2QMKA 4G6CA 1VFSA 4GGBA 3W2KA 1XYMA 4LAOA 3GBDA 4E4FA 5HULA 4M8UA 4YCOA 2WHJA 3A3XA 4HSHA 4TR9A 3O15A 2ZXBA 3RAOA 3KVMA 4IGNA 1XQLA 4WGXA 1HIZA 3M0IA 4NT0A 4GJJA 1S38A 1POJA 1W3LA 1RUSA 5REQA 1JG9A 1L8PA 3PHAA 2OZ3A 3AYTA 3AXKA 4GJIA 1PBGA 1TJ2A 4KT2A 2XFRA 4PRWA 1PE1A 3F5JA 4C6CA 1JDEA 2YKKA 1XBVA 2JBMA 4V15A 3RCYA 1QHZA 4AMCA 2VX4A 4DBUA 2G3IA 2I5QA 4LWWA 2WVVB 3IV8A 1IWAA 3EMZA 3SQMA 2V5JA 3WQEA 4ZSUA 2BOEX 4ZB2A 4JTLA 2DT0A 3CQJA 4F9JA 3SM0A 4E2BA 1W6TA 3BUVA 1GORA 3BAJA 4JIIX 1PYMA 4KGJA 1Y5WA 1YXDA 5CG7A 3FHAA 4NZFA 3PTMA 1FCQA 4R3UA 1TELA 2DP3A 1TWIA 5F7UA 4JNYA 4RK8A 4WGHA 1CWYA 3MP5A 1IZJA 1E0TA 3SO7A 1JIBA 2PZNA 2C15A 4GVGA 4AVOA 1UKQA 4IIEA 4WDTA 1HVXA 3GRIA 3GR7A 1X7IA 2E28A 4DJFC 1GVEA 4DZAA 1ITUA 1KV8A 5D30A 4JTEA 4PTWA 2EEXA 4TMCA 1R2SA 2QT3A 2PTWA 3GTIA 1L9WA 2IXUA 5LHFA 2ISVA 4WOQA 3WD2A 3EWCA 5HNUA 1OIFA 2PE4A 1UHVA 3WBWA 2JIWA 2YDRA 1KGUA 3IACA 5AYIA 1EL3A 4NZCA 2ZUVA 3WQ4A 5IDIA 4NX5A 2WZMA 4WK9A 2PP1A 5DRCA 3QV6A 1UH4A 3VD3A 1OSEA 4XKMA 4BHYA 4U5KA 3ONBA 3WNMA 2DH2A 3UG5A 2GVLA 5K9CA 2W6RA 3G24A 1VPYA 2HZGA 5C8BB 3QR1A 3UWUA 4PRTA 2O9OA 2OXNA 3MSDA 4FLOA 4PUMA 1KFKA 3SUSA 2B31A 3HJEA 3KTSA 1THFD 4A29A 3EPNA 3LCLA 1ISWA 2Z25A 3FK4A 3CH9A 2C91A 3ARVA 3M4HA 1NSJA 1UD8A 3PR2A 5IDZA 3EWZA 3EXSA 2YCLA 3TZNA 1GOIA 4AIUA 3IRSA 4GI9A 5D2YA 3GNDA 4I6KA 3TLQA 2A1YA 1M3UA 3CQHA 1DJZA 4ZB5A 3OBEA 1RV8A 2NQ9A 5DLCA 1SSDA 1LLZA 1LCOA 3B8IA 2A85A 1MZHA 3NVTA 4ADTA 1VEPA 1Q7QA 1WXJA 4JBRA 5AZ0A 3TYUA 2Z1SA 4HPGA 6TAAA 4B90A 4GO9A 2PB1A 4PCPA 1A5AA 5CPMA 1HQTA 8XIAA 5AKQA 4FLRA 4MFDA 5K3VA 2BGQA 5ABFA 1RCOB 3MYPA 2X42A 1RQHA 3GBEA 4O1CA 5FF7A 4CN6A 2VCAA 4RZ4A 1FWAC 4ALDA 2NUXA 4B9ZA 1KTNA 5G1TA 3C0LA 1RAKA 3SUTA 3RM9A 1VGAA 3C2FA 2FMOA 4GUHA 3WL0A 3N2MA 3CQKA 1LL4A 3TMQA 4WXZA 2VFGA 3VINA 1J6OA 3KVJA 3SN0A 2A4AA 3LSBA 3LM3A 3FAWA 3T09A 4BWLA 3HG4A 3TYCA 2PBGA 1HXJA 3OLEA 1UH2A 2E5CA 4IP4A 4UIOA 3WBAA 1GHRA 3JZEA 3H70A 4DWSB 5AC5A 4DUXA 2JQXA 1H09A 4ZVJA 3WNKA 1XW8A 4AZGA 3VM7A 4P8WA 3SCQA 4QISA 4QFUA 2OFJA 3NL3A 3ZJ8A 3ZSSA 3TU9A 4MZ1A 1C7SA 2NUYA 3LX9A 3KFTA 2Z28A 1R0MA 4Y9PA 1WB0A 1UA3A 3W1QA 4O10A 4JAWA 4OUEA 1US3A 4QQ3A 4B4FA 5HJYA 4GI6A 3AQUA 3SGGA 2CHRA 4HTYA 4XZLX 2NWRA 4US5A 2ZVRA 4TV6A 3WUFA 3AMGA 1GQKA 4IL0A 5HNTA 1VJZA 5CBIA 4WF7A 5LIUX 3MKCA 1G4TA 3FNDA 2FZNA 1E6NA 1H50A 1A53A 3VMOA 4IPJA 5EU9A 1Z8AA 1X6NA 1I2NA 1DL3A 1J0KA 5DXXA 4BA0A 4XVDA 4MY9A 1M68A 1TQJA 5E0FA 3S6DA 3WK0A 3CZGA 2EPLX 1NARA 2WANA 5EMJA 4H1ZA 1CXFA 1BD0A 2I14A 1IHIA 5KETA 4R33A 1XCWA 4ZQNA 1DV7A 2E9BA 2VR2A 2ZZ1A 2EF9A 5D33A 1M1BA 1OFPA 4JTIA 5A8PA 1CDGA 1UPPA 2E4TA 3LK6A 4H8VA 5F2GA 2QR6A 3KXQA 5H8PA 3P82A 4NF7A 1Q7ZA 2DH3A 3BOXA 4FF7A 3HM7A 4CNSA 1D2KA 1ONRA 1FH7A 2PLCA 2XINA 1LBLA 3JU2A 2VQUA 1F6YA 1S2TA 4IZGA 2ACSA 4GYPC 3AMCA 1W9PA 2EPNA 3W00A 1XICA 4R85A 4QCFA 5L6UA 1W9DM 2YA1A 2WCGA 1F73A 1CXEA 3RYSA 3BOFA 1XYLA 3NEHA 2C16A 2OT1A 3SURA 4B5NA 3WQGA 3C2EA 3WQVA 2OMAA 3WEMA 2VDIA 1PO9A 4JTCA 3MWAA 2J24A 3M46A 3VNIA 4RJEA 5KEZA 2ZX6A 5J5DA 3CHEA 4FO4A 1KWGA 3GNXA 2I7GA 2UY4A 4LBUA 1NIUA 3IIVA 2CYGA 1JDCA 1F05A 4RE0A 4J5NA 1S2UA 2QAFA 2NX9A 2WPBA 4WKFA 3S2JA 3AMLA 4IICA 5I0DA 3WH8A 4M1RA 4YPJA 1AW2A 4A4AA 3WK3A 4QE4A 3IK4A 1VCGA 3ALGA 4Q4RA 3RO6A 2PDBA 3FJNA 3KLLA 4HOWA 4YU1A 3TYAA 1S2VA 3IJ9A 3AHXA 5LGXA 3DFOA 3LA4A 4OQVA 3EPMA 3GG7A 2KAUC 2IQDA 2PGRA 1VFUA 1YXYA 1H7NA 2FZDA 3DX5A 4EX4A 5H6HA 1PIFA 4J9JA 5FF2A 4AC7C 2HXUA 2F7FA 3EKGA 1HJWA 4O18A 3WENA 2VC9A 4LVGA 3STCA 3B9DA 4RZBA 2P8CA 5LSMA 3B97A 1XD0A 2B7QA 3RRAA 3ZZ1A 1X8CA 2XM1A 1BSIA 2BXYA 4LUIA 4AWSA 4UB9A 3W7MA 4Y9NA 3MWCA 3USZA 3TXZA 2VL4A 2PU0A 3B8VA 4HU8A 3UJRA 3LG3A 1KFBA 1SJDA 3EB3A 1V02E 2VOTA 3PJWA 3V4BA 1BPLB 1LQAA 2WSRA 3ZR5A 1QOPA 3LXCA 4GYKA 3NFUA 4C6LA 5EL1A 1X98A 2J8TA 4IIGA 2ZDSA 3GC2A 1OFDA 4JTTA 4NJHA 1Y65A 2NVCA 4MWAA 5I03A 4QX4A 1MNZA 4DF2A 1YBQB 2GDQA 3RX4A 2P3ZA 1OYBA 2JGYA 4OBSA 4JYFA 3THQA 3UNDA 1WPCA 4NJKA 4KERA 1GONA 2XWEA 2DY3A 1E9IA 2E7FA 1KBJA 4D6CA 1R47A 3S2MA 3H24A 2O7QA 2XZ9A 1WDSA 1CYGA 2AL1A 3T8QA 4C6MA 4E8DA 2CKRA 2FMNA 2VURA 3BTNA 8XIMA 4DBWA 4HTBA 4EANA 3KL0A 3L4TA 1MWOA 2NXGA 3KBWA 2OT0A 1A5OC 2YFOA 3VGEA 3PB2A 3CJPA 2WKGA 1W9XA 4WSKA 3V3WA 3B04A 4RDVA 1H60A 3KCLA 4UQCA 2X1TA 3EYPA 3AWOA 6XIAA 3PWAA 2VGBA 3N25A 3GG0A 2CLMA 2C0HA 3MW7A 1V3JA 3ARZA 4IG2A 3N15A 5C9RA 3L68A 1K4GA 7PTDA 3TW7A 2OO0A 3NQGA 2GK1A 4C6FA 2UY5A 5AHNA 1UG6A 2WC4A 1QR7A 4AF0A 5FI8A 1ZJHA 4P8XA 2J27A 1TPFA 4LY8A 4CD4A 4YTTA 3EDEA 4J3WA 1E51A 1JDFA 3W2JA 1N2VA 2CNCA 4Q3MA 4CQ9A 1EJ7L 1W5PA 1QNQA 4PSRA 3W28A 3E74A 3CQIA 4XO6A 3B8SA 5MHBA 3WQDA 3N6JA 4DPQA 2CETA 1L6SA 2W9MA 4ENLA 2IKGA 3L23A 1JR1A 1EJVC 1NF7A 5J04A 3T05A 2OEJA 2C1IA 2Q3RA 3TFXA 3OEXA 3MYOA 3BVJA 2V3FA 1HGWA 3P67A 1OM0A 4Z1YA 1EJRC 1R5YA 3O7UA 5G2WA 1SW0A 1P1MA 2WZEA 1LJYA 4PFMA 3UGRA 2PAJA 5GVJA 3V18A 2X16A 3F1QA 4XAGA 4XSLA 5XIAA 1HT6A 3LERA 1OFAA 3ID7A 2VEPA 4WZHA 1J0ZA 3SN4A 4B5SA 4UUIA 3MB9A 3QR0A 1F3XA 5FKYA 1FWIC 1XDLA 2XVNA 3BSGA 1NOFA 4WLCA 4F0RA 1JCYA 3UYCA 2OZTA 2G0WA 1MDLA 3QY8A 3WNOA 3S8HA 4I5RA 5DMYA 3WLPA 1WKDA 3QV7A 3WD0A 1TPVA 1ZBCA 3WLRA 1JD7A 4WUIA 2CZEA 3ZWTA 1WCGA 1US0A 1E0UA 4L4MA 1VC4A 3IARA 1IIHA 3QMRA 2NVDA 3KLKA 2ONEA 5AYXA 4OE7A 3OYXA 5KZ6A 4JKLA 4K1GA 2GQAA 4TQTA 2YX0A 4LYPA 4O16A 1W1TA 5ENLA 3DKJA 1HJQA 1MRQA 2TAAA 4K68A 5CPSA 4MLJA 4H00A 3W7LA 1Q6QA 3TW9A 4MY1A 1OGGA 3TP4A 1QW9A 1US2A 5CGQA 2B7OA 4O50A 4G7EB 3M47A 3NQ6A 4UQAA 2WMGA 4INFA 2BY3A 1JCTA 3UWZA 3O16A 4EPBC 3W1NA 4XTDA 4M5PA 2POTA 1EUAA 2Q8XA 2BX7A 3SN1A 3VU2A 1BRLB 1K9DA 1DEDA 2CZ5A 4XBSA 3BWWA 1JPKA 4PH6A 3CEPA 4RDYA 5HUPA 4FR1A 3W29A 3DFHA 4RV8A 1XSIA 3W1UA 1B3VA 3AIBA 4Y96A 3NZPA 4D2JA 4GUFA 2G95A 4QNWA 4QR6A 4AY1A 4GZIA 2NSXA 2TMDA 1EJUC 3LBCA 3UF9A 1IT0A 3V0TA 2I5GA 1MMFA 5A6SA 3W7GA 4UC5A 3MV01 1AQ0A 3DU0A 2YL6A 3FV9A 3WNPA 4XD5A 6PTDA 1VFHA 3BK0A 1XIDA 3CLMA 3OJGA 4WY0F 1TIMA 1NFBA 4Q7NA 1GVQA 1WYIA 3CV2A 4AC1X 2H9AA 4DO7A 3KUMA 4XB3A 3CHFA 5I79A 2QPUA 4E4PA 5KTLA 2WJEA 1DWIM 4C6JA 5JBFA 2R6OA 2E68A 4GD0A 3UZ5A 4NRSA 5RUBA 4NAEB 3PF3A 4A3RA 1GVYA 2XN0A 3CQ0A 5A8QA 1KQZA 4MPQA 4PMXA 1GYMA 1V6TA 3PBUA 4JTFA 1QNSA 3SGUA 3WQPA 5CC3A 1Q6LA 2CHOA 3S4TA 3CAWA 2X7VA 4HKPA 3IJ8A 2WQDA 4CEUC 3B9NA 3NL5A 2BB0A 2GUBA 3VCNA 4GWEA 3EOEA 1QWGA 4XUYA 2FKPA 4AG0A 1DJIA 1TREA 3GZ3A 3M07A 3G5EA 1JGMA 3H53A 1P1XA 1J01A 2D1ZA 2SFPA 3LQLA 3K4AA 4B5UA 5I7GA 4IGHA 4QGCA 3K8MA 2VYOA 3NM1A 1GTEA 7XIMA 2H3DA 1Y5XA 2E6YA 4PB3A 3L66A 3M0ZA 3WKZA 4BF5A 1EP2A 2AOSA 3BJSA 3M6YA 4ZTXA 1VD6A 4NYUA 1WDWA 3NZ1A 4CQDA 5GNZA 1IT8A 3RX3A 1AW1A 4CQBA 3NVDA 3JVAA 2ZA1A 1XGDA 3PTQA 3DYPA 4IMCA 1TB3A 4LB4A 1GVOA 2NVAA 2WM0A 5A2BA 4D9PA 1JUKA 3T2OA 5D9MA 1SZEA 2B4GA 5EMLA 3L2IA 4E8CA 3UPMA 3WX7A 1ZAJA 3BARA 1Q6DA 3WFLA 3URAA 3SADA 1XF0A 1A0EA 4DYEA 1GKQA 4UBPC 4XAFA 1OC5A 2HBVA 1PDYA 1QTWA 4MADA 2BWGA 1T8QA 1CIUA 5LXXA 5A3HA 2Z2AA 2DIEA 5I2UA 2J88A 1HN1A 4M24A 2C0AA 3CHDA 3CPUA 1KBKA 1XS2A 4MGGA 4PUUA 2GGEA 4J35A 4XZIA 2OGYA 1MUCA 5C70A 3CIVA 4YWSA 1QRQA 1UWQA 1YKWA 3C61A 3AHYA 1SJCA 4W5UA 2VEKA 1UW9A 1M7JA 1OT2A 2WM1A 3KL3A 1E43A 2C3ZA 4GFIA 1JZ6A 1GOMA 3OPSA 3YPIA 4CNNA 3WYZA 5JBEA 1AW5A 3NQVA 4ZOEA 5C7HA 3EXTA 5C5YA 4JPGA 1EO5A 3NDZA 1YMYA 3AMKA 5CSYA 5H8MA 4PBGA 1E1CB 9XIAA 4UTTC 2QUNA 1VB9A 2ZADA 4L9ZA 1RD5A 4GX9A 1UUQA 3RFAA 4M19A 3G3MA 3TN6A 4AHQA 4YXGA 3EOUA