4MWFA

Structure of hepatitis c virus envelope glycoprotein e2 core bound to broadly neutralizing antibody ar3c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
226
structure length
223
Chain Sequence
LLEQSGAEVKKPGSSVKVSCETSGGTFDNYALNWVRQAPGQGLEWIGGVVPLFGTTRNAQKFQGRVTISDDKSTGTGHMELRSLRSEDTAVYYCVRSVTPRYCGGGFCYGEFDYWGQGTLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab AR3C heavy chain
publication title Hepatitis C virus e2 envelope glycoprotein core structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 223
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mwfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mwfA01
4YHML 3MV8E 4MZ2A 2XTJD 4Y4KD 4YNYB 3P9MA 4I2XB 5FDWA 3LEYH 4TQEL 4GBXB 4HPOL 3IETB 1HSAA 3SKMA 3MLZH 2Z92A 3D0VA 1D5BA 2CDGA 1NAKH 3U0TA 1MH5A 2PYED 4Z7VE 3WS3B 5HVFB 1N6UA 3MCG1 4Q74A 3O3DA 4UT9H 2Z31C 1ADQL 2D4FA 2DDQL 2UUDH 4AJ0A 1H15A 2AJZA 3F12B 5IW6B 2VLLB 3VXSA 3TN0A 4GRMB 5ITFB 3L5XL 5IBUB 2E7MA 4ZOEA 4LLWA 5KW9H 2VN7A 4Y5XB 3RWIB 2OXGA 3K80A 2P4AB 3T1FB 1KJMB 4U2ZA 1HXMA 2MQCA 1NSNL 3NCEB 2HLFC 1CGYA 5F9OH 4NDMA 4DVRL 3K1DA 4D0CA 3FMGL 2VB5A 2GYSA 2J12B 3M45A 2KPNA 2R0WL 4KZEL 5HGBB 3RQ3A 3DETC 3GJEA 3QEHA 4JM2F 4XP6H 3F62A 3AAZB 4MA8L 3CGTA 3AMKA 5E03A 2EEBA 3ARBC 3D85D 5K59E 4JZNB 2VZVA 15C8H 3VFVB 3BGAA 3WJLA 2FBOJ 1MY5A 4JAMA 3O11A 2AEPL 4ZG1A 1IILE 4GOSA 5FYKE 3DVNB 1U8MA 1JPGB 3OKKB 3FHQA 4P46B 1JRHL 5IWLA 2AV7B 4PJDB 2UZXB 3FB8B 1RAMA 3DMMC 5SWZD 1GAFL 4MA3A 3VWKA 1AE6H 1NBQA 4JO4L 1T66D 1OARH 3GSNH 1YEKL 1JE6A 1HHJA 2DTML 2NTSP 5FIEA 5D8JL 1B6DA 3QDGA 4GRLB 4DN3L 1P84K 3KR3H 1KN4L 1TLKA 4G43A 4RMWA 4Z95H 5TF1L 2NTFB 4XPBL 2KDGA 2XZAH 4P3CL 4ELMF 1M6OA 4XTRD 3K0WA 3S3SA 1UJ3C 2Y36L 3WS6A 3R4DA 3IFOB 4IRZH 2X4TB 3E2HC 4Q9QH 3QDJA 5BV7C 4KMTH 1HH6B 3P9LA 4UIKH 4U1JB 3LDBB 4WY7H 1MOEA 1M71A 2LFGA 4U1LA 5D1XC 4HXBH 4JPWH 3DX7A 1RZIA 3TZVA 1F3JA 2WBKA 2EIBA 4R90L 4R2GB 1BVLB 1RJZA 2A6JB 3EDDA 4HUXB 3I50H 2CIKA 4OCSL 5MHSE 4JFDD 2BOCB 3VFGL 5GRXG 3GBNL 3RY6A 2ID5A 2P48B 2D0GA 4O02L 4ZXBD 4JFZL 5A3IC 4MA7H 3DXAD 3MGTA 2EYTA 4OI7A 2FX8L 3VFTB 3ZZ1A 4DUVA 4WW2C 3DVGA 2ADJA 3EYOA 4KK5C 3P73B 1SBSH 1NLBH 1ZOXA 3GSUB 3WHXA 3FFDA 3BH9B 3UTPE 3QEUA 2R69H 3KPLB 4E41A 5EFIA 1U8NB 1N6QL 3JWDC 1T04B 3QXVA 5HD8C 3WIFB 1KFAL 4FFWC 3FB6A 5JW4N 4R4ND 1HHKB 4Y7MA 5JW4R 3OXRA 1OVZA 1IL1A 1P2CB 2NXZB 4KHXL 3ZSSA 1HHGA 4M1CC 4MA1B 4EDWL 2CDFA 5F7UA 2NY5H 1OD7A 4WUUB 5DEFA 5CEYB 2Z0BA 1R0AH 3BO8B 3QUMA 5H37G 5C0BA 4L3EB 3VRJA 3QZWA 4Q6IC 1N0LA 1XGYL 4PJEF 2ARJB 1BPVA 3NIGF 3ARVA 1R6VA 3JXAA 1E4WL 1T03H 1W2KT 3BPCA 3S4SB 4K94C 5HI5D 3DVIA 3BOVA 3P4LA 3L9RA 4ZUTA 1S9VA 3UO1L 2P46B 3O3BA 4UINH 4UIMB 4K8RD 4P2QB 2FZ3A 1NCDH 2MNUA 1P9MA 3GBLA 2A9NH 3B4NA 3TBTB 3IGAA 2B0SL 4X4ZA 1RK1B 3SCMD 2X4UB 3T0DA 1QSFD 4OF0A 2NY6D 4GMSH 1VGKA 4J4PA 4HHAB 1NC4A 1KPVB 1I7RB 3QQNA 4FTVB 4LQ1A 5DEGB 4XWOC 4FQXD 5E2TH 3MXVL 2NPLX 3G9VA 3VFMA 1I1YA 5F97E 3RUGF 5KS9A 5IV2A 3BZ4B 4C56E 2WWKT 5JMRA 1BF8A 1N59B 1A6UL 5DUML 4OZGF 4MNHB 4H8WL 2Q3AA 3WKML 5T5FH 4HGKC 4RGNC 5T1DH 3AM8C 1AC0A 2JIXA 4R0LA 3TA3B 1ZHNA 4MCZA 3X3FL 1YPZB 1CICA 2IMMA 3ARBD 4Y4FB 2R39A 2MWCA 5EIIB 2DQUL 4NZUH 3BXNB 1RZGA 2Y07L 3QISA 2XZCL 2C1OA 2I5YH 5DJ0A 5BZWB 4X4ME 2CO7B 1N4XL 2HKHL 2ERJC 1EEQA 3BQUC 4I0PB 2CDEB 3B43A 4IIQB 4LCCB 4OAWA 1QBML 1VFBB 4EUPH 1CGXA 3HG1B 4TNVK 4JDTL 1T80A 3SDCA 1X7QA 3O6MH 4OUUB 3ME0A 4GAJL 2EH7L 5DZNA 4NIKB 1BGXL 3EYVA 1Z3GH 3MFFB 1XF3A 2DAVA 2QBWA 5INDB 3UJIL 2Y9RT 2APXA 2X4RA 3A6CL 3UYPA 3WE6A 2FYYB 5IFJA 3O9WD 5L9DH 3N50A 1BM3H 3WFBH 5C8JA 3ILPB 4B53A 2I60L 2GK2A 4L3CA 4UAOB 1DLFH 5F1NB 3PDOB 1JIBA 2CR3A 5FFLA 2DQJH 5FHBL 4PJ7A 5D1XD 1HI6B 4WTXA 1F4AA 3LS5H 2FJFA 3EOYG 5JXAH 1VHPA 1EMTL 3K3QA 1BD2B 1OAUL 1YDPB 3ES6A 2C3GA 5IBLD 1JWSA 5TDOA 1ZA3B 5FDYA 5A3ID 4M1DH 1IQWH 1O0VA 3LN5B 1BIIA 3CLEL 4JN2B 4WGWB 3U9PL 1FDLH 1IT9H 3MCKB 3PWPB 1QQDA 1YNLH 3PGDA 4J8RB 4OM1H 4KK5D 2P5EA 1P7KA 3CAFA 3WDHA 4KROD 5IB3B 2F9BT 1WCBB 3VGBA 5A2LH 3KNBB 2Q1EA 2WQ8A 3QUXD 5IMLA 4A6YH 4PJIE 3FT3B 2V17H 2VLJB 3QFJB 3VA2C 3B9KB 3FQRB 5CAYB 4I5BB 5E8EB 5C3LD 4NQXA 5IG7A 4G9FD 1ADQA 4ZO6A 1CIDA 4EIGB 3RZWA 4P2OD 4DVBB 3PUCA 5C9JB 1OB1B 5HYJA 3U2SA 2P24B 3HR6A 3VFSB 3EYUL 4YHIA 2P42B 5GSVB 2ICWJ 5EB9A 3IAGC 3NMEA 4M1CD 3HZVB 5HSFA 3JUZA 1IGJA 4O2CB 1YYLL 4OIIL 2F8VA 8FABA 4BFIB 2ZUSA 4QXUL 2G5BA 3EJYD 4FABH 2KH2B 1QD0A 3VXTB 1LEIB 5GGQH 1SQ2N 5DMIL 2P8PA 1FZKB 3QWOB 5D7JC 2E7LC 3RVTD 5HGHA 1R24A 2BNQD 2JJTA 2APWA 2YS4A 1FH5H 4MD4A 2XNAB 4NBZB 1YN6B 3HZYB 2NY4C 4GG8A 5CMAB 4NKOA 1AKJB 1YEJH 3T1WA 2X4PB 4OUOA 4NPYB 4Z7WF 5I73B 4LVHC 4HUUB 4A2MA 3ARQA 1X5JA 4EI5C 1ZT7B 3GKWH 4Z7VF 5JDSB 3T2QA 2GK0A 5EBMB 3AGVA 3FB5B 3A67H 3TIDB 1OGTA 3TNNA 4QXWA 3UAJC 3TIEB 3C5SA 1IM9D 1IARB 1EO8H 2R29L 2O61B 3CXHK 3EO0A 4YIQB 1JWMB 1R3KB 2AS5M 3ULVE 1INQA 4MSWA 3CJJA 3L3IA 1VPOL 3S88L 2YEZA 1TQCB 3FQTA 4OF3A 1EAJA 3T8XA 3SDDD 3B3IA 5L8JB 2YD8A 1F45A 1MAMH 1A9EB 4MQ7B 4RGND 1OGAA 1EZVX 3KPNA 1UM5L 4XP4H 4NUJA 1I1RA 3H3BC 4ELMA 1FN4A 2ZOLB 2AQ2A 1LP9B 3LV3A 5B3NA 1H3TA 1HNGA 3ZKND 3S4SG 3GRWL 2UY6A 1SY6L 1ROWA 4UDTB 3U7WH 4UNVA 1E4KA 5HYSA 2H2PD 5K59F 1UM6L 4CU7A 4AEIL 1OTSC 2ZUVA 2NXYC 3TWCL 4IS6A 2EDHA 3QI9C 3QH3B 1C08A 3MRCB 1EXUA 4XXCC 5FYKL 3W9EA 5GGRY 5F44A 1H5BA 1IGFH 1GGIH 3AFLA 5IVXE 5D7IB 4P99A 1QBLH 1G6RH 3TVMD 3CVHL 4PJBB 5IKCB 1BQSA 4HLJA 5ALBH 2VN4A 3QPQC 1E27A 4BQBA 1MCBA 1UXSB 7FABH 1PEWA 3CXDL 5E99L 4LVOB 3EFFA 1A3QA 1NCWL 3OKOB 4HMEA 4R97C 5DI8B 2QHRL 4UTBL 4G7VH 3SKUD 1KULA 3GSNB 3CMGA 2VDRH 2EXWC 1G9MH 2Z35B 5BS0A 1V05A 4LASL 4BSWB 3ESVF 3VD4A 1RZFH 5BOPA 1S5IH 1IQDB 4ZOBA 2F19H 3L3GA 5LBSH 3MJ9L 1OAKH 4X6DA 1RJYB 2EDTA 2ED9A 2UZYB 2W9EH 1W0VB 5D7LB 5KVGL 1MFCH 5MERB 1MAJA 5DUPH 1UEMA 1YQVH 4R7DA 5ILTL 4UU9A 4NT6A 1FPTL 3O2DL 1TETH 3GSOA 3VCLB 1IGTB 2YD6A 4OFKA 1LEKA 3RIAF 5T3ZD 4NQVA 5M94B 2XN9B 3BDBA 1KBGL 1PYWB 2FJGB 1ORQB 3DX8B 1AHWC 1I75A 2AJSL 4Z78A 3TJEL 4DKDC 4JZJA 5KVDL 5B38B 1INDH 4OZIE 3MC0A 4U1SB 3VXUA 3TBWB 1AGFA 4WFFD 2YXFA 1XCQA 3GJFK 3O2VH 4NQDE 4N8PA 3EKCA 4TSAL 1KEMH 1LGVA 2MMXA 5I15L 4HUVB 3MRFA 5EORH 5HHQB 4YO0A 1QFWL 1PD6A 1CFNB 5FEBA 4XBEL 1FSKB 4C54A 5EUKB 1KIQB 1J86A 1YMME 3HE6A 3B2UD 4WV1A 3TT1H 2GSGA 2DBLL 4KTDL 3SJVA 4AMKH 3MJGX 5EN2A 3PE9A 2XTJE 5D71L 2J7LA 3RUGA 2L0DA 5ISZB 5J11C 2EKSA 2HVKA 2QSVA 2YOCA 2AW2A 2GFBB 4JY5H 4M48L 4N90D 3JWOL 4OZGA 3WD5H 5DK2B 1KXQE 2PXYC 5D7JD 1T5WB 1PKQA 3WSQL 3P11L 1K8DB 2GJ6B 5CGTA 2PYEE 4JGMA 4O5LL 3J7HA 1JJUA 1K4CB 1NUFA 2FJHB 5I0DA 3BSZH 1U8IA 1W72H 2E8ZA 2KL6A 4X7EC 5ICXA 1GGCL 1ZVHA 5DMGC 3T0BA 4G8FA 2D31A 3SE9H 2ZUUA 3STLB 3TYFA 5C09D 4Y1AB 5DT1L 4AG4L 2YSSA 5D2LB 2XFXB 1C7TA 3EAKA 4HX1B 4D8PB 3CPLA 5T1MB 5I16A 1YN7A 2EO9A 1QO3A 4J3VA 3NTCL 1ERNA 2Q86B 1X5LA 5BCAA 5ID1B 2A1WH 2HH0H 3MROB 5AZ2L 1KCSH 2Z91A 1DL7L 4OCWL 3CSPA 1GJIA 2V5TA 2Z8VC 2PW2B 4YHLL 3ZO0A 3TPUB 1B0GA 4YEEA 3MLRH 4WTZA 3MRMA 2VDPH 5FOBA 2FEDC 1HZHL 3K74B 5I30H 1X5FA 3I6LD 3BKCH 5FK9B 3DGGA 4RISH 1QBBA 1U3HA 2LU3A 2RHEA 3IXTB 4KPHL 1A3LH 3WL9A 2V9QA 1IE5A 4F15C 3DSFH 2VERN 1Q9WA 3ZTNL 5E95B 5J56B 3G08B 5SWZE 1ZHLA 1QSEB 2YKLL 4OJFL 3WLBA 1OTSD 5GGUB 2FGWL 1LO2L 3H9SA 2ORBH 2YMXH 3K46A 2D2OA 1C1EH 3QI9D 3L3KA 6CGTA 5IROC 4MX7A 3QQ4A 2CUIA 1HH9B 2NY1B 4ODTH 3RRQA 5CP7B 3I2CH 3MOAH 5IQ7H 3IDXH 4QHLB 5INCA 1C5BL 2H9GB 1JZ4A 3DUSA 1MCNA 4PJFA 5CCKL 1KELH 2COQA 5DO2C 1OT1A 4P4KC 3VMNA 4L4VD 4LNRA 1MCQA 1KTKE 5DSCA 4BZ1H 2EKJA 1KG0B 1LK3H 2X4QB 3K1KC 3DBXA 4DOHB 4PJGE 5FYLD 4GXVL 5EPMB 4EUPB 1IAIM 3RDTA 5HHNB 1JNJA 2EH8L 2EYSB 5KTEH 1A6VL 4PR5B 3AB0B 4KMLB 3EOAB 4JFDE 4YFLF 1ZSDB 1WWAX 2X89A 1T1ZA 4Y5YC 5DMKA 3MLTA 5H2BB 2R2HB 4WCYL 4R96B 3DXAE 3PQYD 1XGQA 1XR8A 5E6IB 2J8HA 3QQ9C 4S1QH 4M4PA 1UVQB 2F53A 4LIQE 5C0AA 4IRJD 1WC7B 3O6FA 1I1AA 4I0KA 5CZVL 5IFHH 5KAQG 3MUGA 5DTFA 3IKCB 4XVUD 3BWAA 3VWJC 5IMOB 3OTTA 5GGTH 1QLRB 1PSKH 1CBVH 5JIHA 5IHUH 2J88H 4WWKA 4KKCD 3KLHD 5EO0B 3SOBL 4IBLT 3PNWB 2HT4C 5DJCA 3MV8A 2VDMH 3D25B 3DURB 4Y2DC 5DJ6A 5HHPA 1BLNA 2FO1A 4XX1E 4I18B 1JZ7A 3ZE1F 4HF5L 3HC4H 3MV7D 1M7IA 5F7DB 4ZTOL 3IDMB 1AP2A 4QCIA 5F8RC 1D5ZA 3OSKA 3T2NH 1X5XA 3PWUB 3HZKB 5K9KA 1ZLWH 5B8CB 1EVUA 1Y0LA 4QY8A 3TV3L 2BSTB 2APVA 2QQKH 3TO2A 4OLVH 4Z7VA 3V52L 4K23L 3P4NA 5T1LA 4N1CA 4JDZB 3QNZA 4PJ9B 4OCLC 2J4WL 2D0FA 4BSVA 1ZMYA 4A6YB 3SKJH 3KPTA 4JQVC 3ZTJG 3CX2A 5IHZA 2JB6B 3OAZH 4L29A 4EN3D 1NFIA 1JF6A 4WHYH 2FATH 3KYKH 3OZ9H 2PXYD 3HA0A 3HZMA 4LCUA 3HNSH 4X7SH 5TDPA 5IIEB 4P3WA 5LGHH 1CD1B 1BQUA 4I48A 1KJ3L 4UTAH 5DMGD 4TTDC 1MJ8H 3QIUD 3GRWA 4PGDA 3LPWA 1SY6A 3TM6A 2W65B 3OAUH 1QSFE 1BAFL 4H26A 4I8DA 5KVFL 1U8PB 1T7WA 1S8DA 3KWWB 3QQ3A 5CZXC 2PO6B 5ESQA 1J0JA 5SV3A 1KCRH 1YEDB 2FNBA 5I1DB 1T2QL 1CXLA 4U3HA 4H20H 3BIKA 5DUBA 5JOFB 3PJSA 1UXWB 5DFTA 3S3PA 2DQIH 1JPST 3OAZK 4MD0A 4ZFZB 4YR6A 5J8OA 4MD5B 4HFUL 4ZYKA 4RA3A 3HLAA 2JK5A 5HI4C 3CVHA 3VFNB 1O5DT 4N0FB 4TUJB 3LRGA 5T3XD 5E00B 1CU4L 2X09A 2NLJA 1NGXB 4KK8D 4JPKL 2FEDD 4IOIA 1LK2A 2JELH 3S34H 4DGVL 3KJ6L 3R06A 3VG9C 1IGCL 4ZO9A 5IB2A 1ZA6A 5CWSA 4YDLB 3T0EA 2OK0L 3P9WB 4O58H 3DRQA 5IBTL 2YD2A 3MJ9A 4HKZA 1H3XA 2VDKL 5T1KD 1TNMA 3SO3B 4KVCH 3KJ4C 2A0LC 4MAUL 2QR0B 2WP3O 4P5TA 5D6CB 4Z0BH 5SWSE 2VDOL 3V8CA 5L7XH 2FX7H 3PIQB 2XXCB 1SVCP 4M61A 1C12A 4F3FB 3IKKA 2R1WB 4HLZH 5EBLB 2X40A 5FDWB 5TE7H 3VXNA 1MI5B 3EO9H 3BVNB 3BKJH 5IVXF 1NDGA 3N1QC 1ZEAL 1HSAB 3WNPA 3U36A 4UOW1 2CDGB 3U0TB 5FGCB 1DVFA 1RZJC 4XPFL 2P5WB 1OTUD 1LO5A 2X1QA 4X0KA 5DJ2B 3MBED 5IB1B 1R3JA 5CJXC 1H15B 1MVUA 2XWTB 3ARTA 4ERSH 5C0JB 3NFSH 2DM7A 3D3VE 3TBSA 2DIAA 2E27L 4HEPG 3D0LB 1FVEB 2YN3A 4LMQI 3KPPA 1QRND 1DUYA 3I02B 4BFEA 4X6EA 5E8OA 1HXMB 1UA6L 1FHGA 3NGBB 5E70A 1FNHA 4S1SL 1CT8B 5FUCC 3DIFB 3T3PE 3VWJD 5KSAD 3ZE2F 1XF2B 4FFZH 1WBYA 2Z9TA 1CLYL 3O8XB 2R0LH 2PTTA 4M6OH 2X4SA 1NL0H 4PJCE 2HT4D 3FO0H 4GAYB 1KT2B 1AGCB 1AIFA 1ZTXH 2A38A 3HC0A 4G9FE 1I3UA 1P7QA 2ZUWA 3KPOB 3QEHB 4NFDA 5GS1C 12E8H 3HAEA 5CBAA 2FX8H 5IF0A 4OZIF 1CGTA 3WNLA 1AY1L 2P8LB 4NO3A 5FGBA 2YD5A 5EWIL 1YJDH 2ITDB 3DUHA 2G75A 4PJAB 5HGAA 4NQSB 3SDAB 4DQOH 2R0ZL 4NSKB 2M1KA 4XNYL 3H0TB 4AIOA 2C3VB 3DV4A 5I74B 1WCQA 1T0NB 1CDYA 2BNQE 3AREB 5ADOH 2LE9A 4OLWL 4X6CB 4R4FL 1FCGA 3MTRA 4DUXA 3G5XA 4L3AA 3NFNA 4C56A 1N0XH 2R8SL 5BO1H 1M6OB 2V5YA 2ATPA 4JO2L 4NRZA 3OJDB 4ODUB 5FCSH 4GUPB 1FL5A 4JN1H 1ED3A 3AY4C 3FN0H 3QDJB 4BQCA 3P9LB 4TTDD 1GGBH 1E4JA 3BPOB 3V6BR 1J0ZA 5F89A 4K3DH 4KTEH 3CFBB 4FXKA 2NMSA 3OXSB 1CFTB 1EFXD 3MLXH 2KUTA 3INUL 4CUCA 1OAYH 4QHKI 4JRYD 3JUYA 1W72B 3GSRA 4L8BB 4TVPD 4I3SH 1OPGH 1NUGA 3MODL 4X4MA 1MUJB 3SE8L 4X9BA 4CNIA 3NZHL 4RGNE 4L8SA 5HHMD 1ES0B 1B0RA 2ESVD 1MFAL 3B9EA 5ETUA 2AJVL 2IBGA 3MLYH 1JGVH 1KB9K 3DVGB 3LRSB 4GW1A 4FXGB 4PBXA 2IBBA 3U7YH 2XKNB 1G9NH 3WHXB 1A64A 4YXLL 4XNXL 4LCYA 4QTIH 1IZKA 1A7RL 2DQFA 2DQHH 5EFIB 2WBJD 4KRPC 4KGJA 5C0IB 3TGXA 5FOJA 2Y23A 1EPFA 3TLRA 1FYHB 1A9BB 5L88L 4H8WH 2ADFH 4KZDL 3OXRB 1DBJH 1MFDH 2W91A 1IL1B 2OR8A 1WIUA 3REWA 1D9KA 3ZKSD 1HHGB 1CD0A 3TO4C 4XMLH 3WDIA 4X7TA 2CDFB 1YY9C 3VGDA 4TPRL 3ARFA 3GJFA 1HHIA 4Z0XA 3QWQB 5EUOF 3QDAA 3MO1B 3QDME 4U0QB 3U6RA 2Q7YA 5TGBA 3TCLB 3ARRA 4XCNB 3BPCB 2APBA 3GM8A 1H3PH 4PRPD 1JP5A 4G6MH 1S9VB 3PG2A 5FECB 32C2A 4JREB 3RL1B 2X4NA 1ZHBB 2FZ3B 5I8CA 1QHOA 1JNHB 4HPYH 4F7MB 4GAJH 4PJIA 2IFFL 4F8QA 3IGAB 2M8XA 4XB7A 2I9LA 1X5ZA 2EE3A 5LWYL 3JV5A 4YE4H 3ECBA 3UTZB 5JUEH 5GSRB 4PYHA 4RFOL 4I1NB 1A6PA 3OKLA 2FEEI 4L9DA 2FIKB 3LQMA 4KUZH 5T3ZE 5BRZB 4HWEH 1UKQA 2ZKHH 1RULH 1DSFH 3PHQB 2YPLB 5IV2B 3L7FA 4XAWH 3G6JB 3NVQA 1OCWL 3MLUH 1N5YL 3C60A 5FUOL 4QHKJ 5KANI 4YHOL 3A6BL 4IRSB 4MAYB 4LIQL 4LVNB 4L9LA 3RKPA 1P1ZA 4WFFE 3RGVC 4UB0H 1ZLUH 2JIXB 5C0CB 4Z7UB 4V2BA 1UWEH 3WJLC 1FFRA 1EUTA 1IZJA 3MMEA 4RWYH 5FO8A 1I9JH 1ACYL 5MEQB 1FNEA 2W60B 4MB4A 5DQJA 1AQKL 4S11A 3JVGC 1KC5H 1F4XL 1HCVA 2BNRB 2YBRA 1BZ9B 5IWLC 1DQDH 1JYNA 2HFEA 5I71C 1NUDA 4NNPH 4MHHG 3VWKC 5I1GH 1X5AA 1BFOB 4M8VA 3S35X 4BZ2L 1FLRL 5J13B 3PGFH 4N90E 4O2FA 4ZUWB 4X98A 4OAWB 5IEKA 3BMWA 4HIIB 5E9DD 4OZHE 4RDQG 4Y16A 3SDCB 1EX0A 1ZLUK 1AO7B 2IH3A 1TTGA 5FB8A 2VXUL 5D5ME 4M5ZH 3VJ6A 4DAGL 1A14H 4L4TD 5DDHA 4S0SD 1DQLL 1RMFL 3HI5L 1U91A 3L3OB 2X4RB 3SO5A 5CIPA 2AEQL 3EYSH 5C09E 3WE6B 1JZ2A 5IFJB 4YDIH 3WFHA 4OZFH 3TZVC 3OKYA 3P77A 3QUYA 3MA9L 5ERWA 1MJUL 5HHXH 2VDQH 2A6KA 4NHCL 2IG2L 1UH3A 4AIZB 4PJ7B 6FABH 4K8RL 3QCUL 4MJ6B 1NANH 5TH2A 5F8QC 2IH1A 5C0NC 3HPJB 3P3YA 4J3SA 3TYGH 5I8OH 5DC0A 5EDXA 3T3ME 4ONHA 1U3JA 3Q5TA 5DURB 1PZ5B 3RVWC 4M00A 5IEHB 4JM4L 4PGZA 4JFFD 1I7UB 4X6BA 4P2CG 1V7NL 3ES6B 3TH3T 2AJXH 4IHOA 3W2DH 5A2JH 4QTHB 4G8GD 1BIIB 4TSBH 1I9EA 5F3HB 2FRGP 4U6VL 4XCCL 4X9IA 3QNXB 4EKXA 1ZE3C 1IKNC 2RGSA 3CCHA 3I6LE 2PUQT 2AK4B 2MCPH 4IMKA 5JNYA 1J1OH 3MCLH 4QGYA 4LGPB 5IVXA 3QG7L 1U0QA 4UZGA 2DLFH 3CH1B 1WJ3A 3ARGB 3GHBH 4P59L 2C3XA 1YNKL 4HBCH 1ZGLA 2BY0A 1A6TB 3CMOH 1XGRA 3GMQA 4PIRF 1XT5A 1A4JA 1IC5H 1BHGA 1P6FA 4U1NA 4YPJA 4CW1B 5L8KB 3ALXA 3WIHL 3PV6A 2QSCL 5HYJB 3U2SB 1DQJA 4CVWA 1C16A 2GQHA 3RTQB 4ELKA 3BT2H 3NCBB 4NO0A 2JLLA 1S9YA 1RD6A 3CC5A 5CEZD 4LF3A 1S7XA 4Z7QE 1NMAH 2FL5B 3GMRB 5D9SB 4C83A 5E8DL 2ARWA 1IKFL 3OKMA 1L0QA 4PRHE 1I3GH 5HGHB 3RZCA 4L4VE 3CD4A 4G7YH 4AM0B 1MHPH 2NY2B 5ESVA 4MS8D 2G60H 2AV1B 3KLSA 4WU5B 3RWEB 2FEEL 4P46C 1P9MC 3R8BB 3HMWH 3V6ZB 1KJVA 4TULH 3QHFH 1CLZH 4KY1L 2DKSA 4KKLD 4YHZH 3THML 4U1MA 4OZIA 5DQDL 2NY0C 2GSIB 3WFEL 4HK0B 5BQ7B 5D1ZD 3PQYE 2HRPL 1JHTA 3GUTA 4IMLA 4NQDA 3DO3A 1RZ7H 2ZCLL 1OGTB 3TNNB 3HE7A 4H5SB 5IESH 1H3UA 2EDBA 4PV9A 3KPRB 4OT1L 2BFVH 1DDHB 3CUPB 4ZUSA 2R2BB 1L6ZA 3TBVA 1CR9H 1YMMA 4P2RB 5CD5D 5I1EL 4OSUL 4RGMC 1KGCD 4XPTH 4R0LC 4XT1C 3LRHA 4K07A 1FVDA 4CMHB 3T8XB 1CL7L 1NDMA 3B3IB 4Y4KA 3UBXI 1CICC 4Y8DC 5I75B 1A1MB 2YHGA 3MV7E 3ZYZA 1D5IH 3RGVD 3T0WA 1X5IA 3O3EB 3U4BH 5IOPB 2LTQB 2OP4H 3QZWG 3G6AA 3BN3B 3LV3B 2Y06H 5ILTH 3OG4B 1J0IA 5AZEL 3CK0H 2K1MA 4NN6C 2VYRE 5C0RL 3WN5B 2XZQL 5FUZH 2PYEA 1VACA 2DICA 1INEL 1FFNB 3SDXE 2CLRA 2B4CL 3JTSB 3MV9B 1YNTB 5SX4H 1QLEL 2PYFA 3NOIA 1S7SA 2AABL 4GW4A 2F5BH 1D6VH 4IS6B 5FHAH 2VLRB 2LAGB 3IU3A 4NKDA 1BQLH 1MNUL 4P9HH 4MVBD 1KPUA 2FLBT 1RIVH 1H5BB 3F7VA 2OTPA 3VGHA 2E3VA 3U1SH 5DJYB 5IMKA 5EU5A 1MCOH 1QSZA 4S1RL 5J89A 3GKZA 2R2CA 5D1QD 5E5MB 4OCXH 4XBGA 1OY3B 1WWCA 4N0CD 4PJ5B 5EU4B 1T20A 4GRWE 4J3OC 5IB5A 1T4KA 2WMPA 3N1PC 3K4ZA 2FD6H 3D85A 3FO9B 5HHVH 1EEZB 3GNMH 4QRPB 1B2WL 4OLXH 1OAQH 4X6DB 2B1AH 4O5LH 3V5DA 4YHKH 1JFQL 1UCBH 3FTGB 5I18L 4JPVH 5SWZA 3HAEH 1K4DA 4WHCA 4NT6B 3CDGB 3WCYA 4HS6B 3FN9A 5T3XE 3GSOB 5GS0H 1LEKB 1V3MA 3BKYL 5L0QB 1GXEA 4JHWL 1TPXB 1A6WL 5FF6A 5DK3A 2LVEA 2WUBH 4RQQA 2X1WL 4W4NA 5AYUL 4I9WD 5J0BA 4LSVL 1B88A 1UB6A 4OCYH 1I85C 3SGJA 2FHFA 2B2XH 5AYQA 1ZT1A 1XCQB 4QF1A 1Q72H 2ZG2A 3MYJB 4BJLA 3LD8C 2D7OA 1SEBA 3MRFB 3KGRA 3ZE0F 3GSWA 2V7NB 3HUJB 4MXVE 5C07B 5GJSL 5DJZA 2DL9A 4PJGA 5IM7B 5E8PA 5EZOH 5BVJA 4OTXL 1U6AH 3S5LB 3AXLB 1K6QH 4BFBD 1XF4A 3SJVB 1EJOL 1A4KB 2WWMD 3MRQA 4JFDA 2VAAB 3LQAH 3UC0L 4YBLC 4M62L 4X9HA 3CDCA 2X7LA 4NYLA 3KS0H 1I7ZB 1T2JA 3EOBA 4XMPL 4ZXBA 2HVKB 3RX7A 3P30H 3OHXB 3DXAA 3O3AA 4NQCB 1ZGLP 3OKEA 2FGWH 3NPSB 2ILLA 4JRXB 4JM2C 5FYJU 1GPOL 2R4SL 2BSRA 2XT1B 3MLSH 1U8IB 1XH3B 4JJHA 4P46D 5HJ3A 3GIVB 4PP2A 3ROLA 4MB3A 5TFSH 4XHJD 5SX5K 3EYQC 2WZPD 3AU1B 3P4OA 1A21A 5JR1H 1FBIL 1FJ1B 3K8MA 5MENB 4IIQC 4YHPA 4GW5B 3PHOB 4Q97A 3WNMA 2O5YH 1I9RH 4F7EA 1JF1A 4OI8A 4HKXA 1MVFA 5GRVK 4RA0C 1QRNE 4PRBB 1QPPA 1QO3B 2DWEA 4L1HA 4HG4J 5GRUL 1FC2D 2G9HA 3BGFB 2DWDB 2ZSVA 4X9GA 1QFUH 2J5LC 1P4BH 3NACH 4KI5D 2DD8H 3IDGA 5IK3A 5IW1A 4MDIB 4F7PA 4UAOC 1B0GB 3QIWB 5T3ZL 3H3PH 4PV8B 5CD3A 2OQJB 1Q0YH 1FGNH 4G80B 3LKOB 1E4XH 1EIBA 2N7BA 4R2GD 4Z18A 3MGOB 4K7PL 4XRCB 3FONB 2FDBP 4X5XA 1S7UA 2APFA 1QYGL 4P9MH 3ZL4H 3MRGB 3VH8B 1BFTA 5IHLB 3HFML 3MZTA 3LKSB 5B3JE 5BW7A 3SCMA 3BISA 1QSFA 3U0WH 1MSPA 4TUOA 4ZFGH 1JPTL 4QXGL 3W11C 3MRKB 3L3KB 3PXHA 3RVUD 5C0FB 2UWEE 4FQXA 4V2CB 4PTUA 1HQRA 2WIIA 1UZ6E 2I07A 3TV3H 1NMCC 5INCB 2WBWB 2O5XL 4PG2C 5GHWL 4D0DA 2XRAL 2IANB 3R1GL 4U7SA 5HGDA 2IQ9L 3CDYA 1E4XI 4OZHF 5CSBA 2NXZD 1MHCB 3RAJH 5DSCB 1LD9B 5D5MF 1C5DB 1G7PB 5DHYA 3DRTB 3UYOD 3ARBA 3GO1H 1A7QL 4JRYE 4OFVA 3WIHA 1NGWA 4I3GA 1Z5LA 5GRWA 4BFGA 4FQLH 1Q9LA 5B4MC 1ZKAA 3MLTB 4L3ED 2J6EH 4TVPE 2YRPA 3MNWA 3PL6B 1T0PB 2K9UA 5C0EA 2DQGH 4WFHD 1N5AA 4OGYH 4C4KO 5HYSG 5I0ZA 5HHME 3WEXB 2ESVE 4GKOA 4OZFB 3KYAA 3T3MF 4PJXF 3U9UA 4M7JH 3MUGB 1NBVL 4XWGL 5HDBE 4JZJC 3ELAT 4S1DC 3W0WD 3I6GB 5SWSA 3T09A 1NCAH 4WWKB 4D9LL 5HY9A 4KXZI 1T22B 3B5HA 3WFCH 4FRWA 4OV5B 2HAZA 5HHPB 4NKIL 4QRUB 3BIBX 3CFEA 1AP2B 1TITA 4N5UA 4OFYD 4WI3A 4FTVD 3GSQA 1ETZA 5EU3B 3RU8L 3JV6A 3HE6C 4QY8B 1M7DB 1HKFA 3T4YB 1F5WA 4DGIH 5D1XA 1I1FB 4NM4L 2AJUH 4PB0L 3U4AA 3ULVH 4KHTH 1JYWA 2BNUB 5T1LB 1CDGA 5JTWA 3QNZB 4NOFA 4KV5E 4Y88A 4POYA 2JJSC 3HHRB 2XY2A 2HWZH 4OF8A 5F88A 4ZS6D 3TA3D 5IHZB 3D3VA 1AXSA 1GOFA 3B2VL 5E1AA 3TFKC 3QRFM 2DQCL 3C5ZB 4L29B 4NO2A 1AD9A 3P4MA 1MCKA 1TJIH 3FOLA 4TRPL 3N85H 1MEXL 5CP3H 3DX9B 4Z7QF 4Y4FD 3L3HA 1NFDE 3QCVL 3KYOA 2YA2A 4PRPE 3MRNB 5HPOA 1RJLB 4M6ML 3O6LL 4KFZC 4PJ8B 5TQ2H 4JM2D 4M1GH 4DKAA 2KQNA 2BOBB 3F7YA 3PDGA 4MDJA 3H7BA 3QUXA 3UTSB 3KVQA 4LPYA 1HDMA 4N0UB 5JO5B 1FIGL 5FKPB 4PJCA 3EYQD 4HQQL 5F9JB 2A74B 4I0PD 1CDJA 5F93C 4G9FA 3LEVL 5FYLL 1HCFX 4WIQA 1X5GA 1S8DB 3HG1D 3HN3A 4P2OA 1PW3A 5ESQB 5E6YA 1ZEAH 1RIUH 4UV4H 3BIKB 3PWLA 1RUKH 3PJSB 3UBXB 3PDDA 4ZAKB 1MCCA 2BCKA 4MD0B 3HLAB 4KJYA 2QLVB 1URLA 3BZFA 3D39D 4HUWA 3CVHB 2X42A 2LAAA 4LK4A 1KB5H 5F6IB 4E5XA 1Q94A 5DJAA 2BNQA 3V6OC 1CFVL 1FNSL 1ORSB 2WP3T 3OQ3B 3WHE0 4GMTH 2H6PA 4CKVX 1AGBB 4QWWC 4ZFOB 1D5MB 3QO1A 3OPZL 2BMKA 2ZOKB 3KYMA 2WQRA 1J87A 3V7AE 3DRQB 2ZCKH 4XNMA 2XI9A 3MOBL 4OQ1A 1HKLH 2M2DA 3P0GB 3O41A 5E2JA 4LSQH 3SDXF 2XA8H 1TJGL 5E9DE 1YEGH 5JQ6H 1YEFH 4FZEH 3W11D 3HC3H 1IJ9A 3BGMA 1IM9A 4F7TA 4JO1H 4A2LA 3LIZL 4GKZA 5GS2D 3D6GA 2VDLH 3QFJD 4G6AC 4ONGH 4DEPB 1L7TL 4L4TE 2VDNL 1LNUA 3B9KD 1LEGB 4P57A 4WI6A 1FZMB 4WO4B 2H32A 3GDBA 4G6KH 1GC1L 3SDDA 3ZHDA 1EEYB 4IOSD 4RFNC 3B6SA 3JTTA 3AM8A 3T2PA 2VXSL 3U36B 3H3KA 3RDTC 1U8HA 3VFPA 1PX3A 1RZKC 1SJHA 4WTZG 3SE4A 3I3EA 4CBPA 2JB5L 3K2UH 3F58H 3IT8D 1WWWX 4PPTA 4X0KB 4MLSA 3IJYA 3MRIB 4GRWF 3FL7A 5ALCH 2H3NA 3IU4L 4JFFE 4LSUL 1FL6A 4PJHE 4QOKE 1OP3H 3O6FC 4JO2H 1FFPA 1I1AC 5IMMA 3FOMA 4OQTL 4G8GE 3KPPB 2HLAA 2QADC 4HIXL 3SKNA 4M8QA 3V0VA 4XNUH 3L7EA 4D3CH 2YD9A 2C4FU 1F4WL 3O4OB 1KYOJ 2R23A 5KG9A 1JF5A 4NRYB 2GT9B 5FA3A 3U30B 2X9YA 1MWAL 1ZS8A 1Y6MR 1H8SA 1AKJD 3UYRH 4HJJH 1NCCH 3I9GL 4LOUC 1D5XA 1I8KA 4FNLH 5T3XL 5F96H 4IOFD 4MGXA 1BFVH 2EZ0C 4XH2A 4X99A 1P7QB 1MPAL 1RI8A 2CSPA 4UOJA 2BVQA 3BP6B 5DJXB 2D03L 5E2UH 3HAEB 2XG5A 3MPCA 4KRNA 4XAKD 4NP4H 2FH8A 4RBPH 5IF0B 1JGDA 2H26A 4OB5H 5HDQH 5AD0B 3QXTA 3LS4H 3EO1A 4JANB 1JK8A 4JZOA 5CEZE 1K8IB 4LPUA 4RAUB 1IC1A 3MR9B 2VQTA 3GI8L 4PGEA 5C86A 1A7RH 4F58L 1J5OL 1SJXA 1A0QH 3CX5J 4EQ2A 1G7IB 3K8KA 3DV4B 2O5ZL 3Q6GL 5DD6B 3TFKD 2GI7A 5I8KH 3VGAC 4CDGC 5E08L 3EDEA 3BAEL 4DGYL 3OKDA 3V6FB 4JCMA 3G5XB 4YAQB 5ITBL 4C56B 4YK4C 4NN7B 2ATPB 3MNVB 4XPHH 3GMLA 3C2AL 4QNPE 5E8NA 4UT7L 2ADGA 1MELA 5EOCH 1I8MA 2UYLB 3DECA 1EGJH 1RUAH 1G0XA 1G7QB 2J8UF 4GT7A 3X11B 1VEPA 4MQXC 1QFWM 4JKKA 2Q76B 4Q58C 5T33L 4WFGE 5F9DC 1JGEA 2PW1A 1F11B 5JW3H 4P4RA 3E0GA 3D48R 3FO1B 1KGCE 3QRGL 4Z8FL 1ZANL 4ODHL 3QNYA 1ODAA 4CNIB 5L2JA 4ODWA 3D18A 3PP4L 1DFBH 3BIAX 4P5MA 5ETUB 4APQB 3PXJA 4ZUVA 3CFJA 3QPXL 5D7JA 1GYAA 4OZHA 1GCFA 4LSDA 4CVXA 4DWHA 3EYFA 3SBWC 4HH9A 4LCYB 5GISH 3T0EC 3VFOB 1IM3A 5D5MA 2I24N 3O6KH 1RJCA 4ZD3L 5D7LD 2XY1A 1CG9A 4M93B 5DRZB 1S9WB 4D0BA 3IDJA 5C09A 3BN9D 2D4DA 2EO1A 2E5EA 3VRIA 4P5TC 4LSTL 2ZJSH 1UG9A 1RUPL 3OJ2C 2LU7A 3I3BA 2IADA 2XN9D 4Y5VB 1JYXA 4X7TB 5LKNA 1U8QB 3GI9L 4RIRB 1CVRA 2FX9H 2PETA 3X12B 4IJ3B 1IGML 4R3SA 4JKPH 2NW3B 4PJXA 4DN4L 2BJML 1CGUA 1EK3A 4JHAL 4DJMA 1CF8L 1QNZH 3U6RB 3RI5K 2CLZA 4GAGL 4K3EL 4BQ9A 2JCCE 3FAXA 2IAMB 1DVFC 4EDXA 1AXTH 5A2IH 4WHDA 3VXPB 3RWHB 4UILL 2PNDA 4FXLA 4AT6B 5ABDE 2DJ4A 2VAJA 2X4NB 3TC9A 3V4UH 3VFUB 3ETBF 3HMXH 3QHZH 4JFPB 3SQOH 3V4PL 1QR1A 5TQ0H 3VE0B 5GRYA 2DI7A 2VABA 3E8UH 4U1GB 3VMOA 3GEWB 1MRFH 2X70A 1FORL 3IFLL 3O2WL 1JHKL 4NN5C 5ANMA 2AVGA 3OKLB 3MRBA 2QADD 4R26L 3JWOC 1A7PL 4ZSOB 2GJ6D 3W81A 1XIWB 5SWQA 3QI9A 2IG2H 5C92A 2RAMA 5DD5L 5F7LB 4MXWL 4TVPL 4XXCA 4I9WE 4QKXB 2NCMA 1V7MH 1U8JA 3BP7A 35C8H 5DD0L 4Q9RL 4LSSH 4L9LB 4Y1AD 3V0WH 4GS7B 3PWVA 4U1HB 1CI5A 2YC1A 4RNRB 1SJEA 3G5YA 3Q6FA 1KIRA 2D7PA 4L4VA 1B4JL 5DQJB 4F33B 1XF5A 2HKFH 4M5YH 3VXQA 4GKNB 4JQIL 4QRRD 4EVNB 4XCCH 4XP1H 1KIPB 5EOCJ 1CGSH 2E7CA 3KPMB 2P43B 2P45B 2H2SC 1RURH 3IDIA 3LMJL 2BDNL 1DUZB 5DC4B 3PQYA 3GMNA 2AJYH 4O2FB 1QEWA 2C1PB 4PS4L 43CAA 3VGFA 4IRJA 2H1PH 4PRIB 3LZFH 1MHEB 3NIFE 4I77L 4U1IA 3FT4B 1F2XK 3BEWA 4MJIB 5HYQA 4WU7A 5IR1B 4XCFH 2VKXA 5C0DA 3VJ6B 5C0GB 2V2WB 3D5OF 5L8LB 3DO7B 4PJDE 3DPBA 3RNQA 3TJHD 4XPAL 1KEGL 1QSED 1NFDF 2IFGA 1U8KB 1XGTB 1DBKL 3MNZA 4LBEB 4TUKH 3QUYB 3RBGA 3ZMRA 3MV7A 1BZ7A 4PLJD 2A6KB 1F4YH 2OZ4L 3U46A 5FO7B 2NY1D 5EO1A 4JJ5A 5KS9E 2YR3A 4MQXD 3HAEG 2GJZA 3RNKB 3FT2B 4N0YL 5GZNC 1FG2A 4XC1L 5LAXA 1T6VN 1IGYA 4KI5E 3SDXA 2VLKB 4X6BB 4RCAA 4OD3H 4L8SC 3MRDA 3KPSB 2CJUH 1JNNH 1OL0A 1XZ0B 2HFFB 5BV7H 3HRZB 5KJRL 5EH1A 1CFQB 2VXVH 4O2EB 4LDLB 3H7LA 4EN3A 3H42L 5CINL 1ZVYA 3IJSA 5H37H 5KSBB 2QQNH 2UY7A 1TMCB 5JNYB 2PXYA 1BBJA 1A3RH 2D7TH 3LN4A 1G7HB 5EZIL 1HIMH 1KCVL 3S36L 2YRZA 4OLUL 4YXKH 3L1OH 4CN4A 4HEME 4NJAL 4XNQB 1QLFB 3BDYH 5E7BA 1D9KC 5E6ID 5DGRA 3QIUA 1PFCA 3LKNB 1K5NA 2GUOA 4HV8B 2F74B 1PLGL 1A4JB 3QIBB 4FQ1L 3MBXL 2EYRA 2K3TA 4NKMB 3C6SB 1HEZB 1KJ2L 3PV6B 3AC0A 1KB5B 3NGBC 4QRQB 5AUMB 1N26A 3ARFC 5DR5L 5DHVA 1A47A 4OQTA 1OAXH 4O9HH 1WZ1L 2ICES 1TTFA 1S7XB 2DLHA 4RMTA 5FO9B 1MWAA 4P3DA 3I6KB 5FCUH 5JMOC 5C71A 3HI1A 3JWDH 5I8EB 5AWNL 3OKMB 1YECH 2OR9H 4ZUUB 3FKUS 1JZ3A 3VW3L 3T65B 3RZCB 4WEMB 4ALAH 1NJ9B 2VL5A 5ESVB 2W59A 2AXJA 1E6JH 1YEEL 2Y6SC 4NNYA 4XZUA 4LEOB 2MOVA 3BESR 1VB9A 1SYSA 3M07A 5K9OA 4PJ9D 1XMWA 5GJTL 3HS0B 4LU5L 2HJKA 1X6NA 4L3EE 5I74C 2HFGL 1VESA 4RMQA 1GSMA 5CJQH 4WFHE 4NQDB 2VISB 3X3GH 1T89C 2Z8SA 1AR1C 3EUUA 3T77A 4KKAC 1E6OH 1FO0L 4PRAB 1FVCA 5T1KA 1LO4L 4K94H 3C60C 5J6HB 2PR4H 3L6FB 3W0WE 5DRXA 4DKFH 5IROA 1IMHC 2X1OA 4KVNH 1FZJA 4X5WA 4JG0L 1TJHL 1N7ML 2A73B 4WTWA 1NDMB 2RIKA 2EIDA 3N9GL 5CJ8A 1FE8H 4FTVE 2SEBA 3ARPA 2PO6D 1A5FL 3A6OA 4H0GA 3QCTH 1OLLA 5GRJH 5JXEC 2FSEB 2I26N 3FQNA 3HPLA 1MLCA 1NLDL 3O4LD 4P5KB 5CUSH 4LLDA 4PP1C 2H32H 3MBEA 1G7MA 2NY7L 3LH2L 3C2SA 1S7TB 4GJTB 2H2SD 1YPZE 1OAZL 1CZ8H 5C6TL 1L0YA 4Y16C 1QRNA 5MEPB 4OD2A 1Z2KA 2YWYA 3WIIH 5CEZL 5HVWA 1KPUB 4QT5A 3K2MC 5D70H 3F7VB 1CK0H 2RFXB 1T3FA 5EC2B 4X80H 3ZHKA 2DMCA 3RWCA 5EU5B 3OGCB 2IGFH 4NHUA 4NZRL 5JPNB 3VWJA 5KSAA 1U95B 4G3YH 4QHMB 1MFBH 2VR9A 1DEEA 4HK3J 4N1EA 1I4FA 4CRPA 25C8H 2VKWA 5I1IH 4K9EH 1GH7A 3HG1E 3MUY1 4N0RA 5I17A 5BXFA 4QNPF 3UP1A 5DYOB 5ADPH 3DWTA 3VFWA 3EDJA 5I2IA 1P53A 2R1XA 3ZKXC 3V5DB 2CIIB 1FFOB 3UZQA 1XR9B 4PB9H 3ARDB 3ZYOA 4PGCB 3VXOB 3D39E 1S7RB 1MI5D 1GGUA 4LRNH 4CADA 1NBYA 4JO3H 5D93C 1K4DB 3TH2T 4OGZA 3FHAA 2BY1A 2DQTL 3NA4A 2HFTA 4IMKC 5TE4L 4JQVA 1ZVSA 3FFCE 4JREC 3KDMA 4FZ8H 4KK9D 3WUWA 4PG9A 3GGWA 2ICEA 2P5WD 2EDRA 2UWEA 3FZUC 1HYRC 1CCZA 3STZB 1VGEH 1CFSB 2XWJA 5CHNA 3TEUA 3HI6L 3OX8B 5EA0H 4YGVB 4QF1B 5I1CH 4FFYH 5F7EH 5C70A 4LARL 1NMBH 1F13A 3DNKA 3GHEL 3GSWB 2DMBA 1KV3A 1NEZB 1K2DB 3V4VH 4F9PC 1S7VB 4LLAA 1EFXA 4PJGB 1RHFA 1WEJL 3UJJH 3BPLB 3C08L 4WNQB 4LVNC 4JRYA 2NY3C 2Q8AL 1IC4H 3O8XD 3MRQB 3QFJE 5JLZA 2X7LB 4NYLB 5TF0A 5C2UB 1WITA 5J12C 1MREL 2V7HA 1F42A 5TPWL 2DQDH 5J3HD 4BH7B 4M7KH 1PDKA 1AI1H 2DQEL 1UQSA 1F8TL 1RIHL 1LDPH 3QUZB 4XVTH 2PKDA 3TNMA 2ESVA 5BS0E 4Z5RA 9CGTA 5LQBL 5EBWB 2NX5B 5E94A 5MEOB 4Y4HC 2WUCH 2Y6SD 3SKOB 2IPKB 1JNLH 4NC1C 4XP5H 5K9JH 1KTDA 1IEAA 2JCCF 1ZT4A 3SDAD 3VRLF 5DQ9B 3P4OB 2WBJA 3MXWL 5LVEA 1N2RA 1XCTB 2ZUQC 4XP9L 3HE7C 4UBDC 3ARED 5DGQA 3X13A 5JW5A 3R0NA 1U42A 1AR1D 2BVPB 1B6UA 4GSDH 3QUKA 4KKAD 4HIEB 4PJEE 3RL2A 3D9AH 5I1JH 4JFQA 3WXWL 4X4YB 1KLUB 1NGQH 1OHQA 2CH8A 2XTJC 1HYSC 4Y4KC 5IK3B 5IW1B 2DRUA 1A6ZA 4UT6L 3EFDH 1GIGH 4Q0XH 2ZSWA 4AH2B 5CKGA 5JOPD 1HQ4B 2XYCA 4QRSB 4PY8I 1A1NB 4XAKE 2GAZB 3W39A 3RIFF 3L3JA 1KCUH 2BVEA 1NFDA 2FB4H 3BZEB 4PRPA 3LEXA 4AK1A 1IAMA 3PWNA 1FYTD 2VH5L 2OZ4A 4EOWL 5JXED 4EJ1C 4HGWA 1AD0A 5ESAB 4GG6B 3DHJA 3IJHA 2N4IA 5CSGA 3GSVB 2Z31B 1EHLH 3UMTA 4LP5A 2X05A 1QSFB 5I1HL 5DK0A 1CGVA 5DWUH 1DLHA 1H3GA 2CKBL 1PG7H 4N5ED 1U93A 5D72L 4WUKL 2K7QA 1YEHH 1WFTA 2IQAB 4H25A 4W81A 2O93L 1AGDA 2VXQH 4X7FC 1RU9H 4IM8A 2ADIA 5F70A 4J3UA 4FQIH 5HTSA 4LLQB 3TESA 5TE6L 4G5ZL 5DVNA 2B1HH 5KN5B 4N8CL 3ZT7A 4NJ9H 4C4KT 4Y2OA 2VUOA 2FIRT 3HCVB 3GBML 3FQXA 3TH4T 4YXHH 5ACZB 2GTZB 4PJDF 5LGJB 4Q2ZB 3ARBB 4K3JL 4X6FA 5D7IE 3DYPA 4ODVL 2BC4A 1U8OB 2X1PA 4PJBE 5FV1L 4PUBL 1KJ2A 1WZMA 3KPQB 1Q9LB 3S35L 1UYWL 1I9IL 2ZCHH 2DYPB 3J8F7 3MNWB 2C7UB 4QHUB 5EG6C 4UQ2B 5GRZA 2VITA 3HNTL 2DI8A 3DMMB 4H0IA 3HKFA 4IEFB 4QYOA 4Z7NE 2NW2B 5GZOC 4G42A 5E7FA 4ORGB 4KI5F 3RJDA 5C2BH 4PD4J 5FKAB 5E9DA 5I76B 2QQLL 3DTXA 3V6OE 4I3RL 5I1LA 4XTRC 5DA4A 5SWSB 1CLOL 4XPGH 4ZS7L 3FN3A 4KJPD 3GIZL 4KC3B 3SY0A 5D7LE 4L4TA 1SEQL 3DGCR 2VRAA 1YYML 1D7FA 1KTLA 1UJ3B 2VWEE 2WSKA 3CFKA 3IFPA 4JB9L 4Z77A 5I9QC 1J0KA 3E2HB 4U0RC 5BV7B 1N64L 5BRZD 3JBG7 4NUGH 4LAQH 2XN9E 1T0MB 5D1XB 2HVJA 2YPLD 4YFDB 5I19L 4QRTB 2OL3A 2CMRL 3PABB 3SE3A 3ZDZF 3LB6D 5BMFL 4JFYB 2R1YB 2Q8BL 1FO0A 4CMHC 4IRSD 4OLZH 4ZXBC 4MAYD 2NY3D 1S7WB 1E28A 3MREB 4XMKL 4JFFA 1ZK9A 1A1OA 2CUMA 3QEQD 3O45A 1NEUA 3D3VB 1C5CH 3QEGH 1MJ7L 4PJHA 1R3LB 5C0CD 1JGUL 5J4MA 2MTPA 2RB8A 4WI7A 4JFXB 1FNAA 1AD9B 1R5VB 3P4MB 2GIYA 4G8GA 1LE5A 2BVTA 3L3HB 5DVMA 2BNRD 2BSED 1NAMH 3NABL 2YK1H 2AJ3A 4WW2B 5DD1L 1N3NA 3Q1SH 1DANU 1IAKA 4Y4HD 2AEIT 2F5AH 3H7BB 4JG1L 4G9DB 2FBJL 3BH8B 1HDMB 1DQQA 1J05A 3EJZC 1TZIA 4R4NC 5ICYB 1BBDH 1T1XA 1UENA 4PJCB 1YY8B 1T7VA 5EO9B 1S3KL 3BX7C 1FGVL 4L4JA 4U1KB 3OV6A 2GJ6E 1ZAGA 4FQQB 4HIJB 1AO7D 1I8IA 3OR6A 4QO1A 4NWUL 2EDOA 4K7PY 3O0RH 3TO4A 1E0OB 3MRHB 1IFHL 4HH8A 1UWGL 4XNZC 4ISVA 5E2WL 2YN5A 1HYSD 2YPVH 3RFZC 4HUWB 5D2LE 1R5WA 5LG1A 4YHYC 1L4IA 4LNVA 4PGBB 4Q6IB 5HI5C 4Z7WE 3VU2A 3QFDA 4HC1H 4NGHL 4NRXA 2BNQB 5DHVH 2V2TA 3F8UB 3NFPB 1FIEA 5F72S 4FP8H 1EAPA 4K8RC 4G6JH 4QRRE 3LHPH 1J1XL 1TVHA 4TTGA 3QG6A 1IEHA 2KZ1B 5ENWA 5LXGL 5DURD 3ARZA 4JFOB 3QO1B 4M4RA 5BW7C 3SCMC 2YUZA 5J57B 2NY6C 3ARXA 4UV7H 2W0FB 1NGYA 1UEYA 3H9HB 5D1ZA 2BSSA 2AK1L 4OCRL 4FQXC 4JGUA 5FYJL 4O51A 5IHBA 1MQKL 3D2UD 3AS1A 4XX1G 1XEDA 2AK4D 3EGSA 3T4AB 1MCWW 4XCYB 4DKEL 3HR5A 1T1YA 1JYVA 3WFDH 4DZBA 4F7TB 1VADB 2AXFA 1MRDH 2F58H 4GKZB 1YPZF 3IFNH 3ARGD 4HWBL 4GKSA 4KKBC 1LNUB 3LKPA 4K3HA 4OKVA 4KAQH 1HINL 5DJ8A 4P57B 4LSPL 2VE6B 2H32B 1QSEE 1JN6B 1X4ZA 3VMPA 5IQ9B 1IBGH 1TVBA 2MKWA 4DTGH 1T5XA 3RGVA 2QKIA 2UUDK 3RTQD 3VFPB 1VKXA 1SJHB 1G9NC 1NCBL 2CD0A 5LCVH 2HYMA 3UTQA 1S7QB 3JVGA 1RZ8B 3VXMD 5KSVA 3IJYB 4HIHA 3GK8L 2EDWA 3LKRA 2E6QA 1SYVB 4JDVB 3PV7A 4ODSL 1CIUA 3OWEA 4N1HB 3W9DA 1DBML 1LDSA 3G04A 4AZ8A 2NY2D 4Z76A 4UNTA 2BXYA 4OV6F 3P0YH 3BQUB 3QJFA 4L5FL 4FFVD 3KAAA 1G0DA 5GZOD 4ONFL 2YXMA 2LV4A 4P2YA 3ZTJH 5BZDA 1P4IL 2Z8WC 3G6DH 4E42B 1X4YA 3M1BB 2BRRH 3MRJB 3RA7L 1BX2B 3O9WC 1JHLL 3T0EE 2HMIC 2P8MB 4FN0A 4LKCA 4KMQA 3IAQA 2C3WA 4JY6B 4PY7A 4G8IA 4IDLA 5D1QA 3MRPA 3QDMB 1OM3H 1JUFA 1WQVT 4U6YA 3FQWA 4CMMB 3ZDXF 2JCCA 1FAIH 4CL7A 2ED8A 3NAAL 2AI0L 3KPRD 5CSZB 4ZPVA 5EIQA 1M05A 4J6RL 2H26B 4WVRA 2IPTL 3BP5B 2X41A 4D94A 4EI6A 4P2RD 3BUYA 4JZOB 2X5PA 3WO3B 1TCRA 2PTVA 2Y5TB 1MIMH 5IBLC 2R0KH 1DQML 4HKBB 4I2XA 3ZLQC 2VC2L 5KVEL 5C7XH 1XGPA 3FQUB 2W0KA 4XB8A 3IETA 4OGXH 3ROOB 4S10A 1AJ7L 4KROC 4WEBH 1Z6JT 5EOQH 1IGIL 1DN0B 3WS3A 4U05A 3QUXC 3NH7L 1IKNA 1UACL 2FWOA 1F3DJ 1BEYL 1MCFA 3MV9D 1BZQK 3GMLB 3E6FA 5E8NB 1F58L 2A2QT 5IW6A 3F12A 2B4CC 4UOW0 1GHFH 2VLLA 3EJZD 4P2OC 4DCQB 4RGOL 3NA9H 2VLRD 4GRMA 5ITFA 1QA9B 5JHLH 2V9TA 5DLMH 5TJWK 3LKQB 5HBBA 4Y5XA 3RWIA 4XVSL 3IS1X 1X9QA 1JBJA 1NGPH 3T1FA 2PW1B 1KJMA 5D2NB 1MIEL 2CKBA 2E6JA 3OBAA 1IAIH 3EJYC 4YX2H 1KCKA 3ZYIA 2UZIL 3SDYL 5J1AB 5A40E 3QNYB 3MLVL 4PJ5D 3EDFA 3RVTC 3T08A 1FNGA 2XQYG 2IBZY 3B5GA 4ODWB 4PTTB 5FAAA 5L2JB 5HGBA 2RQ8A 1S78C 2DKUA 4ZUVB 5JZ7C 2XV6B 4JZNA 4F7CB 4OM0L 4QRPD 4FQJL 3VFVA 4M6NH 4FA8A 2ZWLT 5EIVA 4HH9B 5F7NC 3MGAA 1JPGA 2NY4B 2EIZA 3AROA 4P46A 3O4LE 3RWFB 5F71A 3LEYL 1A7NH 1CG9B 2JJVA 4PJDA 3FB8A 4M7LH 1U58A 4LL9A 5C09B 4Q9RH 1HHHB 4HWZB 3MLZL 3L95B 4JFEB 4LVHB 2F54B 4WFED 3VRIB 4PFEA 1NAKL 1MCIA 5C3TA 1G9EA 4EI5B 2Z4QB 1MF2H 1IAII 4LHJB 1CXEA 4UT9L 1I3RB 1ZWIB 2OJEB 4R4BB 2NTFA 4M7ZC 4R3SB 1Q9OB 5E2VH 3CSYB 3SDDC 3M8OH 4DW2H 1LP9F 3IFOA 4KKBD 1G84A 2X4TA 5KW9L 1HH6A 5EU6E 4U1JA 2Y1VA 3SE4C 3QXAB 2A83B 5CJ5A 5C07D 2ICWI 1PJ9A 2IMNA 3ZKNC 3I3DA 4M02A 5F9OL 4V1DB 1BVLA 1CXFA 2A6JA 4HUXA 5ID0B 5KAQF 4H88H 4FQ2H 1IC7H 5IT2H 2H2PC 2BOCA 1BOYA 1G7JB 2ENYA 3B9DA 5C6PB 1QR1B 1BF2A 4MCYA 4JHBA 3QO0B 3MRLA 2VABB 4TOYH 1WV7T 4XP6L 1MI5E 3ULSB 4NQCD 5D7IF 3MV01 1G7LB 1RVFH 4P23C 15C8L 2X2YA 3C6LB 4PJBF 3VFTA 4R7NB 4PJ8C 4JRXD 2NXYB 5FGCE 2VXTH 4S0TD 3S3JA 3RBSA 3P73A 3TVMC 2P47B 3QI9B 3U82B 3WO4C 3U0PB 2P5WE 5MP6H 1OWRM 1RZJH 3GSUA 3P40A 4OLYH 1YEIH 3BH9A 2J8OA 1MFEH 3KPLA 1AE6L 4CN6A 1MCRA 4Z7NF 1OARL 3GSNL 5MEND 1T04A 1II4E 4NCC1 5CJOH 2HMID 3WIFA 5JORB 2B20A 4K55A 2VQ1B 1G0YR 1CD9B 1T7YA 1HHKA 3PWJA 3G5YB 3Q6FB 1KIRB 4PRHB 5BVPH 1A6AA 3KR3L 4HD9A 5BJTB 2R4RH 1XF5B 4Z95L 3DLQR 5K9QG 3VXQB 1LO3H 2OYPA 2XZAL 2AXGB 1OP9A 3SPVB 4HCRA 1D6EB 4IRZL 5E4EC 5CEYA 4Q9QL 3BO8A 4YFEA 4XXDA 4UIKL 3CDFA 4HKJA 4L3EA 4WY7L 3QIWD 4HXBL 4JPWL 2ARJA 2E9BA 3S37H 3CZJA 1Q9KB 2GY5A 5DJDB 1GZPB 4MNGB 3I85A 4U1IB 3I50L 2HTLD 5JW4M 1CFBA 3ZE1E 2D3VA 1KJ2H 5FYKU 4JKWA 4LLUB 5H8DA 4LLMB 2D7MA 3RY4A 4QHNB 2HT2D 4HS8H 3W0WA 4MA7L 1NBZB 1AHWB 1SMOA 4PJAE 3Q5YA 1B9ZA 3E1F1 3TBTA 5MI0C 3DUUA 5E0QA 1RK1A 3MNZB 1J1PH 5E5UB 1DN2A 2X4UA 1I85A 3G5VA 3MV7B 5D7KD 1Q1JH 4G8EB 4LHQB 4BK5A 4HHAA 4OFYA 3BE1H 1KPVA 1RZKL 4FTVA 5GIRA 1BIHA 4KKNA 5DEGA 3SN6N 1JZ6A 1N8ZB 1RK0B 4X6CE 2R69L 3B2UC 1QKZL 4R8WH 1QOKA 1NAMB 3BZ4A 4PREB 1FG2B 4NM8H 5LAXB 1N59A 4HMDA 5TDNB 4WO4C 2IAND 5H94A 5F9WC 3TA3A 5J6GA 4HWBA 5CBEB 1ZHKB 1YPZA 5JOPE 5J11B 2QSQA 1MHHB 3DX6A 1S78D 2OL3H 3UPAA 3IJSB 5JZ7D 1TTUA 2NY5L 3G9AB 1JPSL 4Y4FA 4LEXH 5DD3H 2PXYB 4RAVB 4YHNB 1BOGB 1CGWA 5D2LF 1FYTE 3HNVH 4JM2A 3RJQB 1S9XB 3BXNA 2ZPKH 2W9DH 5BZWA 3IAPA 3MJ8B 4AL8H 3PL6D 2GCYB 2P7TB 5T5NF 3VFRB 1BWMA 1T03L 4MNQB 4K7FA 4I0PA 2CDEA 4D9QD 1YUHB 4IIQA 4LCCA 4NC0B 2PF6A 2AGJH 3DI2B 5IB4B 1VFBA 4UINL 3HG1A 5DHVB 3WXVH 1NCDL 1AFVH 1X4XA 5I1AB 4OUUA 5JIIA 1HNFA 1QACA 2A9NL 4NOBA 1AGEA 3MFFA 4O4YH 1CE6B 2CPCA 4HJ0D 1RUMH 4LAJH 5INDA 4GMSL 2FYYA 5D4QA 3D39A 4LHUB 2YA0A 5E2TL 3REVB 5F1NA 1JZ5A 3PDOA 4GQ9H 4HJGA 4XZUB 3FFCA 3VD7A 5AG8A 3AUVA 5DVKA 1HI6A 4TNVF 1ONQB 3QJHB 3VG0H 5T5FL 4ZNCD 3N06B 5T1DL 4FQCH 2N56A 1V3KA 4F15B 1J8HD 4ZOCA 4NZRH 4NO5B 3R0MA 3TT3H 4LCIH 2UVFA 4AEFA 1DBBH 3BKMH 3C5ZD 4NZJA 1SM3H 2N1KA 3LN5A 5EC1A 2A77H 1SBBA 4JN2A 4IDJH 4P23D 3MCKA 4KRLB 4NZUL 4UDUB 5T1KB 1CE1H 4F9LA 4J8RA 4PJ8D 4HULB 4NN7C 1KPRB 2I5YL 3F6LA 5DRXB 3KNBA 4DK6A 3WV0A 3UTSD 3LQAC 2FHBA 1NCTA 3FT3A 1UCTA 5D96C 3QFJA 4Z6AT 3B9KA 3FQRA 1VSCA 3K81A 4NBXB 1QG3A 5E8EA 1LO0H 4ZPTA 4PG2A 2CGRH 1QVOB 3QHTC 4X7DC 3FCTA 2SEBB 4HXAH 4DVBA 3P0VH 3IDNB 4P4KB 5C9JA 5BRZE 1OB1A 3O6ML 3PGCB 4F57L 2P24A 4N9OB 2RCSH 5GSVA 1Z3GL 5B21A 3G6JE 4ZAKD 1KTRL 1BQHA 2YRLA 4O2CA 5L9DL 4PYGA 1G7MB 1A7OH 4MHHI 4ZO7A 1BM3L 3WFBL 1U92B 3WBDA 5I66B 3VXTA 1LEIA 5CLTA 4Y5YB 1DLFL 3QEQE 4IRJC 4Z7UE 5C0CE 3ZE2E 2DQJL 4YUEH 3QWOA 1FZKA 1B3JA 2EDDA 1QRNB 4XVUC 3MACH 3LS5L 2XNAA 4L8CB 1YN6A 3MYZA 1QFPA 4PJEA 4KKCC 3KLHC 5CMAA 4AYFA 1CQYA 3VWJB 1AKJA 5IGXH 4NC1E 4HFWB 3CFDB 1WFOA 4M1DL 2PCPB 1IQWL 4HUUA 1FDLL 1IT9L 1Y6KR 5JDSA 2XQBH 3SGKC 4Y2DB 1MCEA 1YNLL 3E3QC 1UM4H 3FB5A 4OM1L 1P4LB 2OM5A 2OJZH 3TIDA 3D69B 1EH9A 2DBJA 5BXFB 1GZQB 3ZKMD 1H0DA 5LQBH 1AO7E 2VTFA 3FO2B 4A6YL 4I4WB 4YIQA 1JWMA 2V17L 3VFWB 5IVZB 4YQXH 1AQDB 1OTTD 3QAZC 1UH2A 4WO4D 3RWGB 1SMAA 1NBYB 1HXYB 1HWHB 1I8LC 1TZGH 4EN3C 1A9EA 2JJSA 4MQ7A 4N8VB 4XVJH 5FA4B 1WSST 1GC1C 2ZOLA 4NZTH 1Q38A 5B22A 3GGWB 4MWFB 4FOMA 3ORJA 1HOCB 2UWEB 2IALB 2OI9B 2WINA 1RQ5A 3JV0A 5IFAH 4ZTPH 4UDTA 4YDJB 1XGUB 4FABL 1KN2H 1L7IH 3QIUC 4U1GC 5GGQL 4YDVB 3B9VA 3UTTD 4HBQA 1FH5L 2OTWB 3JV4B 2A6IB 3MRCA 4K2UH 4ODXB 2AK4E 1YEJL 5D7IA 1HILB 4ODBD 4GO6B 4PJBA 5IKCA 1QUNA 2BZDA 5GGVH 4YDKH 3GKWL 1L0XA 1UXSA 2ICWB 4U2YA 2ZUYA 3A67L 4ZDHA 2FR4B 4LLVB 1UQSB 3OKOA 2PN5A 3B5TA 5HHMB 5DI8A 3TNMB 1EO8L 3ARYA 4KK8C 3GSNA 1ZLSH 4ZQKB 5GS0D 2Z35A 4JGJA 4ZNEE 3TPKA 2CKBH 4BSWA 1MRCH 3V6OA 1KTDB 3RVXD 2XWBB 3VXME 4OD1H 3QUMH 4NQEB 5GGRB 2WIMA 4TVSa 1RJYA 3MUHL 1OP5H 1MAML 3SGEH 3DROB 3U7AA 5D7LA 5MERA 4XP4L 5JPMA 5KBNC 2W38A 4YWGH 1BWWA 1K3ZA 5EUOE 2HN7B 4M43H 4YBQC 5HHOB 2A9MH 3VCLA 1IGTA 3RL2B 2FO4B 3TBYA 2XN9A 3KLAB 1PYWA 4JFQB 3U7WL 2D7QA 1ORQA 1WBXB 3DX8A 4LCWB 4ETQB 1DE4B 4LMQE 5L6YH 3KJ4B 4LPTA 1FV1B 4YLQT 5B38A 3STBA 4U1SA 1RHHA 3TBWA 1J88A 2ZSWB 5IJVA 3C09C 5ACMA 4R9HA 4HUVA 1IGFL 1GGIL 5HHQA 1HK6A 3UJTL 1NC2B 2IPUG 3W39B 1QBLL 1G6RL 1DBAH 3KPRE 5A16A 2DM4A 1OTUC 4LHUG 4S2SB 3SGEI 1CFNA 4M6AA 1IRAY 5ALBL 2ZUXA 5EUKA 1KIQA 3MBEC 4PBVC 4P2RE 2FH6A 4XCEB 4HW6A 2XTLA 1Z9OA 7FABL 2AKRB 3BW9B 4XBPB 1AD0B 4RDQF 5DRNA 3R8QA 2YPKB 2K7PA 3VGEA 1A2YB 4G7VL 1JGLH 1KENH 5FM8A 2GFBA 2VDRL 4APQD 1G9ML 2MPAH 3GMMA 3MLPA 1DLHB 5DK2A 1RZFL 1T5WA 1S5IL 2IF7A 4XC3H 3W5NA 2F19L 2GJ6A 5LBSL 1OAKL 5KSAC 1AGDB 3KXFB 2FJHA 2W9EL 1MFCL 5I1KL 4FQPA 3FJTA 3MV9E 5DUPL 2GW5A 2LQRA 1YQVL 3ILQD 2HJFB 3STLA 3VXRB 4ZFFB 1R3IH 4D9RD 5D2LA 1MCPH 1TETL 2VLRE 4D8PA 5T1MA 2CK0H 2IC2A 4Z7WA 3FQXB 3CVIH 5GS1B 4PJAF 4X6FB 4KJQD 1F90H 2AEWA 2BC4B 2Q86A 4LSRH 4QRRA 1INDL 4PGJA 5ID1A 1KJ2B 1S5HB 1VFAB 5DD1H 2Q6WA 1FNLA 1SVZA 4KK6D 1A22B 4FQHB 3O2VL 5F6HJ 1JMZA 1B90A 1KEML 4HT1H 3TPUA 4PJ5E 2FLRT 4X6CF 2IAMD 1T1WB 5EORL 1BVKA 3L3DB 4AEHH 3IVKB 4QYOB 3CLFH 3V5HB 5D7SH 2C4FT 1BJ1J 1UWXH 4HCRH 4LLYA 3ULUH 4QRPE 5FK9A 3TT1L 4EIZC 3IXTA 4AMKL 5I1LB 2BY2A 2F8OA 4EBQH 2NNAB 1HSBB 3EOTH 5CILH 2R56H 4J1UB 1ZLWK 4L4TB 4JY5L 3G08A 4YHMH 2A6DA 3WD5L 1QSEA 3K4AA 3NCMA 5HDLA 1U2CA 4HS3A 4WFEE 3IXAA 4TQEH 3F5WA 1XIWD 5DS8B 4HPOH 1MLBB 3BSZL 1W72L 3F7PC 1HH9A 3SHSA 2OL3B 4UI2A 5CP7A 3ZT6A 3SE9L 3DYOA 4JPIB 3BEVA 4YJZL 4QHLA 1J1XH 2H9GA 3QA3A 1TZHB 1MY7A 2Z93A 4JFFB 1ADQH 2DDQH 4QOKB 5HPMB 1JV5B 3WKNA 1LE5B 1UZ8B 3HUJE 3RWJB 1BJ8A 5C07E 3L5WB 4RZCB 1KG0A 1YC7A 2X4QA 3L5XH 4N8VG 2A1WL 1KCSL 5EPMA 4EUPA 1R3HB 5HHNA 1QPXA 5J9PA 2WBJC 5KSUB 5DFVD 4PR5A 1ZSDA 1NSNH 3DYMA 1DTUA 3SBWA 1TZIB 3CZFB 3MLRL 4M7LT 5H2BA 4DVRH 3BYYA 3FMGH 4AENB 2Q20A 4KRPB 4R96A 3OF6D 2VDPL 1EBPA 4NQCE 5E6IA 2EC8A 3OG6B 1PGRB 5I30L 1UVQA 4CVZB 3I75A 3BKCL 2WW8A 4RFEB 4PRID 2R0WH 4KZEH 4RISL 1A3LL 3T0AA 3C8KB 4MA8H 4MJID 5J06A 4YBQD 1I8IB 3OR6B 4HDIB 3NN8B 3DSFL 3TO4B 3ULVD 1U3ZA 1QLRA 3BHBB 1QP1A 5GGVY 3O2DA 1B0WA 2AEPH 2LABA 2AAVA 5EO0A 2PTUA 3PNWA 3P9MB 3U79A 3D25A 1JRHH 3DURA 2ORBL 3QUYD 2YMXL 1C1EL 2XACC 3IDMA 1GAFH 1NGZA 4JO4H 3QFDB 2ZNXA 3PWUA 3SKMB 2Z92B 4ODTL 3D0VB 1FC1A 1YEKH 1D5BB 2DTMH 1NQBA 3I2CL 3MOAL 4WI4A 5B8CA 1MH5B 1EAPB 3IDXL 5IQ7L 5D8JH 4D2NA 4DN3H 4Q9CA 3RVVD 1TVHB 3QG6B 3O3DB 1QFHA 4YGAB 1KN4H 4RX4D 4JHZA 2VLKD 5TF1H 1KELL 4PJ9A 3KPSD 4XPBH 2AJZB 4P3CH 2W92A 4J7RA 4A6YA 2EDKA 1VEOA 4WI2A 2Y36H 3VXSB 3TN0B 4BZ1L 2BSSB 2JB6A 1LK3L 5K93A 3G6JF 4LLWB 5DVOA 2E9WA 5KTEL 3EIFA 3HR5B 1T1YB 1JRHI 2AXFB 4R90H 4Z7UF 5IIEA 4NDMB 5HVHC 2XA3A 4D0CB 1CD1A 4OCSH 4OKVB 4LQFL 3VFGH 4S1QL 3GBNH 4CJ1A 4KI1A 5DRWA 3QIBD 4O02H 4JFZH 3GJEB 3QP3A 5IFHL 1T5XB 2HP4A 3RGVB 1U8PA 2QKIB 4FS0A 3KWWA 2HRLA 5GGTL 1PSKL 2PO6A 1FQ9C 1CBVL 4JAMB 1YEDA 1Z9LA 2J88L 5I1DA 3O11B 4HUKB 5JOFA 4ZO8A 1UXWA 1U8MB 2VDML 4ZFZA 2CQVA 4MD5A 3O4LA 2WM0A 4LDEB 3HC4L 5I71B 2VUYA 3H9YA 4MA3B 3VWKB 3T2NL 2BHZA 1N6QH 4N0FA 1HHJB 4TUJA 1KFAH 3D1MC 1NPUA 2CRZA 3QDGB 2QQKL 3QJFB 5E00A 1WFNA 4OLVL 4KHXH 1NGXA 4G43B 2M26A 5JHDD 4EDWH 3SKJL 4YEFA 4PJ7F 4I13B 4G8IB 3VD3A 2E9IA 5C08D 1JUFB 4U6YB 2FATL 3KYKL 3OZ9L 1M71B 4U1LB 5EU6A 4DUWA 3ULUF 1XGYH 4D9QE 3DX7B 1RZIB 3LN9A 1F3JB 3SE3C 3TZVB 3HNSL 1E4WH 2FGZA 4X7SL 3WNKA 5CS7A 1ZV5A 1RJZB 5LGHL 2QR0A 5D6CA 2CIKB 3UPRA 3MX0A 3BUYB 2CRIA 3CU1A 4UTAL 1TCRB 1MJ8L 3UO1H 4F3FA 2R1WA 5EBLA 4YPGA 3OAUL 2CRYA 2VNCA 4Y19D 3EHBD 2YA1A 3MGTB 2EYTB 1XGPB 1MI5A 2B0SH 2X10A 3BVNA 3ZYJA 5JA8B 1LWRA 1KCRL 3V7AG 2ADJB 3EYOB 4H20L 3MOQA 2DQIL 3OMZA 3FFDB 1I7TA 2P5WA 3QEUB 5DVLA 3MXVH 2FWOB 3ZE0E 1K3IA 4E41B 5DJ2A 1G6RA 5IB1A 3E6FB 5FGSA 1A6UH 2XWTA 5C0JA 5DUMH 1J8HE 3WKMH 3FB6B 3D0LA 1FVEA 1U9KA 1T7ZA 1WFUA 3EZJB 3I02A 2D0HA 3X3FH 2VMFA 2JELL 1NUNB 3S34L 2MKLC 2CKBB 2QEJA 1CT8A 3AMLA 3DIFA 5DEFB 2OTUA 1XF2A 1NCUA 2DQUH 3UTSE 4O58L 1TDQA 3QUMB 4N0UE 3O8XA 5C0BB 2L7UA 2Y07H 3VRJB 2XZCH 3QZWB 2XZZA 3IDYC 5AEAA 2MFNA 4GAYA 1KT2A 1FNGB 2AQ1A 1AGCA 1N4XH 4MS8C 2HKHH 3KPOA 4KVCL 1UT9A 4Z0BL 5L7XL 2MJWA 2FX7L 4W4OC 5F1OB 3L9RB 5DMJB 4ZUTB 3D87B 1QBMH 4CDHA 1Q0XL 4UUJA 4CU8A 3O3BB 3BPNC 1GRWA 4JDTH 5EOTA 2P8LA 4KKLC 2EIZB 2ITDA 2EH7H 5TE7L 1BGXH 3BRGC 3ARDD 5D1ZC 4PJAA 3EO9L 3BKJL 4NQSA 1QSVA 2E7BA 3SDAA 1U58B 4NSKA 1TQBC 1ZXQA 3H0TA 2C3VA 3UJIH 2NY0B 1VGKB 3A6CH 2DB8A 1T0NA 1FCCA 1NC4B 3AREA 2I60H 1T89A 3VFMB 1I1YB 2F8XC 5FHBH 4X6CA 5CD5C 5KS9B 3QDHA 4Q9BA 1PX4A 5EZLA 4RWHA 3VI4F 3JWNC 4ERSL 2H8PA 3NFSL 1T21A 2DF3A 3OJDA 4ODUA 4GUPA 4RGMB 1H3WM 4WHTA 1JI1A 2HG5A 4LFHD 4R0LB 1UFUA 1ZHNB 4MCZB 1EMTH 4BELD 1OAUH 3IS0X 2L7JA 4EZMA 1CICB 3KG5A 3B8YA 3CFBA 3CLEH 3OXSA 4JKMA 1CFTA 3U9PH 4FFZL 3QULA 2R0LL 4M6OL 1RZGB 4G6FD 4NN6B 1FYTA 5A43C 1NL0L 1WISA 2C1OB 2DIJA 5DJ0B 5JXEA 3FO0L 1W72A 1FL3A 4L8BA 4MCYB 1ZTXL 3MRLB 12E8L 1MUJA 3CFCL 4WI9A 3QUZD 4MJ5A 2G2RA 1ES0A 4MVBC 5I6XC 4MJ4A 1F97A 2NX5D 3LRSA 1CQKA 4FXGA 1PY9A 4ENEC 3ALPA 1X6LA 1YJDL 1RZKH 1X7QB 2XKNA 2HTKD 3EYUH 3EYVB 1QKZH 4DQOL 3RKDD 1XF3B 5D1QC 5C0IA 4N0CC 2QHLA 3N0PB 4U31A 1YYLH 4OIIH 3H8NA 1A9BA 2BHYA 4QXUH 3UTTE 5C8JB 3PWJB 5ADOL 2R9HD 2NR6D 1RUQL 4L3CB 1A6AB 4X6DF 5DMIH 4P49A 1N0XL 5BO1L 4WI5A 2FJFB 2DJUA 2W1NA 1JPSH 4PJXE 4JN1L 5HGGS 3MJ6A 5F7FA 3FN0L 4XXDB 2I27N 1GGBL 4HKJB 3BI9X 4GBXC 1BJMA 3MO1A 1JWSB 5TDOB 4K3DL 4KTEL 3TCLA 4MZ3A 1BVZA 3MLXL 5DEZA 4XCNA 2VSCA 1QQDB 1OAYL 3PGDB 2B39A 3HB3C 2P5EB 1P7KB 3GZKA 4LGSB 5FECA 1D3CA 1WGOA 3RL1A 4B5EA 1P84J 4I3SL 1ZHBA 1OPGL 4K7PX 3W0WB 5IMLB 1JNHA 2R29H 5LJYH 4F7MA 2YD4A 2Z31D 3UCRA 3HUJF 3ZKQD 1VPOH 3S88H 2Y25A 3DUUB 1QR4A 1NANI 4NQXB 5IG7B 3MLYL 1JGVL 1G1CA 4Y5XC 3UTZA 5ANME 5GSRA 3G5VB 3U7YL 1CTOA 5GIRB 1UM5H 1G9NL 3LD8B 2FIKA 2D7NA 4YHIB 3OB0H 5BRZA 4QTIL 5L2KD 2DQHL 3PHQA 2YPLA 1F6AA 1IGJB 2WWMC 3G6JA 5IVNA 2VZ3A 4F9PA 8FABB 3GRWH 2HLFD 2ADFL 1F3RB 5H94B 1LMKA 4JCLA 4IRSA 1SY6H 4LDOB 2G5BB 4MAYA 1DBJL 5K33A 1MFDL 2DLEA 3QXUA 2P8PB 4YBLB 3QEQA 1UM6H 4PLNC 4Z7UA 4AEIH 5C0CA 2C9AA 1R24B 4XMLL 5J6GB 2XKUA 4MMZC 3DX6B 2VSDA 1VFMA 3DETD 5MEQA 4MD4B 2W60A 4WDIA 4O00A 3TWCH 3P2TA 2BNRA 3NCJL 5FYLE 5A1AA 1BZ9A 4GG8B 5FYKH 2W07A 4JM2B 4Y4HA 4XHJC 4NKOB 3Q3GA 5GGTA 2BK8A 3CVHH 2DYPD 1LE9A 1BFOA 3OB0K 4C55A 1JWUA 4GRLC 3DMMD 4K7FB 2GK0B 4K9EC 1H3PL 3CXDH 4ZUWA 5E99H 4G6ML 1NCWH 5ICZA 4HIIA 5IW3A 3C5SB 2QHRH 4UTBH 5IBUG 5SWSD 3EO0B 4KI5C 4HPYL 1AO7A 4F57H 1INQB 4LASH 4MSWB 3L3IB 1AGEB 2YEZB 4YE4L 2J5LB 5JUEL 2VOTA 3L3OA 3FQTB 4OZ4A 3LDBC 3MJ9H 4D9RE 1OGAB 3D39B 3KPNB 5KVGH 1BFSA 4NUJB 3OKNA 4H1LA 4KUZL 4ELMB 1FN4B 5B39A 4HWEL 2ZKHL 1RULL 4R2GC 1PG7X 4HJGB 4NFCA 4AIZA 1DSFL 3FFCB 4XAWL 3E3QE 3L5JA 4MJ6A 1FPTH 1WAAE 3MLUL 3O2DH 1K85A 3HPJA 1CN4A 4KRMB 1KBGH 1PZ5A 4UB0L 2AJSH 5HYSB 5IEHA 1I7UA 3TJEH 1TNNA 1UWEL 3D3VD 5KVDH 4RWYL 5D6DA 1EVTC 1I9JL 4QTHA 2Y7QA 5EC1B 1KC5L 1NKOA 3RVUC 1C08B 1EXUB 3Q5OA 4TSAH 5F3HA 3WNOA 3W9EB 5F7KC 5I15H 3QNXA 1DQDL 3D2UA 4NNPL 4PJFF 2AK4A 1QFWH 4ENED 5I1GL 3JZ7A 2CRMA 2GITA 4XBEH 1E27B 3CH1A 4B0MM 3BFOA 1NMCB 2KZWA 3ARGA 2DBLH 4KTDH 3PGFL 1DR9A 2NXZC 4WJ5A 4ZPTB 3EFFB 3IDUA 5D71H 5HD8D 4HG4K 1A6TA 2NQCA 4FFWD 3RIAK 3FCTB 4CW1A 4MA1C 4ZSOE 4M48H 5D2NC 5BS0B 3JWOH 4M5ZL 3RTQA 5SX4I 4ZNEA 1A14L 3WSQH 3P11H 3L3GB 4TNWK 1BQHB 2O26U 3VXMA 3EYSL 2R2EA 2FL5A 4YDIL 1OOAA 1GGCH 2B5IB 5EBGA 1WUNT 3GMRA 5D9SA 5HHXL 2VDQL 4U6XA 2BVOA 4GBXD 6FABL 4R7DB 1QFWI 5DT1H 4AG4H 4UU9B 4AM0A 4B7IA 2AV1A 5EUOA 4NQVB 3TYGL 5I8OL 4WU5A 4PJEB 3RWEA 4BQ8A 2I9TA 4KUCD 2Y5EA 3HB3D 3NTCH 1CTNA 4Z78B 2CXGA 4JZJB 3V6ZA 2AJXL 3W2DL 3VXUB 5AZ2H 1AGFB 3C8DA 1DL7H 2GSIA 1PEZA 4TSBL 4OCWH 4HK0A 5BQ7A 4YHLH 2IBZX 4MB5A 3IB4A 2MCPL 2E8YA 4PRIE 4YO0B 1J1OL 3MCLL 3Q2CA 4H5SA 4NWTL 1H0DB 1M1SA 3KPRA 4MJIE 4XWOD 1DDHA 1HZHH 3CUPA 2DLFL 3HE6B 2E9JA 4WV1B 2R2BA 3GHBL 2GSGB 2DJSA 4P2RA 4HBCL 3KYNA 4KPHH 5EN2B 4ZS6C 3TA3C 3RUGB 1KLGA 3CMOL 2WAHA 2EKSB 1IC5L 3ZTNH 1A1MA <