4MWFA

Structure of hepatitis c virus envelope glycoprotein e2 core bound to broadly neutralizing antibody ar3c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
226
structure length
223
Chain Sequence
b'LLEQSGAEVKKPGSSVKVSCETSGGTFDNYALNWVRQAPGQGLEWIGGVVPLFGTTRNAQKFQGRVTISDDKSTGTGHMELRSLRSEDTAVYYCVRSVTPRYCGGGFCYGEFDYWGQGTLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab AR3C heavy chain
publication title Hepatitis C virus e2 envelope glycoprotein core structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 223
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mwfA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mwfA01
1JV5B 4KZEH 1JL8A 5HYFA 5AYQA 2X4SA 3HCVB 4NN6C 4ORGB 5F96L 3DURA 2JKXA 5HYSG 3TBTB 4TVPD 1WGOA 2HKFH 3MLPA 4O51B 1HXYA 3HHRB 3Q3GB 4IRJD 4LKCA 4HW6A 1KV3A 3FONB 4ZAKA 4LAQL 2VABA 3M1BA 3QZWA 3BKYH 3D2UA 1NGQH 3EFDL 3F5WA 3MZTA 4B0MM 3IDMB 4PLKC 5H2BB 3V2AR 4HIJB 1OSZA 1KJ2B 5DJ8B 1RK0A 5GSVA 15C8H 4HUUA 4K8RL 1Z5LA 1T7VA 3D0LB 1EDQA 5C09D 5DEGA 4K7FA 1JMZA 1IC7H 5FIEA 5GHWH 4FZ8H 3GBNL 3C5ZB 3NCYP 1F6AB 3BUTA 3EZJB 5JW3L 3FRPA 1JGEB 1F11A 3KPRB 4M6ML 1JTTA 2HRLA 3HUJB 5E6YA 3RWDA 4CN4A 2GY7B 4X5XA 4KKCC 3MACH 3UTTA 4PJ8D 1S9VA 1F4AA 1KBGL 3QRGL 5FOBB 3MCLH 4MA7H 4LLYB 4KUCF 3P4NA 1IE5A 1Z3GL 4U49A 1HQ4B 4XVJH 5D7JD 3L6FA 4WFEE 5TDPA 1Y0LA 2J6EL 1MF2L 4DOHB 1UZ6E 3IFOB 4OBSA 5C0IB 4J3TA 2X4OB 3X3GL 3HAEH 4S1SL 1M7DA 4HKJB 3BP6A 5FA3B 4UIKL 2MQCA 3BP4B 5T1KA 1WISA 1QYGH 1IGFH 5FGCB 2I26N 3D69A 4OV5A 4HK0A 1NFDF 2E7MA 3PWJB 5SWZD 1TVBA 5FYLD 2FH6A 3KYOB 4ODXA 3SDYL 4WU7A 3STZB 3QHTC 3IKCA 3LDBC 2YPLD 2OI9B 4U1HA 4JFHE 1KJ3L 3EJYC 5C8JB 1A7RL 4U6VH 1X4XA 4RMSA 4MA8L 1DQQA 5JDSB 2ADIB 3DGGB 4S1RL 2VSDA 4ZNCD 2VAAB 4M5YH 4BA8A 2DQGL 5HHMB 5KS9E 3CD4A 1JZ4A 5C0RH 4X98A 5E94B 3PWPD 1FYTA 5CGYD 3I3DA 4OKVA 5C2BH 5INCA 4NUGH 5TF1H 1BOGB 3VXOB 3P9LB 3FT2B 5FO7B 4OM1H 5F9JB 4YXLH 2X1WL 2A9ML 3KPMB 4M43L 3OF6A 3CC5A 3N50A 1H3VA 1WUNT 4KI5C 5E9DB 4Z18A 2P44B 4M93C 3EGSB 1MCPH 3RGVB 3RZCB 4OGZA 1DDHA 5HGDB 2XQBH 1OTSC 5LAXB 3DX6B 4JRXB 3PHOB 1NLDL 4RCAA 1QG3A 2QQKH 1GJIA 1H5BA 1FGNH 3P0GB 4FP8L 5TQ0L 4XWGH 4OJFL 4GG6A 5IEHA 5DR5H 2P24B 3X14B 1EPFA 1LEKB 2DBLH 3ARBB 4LSDA 1FFRA 4HIIB 5D6CB 2WWMC 4ZDHB 1JTPA 4QNPE 5JTWA 4R0LA 3VWKC 1KPRB 1OAZL 4N9OB 1MNUL 1DBBH 3WS6C 2R23B 1CXKA 3BPOC 5CEZH 3C5ZD 5B3JE 4BQBA 2AEQL 2HWZL 4PLJD 3ZTJH 3LOWA 4P3CL 3LPWA 4XVUD 3LH2L 2PW1B 2C5DC 1G7IB 2O5XL 1URLA 3MLRL 4F58L 1V7NH 1CVSC 2ZUSA 5J9PA 5IMOB 3PHQB 3T4AB 3IAPA 2IG2H 8CGTA 2PCPB 1OAUH 5BO1H 2IADB 3LN5B 3H7BB 1GZQA 3U7YH 1CIDA 1F8TH 4Y5XB 4N5UA 1Q9LB 4PB0L 1D5XB 4LPUA 3PJSA 4OB5H 3IYLW 2WBJB 4TRPL 4PJCB 2Y9RT 3E2HC 1KUMA 5DUPH 1F3JB 5F3BA 4N0UB 5GIRA 2C3WA 4G7VL 3PP3K 3FKUS 5E1HB 4ZTOH 5IBUB 5E4EB 3W81A 2D3VA 2DMBA 4YBQC 4DN3H 5T3ZE 1BP3B 5A2JH 5JW5A 3T2PA 2GYSA 3QWOA 1NBVL 5FB8A 3LD8B 3OAZK 1LO2L 3AS2A 2ZCLL 3QQNA 3VXUA 1U42A 1UA6L 3G04A 5L2KA 3ZDXE 1UC6A 5DLML 1L0YA 1BLNB 2PN5A 3GI8H 1S7UA 2DWEB 2AQ2A 1I8LA 3IS1X 1DLHA 2A6JA 4GRWF 4X7DC 4PJ9B 4BSVB 4RBPK 5E6ZA 1A1OB 2VDNL 1P4BH 4GXUN 1DLFL 4WCYL 2JB5H 3O3BB 5CD3A 2QSCH 5DUML 5GGRA 1KB5H 2R2BA 3GMPA 2BFVL 1NUGA 5FYKL 2Y36H 3ARGA 4UV4H 5E9DD 4NBYB 3UBXA 5DJCA 1S7VB 3RZCD 2HTLD 4X99B 2ERJB 4JFDE 2Q76A 5L8LB 1NCDH 4JRXD 3KXFE 1KCSH 4JRYB 4M6NL 5D71L 4NT6B 4JY6A 1J05B 1A1NA 1SYVA 3LQAH 3RWEB 1PFCA 4JPIA 2MKLC 3DV6A 1U9KA 1QR1B 5DC4B 3CK0L 2CR6A 3HG1B 4BK5A 5D1ZB 4PS4L 3C8KB 3S37X 3QUXB 2IQ9L 4R26H 3ARBD 4HMDA 5IFHL 5ETUA 4K3DL 4IJ3B 3SKNB 4YDVB 4GRLC 3IETA 4IMKC 1MI5E 1KOAA 4ZPVA 1RJLA 5DRWA 1PZ5B 4KQ3L 1DUZA 3BI9X 4HIEB 3RKPA 1KXVC 1NCCL 3HI1B 5F1NA 4F37F 4LDLB 4LASL 1G6RL 3SPVB 4U3CA 4JKMA 3I6KA 4MNQB 5DTFB 5IIEA 4X6BB 4PY7B 1CF8L 1HINL 1JNNL 4XX1G 1PY4A 4G9FE 4FXGB 5B22A 4PJXF 6FABL 3LHPH 1V3LA 4QOKA 2OM5A 2JCCB 4JFOA 3MYJA 3HAEG 4KV5E 5B8CB 3FZUD 3WFEL 3JUZA 1U3YA 1KFAH 1NLBL 2WBJD 4LK4A 4Z0XB 5KVDH 3C8HA 5CIPA 1GGIL 1NUDA 3F58L 4FQCH 3U4AA 4NN7B 5LGJB 3B6SA 3HMXH 5KSAA 4JDTL 2HT3C 4QHMB 4NQEE 4XBEL 2BNUA 5IW1A 2XQYG 1DVFA 4PRHE 5IK3B 1PQZA 2ZSWA 2VOTA 3KYMA 4XAWH 1QFUL 1MRDL 1CXHA 4WTXA 3A6BH 5F44A 1AY1H 3WXVH 4NN6B 4GSDL 3CDCA 5F71A 2EDRA 3VG0L 5IJKC 1X5YA 2H26B 4MNHA 4WENB 1Q9OB 1W2KT 4ZUVB 5D1XA 4Z78A 3QCUL 1U36A 2EIBA 3QJHA 2F5BH 3ARTA 4PJ9D 4WUUB 3S96B 1M71A 1X3DA 3VXSA 5IOPA 4JR9H 3ZHLA 2VR4A 4KK9D 1HXMB 1SVZA 3PL6A 4I8DA 3CPLB 2HJFB 1VDGA 3OGCA 1AXSB 3C60A 4Z7VE 1CD0A 5E1AA 2BVQB 4NZTL 3IJHB 1F4HA 3PIQA 3ZL4H 3SE4A 2J3SA 3G5YB 2AXGB 4JRYD 1JZ5A 1A7NL 4O5LH 4PUBH 4HEPG 3VG9C 1WBXB 4NQXA 3GUTB 3RRQA 5T3ZL 1U95B 3G5ZB 4LPCA 1EMTL 4HCRL 5TJWK 2DOCA 3HG1D 5L9DH 5D1ZD 2NY0C 3SE8L 3QUXD 4XX1E 3ES6B 1OCWL 2VLKA 3B2VL 1EUUA 1JGLL 2FIKB 1I7RA 5L7XH 1SY6H 1MAKA 1TCMA 2FL5A 4FFYL 3ZTJG 3C8DA 1F58L 1TPXB 4YHOL 1VGEH 2EDYA 2CH8A 4MJIA 3QCTL 1FDLL 4EXPX 1WSST 2A0LD 2UYLB 5DZLA 4M02A 1T2JA 2Y07L 5DWUL 4GKZB 4ELMF 1MOEA 2LV4A 1IM3A 1FGVH 3RQ3A 1EO8L 4AM0A 3SHSA 1S7XB 5D7LB 1LD9A 3MXWL 3AS1A 5GRXG 1YEDB 2VDPH 5C08A 4KJWC 3HZVA 2BVEA 4PY8I 5TPWH 4G5ZL 3MRRA 5KVEL 4OI9A 2YKLL 3TJEL 1BWMA 1P7KA 4FN0A 3SCMA 4TUKL 1JV5A 5CGTA 4KTEH 4XPHH 1AC6A 5E56A 1M1SA 2MQ0A 2OZ4A 2ICWB 3CSGA 5IF0B 5C6TL 1MUJA 4AIXA 3NIFF 2CXKA 1OW0A 3EDJA 4LNVA 4HJ0C 4O51A 3Q3GA 5FM5O 4KK8C 1G9EA 1MIML 3U4BH 5BV7C 2B2XL 3N1PC 2CLRB 3TFKC 3V4PL 2ZUYA 4G8EB 5ENWB 5EBGA 3IDMA 3MLSH 5MEQB 5JR1H 2NZ9C 4M93B 2DTMH 4HIJA 2DJUA 1KJ2A 4I77L 5DJ8A 3D0LA 1EHLH 5D7KE 3V95A 3OV6A 5GS0H 3I6LE 2Q8AH 5FGSA 1A6TB 3AFLA 2ZJSH 1QQDB 2K7QA 4HKXB 3LVEA 4PPTA 1DN0B 2DQDH 5CEZE 5BJTB 4NJ9H 1MCOL 3IDUA 3MFFA 3QXVA 4HXBH 2E6QA 3KPRA 1XF3B 5ISZB 3VWKB 2YN3A 1PJ9A 3NAAH 4KZEL 2HRPH 4N0FB 1IVLA 5J06A 5AUMB 5J6HB 4L4TE 3BPOB 4OUUA 5FOBA 3DVIA 3EYQD 3OBAA 5ANME 3ECBB 1CDUA 1YMMB 2CIIA 3BXNA 5DJXA 5F89B 1HQ4A 2HKFL 4Q6YA 4WDIB 2D4FA 3P0VL 4N8PA 3P3YA 1ZA3B 3WKNA 2C4FU 5C0IA 3BKYL 2X4OA 4HKJA 1NGQL 3BP4A 5EZLB 4Z7UB 3O3AA 2YBRB 3RKDD 3EYVA 2SEBA 4KVNH 2LFGA 1LEGA 15C8L 4APQA 2IAMA 1D5BB 3RZWA 4QRQB 3JUYA 1EJOH 3I75B 2IALA 5D7LD 3STZA 1CFNB 3ULVH 4NN5C 4ONOA 1IC7L 2P8MB 5GHWL 3SE9H 4P49A 5C8JA 4L8CA 4FZ8L 2YHGA 1D6VH 3DGGA 4YBHA 1I3GH 3ARXA 2JB6B 3O9WB 1QSFB 3QEGH 5CZXC 5T1DH 3NCEB 1AGEB 1NAKL 4Y4KB 3MRIB 1OP3K 3J8F7 4UNTA 3EJYD 4D9LH 1U8QA 3MACL 4B5EA 1FNEB 3TIEB 3MCLL 2W65A 1BOGA 1NDMB 3VXOA 1QRNE 1ZHBA 3B9KA 4MA7L 5C0FA 5FO7A 3FL7A 1OLLA 3OKEB 4RRPA 4ZUUB 4XVJL 4I3RH 3KPMA 5IROC 4QY8A 3VGAB 4X7TA 1OP5K 3ZKSD 1VACA 2EDXA 3BZDA 2J7LA 3EGSA 3RGVA 3S88H 4XC1H 4QRRE 5HGDA 3DX6A 3HR6A 3BPLB 4YBLB 2EH7H 2F74B 5F3HA 1QYGL 1S9WB 5KSUA 1IGFL 3H9HB 4P9HH 4MCZA 1A14H 5AG8A 4C83B 1WBYA 1CYGA 3EOAB 3RBGA 3ARBA 3PABB 5D6CA 3JSSA 4ZDHA 3UTSB 4RBPH 1W72H 5KOVC 3OL2A 3LEVH 4ONFH 2VB5A 3QO1B 4U6VL 5EU6E 5J6GA 3MNWA 3BRFA 4OGYH 1EXUB 3QEQE 2R23A 4M5YL 3VFMA 4OLVH 5F70A 3H9YA 2RGSA 5KS9F 3DX7A 2WWMD 5T3XH 3IF1B 5C0RL 1J8HA 3VWKD 5TDOA 4GRLB 4AT6B 2PW1A 1G7IA 4NRYB 5C2BL 4S1DD 4X5WB 1LNUB 1RZKL 4NUGL 5TF1L 5IMOA 3DX9A 2EXWC 1QSEE 4OM1L 1YMMD 2VXQH 4NSKB 1MJ7H 5JIPA 2EIZB 1IJ9A 3CZFA 3LN5A 3H7BA 1I9IH 1BECA 3CJJA 1Q9LA 4KTDH 1D5XA 3FAXA 3HNTH 5GSRB 1MCPL 2R39A 4H8WC 4XP1H 2FBJH 3VU2A 2XQBL 2P1YA 1FPTH 4PJCA 2HH0H 4PJGE 5E5MA 3BE1H 4N0UA 4NQDD 4MQSB 5GJSH 5E0QA 2QQKL 3BKMH 1FGNL 4XWGL 3PGCB 3GKZA 2HT2D 5B39G 1H15A 5BVJB 5ECJE 4PLNC 2B0SH 1B0WA 4GKOA 5DR5L 1WFTA 3EAKA 2DBLL 3D3VB 5DJDB 3SY0B 1WIUA 1LE5B 1Y18A 5A2KH 2QQQA 3SKOA 3Q48A 1DBBL 5EORH 5CEZL 5FHBH 3UC0H 3WDIA 4DCQB 1BLNA 3O9WD 5B3JF 1QSFD 2DWEA 3TV3H 2MKWA 1ZGLA 1KENH 1AP2B 1J7VR 4Y4KD 4PJ9A 5C0GA 2I07B 1V7NL 2YRZA 1HSBB 2O5ZH 5JUEH 4NNXA 2DQFA 2IG2L 5DJ6B 3BH9B 1OWWA 5BO1L 1FZJA 4HWNA 4F9PC 2G5BA 4PJEB 3U7YL 4OCXL 1F8TL 3MRQA 4KZDH 4GG8A 1CU4H 1CD1A 4RZCB 3VI3E 3JTTB 3IDNB 2VIRA 4JVUA 4OB5L 1E6JH 4NZUH 4DKFH 5JQHC 5IV2A 3G6JE 3AM8C 4M8QB 3RPIB 5J0BA 4LPYA 4MQXC 1ULVA 4ACPA 2AEWA 4NT6A 1J05A 2A77H 3GM8A 3R0NA 4H5SA 3WUZA 4ZTOL 2W07A 5HTSA 2H2SD 1EO7A 3HI5H 4DN3L 3NH7H 4YEEA 3S5LB 2B20A 3MCG1 4HULB 1CD9B 4ODUA 2W0FA 3BIBX 1YNLH 1T89A 2NY2D 3NFPA 4G43B 4OCYH 4A2MA 2J1KA 3DNKA 3BPCB 3K4AA 3UTSD 2KPNA 2Y5EA 3CFEB 4YDVA 4NO5B 3QDGB 1INDH 1WBZB 3P30H 4J8RB 3PWLA 3ZDXF 4YDLC 3B8SA 3FHQA 3GI8L 4LRIC 2NY0B 2J5LC 3KPLB 4HIEA 5GRVL 3HI1A 4FQXA 3AMLA 3D48R 4GRLD 1MWAB 1H8NA 1Q9WB 5F7WC 1NEZB 3LRSB 1P1ZB 5I1IH 2JB5L 4MNQA 4I13B 4XCNB 2QSCL 4MDIB 4PY7A 4HEME 1KB5L 3SDXB 4JQVA 3LN9A 4EOWH 5D7IE 5DT1H 3GBLA 4OFDA 4K07A 5GGQH 1MHPH 3KPQA 4KROC 4OD2B 1N3NB 2Y36L 4UV4L 4GRMA 5AD0A 5KG9B 2WZPD 4JRWA 1IL1B 5B8CA 2DLHA 4WFFD 2EXYD 4LPTA 1NCDL 4N8VG 4WW2F 2UVFA 1KCSL 3QNZA 5LGJA 3QA3B 5DGRA 3ZHKA 5J11C 1P9MA 3LQAL 2XWBB 4QHMA 2BNRE 3GMLB 5DJ2B 5CSGA 1NFIB 2CKBA 4R26L 3D3VD 3FRUB 2VLLB 4GMTH 4E42B 3QRFM 5BS0B 4ZNEE 2QSQA 2E5EA 3IU3B 4X0KA 4NFCA 4P3DB 3GJFA 1R3KA 2X09A 2LU7A 3MRFB 3T04D 4OFYA 1JWUA 3EFFA 3ARSA 3WNKA 4WUUA 3OJDB 1U0QA 5KSBB 5I30H 4DUWA 5J12C 3O81A 1HXMA 3H42H 3ABZA 3LHPL 3CPLA 2BNQA 2HJFA 3WO4B 3NVQA 4OD3H 4MWFA 5ICXB 3OX8B 4ODSH 3W11C 1KFAL 3T0BA 1MY7A 2QADC 2Y5TA 2Z4QB 5KVDL 1MSPA 3G5YA 3AAZB 4FQCL 1I3UA 3P77B 3LB6C 3HMXL 2DLFH 5CP7B 3OXRB 4HIHB 1WBXA 4XNMB 2ESVE 2GTWB 1U95A 2XZAH 4CUCA 4TYUA 4JM2F 2FJGB 4LEXH 4UUJB 2GITA 4GT7A 4XAWL 2YEZB 1H3PH 4PJAE 1CI5A 5AZ2H 2N1KA 3D87B 3DO3A 3ES6A 3N06B 4BSWB 3WXVL 3A6BL 4G6FD 1AY1L 4G80B 1PW3A 2FIKA 3RIFK 3QDGD 1RZ7H 3S35H 2GJJA 5GGTH 4OZIE 3IGAB 3B83A 3QUKB 1UFUA 1XF4B 1JZ3A 4LCWE 1AD0B 2UYLA 2F5BL 3HFMH 4B50A 4GKZA 3L3GA 1LO5A 1BFSA 4M6OH 3S36H 5EB9A 4HBQA 4KK6C 1Q72H 4NRXB 3P9MB 1CDCA 4JR9L 1HWGB 1S7XA 3SOBH 1NGYB 2DQUH 3ULVE 1JZ2A 5CWSB 4XGZB 1MRFH 3VRJB 1QLEH 1XGQB 2CRMA 4HKZA 2GT9A 1FL3B 3BIKB 4Z7VF 2XTJB 3HE6C 2H6PA 4HWBH 3ZL4L 1YPZB 4XVSH 2WBWB 5F7EH 4GMSH 1RZIB 4O5LL 3PQYD 4H26A 4K3HA 4PUBL 2ICWA 1X5XA 4H1LB 3T1FA 4YH6A 5IF0A 3I6GA 5ID0B 1WC7B 1JK8B 5L0QC 5L9DL 4OZFH 3SDDC 5E2WL 4KJYB 2GHWB 2ZUXA 4A2LA 3GGWB 5BS0D 1FZOB 4KRPC 1X6LA 1SY6L 5L7XL 4OFPA 5IFAH 4HGKC 3VDAA 5SWSB 4OZHE 4PRPE 3CFBB 1VGEL 2YRPA 5GJTH 4JGJA 2UZYB 3GMMA 4D9RE 2C26A 1BQHB 1XH3B 2DF3A 4U6TA 5MEQA 1YEIL 4KK8D 1FGVL 4CNIA 4F7EB 5JW4M 1P7QB 1U8PB 1DBMH 2X9XA 8FABA 3BDXA 3M45A 3NCYS 4I48B 5FXCH 1OP3H 3W2DH 2OJEA 2W1NA 3FQWB 3ZLQC 4M61B 2NZ9D 1A6TA 2VDPL 4X6CB 4PJ5A 4ZSOB 5TPWL 3X13B 4WGWB 3DVNA 3ILQC 1DN0A 2F54E 3LKNA 3AROA 2BRQA 3BZFB 1CFQB 5T3XE 5F88B 1FRGH 5ISZA 3VWKA 1ITBB 2N56A 4KTEL 2WSKA 4XPHL 1F3DJ 5I8EA 2YWZA 5J6HA 3WS6A 3CVHA 5IB1B 4Y19E 5FV2A 4OT1H 5D5ME 5ERWB 3FO9B 5JORB 4HXAH 3UO1H 3X12B 4NFBA 2E9BA 2E8YA 1RUMH 4P23D 3EZ8A 5F89A 3BIAX 4V1DB 2AQ3A 1T66D 4JJ5B 5F9AC 5JO5B 2NYYC 4BM7A 1JCKA 3U4BL 1IAKA 1ZA3A 3MV9B 2IBZX 4FQIH 2R1XA 4OCMC 4WNQA 5EULV 3I9GH 3MLSL 5CGMA 5JR1L 4N0YH 2DTML 2YBRA 3RY5A 1N7MH 2VDOH 4QRQA 1EHLL 2YXFA 3I75A 5GS0L 5F21B 2Q8AL 2NX5B 4QRPB 1RUPH 2ZJSL 2OTWA 3OB0K 5FDYA 3RUGE 3REWB 5TE7H 1K8IB 3VFUB 3IVKB 2DQDL 2JK5B 2JB6A 5IT2H 5FCUH 4WTZA 4NJ9L 2PTVA 2HLAB 4HJGB 2XTJD 3U83A 3O6FC 5KJRH 1AGEA 5C07B 3NAAL 3VH8B 2HRPL 4M1CD 3GSQA 4MCYA 2BVOB 3BHBB 4LCUA 3FQUA 1FNEA 5ESVB 3WS3B 3TIEA 4UNUA 4XBPA 3WHXA 1MFNA 1NDMA 5HVGB 4GLRH 1XF5B 3BUYB 2ARWA 1S9XB 3RVTC 3OKEA 4ZUUA 3SBWC 1J0KA 4EQ2A 2P8LA 5FECA 2DWDA 1F2QA 3QUMA 3PG2A 1TNNA 1UEYA 1YN6B 3WFCH 4BFGA 1IKNC 1HN1A 5SWSD 3QQ9D 5CSZB 2EDDA 4HS3B 4XP9H 1S9WA 3H9HA 4ONGH 4X9BA 4KVNL 3GDBA 5GS1B 2H3NA 5T5NF 1P7QD 2O61B 1EJOL 4HQQH 4Z77B 4BH8B 1CDYA 5I1HH 3ULVL 4POZD 2DQJH 1A6ZB 4F7PB 3SE9L 3QO1A 1D6VL 1BX2B 1A3LH 1I3GL 1JHLH 1J9CT 1EXUA 4M9PA 4RMVA 4OBRA 3ARYA 5E8OB 3H0TB 3QEGL 2VLRB 5T1DL 4AG4H 1YEFH 1NDGB 1G9NC 3MSPA 1CVRA 2H2PD 3QQ3B 4E41E 4D9LL 3AS0A 4GRLA 1RMFH 4AT6A 3KGRA 2LQRA 4IMKA 4IOFC 1XGUB 1TZGH 4YDLB 4I2XE 2J5LB 4P2RE 1E4WH 4KRMB 3JWDH 5JXEC 4XT1C 4I3RL 2V6HA 2R69H 4IBLT 3UZEA 3S88L 1PZUB 4XC1L 4QT5A 1AE6H 4G6JH 3MV9D 4HUWB 2YA2A 1QHPA 2EH7L 4P9HL 3QFJE 2E6PA 3PGCA 2NZIA 5DQJB 5BVJA 4OLZH 4MD4B 3SY0A 5J11B 1XCTB 1W72L 5DD0H 1HH6B 2NX5D 4KJQC 4QRPD 3MRCA 4P5TB 2DTSA 5A1AA 1ND0B 1VADB 2KBGA 3P73B 4OGYL 3GSUB 5KZCB 4OLVL 1DUYB 5F6IB 4DCQA 3WJLC 3T3ME 3L1OH 4ZG1A 2WUBH 3S9DB 2I27N 3E8UH 1OOAA 1AP2A 5MENB 4QXTA 4I3GA 2Z92B 3TNMB 2I07A 1J0IA 2RQ8A 3GJEB 5IJKA 1QA9B 5DJ6A 4P4RB 4OZFG 3BH9A 1VPOH 2VXQL 2EE9A 4Y5VC 1MJ7L 4X9GA 4KH2A 3RWCB 1I9IL 3FQNB 3MJ9H 3BN3B 4KTDL 3HNTL 1T5XA 3HLAA 3IDNA 3JTTA 4XP1L 2FBJL 5I15H 3CFJA 4QRSB 3W0WB 1UJ3B 1FPTL 3WFHA 2HH0L 5EUKA 1H8SA 3BE1L 4M8QA 5GJSL 3RPIA 2LE9A 1ZLUK 3VFTA 3BKML 2VZOA 3OKLA 2QQLH 2B0SL 4JFZH 4HZAA 1NGWB 3P9WB 3BP5B 2LAGB 4HC1H 5EA0H 1A6VH 2EDFA 3WKMH 4HK3J 1JNHB 3GMOB 2EYSA 4G43A 3BPCA 5B38G 2IANB 4OF8A 5IBTH 1LO3H 1WBZA 1FNAA 3QXUA 5EU5A 1NGXB 4J8RA 5FHBL 3UC0L 3V5HB 4MA3B 5CJBA 4CN6A 2XZZA 5AEAA 2VLRD 3TV3L 3C6LC 3VXRB 1KENL 5FF6A 5DHYB 3RHWK 1JZ8A 2X4RB 4UAOC 4TPRH 3KHOA 3MROA 3TBWB 5I73C 4PJHA 1MWAA 2JELH 2O5ZL 3BH8B 4P57B 5JUEL 3LRSA 2NY5H 1NANH 1P1ZA 3W5NA 4RFEB 5FOJA 3DRTA 2F8OA 2VWEC 4MDIA 4ZOEA 3SDXA 4EEEA 2F53E 1UEMA 3EYOB 3ZTNH 3E3QC 4K8RC 3QG7H 4KZDL 1CU4L 3RDTB 1N3NA 2EO1A 4GAYB 1E6JL 1QLRB 3MLTB 4NZUL 3VI3F 1JTOA 5E7BA 1GAFH 4DKFL 5HI5C 2XWJB 1ZLVK 3UZVB 4PTUA 2GK0A 3G6JF 2A77L 1U58B 3ZDZF 3AY4C 3HI5L 3P4LA 4C56B 2XWBA 1B0GA 2PYEB 3HE6B 1WZMA 3WEXB 3VMNA 2FJFB 3GMLA 1YNLL 5E03A 4BSJA 1II4E 4LPVA 1E4KC 5CHNB 4OCYL 4E42A 4WEMB 1EAJA 3MV7B 5JW4R 4XC3H 1INDL 5D2LB 4JVWA 1UH3A 2W59A 3P30L 4LSVH 4P5TD 4MLIA 4P3DA 2K9UA 3MRFA 1TJGH 2R8SH 3SDDB 4M1GH 1VERA 2K7PA 2YRLA 1QKZH 2C3HA 4KRPB 5MEND 4AZ8A 1KLFA 3OJDA 4KK5D 5I1IL 3TLRA 5DHVH 4LOUC 5DJZB 3ROOB 5KSBA 2I24N 4OQTA 4EOWL 5DT1L 5GGQL 1T2XA 3V5KB 1MHPL 1T0MB 4NKDB 3Q5OA 3G9VA 1AR1C 3N85H 3QXWA 4JEGB 1NFDB 4X4XA 3W0WD 5EN2B 5BZDB 1CGUA 4YHNA 1T1WB 3P77A 4BQ8A 4MA1C 5CP7A 4GW1B 1EVUA 4L3AA 4O2FB 5HVWA 3OXRA 4HIHA 3W11D 5JXAH 4HFUH 1QVOA 1TTFA 1KIRB 2GTWA 1H3WM 2NY3B 3PWNB 4GO6B 2O5YH 2X7LA 4GMTL 2OL3H 4S2SB 5E8PA 4WTZG 2BK8A 1F13A 2PTTB 4MDJA 2NW2B 4F8QA 2IAND 1KB9K 3QI9D 1EX0A 4DKAA 2JJWA 2ED9A 3IGAA 4GAJH 3QUKA 4O2EA 4NRZB 3IXAA 4QTHB 3ME0A 3VXRD 1HHGA 3S4SG 4NBZB 2O93L 1DQJB 3KS0H 3BD5A 1DANU 3VRLF 2NXYC 3P9MA 3VGEA 5I30L 2AV1A 2HJLA 4XRCA 1R5WA 4FFVD 1NGYA 3H42L 4CN1A 5CWSA 5GQBA 4FG6C 4OD3L 4POUB 5I2IB 1F4XH 1FO0A 4ODSL 3RDTD 4OAWB 3F7RA 1FL3A 3BIKA 3IXTB 1B88A 1YPZA 4MD5B 1RZIA 2DLFL 1MCJA 2V17H 4R7DA 5TFSH 3RVVD 3MUGB 2PYED 4RIRA 2XZAL 1RUQH 1JK8A 4CMMA 4GXUM 3DO7B 4LEXL 4RX4A 4S10A 5C86A 1H3PL 4MJ5B 5H94B 1HHIA 5JHDB 5AZ2L 4PJAF 1PX4A 3MV7D 4XTRD 2DLGA 1FZOA 2DM3A 1RZ7L 5D72L 3S35L 5SWSA 5GGTL 3Q1SH 3CFBA 3RIAK 1XR9B 5IROA 4OZIF 4LDOB 2VISB 2CDFA 2O26U 3C5JB 5EPMA 4LVHC 3S36L 4M6OL 5T1LB 4F7EA 3ARQA 1Q72L 4OD1H 3DIFB 3SOBL 2X4NB 1XIWB 4RGNB 4JFFB 1L7TH 2WWKT 2DQUL 5HI3D 3L3OB 1MRFL 3ULVF 2VKWA 5E6IB 4PD4K 3O8XD 4TVPH 1QLEL 3SKMA 1UXSB 1J8KA 1EEUA 3QDMB 3X13A 3BX7C 4HWBL 4PJIE 3DMMC 1CFQA 2YD6A 1OT2A 2MJWA 2P48B 4XVSL 5FO8A 5F7EL 3IJYB 4GMSL 5T1MB 4GKNA 3F7QA 1IRAY 5D96B 5IB1A 4PR5B 1EH9A 5DXWA 5JORA 2Q1EA 2NY3D 3PF2A 4G8FB 1GRWA 1JPSH 4V1DA 5C2UB 5E8EB 4JJ5A 4WFHD 4GRWB 5JO5A 3KG5A 5ESAB 1ORQA 1IM9B 3G5XB 5IFAL 1K3IA 2G75A 3K74B 1YEKH 5F7YC 4P2QA 2J8UF 4OZHF 4BKLA 3H6JA 5GJTL 3RVUD 2AW2A 3FO1B 5I8CA 1KJVB 2NYYD 4U7KA 4UOW0 5EU6D 4PJFA 3A67L 2NTFB 4H0HB 3QEQD 1DBML 3UTTE 3FFDB 1A9EA 4MSWA 1RFDH 4IRSB 4U05A 3W2DL 3OJ2C 3TT3H 2NX5A 2VLME 3OWEA 4QRPA 4KXZH 4MAYC 2CKNA 1BJMA 3FO2B 1AO7E 4F2MA 3HPLA 3REWA 1K8IA 1TVDA 2YD8A 2JK5A 3IVKA 1A2YB 4JCMA 1S9KC 3ARDC 4LHUG 1VEOA 2HLAA 2NLJA 1FRGL 3Q0HA 4Q2ZB 5C07A 3VH8A 2EKSA 4D2NA 4PYHA 3H3BC 3MRLB 1HI6B 4KKLC 5ESVA 2XN9B 1HHKB 1WWAX 2CMRH 4OT1L 1PKOA 1N6QH 3WLBA 5K9OA 1XF5A 3BUYA 3MGTB 3L95B 1S9XA 1RUML 1TCRB 4R4BB 5FYLH 3EDEA 4Q7DA 2D7PA 5JHDD 1U41A 2OSLA 3RJQB 1ZKAA 4F9PA 2QQNH 4FQIL 4NWUH 5GZOC 3I9GL 3DJ9A 4CJ1A 4HS3A 4N0YL 1G1YA 1PKQE 2DICA 2VQ1B 1FYTE 4PJXB 1I4FB 1ONQA 1A5FH 5T1LD 3MJ6A 1ZT4B 4K7PX 1N7ML 3VI4E 3AM8A 2VDOL 5LGHH 1MCKA 1A7OH 1XIWD 4RGND 4OF0A 1YEJH 4JFFD 2KL6A 4I0PC 1NCWH 1TZIB 1RUPL 4WO4B 4F7PA 4N0CC 4TNWF 5E6ID 5TE7L 3L9RB 1BX2A 3RUGF 2WM0A 2FEEI 3QDMD 5IT2L 5FCUL 5IMMB 1P5VA 4GLRI 3H0TA 2AXJA 4F33B 5KJRL 4NIKB 1NDGA 2MNUA 3D18B 3QQ3A 4U6HB 2R4RH 1X5LA 1D5IH 4LRIA 1J0YA 3BEWA 3CUPB 3UJIL 3K81A 1QRKA 2FHBA 5FM4A 4UQ2A 1RZFH 4XP4H 5I73B 1G7PB 1A7BA 2DQCH 2PXYC 2CSPA 3LQZB 1OGAB 3WFCL 5ILTH 1L9MA 1IM9D 4FZEH 4LIQH 3SJVB 3TC9A 1UENA 5IM7B 4KKBC 4P2YA 5JQ6H 5JXED 4LLQA 3GSNB 1AGFB 3PWVB 5FM5M 1JYWA 4XP9L 4JN2B 5GISH 3KPSB 3BPNC 4ONGL 5C0JB 1W0YT 4YDJA 5DQJA 3V6OE 1ERNA 4OLUH 4HQQL 1IGJB 4IRSD 3IFNH 43CAA 4JQIH 3WYRA 4Y16C 4BQ9A 2DQJL 4ZPTA 3B9DA 3MLUH 4CVWA 1A3LL 1JHLL 3P73A 3GSUA 3TH2T 2UY7A 4AG4L 5GGVY 1YEFL 4OCSL 4Q6IB 3IAGC 2X70B 3H9SA 3GSVA 1TENA 1A4KB 1RMFL 2Z92A 3U0TB 5HGAB 1TZGL 4KKAC 3MV11 4LAJH 1Q8MA 5C0AB 3SGEH 3TA3C 2JJSC 3GJEA 1QA9A 1ZLVH 3RVXD 1E4WL 2X5PA 1NQBA 3FB8B 2AVGA 3JWDL 2QL1A 4F15C 5F1IB 4S0TD 2NY6C 3FQNA 1R3HA 1PLGH 4R7NB 3FB6A 4EI5B 2GTZA 2R69L 4P46B 5HDOA 3VXUE 4MMZC 4U2ZA 3MNVA 3W0WA 4G6JL 4M4RA 4Q0XH 1YY8B 4F37K 2BOBB 4Y4FB 4WW2C 2J2ZA 3STLB 5IESH 5ICZB 4UTBH 3L3DB 1MCQA 4X7CC 4OLZL 1CXLA 1M05B 3TYGH 5DD0L 1JNHA 3GMOA 4OSUH 2FSEB 4WO4D 4RGOH 4GQ9H 1HNGA 4NO3B 1EA9C 1NGXA 5L88H 5EBMA 5EIVA 1DE4A 5C0BB 4MA3A 3ZDYE 4YDIH 1SYSB 2ZUQC 1UACH 3L1OL 4X7SH 2WUBL 3E8UL 3T3MF 4WWKD 3VXRA 2X4RA 3F7YB 4Y5YC 2VXSH 3QAZC 4OIIH 4FQJH 4Y2DC 4NKOB 3IDYB 4P57A 4YFLI 2VQUA 5DMGD 1VPOL 4RFEA 3A6OA 4U0RC 1VFAB 5IMKB 1C5CH 4ZFZA 4F9LC 5L6YH 3MJ9L 2FNBA 1KTKE 5HYJE 1HHJB 1K9TA 2NXYB 1JWSA 4ZXBC 5I15L 1JIBA 1QLRA 1RY7B 3MLTA 1OGAD 5FUCE 4EDXA 2XWJA 3ISWA 5IP4A 4JFYB 1WTGT 3K0WA 2JTDA 2BSED 2D0FA 3SJVD 5BRZE 3QFDA 2WQ8A 2X1QA 4NO0D 3RY4A 4CU7A 2BVYA 1IEAB 1U58A 4WEUD 3KPSD 5MHSE 4C56A 3EKCA 2QQLL 1SJHA 1E4JA 2GFBB 1LP9B 3HE6A 4JFZL 5A16B 4YZFE 3WEXA 4HC1L 1SQ2N 2FJFA 5EA0L 4P4KC 2EZ0C 1A6VL 3DBXB 4PJ7F 2YUXA 3ULSB 3WKML 4L3EA 1JWMA 2A73B 3MV7A 4LGRB 4JM2C 3O0RH 5IBTL 1BZQK 1HWHB 1LO3L 4IMLA 5F97E 4LKXB 1EHXA 2Z31C 5IG7B 1BPVA 4I18B 1W8OA 2PYFA 3SDDA 3UJTH 3WXWL 3D39B 3WIHH 2Z8SA 2ITCB 3VXTB 4TPRL 3CH1B 3DVFA 4PJDB 4TN9A 2JELL 2FR4A 2NY5L 3QQ4A 1E6OH 5C0AD 3ROOA 5DJZA 4ELKA 3REVA 4W70A 4GAGL 3V5KA 3ZTNL 1P53A 4HHAB 4TVPE 4NKDA 1KB9J 4D8PB 4EI5D 4P46D 1N26A 1BFOB 1GAFL 1C7TA 1NFDA 4EUPB 3MQIA 5CMAB 2EE2A 5EN2A 4N68A 1RI8A 4HPOH 5TE6H 4AMKH 1T1WA 2H9GB 4XNUH 2QV2A 4M03A 2CJUH 1J1XH 4GW1A 4Y4FD 1AR1D 3OJVC 3CU1A 4HDIB 5FGRA 1KIRA 4PRPD 5A2LH 3OKMB 3PWNA 3U9UB 3ZYOA 1F3RB 1Q9KB 1IGTB 5C09E 1CGXA 2VLJA 4S2SA 2OTUA 4FTVB 3Q2CA 3UYRL 4PREA 4XC3L 5F9DC 3VMOA 1J86A 4HK3N 4LSVL 1YUHB 4P3WA 1D7FA 2VE6A 3ZYJA 1WCBB 1TJGL 2R8SL 3I2CH 4M1GL 3BGFB 4WJ5A 4YHYB 1QKZL 4D0BB 3V9FA 4NRZA 4TNVK 4QTHA 3QEUA 5DRNB 1QOKA 1DQJA 5DO2C 1BJ1H 1X9QA 3O2DA 4NKMB 4XHQA 4Z0BH 3OZ9H 5M94B 1YY9D 3K1KC 4A6YA 3N85L 3VFSB 2NXYD 1NC2A 1ZT7B 2VLKE 3MV8D 4LSRH 4OAWA 4U1LB 4Z7NF 4L29A 5DS8A 2P5WA 3IXTA 1E28B 2BSRB 4N1HB 4MD5A 1RJZB 4MAYB 2CUMA 4ZUSA 4FG6D 4M7ZC 2CLZA 2P5ED 2VN4A 4K3JH 3SQOH 4PBXA 2UWEB 3JXAA 5JXAL 4HFUL 2KKQA 4D94A 2X10A 1B3JA 5KBNC 3O6FA 3LKRA 2FWOB 5FYLE 4C4KO 3DO7A 12E8H 2O5YL 2Z91A 4YNYB 2W9DL 4PD4J 5HVHC 1RZKC 2OL3L 3M07A 4D0CB 3MRJB 3OMZA 2YPLE 2FO1A 3QHFH 2DMKA 5MI0C 1PYWB 4NQVB 2XZCH 1BJ1J 1UCBH 1G6RB 4R3SA 2ATKA 4XHJC 4HF5H 3VDCA 1I9JH 3R06A 4GAJL 2JIXB 3SBWA 1XR9A 4X6DF 4PGCB 3PWPE 4U0QB 4KHXH 1EVTC 4M6AA 5T1LA 5I66B 5F93C 1IKNA 4PG2C 1UQSA 2X4QB 4WRLA 2VXVH 4I5BB 4JFFA 1YNKH 3O4OB 3FQXB 2VAJA 1FFNB 4LP5A 1OTUC 2FX7H 3S8WA 4XCEB 1F4XL 5C9JA 1UXSA 1FG2B 5CUSH 1KTRL 3NCFB 3OPZH 2VO5A 2M2DA 1FLRH 1ADQH 1XGRA 3ARFC 3MUJA 5IKCB 3TO4C 1HQRB 4YHMH 4OZGF 4DVRH 2V17L 3MNZB 4YO0A 3WJJA 2FYYB 4PR5A 3GHBH 5GGSA 3AU1B 1CK0L 3MRPA 1TLKA 2R4SH 1L0XA 1C08A 1J1OH 1CGTA 3PV7A 4NBXB 1WIOA 4LIQE 4LVNB 3Q1SL 5JXEA 1A6UH 2AERT 2A6IA 2AXFB 1LGVA 1N8ZB 1KTDA 4QHUB 3KNBA 4NHCH 4JFEB 3KPRE 1KJVA 1RJYB 3HKFA 3HUJE 2H32B 3V52H 3AREC 3OQ3B 2BVTA 2NTFA 4JQXC 4OD1L 4XNXH 4PG9A 4TTGA 4ZS6C 1L7TL 4JHAH 5E00A 3BPNB 4LHJB 5HYIA 3WLWD 4TVPL 3CVIH 3EO9H 4TOYH 3T3PE 4G9DB 5DURD 1AQKH 1A2YA 5DYOA 1FNGB 4G8GD 4DOHE 2YN5A 4J3WA 4Y16B 4PJIF 2ZUVA 4MAYD 2DYPA 1KCRH 4XCFH 3JV0A 3MRLA 3WJLA 5FGCE 2XN9A 4NNYB 4TSCH 1PDKA 4DFIA 5DZNA 1TCRA 4LSPH 4R4BA 3TZVC 1JPSL 2DJSA 3L3JB 2OXHA 1R6VA 3TA3B 3BQUD 3HRPA 1YQ2A 5D2NE 1ZK9A 5TGBB 2H41A 1YEKL 1UB6A 4Y5VA 3NN8B 4F15B 3L5XH 1HSAB 2JIXD 5L2JA 4M9OA 4KXZI 4UB0H 2G5RA 2VQ1A 4PJXA 1I4FA 3KDMB 3FB7B 5HJ3B 1ZT4A 3QCVH 1RFDL 3LQAC 3QDJB 4ZFFB 5GZOD 4NQTA 3TT3L 4EXKA 4JFDB 1QFOA 3FFCA 1N0XH 1JHKH 1IAOA 1QSVA 3L9RA 5E9DE 1I3VA 1FHGA 1XMWA 1MVFA 5IMMA 4MZ3A 2XXCB 4F33A 3F8UB 1N6VA 4JRXE 3D18A 4XAKD 3BD4A 4N0CD 5DZOA 4U6HA 3ZE0E 1U2CA 4HKBB 1IGYB 1B4JH 4BFIB 2CMRL 1N6QL 2ZUQB 1GGBH 1CFSB 5TE4H 3C6LA 5FYLL 1G7HB 2EKJA 1R3LB 4Z7OE 43C9B 4B41A 3N1GC 4MNGE 4U0RB 3IDIA 5GZNC 4OCRH 1KEGH 2QQNL 4YFLF 4KJPD 4ODHH 5EBWB 4BQCA 3B2UC 4MB3A 3PGDA 3SJVA 1H0DA 1QD0A 5IM7A 4NWUL 3PWVA 1OPGH 1HH9B 4HUMB 1F42A 4JFED 4ZXBB 2FLBT 5EO0B 3KPPB 5C0JA 1A5FL 4QRTB 2V2WB 1Q0XH 4PRBB 5LGHL 3FQTB 1A7OL 2Q6WB 3VI4F 4P5MB 1GGUA 3TYFB 1K5NB 1IGJA 1YEJL 5A3IC 1IZKA 4WIQA 5INDB 3AY4A 4JLRA 1HE7A 1NCWL 1HCFX 5IJVB 4J4PC 3BOVA 3NPSC 1YYMH 1E4KA 4Y1AB 4EQ3A 4PJCE 5E70A 3ZKMD 4CMHB 2FBOJ 2GCYB 3C87A 1EERB 4LF3B 4JZJC 4N0UE 2R4RL 3ZKNC 3PDGA 5AWNH 2BHZA 3U0TA 2F5AH 5HGAA 2VXTH 5HHOB 1D5IL 5C0AA 1FE8H 2OCFD 4JFXA 5EO1B 3O3EB 2J6EA 3RI5K 1FIEA 1WVZA 5DFVC 1RZFL 1PBYA 2F58H 4S0SD 4RGMC 4XP4L 3ZE1E 2DQCL 1DQLH 3GIZH 5JMRA 4ELMA 5ILTL 4U1JA 2MTPA 4MVBC 4PLOB 5AAWA 1NAML 1O7SA 2HN7B 2PTUA 4FZEL 4LIQL 3TPKA 4JGMA 5JQ6L 5ADOH 5ADPH 1YY8A 5GISL 1ZXQA 1CGSH 5JNYA 3DXAB 3STLA 3RIFF 3QEHB 4OLUL 4U1GC 2BY0A 3IAQA 1IC5H 5E4IA 4ZUTB 3C6SB 1O5DT 3ESVF 3IFNL 4JQIL 1K2DB 3QDJD 5C3LD 1KTLA 3MLUL 2FSEA 4FMFA 4NO3A 3SGEI 2X4SB 2B5IC 4KY1H 1KULA 5C0BA 3DI3B 5KW9H 1SYSA 2EECA 2Y6SC 4U1KA 4JRYE 1Q38A 1LO0H 3JWOH 4LKCB 4Z9KB 5FEBA 3V0AC 1AGDB 4N0RA 4NKOA 3DARA 3VGBA 5J1TC 2APXA 4ZAKB 1FC1A 2IH1B 2VABB 3EJJX 3H9ZA 3QZWB 5CBAA 3BEVB 5IMKA 3VFVA 5FUOH 4XXCC 3F5WB 3HG1E 3HAEB 1PLGL 3QXDA 5DK2B 3NCJH 1DANT 5GSVB 5DK3A 4HUUB 3TBVA 1Z5LB 1VGKB 5CJXC 3MRMA 1RZGA 4Q0XL 4XPTH 5DEGB 4O4YH 1GZPB 3OTTA 3BESR 1C16B 2EDJA 4ZXBD 5IESL 4UTBL 2GFBA 5BVPH 2HG5A 3EJZC 4LDEB 4CW1B 3TYGL 5F9WC 1VESA 3RWDB 3ULSA 4X5XB 2A73A 4OSUL 1UCTA 4JCLA 2LVEA 5GS2D 4RGOL 4GQ9L 4NC1E 5L88L 3BDBA 2JCCE 4LKXA 5I1GH 2MHAB 4YDIL 5HVHB 2QHLA 3P4NB 1UACL 3EW3B 4X7SL 3ZDYF 3D39A 2R0KH 4Y1AD 1FH5H 1AGBA 2ITCA 3UTZA 3VXTA 3L6FB 2VXSL 5TDPB 1Y0LB 4FQJL 4OIIL 9CGTA 4WUKH 5HHOD 1C5CL 5L6YL 1FORH 1M7DB 3T0DA 2ED8A 2F8VA 3BP6B 3NIDE 4HHAA 4HH8A 1U2HA 2P49B 3ZO0A 3D69B 4D8PA 5EZJB 1LVEA 4OV5B 1LEIB 5GS0C 4JG0H 1BFOA 2V5RA 3MRHB 5BCAA 2ADJB 1QPXA 5CMAA 4DGYH 2E7LC 2DIAA 1S8DA 3Q5TA 4XNQA 3CAFA 1BJ8A 1DQQB 3DXAD 1DP0A 4HDIA 3DMMA 4L3CB 4WUUE 5AG9A 1YEGH 2FHCA 2OXGA 4NQCB 1JUFA 1GOFA 4YZFF 3U9UA 1CDHA 1Q9KA 1IGTA 3TO4B 2EDQA 4X98B 4FTVA 2QHRH 3OAUH 3O0RL 4O2CA 4G6AD 4WI5A 2EDOA 2QTEA 5ITFB 4U3HA 5INCB 1YUHA 1S7SA 1FL6B 1WCBA 1YECL 3IFPB 2IPKB 3UJTL 4X8JA 5J7CC 3NFSH 3WIHL 4HH9B 1BGXH 7CGTA 2CUHA 2C3XA 3CC5B 2NY1C 5DRNA 4J1UB 1TITA 3KAAA 2GIYA 1DDHB 1E6OL 4L5FH 4ZAKD 1TNMA 3DUUA 2BP3A 4M7JH 4NKMA 3SDAC 2M26A 3AREB 1H5BB 4N5ED 4YJZL 2APVA 4TVSa 3ULVC 4HT1L 4U1LA 4GG6B 4RAUB 1PSKH 5IEHB 2NY7H 1E28A 3T2QA 3IRPX 2BSRA 4HPOL 5TE6L 4AMKL 1RJZA 4R0LB 2CJUL 1J1XL 4LBEA 4WI9A 3VE0B 3BJ91 2CDEB 5HYSA 2HMIC 3ARDA 3QG6A 3RL2A 4LHQB 3K46A 2FWOA 4YNYA 1A21A 5D7LE 2MCG1 4UMGA 4KDTC 5KS9A 4D0CA 5DD6A 4F7CA 2MMXA 3DRQA 3WO3B 4NQVA 1IGIL 4TULH 1ZWIB 1G6RA 5DFWH 4UI2A 3I2CL 1BOYA 5IB5A 1S7WB 2A6DA 3QXAB 4LSUH 2JIXA 3TESA 2YD4A 4OI7A 1CN4A 1KB5B 1GZQB 3GFUA 4HWZA 1SBSH 4LCYA 2X4QA 3U7WH 4P9HC 3SO3C 3BYTA 1NMCC 4U1SB 4Z0BL 5GIRB 4QRRB 2JJVA 2X42A 3FQXA 1T4KA 3IJSA 1FFNA 5DMIH 3OZ9L 1JZ6A 5T1KD 1VHPA 4XCEA 2Z0BA 1FG2A 4LSRL 1N2RA 5JW5B 5FB8B 4I0PA 3MOQA 1JPST 2Q87A 3I50H 4K3JL 3SQOL 1HQRA 5L2KB 3MNZA 4X6FA 2FYYA 2CRYA 1PG7H 3HMWH 4NQCD 12E8L 5J57B 2OR8A 5I1KH 3EDDA 1DLHB 3QUZA 2A6JB 4G8IB 4OQTH 4PV9A 3QHFL 1N4XH 5GRWA 1GYAA 3BGAA 2XZCL 3MLZH 1UCBL 3DSFH 5E5UB 3V0WH 1LE9A 5MEPB 4HF5L 3KLAA 4OGAD 1I9JL 1NUFA 3BZ4A 3D1MC 5GGRB 2G2RB 4YX2H 1HILA 4QHUA 4DVBB 1QSEB 3GMPB 2PXYA 4U4BA 5ISZE 1RJYA 5K93A 3SGDH 3OF6D 1SHMA 4KHXL 3ARGB 3TVMC 1JPTH 1V3JA 2B39A 3FN0H 2VXVL 3BKJH 4RDQG 2IFFH 2ZUUA 1YNKL 5K9JH 1YMME 4JY6B 3CSPA 2FX7L 1A1NB 3B9EA 1SYVB 4R2GD 5JW4N 5CUSL 2DQIH 4AYFA 3OPZL 4G9DA 3MMEA 4BFBD 2GUOB 1B90A 1YEEH 3QH3B 1FLRL 4Y16A 1ADQL 3H3KA 5JZ7C 5KSVB 3G9AB 2YSSA 5ETUB 4YHML 4XZUB 3ZT6A 4DVRL 3NPSB 4MQTB 3C08H 2VR9A 3VD7A 3GSWA 3FB5A 4Z7UE 1F4WH 3GHBL 4NNYA 5DRWB 4AY0A 1WZLA 5CILH 1BQLH 5I75C 2NMSA 2R4SL 4R4NC 1J1OL 3TA3A 2JJSA 3RX7A 1TJIH 1A6UL 1B0RA 5FO9A 4RGMB 5HGBB 1QSFE 1MLBA 4YIQB 1HSAA 1UJTA 4NHCL 3QBTB 1FLTX 2ZP0T 4QOKB 3V52L 3V5DB 4DN4H 2V5SA 3HUJF 5C6PB 3RNKA 4JFOB 4WI6A 5EWIH 4XNXL 5HJ3A 4MJ6A 1H3GA 4H1LH 1P4LA 2H45A 4JHAL 5DI8A 3RHWF 4P48A 4WW2A 1AQDB 1HZHH 4JFDA 1IMHC 5I9QC 1A9BB 3CVIL 4UT7L 3KXFA 3EO9L 4TOYL 3EIFA 1AIFB 4HLZH 1AQKL 2BNUB 5IW1B 2WLYA 1DVFB 5EOCH 3VFWB 4RAHA 1KCRL 1ZSDB 3CU7A 4JREC 4XCFL 4Z6AT 4MB5A 2V5YA 1IGYA 2D2OA 1OSPH 5L2KD 2ADFH 4BFIA 4P2OC 1I85C 4TSCL 1MAJA 4MLSA 1MVUB 4MNHB 3KWWB 4LSPL 1MI5A 1G7HA 4X5LA 1EFXA 2AKRA 1TETH 4Y5YA 5D1XB 4Z78B 1R3LA 4Y2DA 43C9A 1YJDC 3UTSE 2A6KB 3VXSB 1UG9A 5EBWA 2ICWI 4F9LA 1K4DB 1SJEB 1I1FB 3L5XL 4ETQB 3PL6B 4LPWA 3OSKA 3U7AA 3TCLB 5IHBA 4UB0L 5CJ5A 4ZXBA 3OGCB 2EC9U 1XF2B 3ARGD 3F6IA 2V2WA 3TJHD 3S5LG 3B2UD 3QCVL 3VFPA 1CE6B 5E1AB 2PNDA 3PIQB 4PP1D 2DD8H 4P5MA 1K5NA 5INDA 1N0XL 5IJVA 1JHKL 2IH3B 4NQXB 1JYVA 1QBAA 4L1DA 4P4KA 1EZVX 4XI5D 1ZS8A 2C1OB 5F9WB 5IVNA 3AB0B 4LGPB 4WFFE 3OG4B 1B6DA 4Y1AA 4AEIL 4NQEA 4JM2A 1NEUA 4PRHA 4LF3A 2VYRE 1OD9A 5SWQB 1XR8A 3S34H 2Z31A 1I7RB 1B4JL 2P47B 3ZE0F 5GRYA 1NEZG 1GGBL 2FL5B 2QKIA 5TE4L 3NBNA 2BERA 4KHTH 4JFPB 1AHWC 1U93A 3D3VE 4JQVC 3I02B 3FJTA 5MHSD 1MELA 4AL8H 3VGFA 3CXDH 4ZQKB 2E9JA 2MPAH 4FXKB 4OCRL 4RMUA 1KEGL 4ODHL 4AM0B 3SDCC 5I74C 1LD9B 2HP4A 4JO3H 1OPGL 3OKKA 1G0DA 5C08B 4LCCC 1U3ZA 3HZVB 4QOKD 3LN4A 3QEHA 1Q0XL 4W4OC 2ZNXA 4U1MA 4Z7VA 1P7KB 3SCMB 1K2DA 3MJ8B 4PJEE 5KSAD 5F7UA 2XRAH 1MUJB 1U6AH 1YYML 5FA4B 1DVFD 3KYKH 4UBDD 2Y7QA 3DETC 3VXMB 5AWNL 2F5AL 2VXTL 1LK2A 2AV7B 1AGDA 5I1AA 1FE8L 1R5VA 2VZ3A 1K4CB 2IH1A 3NACH 1UH4A 1T83C 3BEVA 1YEHL 2F58L 2NY1B 4XCCH 3HAEA 5D1XD 2AQ1A 1UKQA 5F7MC 2ARJB 3ZE1F 1DQLL 3GIZL 4N8VB 2NXZC 5DK2A 3VXSD 3QDGE 1S5HB 2R1YB 4AIZA 2R9HC 2DKUA 1VGKA 1E27B 3SDAB 5ADOL 5ADPL 4O9HH 5J13C 1GZPA 3PL6D 1CGSL 1KIPB 2KUTA 5D9SB 2PF6A 5I6XC 1C16A 5GGVH 2FEDD 3C60D 3PP4H 3QULA 5ALBH 1IC5L 3RIAF 3BMWA 4CW1A 3E0GA 3MFFB 4H0IA 3M17A 4L4VB 3EO1B 3ZZ1A 3TBYB 1XGPA 4OUUB 1MJUH 1A1MA 5IVXE 2FHFA 4KY1L 1HYSD 2MHAA 4Z7QE 2CIIB 2EIEA 3BXNB 5KW9L 5SX5H 5BXFA 5DD1H 5DJXB 1MFDH 2HTKD 1Y6MR 3S3JA 1VCAA 5ITBL 4UDTA 3RWFB 1LO0L 2V2TA 3JWOL 1DFBL 3PQYE 2VLKD 2L0DA 4XVTH 1RHHA 1ZLSH 5FUOL 4MJID 2J8UB 2W0PA 4YUEH 3WFZA 1FN4A 1NMBH 4PG2A 3O3AB 3EYVB 5EZJA 2SEBB 1LEIA 5BS0E 3NCJL 1LEGB 1OHQA 4APQB 3WNNA 2IAMB 1NMCB 3MRHA 1KT2A 4XPTL 2ADJA 2BCKB 2IALB 4O4YL 3VFRB 4ONHB 1YA5A 1A7PH 2BRRH 3LKPA 4ZUWB 4IOSD 2AJUH 2CR3A 1FSKC 3RVWC 3FT3B 4L8CB 5C08D 4DWHA 3IKKA 4H1LG 3L3KA 5IW6B 1CLOH 1BF2A 5BVPL 4L3CA 1I1RA 4NQCA 5FKAA 3ARFA 5KSBE 1ZMYA 2YOCA 3TO4A 5AZEH 3SCMD 1RIHH 1WZ1H 1MHEB 4HLZG 1QSZA 1U8QB 4PBVC 5ITFA 2A9NH 3O45A 2W65B 2X6MA 5I1GL 3MOAH 4L4TA 3B9KB 1ZHBB 1FL6A 4P2CG 5C0FB 3IFPA 2JCCF 4WTWA 3U36A 2IPKA 3F7VA 1OGTA 4J3XA 1AXTL 2R0KL 1CXIA 1FH5L 4HH9A 4K55A 3RBSA 1BQHG 4RNRB 4QY8B 1EJ6A 1UM5H 4X7TB 4WUKL 4J1UA 1VACB 3V6FB 4RFNC 2YA0A 1FORL 5I1EH 3GHEH 4ZFOL 5EC2A 4ENEC 5F3HB 4Z8FH 1G0YR 3QIWC 3AREA 5KSUB 2GJ6B 3NIDF 1B4RA 3KJ4B 4JQXA 4MCZB 1BFVH 4JG0L 3WUWG 1WICA 4U31A 4K71B 1WBYB 3WV0A 2IFGA 4RAUA 4DGYL 5DMYA 3SDAD 5C0EB 3DOSA 3JV4B 3L5HA 3VE0A 1EFQA 5J6GB 3MNWB 2CDEA 2ZSVB 3BDYH 1A64A 1YEGL 3C2SA 4OIBA 3VFMB 3RNQB 1UZ8B 4FOMA 3DX7B 4OIAA 2WV3A 3KPRD 1J8HB 5C0DA 1XGTB 2QHRL 1LILA 2YPVH 2C9AA 3OAUL 4UU9B 5TDOB 3VXPA 4L4VD 1YC7A 5L8KB 3FO0H 4C58B 2HYMA 3DX9B 1ZWIA 4EN3C 3SKJL 5I75B 5IBLD 1O7VA 1S7WA 3R8QA 3TZVA 3NFSL 3QXAA 1BGXL 2XTJE 1UADC 3CZFB 1QRNA 5DK0A 1KB5A 1YPZE 4WI4A 2WIIA 4KDWA 1X5GA 1ZA6B 3RU8H 4XH2B 1KLUB 2C3VA 5F7HA 4L5FL 1ZTXL 3P0YH 2DL2A 5F7LB 2PR4H 4M7JL 2XKUA 5E5MB 5DQ9A 1YMHA 4U1SA 1S3KH 4QRRA 1A0QH 4TTDD 4RSVA 2RFXB 1YZZA 5EOQH 5LG1A 3MRBA 4N9GB 5IGXH 1H15B 1T04A 1PSKL 4APQD 2NY7L 4JJHA 2IAMD 3HR5A 1U8JA 3H2WA 5SWSE 1T80A 5I9QB 2X2YA 1G7QA 1GL4B 3DROA 2KDGA 5HHQA 1Y18B 4NUJB 4Y4HC 4X4YA 3SKOB 5FYJU 1JYXA 3L5WB 5GGUB 1A6PA 2XXMB 1M4KA 1F6LL 3VWJC 2QLVB 3CIQA 5HHMD 4JREB 2CQVA 1ZGLB 4G8IA 1V7MH 4OCNC 1VB9A 5ABDE 5C0GB 4F3FA 3MRDB 3JWDC 4X6CE 4P2OB 2GJZB 4TULL 4NNXB 2DQFB 5IHZA 5E8DH 4ZSOE 5MEPA 3QUYC 1R24A 1FZJB 3B9KD 3KPOA 4LSUL 3K8LA 4QXUH 2G2RA 2YMXH 2G5BB 4DVBA 1DQMH 1QSEA 3MRQB 3TP4A 4HWEH 4GG8B 1X4YA 4EVNA 1CD1B 1BM3H 4AH2B 2VIRB 1SBSL 3N1QC 2P45B 3S3SA 3U7WL 3RGVD 5IV2B 3ULUD 2WP3T 3GEWB 4ZFGH 1BQSA 4H5SB 5DMIL 3NPZB 4V1DE 2GJ6D 3N1MC 5C0ND 3HMXA 4Q58C 1WAAE 2DN7A 5FK9A 1ZOXA 4R97B 5CFHA 2GUOA 4ODUB 2W0FB 3QH3A 1JNLH 3HNVL 1INQA 3MV9E 3NFPB 4MXQD 1DTUA 4MS8C 3I50L 4J4PA 3S6CA 3CSYB 5KSVA 5BMFH 1CR9H 4XZUA 4M4PA 1EHNA 5FHAH 3BRDA 3VA6A 3PWLB 1PG7L 3D9AH 3HMWL 2IBBA 5I1KL 3DVGA 4JZJA 1K85A 4FQXB 5CP3H 1VFOA 4OQTL 2HA1A 1N4XL 1J8HD 4PJBF 1T3FA 5B4MC 4GJTB 4K7PH 2NX5E 4QRPE 4TNWK 3MLZL 3V0WL 3DSFL 5GGRY 4NZDA 2L4OA 3RPKA 2ID5A 1AHWB 2HAZA 2PO6C 3KYAA 4YX2L 5HGBA 3O11A 5FFLA 3O4LB 2AAVA 4YIQA 5LCVH 3KPQB 3V5DA 1JPTL 2Q7YA 4FA8A 4GRMB 1JFQH 5AD0B 5I74B 3FN0L 1XFPA 2RR3A 3BKJL 4Q9BA 1HOCB 2IFFL 5K9JL 3QNZB 3T0EC 4UZGA 5HYEA 3WN5C 5B3NA 1EAPA 1AQDA 4LFHD 3G6JA 1A9BA 2EDNA 5EOTA 3CFIC 1AIFA 4OLXH 1YEEL 3AS3A 3VFWA 2CKBB 3QP3A 4WWID 5CD5C 2FIRT 4PJ7B 1ZSDA 1NBZA 3C08L 4X0KB 2HFEB 3WNMA 1F4WL 1RULL 3WL9A 3GJFB 1R3KB 4Z7UF 1EK3A 1SY6A 5CILL 4NOFA 1BQLL 1I1AC 3UZQA 1MVUA 2BXZA 3KWWA 2NY5C 2WANA 1JWUB 3INUH 3BISA 3EFFB 5I8OH 2YD7A 2A6KA 4I9WD 1EEYB 4P2OD 4M48H 1LDSA 1CBVH 4XXCA 3EHBD 2A1WH 3U4EA 1K4DA 4HD9A 1SJEA 1I1FA 3LS4H 5HY9A 4ETQA 2QBWA 5B39A 2VLRE 1TVHB 3TCLA 1IT9H 2BNQB 2NXZB 5I1JH 4DN4L 1XF2A 3O6LH 4MWFB 4KAQH 3LIZH 5EWIL 5CJXA 3MCKA 2RAMA 4D9QD 1CE6A 4YHKH 2Y5TB 3PHSA 3TIDB 3QIBC 1HZHL 4K3EH 4KQ4H 3V6OC 4UNVA 2QR0A 2Y06H 2IH3A 1YNTB 2HLFC 1X5KA 2I25N 4HIXH 3V4UH 1C5BH 1T22A 2C1OA 3UAJC 5EOCL 2AJ3A 2GITB 2XY1A 2BNRA 3T0WA 3ALWA 4OZFB 3GZKA 5SWQA 2CDGA 2K1MA 3OB8A 1OSPL 2ADFL 4HFWA 3ZMRA 3W9EA 4U7MA 4ZNEA 4FQHB 5KANG 1X5FA 4KKNA 1BBJA 1C5DB 4JFPA 5FGBC 2EYRA 1TETL 4RDQF 3I02A 4FQXD 3L3GB 1LO5B 3EYFA 4ZQKA 4PRNB 2NW3B 4FXKA 5JOPD 3V6BR 2BHUA 4MNQD 1V5JA 4YQXH 3STBA 2YZ8A 3O4LD 3JV6B 4P59L 4R96A 5MENE 5J3HD 4HKZB 1T7ZA 2VRAA 1R5IA 2GT9B 1AR2A 4BZ2H 2E7LA 1OAKH 2VZVA 2H6PB 1REIA 5B38B 2DD8L 3LDBB 2R56H 4DGIH 1D9KC 3BN9C 4TNVF 4PRIB 1HEZA 3BJLA 3CH8A 2ADGB 3MJ8A 4DQOH 5T5NG 2VDQH 4H26B 5FM8A 3IT8D 4YPGB 3T1FB 3I6GB 4UQ3A 1GGYA 3QXTA 1MIEH 4TSBH 2R2EA 3W0WE 1JYNA 4YHIB 5FA4A 4CDHA 1F02I 3MA7B 3VXMA 1R3IL 3S34L 4XWOC 4PJAA 2AV7A 1TZHB 1K4CA 4KHTL 3GRWH 3SGJC 4OFYD 1EBAA 3GMMB 4X6DB 4OZIA 5JHLH 4AL8L 2ARJA 3CXDL 3HZMB 4CNIB 4LCWA 4N8VA 4ZTPL 4WUUD 1CGYA 2IANE 2MPAL 3LCYA 2OYPA 1S5HA 1KELH 2R1YA 3RWGA 8FABB 1QO3A 1E27A 3SDAA 2JJUA 2Y1VA 2X89A 4JO3L 2OJEB 3P40A 2R0WH 1XZ0A 4PLKD 1KIPA 1ODAA 4PJ5B 3VXRE 5D9SA 2NXZD 2BNQD 3U2SA 3DVNB 3IDJA 3LKNB 4PIRF 2GAZA 4NDMA 1U91A 1QPPA 1BVZA 2V7NB 4X9IA 5KOMC 3EDFA 1ZV5A 4NWTH 5I8EB 4L4VA 3EO1A 3TBYA 4LAQH 5D6DC 3BAEH 3CVHB 4PJEF 4OZGB 4HG4K 4NO2B 4NCDA 1U6AL 4NZJA 5HDQH 4KDTA 3KYKL 4KKCD 1WWWX 3RWFA 1UXWA 2E9IA 5EU4B 3GSNH 4EN3B 4CVXB 1WCQA 1IAKB 4C57C 3S35X 2D7NA 2VTFA 5HGGS 1U8IA 2PYEE 3NACL 2R1XB 4KFZC 4WNQB 2OR9H 3L3HA 2R1WA 1XCQA 4XCCL 2DMCA 2J8UA 4OZHA 3B5TA 4UT6H 3S36X 5ID1B 2AEIT 4CVZA 3MV7E 1CIUA 2ICCA 1WT5C 3E2HB 5D2LE 2BCKA 5CBEB 4O9HL 1JF5A 4IRJC 4I1NB 3VFRA 4ONHA 4ZUWA 2OTWB 3FT3A 4NC2B 1W72A 3B5GA 5GGVL 1MCHA 3PP4L 5IW6A 3LPFA 5ALBL 3K8MA 4M62H 4NYLB 3UEZA 4E0RB 1MLCB 1FVCA 2F54A 4IRZH 4QHNA 2J6EH 1CLZH 3GSQB 1IEBA 5D70H 1MHEA 2OQJB 3WE6B 4MCYB 1MJUL 4LCUB 3FQUB 4Z76B 4XBPB 3WHXB 5CS7A 5IVXF 2A83A 3Q6FB 4UIKH 1MPAH 3O3UN 5DD1L 1EHAA 1NFDE 4WEBH 4Y19A 1MFDL 4LMQE 3U0WH 4Y0GA 3DWTA 1A4JA 2IQAB 3CMOH 4RNRA 2P8LB 5FECB 2DWDB 4FQLH 3QUMB 3U82B 4XVTL 2ILLA 3R1GH 1MFBH 3V6FA 1ZLSL 1UZ6F 3GMQB 1FVDA 1CG9B 2H1PH 2UUDK 4YUEL 3TVMA 4PJ8C 1NMBL 4KI5D 5DC0A 2GJ6A 4WFHE 4X9FA 1F4YH 2H3NB 1OTSD 5D7JC 1ZVYA 2ZCHH 4JE4B 1CLYH 4LVOC 2HFFA 5C0EA 1A7PL 2BRRL 4GS7C 2XT1B 2AJUL 3JV4A 2DM2A 4EZMA 4PJ5D 2AI0H 1CLOL 2ZSVA 4EDWH 1SEBB 3RNQA 3RUGA 1UZ8A 5AZEL 4XP5H 3V7AG 5ISZD 1XGTA 1WZ1L 4UU9A 1NC4A 1YC8A 1P6FA 2A9NL 4LARH 3RAJH 3FOLA 4MQ7A 1IZJA 5CEXB 4YXLL 1ORSA 2J8HA 3UPRA 5IMLB 1UM5L 1ZA6A 5IFJB 4XH2A 3RGHA 1KLUA 4FMKA 4EN3D 2V5MA 4QT5B 2XKSA 1Q94A 2DQTH 4Y88A 3GNMH 4JN1H 5I1EL 3GHEL 1NUNB 3F6LA 3JZ7A 5HHVH 2WAHA 4Z8FL 1OL0A 2RFXA 1FP5A 1BFVL 5JHDE 4N9GA 4XPFH 3OKDA 3B9VA 4UDUB 3T0EB 3WN5B 3VXQB 3LH2H 5KANI 5DVOA 1P5UA 4HS6B 4EJ1C 4L8BB 4NUJA 5I19H 4QNPF 5EU3B 5IQ9B 3MRCB 4YBQD 4DUXA 3BDYL 2FGWH 2VUOA 2Y23A 3TH4T 3L5WA 5GGUA 3RY6C 5IB3B 2A74B 3JV5A 5JPNA 5DJAA 2FJHB 4W68A 3LS5H 4RGNE 2XACC 4JO1H 4JFFE 2YPVL 4QXTB 2Y72A 3TBSB 3MRDA 3FO0L 4K2UH 1KCUH 1I85A 2GJZA 4K9EC 4P2OA 3BWAA 4E41A 4QXWA 1OAUL 3QDME 4Z7WE 1FIGH 3CX2A 4I2XA 2CIKA 4ZOAA 4EUPH 2NCMA 1KJMA 3O6MH 4P2RA 5HHPA 1C8PA 3RU8L 3C5ZC 3EYUH 3C2AH 1J5OH 1T5XB 3HLAB 4AH2A 3P0YL 3CFJB 4ZO9A 4HJJH 3WFHB 2PR4L 1FAKT 5DUPL 5EUKB 2FZ3B 4XVUC 4HGWB 1S3KL 5JPMA 1A0QL 2AK4B 2FECI 2Z35A 3VFTB 5EOQL 3V7AE 1K3ZA 5DLMH 2R15A 2EC9T 1ACYH 3OKLB 5IGXL 3TF7C 4GRWE 2XKNB 4LNRA 1TTGA 4RA3A 3RI5F 3QIBB 5LVEA 1UT9A 5EU7E 2FECL 4NFDA 2BHYA 3CSYA 4POYA 2EYSB 3VG9B 4JHWH 3G6AB 4WHDA 1V3KA 2DRUA 4JKWA 5EU5B 2JE8A 1D6EB 4DZ8B 4MS8D 4LMQI 5FF6B 1V7ML 3WSQH 3MROB 4LGSB 4B7LA 4PJHB 3MX0A 5E8DL 1P4BL 2C4XA 4X6CF 4BJLA 3DRTB 1AHWA 4QXUL 5DHVB 4OLYH 1KN4H 2OI9C 3O4LA 4X83A 2EDEA 1DQML 5D2NC 1CDGA 2NQCA 4HWEL 2DB8A 4HZLA 1JHTB 1WEJH 1BM3L 1KGCD 3T0VA 1QNZH 3SDCA 4OF7A 4F80A 1EGJH 1O0VA 1HOCA 4K3DH 4ZFGL 4PTUB 2GK0B 2XI9A 4LCCA 1RUKH 2HFGH 3ARRA 3DYMA 3RA7H 3NCBB 1B0GB 4L9LC 4W4OA 4H0GA 2XPGB 1RK1A 1WAAF 1D9KB 1A47A 1JNLL 4YFEA 4LASH 2AJXH 1OAQH 3T4YB 1IEHA 4W4NA 4KMTH 4PJ7A 1CR9L 2OL3B 5FHAL 3RZCC 2HTLC 2HT3D 2HFEA 3O3DA 4R90H 5HXMA 4L8DA 4PJXE 3SQBA 5J89A 3D9AL 3H3PH 3VFNB 2YA1A 5CD5D 3OKOA 3VRIA 32C2B 5GGTA 4YGVA 4K7PL 4LSQH 5BV7B 1TTUA 3CLEH 2J4WH 3BRGC 4OTXH 1MCFA 4I4WB 1F97A 3WIFB 1EEYA 1T83A 2X9YA 2KQNA 3QHZH 1FNSH 4IHOB 3BGMA 1TVHA 1U8MB 5IEKB 2XIDA 2F53A 4LCIH 1EO5A 1JFQL 2I60H 1XF1A 3FTGB 4HAGA 2DIJA 5DVMA 2VDLH 2KQMA 5HYJB 1FFPB 4X4XB 4KV5F 5FYKU 4YHNB 4F7MB 3TIDA 4HWBA 3AGVA 4CBPA 3G6DH 5BZWB 3C09C 1B6UA 1YNTA 1QVOB 4OLXL 1OGAE 5CJQH 2VWEE 2MQ3A 3QIBD 3EOBB 2X7LB 3SJVE 5E8PB 4Y5XC 4OZFA 3FZUC 1G7JB 4MDJB 2LU3A 2WBJC 3KPSE 3RWHA 4DZBA 2E3VA 2H32H 5C0CB 3UAJD 4FQHA 2WNGA 2HJKB 4O2EB 1A6AB 1C5DA 1UM6H 2NY0D 4UIMA 3IXAB 3INUL 1KEMH 3CXHK 1HHGB 3TNNB 5KAQG 3EO0B 5TH2B 2XFXA 4I0KA 5DQDH 2FCBA 1JZ7A 4PRNA 4M48L 3Q5YA 3LD8C 2XV6B 1F45A 1FL5A 2LU4A 2NW3A 1CBVL 2A1WL 1KPUB 2AV1B 1WWCA 4KMLB 5DGQA 3LS4L 4Z5RA 2HJLB 3OR7B 4XRCB 1R5WB 3GB7B 4UT9H 2GQHA 5I1JL 3JV6A 1X4ZA 1S7QB 1LK3H 3O6LL 4KAQL 1FO0B 3E6HB 3LIZL 4WI3A 4YHKL 5C0AE 4IRJB 5B38A 4NN5B 4XCYB 4K3EL 4KQ4L 4PRIA 2ADGA 1BWWA 4KJWD 2Y06L 5JLZB 4R7DB 4YPGA 1CICC 4KK9C 2Q8BH 3MRNB 4HIXL 4RIRB 2G9HA 3V4UL 1C5BL 1A6WH 2AJSH 4CMMB 1T1YA 1TQBC 1KLGB 2RJMA 4YHIA 1D9KD 2X4TA 3BN9D 3KLDA 4X8XA 4PGEA 1HHIB 3MA7A 1NH6A 4W6XB 3MC0A 4LL9A 1R0AH 2PW2B 4NPYB 1TZHA 3BWUC 4M1DH 5MEOB 2DDQH 1WWBX 4HJ0D 5IR1A 2CDFB 2YZ1A 4X6DA 1CFBA 5EPMB 4HG4J 2WQRA 3WFDH 1J10A 4LLUB 2YKLH 4BH7B 3HZMA 3V7MA 3TFKD 3NCMA 3LQMA 4EUPG 5D1ZC 2UZIH 3QUXC 1D5ZA 4YQXL 3QIWA 4CRPA 1DL7H 3NIFE 1MHHA 1DN2A 1UYWH 3SKMB 4HBCH 4AQOA 3MREB 3T0XA 1U92A 1KIQA 5D7JB 4G42A 4BZ2L 2A0LC 2R56L 4DGIL 2V7NA 3GSOB 1G9MH 5FO8B 3D85A 4GKNB 4DQOL 2VDQL 1DBKH 3MR9B 3QNXB 2JJTC 4D0DB 4OZGA 4QO1A 1MIEL 4TSBL 3MV8E 4NO2A 2BSTA 2UUDH 4Q9QH 3R0MA 5SWZB 4GOSA 1MHCB 1JF1B 1VEMA 4X4MA 2P5EE 2VR5A 5EU4A 3VFGH 1ORQB 4EN3A 4CVXA 2B4CC 1R3JB 1YN7A 2G75B 1RUAH 1CQKA 4OCWH 1LP9E 3GRWL 4P2QB 5C0CD 4BKLB 4QTIH 4NN7C 2C3GA 3K8KA 4J3VA 5I8CB 1AFVH 5JHLL 5KVGH 5ID1A 3U0PA 1HHHB 4PJFB 4YEFA 1UVQA 5GS2H 1CWVA 3PWPB 1KELL 1A9EB 4MSWB 2YR3A 3N9GH 5C6WH 2ZOLA 3T65B 5CBEA 5HYQA 2R0WL 2EDLA 2Z8RA 3D39E 1IGMH 2MSPA 4PGBB 2P8PB 4F2MB 3HPLB 4PJDE 4RAVA 2FDBP 1Z2KA 2BDNH 5I17A 1RZ8A 4HXBL 2DM4A 4IDJH 3CX5K 3T09A 4NYLA 2NLJB 1BHGA 1N5AB 3KPNA 5EUOE 1MLCA 4E0RA 4FABH 4Y4HA 4NWTL 2EKSB 3P0VH 4PJIA 1X7QA 3O2WH 2OQJA 3WE6A 3BAEL 4Z76A 1HYRC 5DEZA 3VWJA 3WLBB 3Q6FA 5CZXD 3HC3H 5K9OB 5HDQL 2IF7A 1GC1C 3S4SA 3NOIA 4RX4D 3QB7C 2IQAA 4HX1B 4QXGH 3GSNL 4MZ2A 2OSLB 3QUYA 4LRNH 2XWTB 1UB5B 3P4OA 4MB4A 2OR9L 2QSTA 1IAIH 3GMQA 1NAMB 1CG9A 3C5SB 4UT6L 3DX8A 4KTYA 3EYQC 2YUWA 4FTVE 3WNPA 1ONQB 2P4AB 1NAKH 3TCXA 5D2LF 2X1PA 3ORJA 3DUSA 3MV01 2IMNA 5IUSA 3BW9B 1TPXC 1G7LB 1SEBA 4M62L 4P9MH 3WJJC 1AO7A 3BVNB 4NP4H 5FYKE 4GQPH 4IRZL 5J56B 4MD0B 4NKQB 1CLZL 2XG5A 3RKDC 5D70L 4PGDB 3BD3A 4EIGB 3MGAA 4WU5B 1WLHA 4N1CA 3BEWB 1MPAL 2OJZH 3UP1A 4TSAH 4G8GE 4E5XB 1DCLA 5CEXA 4WEBL 1AJ7H 3KR3H 4UQ2B 3U0WL 3K80A 3CMOL 5IMLA 4V1DD 4FQLL 1MCRA 3MJ9A 5IFJA 2EXWD 3R1GL 1T5WA 2UWEE 4XPAH 2PO6A 1MFBL 3NZ8A 2H1PL 5D2NB 2BY3A 4P2QD 4LLQB 4OM0H 2DI9A 4LVEA 4KROB 2IEPA 1FQ9C 1UKTA 3U30C 1A14L 4YDJB 1F4YL 5I0DA 1IILE 4OFIA 4ISVB 1PKQA 4YK4C 1IFHH 2X44D 4UDUA 4CGTA 3T0EA 2Z93A 2ZCHL 3VXQA 3WN5A 1CLYL 43CAB 4HC1A 1RZKH 4KVCH 4HS6A 4ONFL 3LEVL 4ZPTB 2VL4A 4L9LB 4L8BA 5EU3A 1WTLA 5IQ9A 2AI0L 5H35A 4N90D 4EDWL 5IB3A 4FQ2H 2A74A 1QBLH 3CDYA 3LPGA 3QO0A 2FJHA 4XP5L 3H9SB 3GSVB 5T3XL 4UOW1 5KVMC 1EEZB 1W0WA 5C07D 3WNLA 1S9YB 1JNJA 3TBSA 3RTQC 3D5OF 3O6KH 5DJ0A 2D7TH 1I1AA 2WWKO 4LARL 3RAJL 1A02N 2X4PB 2H8PB 1DBAH 3WCYA 4DW2H 2CO7B 2ZG1A 1LQSR 4PTTB 1ROWA 1R3HB 4XAKE 3FB6B 2GTZB 2G60H 2DIBA 3MNVB 5J12B 1SMAA 2DQTL 4MNGB 3GNML 4JN1L 2FZ3A 3W39B 2ZOKB 4HGWA 5HHVL 3P4MB 1YQVH 2XG4A 4PJGF 2AK4A 4S1DC 2IMMA 4F57H 3ARUA 4UILH 4E9LA 4LHUA 4XPFL 1I9EA 2XKNA 1JP5A 2QADB 5LGKA 2CO6B 3QIBA 4JO4H 3KYNA 3V6OA 4MQXD 3C09B 5E08H 3HNSH 4AENA 4DAGH 4JG1H 1VFBB 3DLQR 5I19L 3G6AA 5JIHA 1RURH 4JFEE 2FGWL 1BFTA 3PUCA 4M7KH 5CJ8A 5EORL 1KIUA 5EBMB 1DE4B 4AJ0A 1U8OB 1D6EA 4OCXH 4DKEH 3PXJA 4DZ8A 1DJSA 2C7UB 3LS5L 4JO1L 2HT2C 4LSTH 5DMKA 4ZMAT 4PP2B 4K2UL 1KCUL 3QWRA 4C55A 1FIGL 5FGBA 2HKHH 4B53A 4Z7WF 5DHVA 4ZFZB 2AXHA 3O6ML 2GSIB 3EYUL 3MRGA 4GW4A 1JHTA 3C2AL 1J5OL 1CT8A 1MCDA 1UKSA 2P7TB 1JWSB 3O9WC 5DJYB 1A8JH 1OF2B 4HJJL 4EDXB 1Z6JT 2CUIA 4DJMA 1P84K 4Y4KC 3X11B 3BYYA 4LLMA 3QFDB 3D25B 4OGXH 1T2QH 4YFDB 3PNWB 5DVLA 4KROD 4Q9CA 1FCGA 1ACYL 3NH7L 5DVNA 5I8KH 1SJHB 2XPGA 2EICA 4ZO6A 1D9KA 1MFCH 4OV6F 2Z8VC 3T4YA 4L3EB 1CDJA 1JWMB 3VGAC 2OX5A 4JHWL 1CICB 3UMTA 1I75A 1FC2D 1T0NA 2OL3A 2P42B 4IMLB 1FBIH 5L0QB 1TQBB 2NR6C 3BPLC 2PYFB 3JWOC 4YBLC 3VFNA 5KZCD 3V4VH 4IIQC 1N5YH 2H2SC 32C2A 3GSXA 3WSQL 5TF0A 3H9SD 3QDJE 3G08A 3BP7B 2EDBA 3FCTA 2ATPB 4O00A 1DQDH 2FR4B 2D4DA 4I4WA 2NY2C 4ODWA 3WIFA 1EEQA 3QQ4B 3SGJA 4JFQB 3B5HA 4ELKB 1F6FB 3REVB 4OLYL 1KN4L 2UVEA 4IHOA 1XT5A 5D7IF 1U8MA 1PGRB 2W60A 5IEKA 2VUYA 1WEJL 4NOBA 1QNZL 4GXVH 2DM7A 5ESQA 3FTGA 5DD5H 3K7UA 1EGJL 5HYJA 1FFPA 2QEJA 3UXFA 4U3XA 3CXHJ 4F7MA 3U46B 4KUZH 3CFDA 1RUKL 2HFGL 3QDAA 5BZWA 5BRZA 3RA7L 5FYJD 4EI6A 5HBBA 3HPJA 2APFA 3ET9F 3UTOA 2QADD 3D0VA 4XMPH 5I16A 2AJXL 3QPXH 1OAQL 2L7JA 3EOBA 1MCLA 4KMTL 4CADA 2VLJB 3LB6D 2OTUB 5D6DA 2VSCA 4PREB 2QSVA 1G7JA 1TJHH 4JM4H 2EXYC 4R90L 5GRJH 5CKGA 1N6UA 5FKPB 1HKFA 1T21B 2VE6B 1L6XA 5CJOH 5C0CA 1BIHA 3H3PL 2IBZY 3QZWG 4WJ5B 3LRHA 4Y8AA 1ZHNA 2HJKA 1A6AA 5DF0A 4WHYH 3GIVB 3AVEA 3IDXH 3QEUB 4JKLA 4LSQL 3CLEL 2J4WL 3TNNA 4OKDA 3EO0A 5TH2A 4OTXL 4JANB 2D03H 2EDKA 3F12A 4QF1B 1KPUA 2C4FT 1QEWA 3OR7A 3QHZL 1FNSL 3B3IB 3GB7A 3LY6A 4Y1AE 3LZFH 3QSKB 4LCIL 1S7QA 1WT5A 4A6YB 3HZKA 1FV1B 1H9VA 2I60L 3E6HA 4JDVB 1NC2B 4KK6D 2VDLL 4M7LT 4L29B 5DS8B 5HHOE 3MRKA 2P5WB 4IRJA 3FRPG 2VDKH 4NCC2 4U6XA 3NA9H 5A43C 1S7RB 1MJJB 1KN2H 4XCYA 4NZRH 4ZUSB 3G6DL 2CLZB 3TH3T 5I1LA 5JLZA 2XICA 2ZCKH 4C56D 3MRNA 4YHPA 4KRNA 1MCWM 3O6FB 3HE6D 5CJQL 3LKRB 1BIIA 2GK2A 1FAIH 3G5VA 1KLGA 2Z91B 4YR6B 4JDZB 1J88A 1CQYA 1JRHH 4L3ED 5C09A 3KS0J 1CICD 3DHJA 1V05A 4OLEA 4JY4A 2PW2A 4NPYA 3DXAE 4PFEA 4R3SB 3VDBA 2ATKB 5MEOA 3R06B 1JPFB 1C7SA 3SDDD 1UM6L 1G84A 1KEML 3ZKXC 4KUCD 3HFML 5CIPH 4KRPD 4LLUA 1U8NB 5DQDL 4BH7A 5F1SA 1UQSB 1I7TB 3KPTA 1L7IH 1QFPA 2E6JA 4UT9L 3GMRA 4PJ8A 4YPJA 5L8JB 1LK3L 3W5MA 3MREA 3BO8B 4DEPC 5C9JB 3C9NA 3TWCH 5E99H 1HKLH 3MPCA 4U1IB 5D7JA 3VJ6B 3JTSA 5E2WH 5T33H 2I9LA 3GSOA 1XGRB 4RMTA 1VEPA 4XNZC 3MR9A 3QNXA 3S98A 4D0DA 3ILQD 2Q8BL 4LLVB 3ARVA 4YO0B 1A6WL 2AJSL 1OAYH 5GGSB 3MRPB 1YEIH 4WFGD 1JI2A 5SWZA