4MWOA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor cpb-t
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
total genus 66
structure length 193
sequence length 193
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mwoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mwoA01
2WF8A 2WF5A 2YMMA 4KNVA 3ZU6A 4EENA 3FZQA 3I1YA 2D2VA 1RMTA 2YMPA 2P9JA 3K1ZA 2EARA 2RB5A 5ALZA 4EX6A 1Z4JA 3W5DA 4NV0A 1WZCA 4Y2VA 4Y2UA 5AKKA 2C9MA 5AI6A 3GYGA 2B8EA 3L8EA 2I6XA 4G9BA 2IOFA 1Q92A 4CF5A 1QQ5A 4XOUA 3A3YA 5AVQA 1RLOA 3N28A 2HI0A 3QU5A 2G09A 3ET4A 2P27A 2I34A 2HDOA 4YIHA 2YJ4A 3ZTYA 2PQ0A 2Q5EA 5AW5A 1RPZA 4OCZA 3BA6A 3DAOA 3OCXA 1U02A 2WF9A 5AI4A 3KC2A 4QJBA 2EAUA 1T9ZA 3KD3A 2MSNA 2W11A 5AW3A 2HSZA 5AKHA 1XPJA 3SF0A 3ET5A 4Y2SA 4ZEVA 2YMLA 2HHLA 2P11A 3ED5A 3P96A 1RDFA 3FM9A 4J03A 5AK6A 4UMDA 3SLRA 2ZXEA 2ZBDA 2B82A 4UMEA 5AW4A 4XPZA 3KZXA 3AR7A 3I76A 1NF2A 5ALNA 4JDPA 2I33A 3PCTA 2I7DA 1WVIA 5ALOA 5AW6A 2HF2A 5AW9A 2IOFK 1AQ6A 5AM2A 4NWIA 1ZD5A 3M9LA 2CN1A 5AVXA 5FP0A 1U2SA 4UM7A 3KDPA 3DNPA 5ALQA 1L7PA 5AW1A 2RAVA 4BEVA 4O8CA 4OD0A 5ALRA 4GXTA 5ALPA 3A1DA 2GO7A 2B30A 4JB3A 4UMFA 4BNDB 4BX3A 4Y2XA 4AS2A 3FVVA 3L0BA 3QYPA 1XVIA 3SMVA 2R8XA 3E58A 2OM6A 5ALFA 4XQ0A 2R8ZA 1Z4PX 3W5BA 1LVHA 5AKJA 3SHQA 2R8YA 2RBKA 1KYTA 3WK8A 4YCMA 5AIAA 3ZX5A 3ZUPA 5AI5A 2ZBEA 1ZRMA 4XE5A 3S6JA 5AVZA 2YJ6A 1QQ6A 5AK3A 2I54A 2YMQA 5ALDA 2FPXA 3FPBA 3UMGA 3D6JA 4DFDA 3U19A 3ZX4A 3ZVMA 1RKUA 1YJ5A 4AS3A 3L0YA 4HGOA 3PGVA 4HGPA 4BBJA 1TJ3A 1ZD2P 3ZVNA 2R8EA 1RMYA 3U7GA 3KOOA 5AVRA 2YBDA 4RESA 4EEKA 1Z4NA 3KBBA 2YN4A 2GHQA 5AW7A 1RRCA 2JAWA 2HOQA 3OCUA 4KX3A 4MUMA 4DWOA 2OA0A 1T5SA 3AR9A 1RLMA 2W4MA 1RKQA 2ZG6A 4Y2RA 3I28A 1Y8AA 2HX1A 1N8NA 3EPRA 3NAMA 5ALYA 2HEGA 5ALWA 1ZJJA 2ZBFA 3OCVA 4F71A 4H1WA 3U7FB 2ODAA 2GHTA 2IOHA 3AR4A 3L8FA 3NANA 1U7PA 3QU9A 2C8KA 1ZRNA 2AUTA 5ALLA 4HAIA 4ZEXA 5AVWA 4Y2YA 4C4SA 1YMQA 4UW9A 2PR7A 5AM0A 1S8OA 5A3QA 3E84A 3RF6A 4QQFA 2WF7A 5AK4A 2JAUA 5AI0A 2FUEA 5AKIA 1ZD4A 3WKDA 2CFTA 2O9JA 4Y2QA 5ALSA 1U2TA 1QQ7A 5AM4A 1VFPA 2YFYA 4UM5A 3ESRA 5ALHA 4OHFA 1J8DA 4I9GA 4NABA 4AP9A 2O2XA 1L6RA 3QUCA 4IG4A 2G07A 2JARA 2WM8A 2NO4A 1FEZA 3ZVLA 1XP5A 2WFAA 4UARA 2FEAA 2OYCA 3ONNA 4FYPA 3RFUA 4I9FA 2BY4A 4YCLA 2HCFA 2Q4TA 1ZS9A 3NRJA 2C4NA 3EWIA 3QUQA 4L57A 2FDRA 3R4CA 4KNWA 4DCCA 3E81A 4DW8A 3PGLA 3IJ5A 3DV9A 2AH5A 1Z4MA 1Z5UA 2FI1A 3FGOA 3L0CA 2MU1A 4YIKA 5A3SA 3U7EB 5AKGA 5AI8A 1O03A 4CF4A 4Y2JA 5A3RA 1O08A 1QH9A 2B1RA 5ALEA 4CF3A 3B9RA 4L6AA 1Z88A 1CR6A 1Z4QA 3A1EA 1LTQA 2IYEA 1RMQA 3MN1A 3R9KA 1L8OA 3OPXA 4HYTA 5AKYA 3AR5A 4RETA 4C4TA 4OFZA 4UAVA 5AM3A 3L1VA 3QGMA 3WKBA 2AMYA 5AM1A 3WK7A 1Z5GA 2G0AA 4F72A 2RARA 5AVSA 3OCYA 1X42A 3FPSA 3I6BA 1NNLA 5AESA 1YS9A 3W5AA 3L8GA 3J7TA 4CE6A 3WK9A 1Z4IA 4HGQA 3HLTA 2YY6A 3QU4A 3VAYA 1RQLA 4BX0A 2JAOA 3MMZA 3OCWA 3QU2A 1ZOLA 3QUTA 1TE2A 2FPRA 4YGYA 3AR8A 2G1AA 2I55A 3WGVA 3UMCA 5AVYA 4PNHA 3ESQA 4UU1A 2Q4RA 3N8GA 2QLTA 1MH9A 5ALGA 2G80A 2OBBA 5AW2A 5IS2A 1SWVA 4HGRA 5ALUA 1L7MA 5ALIA 2DQSA 1YNSA 3B8EA 3BWVA 4CNQA 3AR6A 2IA5A 3AR2A 4J2TA 5AI9A 3L8HA 4Y2TA 1YV9A 2EATA 1VJRA 3CNHA 2B0CA 3AR3A 3M1YA 2FPSA 1L7NA 3R09A 4UASA 4Y2PA 4UMVA 2B1QA 2G08A 1ZD3A 3ZI4A 5T41A 5IT0A 1RLTA 1RC8A 3TLMA 3MPOA 5AICA 3HYCA 3QLEA 5AKEA 1TA0A 4ZEWA 4GIBA 3NALA 4L6CA 5ALVA 3WK6A 5AVUA 4Y3UA 4UAUA 2W43A 4EELA 5IT4A 3OCZA 3ZTWA 5AKXA 1IWOA 3WKEA 4YH1A 3WK4A 1SU4A 1S2OA 3ZWKA 2X4DA 5AKLA 2JGAA 1NRWA 3QNMA 3SKXA 1JUDA 2BDUA 2C8LA 1L7OA 4FFDA 3IB6A 1WPGA 3PDWA 2NO5A 2HF7A 3SKYA 2P69A 3NASA 2HO4A 3U13A 1Z4KA 3QXGA 5AK5A 3U26A 3W5CA 4BX2A 3CZ4A 3U7HB 5JJBA 3N1UA 3L5KA 3WKCA 1T5TA 1L8LA 1YDFA 3UMBA 1CQZA 2QYHA 3QU7A 4BYGA 3QX7A 2WF6A 3WK5A 2CFSA 1Q91A 3DDHA 4G63A 1EK2A 5AW8A 3NUQA 4HGNA 3WKAA 4FE3A 2C88A 3ZW7A 3IRUA 4C4RA 3F9RA 5ALXA 3NIWA 3N5KA 5AHXA 3N07A 2B8JA 3QUBA 1Z4LA 1Z4OA 2GFHA 4KX5A 5AKZA 2GMWA 1U7OA 4YCNA 3MC1A 5AVVA 2ZBGA 3L1UA 5ALMA 2FPUA 3ZWDA 2FUCA 4NAVA 3EF1A 1EK1A 1K1EA 4B6JA 4MWOA 2G06A 2ZOSA 2NYVA 5ALKA 5E0OA 5AIBA 3UM9A 1N9KA 3OTQA 2WHEA 3SD7A 1TJ5A 4NFLA 2PKEA 1RQNA 1RKVA 2VKQA 3L7YA 4E88A 1QYIA 4UU0A 4BKMA 3E8MA 4BEWA 3B9BA 2CFRA 3EF0A 2BDEA 4KYTA 4KN8A 2YJ3A 4EX7A 1SWWA 5AM5A 1F5SA 2AGVA 5ALTA 3WGUA 1PW5A 2FPWA 3A1CA 1WR8A 5AW0A 4IFTA 5ALJA 2YJ5A 1J97A 5AVTA 4BNDA 4UATA 1VJ5A 4EZEA 1TJ4A
chains in the Genus database with same CATH superfamily
1RABA 3E27A 4COKA 3REQA 4N8DA 1US8A 3DC7A 1N5MA 1K9SA 3ELDA 3LZCA 1EGAA 3ML1A 4GI2A 5CB4F 4RW0A 4F04A 4GRIA 4R40A 2WWTA 3PC3A 3BSYA 1RE1A 5A5DA 3R5HA 1IBSA 3KKMA 4NYIQ 4QBHA 2PO7A 5HSGA 2UVQA 4UDNA 5I48A 5JT1A 3A6GA 2Q49A 3CNOA 2RG7A 3EW7A 5H7XA 5CW1A 3L0PA 3MOSA 3PCRB 2LCFA 4LJSA 4EUEA 1T26A 2M6KA 5KTPA 3O0DA 3PHIA 1Z2DA 1A5ZA 2B8EA 3JVVA 1O6BA 3TVYA 4CF5A 3ZU3A 2VHXA 3M82A 2Q6LA 5HFNA 1UPXA 2XTMA 1XXLA 2YHBA 2AJDA 4RTSA 1G6OA 5FV4A 1NQ5A 1OV6A 1TM2A 1R8XA 1HTTA 5KQRA 2O23A 5CTJA 4FMDF 5M29A 3TRIA 5BR7A 1U16A 4NZ9A 3NX4A 1COZA 1PGPA 3T0IA 4ZU1X 3VR5D 2HJHA 5TMBA 4BCCA 1A4UA 2DQZA 5AJXA 1EDZA 1MW9X 1RZ3A 5DBEX 2AQKA 1HYBA 4J6EA 5IH3A 2E4XA 2B7LA 4R16A 5EIHA 5SZJA 3EUAA 5B7NA 3G85A 3C3DA 3DPSA 2JGJA 1GAEO 2JFOA 3IPXA 4MV8A 1NVDA 2BEKA 3ZGZA 1Q0QA 1W0KD 3IQDB 3QFSA 1VKNA 3KSAC 4XD7A 4BNXA 1XTQA 2RGDA 2I62A 5EEGA 4E5KA 5ELMA 1XRJA 1BIFA 4J03A 1HUQA 4O2LA 4E0BA 3JYNA 2SNIE 5B6PA 4ETMA 2HDNB 2J6CA 3TLGA 1J24A 1EUCA 2AD5A 3WRYA 3ZZUA 4RKRA 4LF4B 1UQTA 3D8TA 4XZ3A 3ZCPA 1H0HA 2HRBA 2AR7A 3NOQA 5KVAA 3KQNA 3FFAA 2ID9A 3BHGA 2X5XA 2LCQA 3G5AA 3OU6A 4G0ZA 4I5FA 4KE7A 1G3UA 1SIBE 3ASYA 4F4FA 3ISJA 3M9LA 3TNYA 4EHKA 4QOJA 3PHLA 5KNDD 5IULC 1RI1A 4D4MA 3PA6A 4HQNA 4UTOA 4D3ZA 5FP0A 1E6CA 4RADA 2AFVA 4Q1EA 4LGVA 2SBTA 5A5FA 2W2PA 2C2BA 3U4MA 4TS3A 3BTVA 2GZAA 3W9YA 4AZ0A 2H07A 1R5NA 5AW1A 3COYA 1NKVA 1T5IA 4FR2A 1W5TA 2EKDA 2YWGA 5JYCA 3G0IA 1UINA 1G21B 2FCAA 3BDAA 3UT5B 2NUBA 4O2RA 3FYUA 5TVKA 1JAIA 3O82A 1JGTA 4Y2XA 1HLDA 3DKVA 3NHRA 2QQFA 1VYVA 4KXFB 4FYWA 1Z83A 3T3MB 1EE2A 3Q15C 2BRUA 4HRXA 3TLYA 1PYDA 1F8GA 2GYYA 2YWDA 3E58A 3V4PB 4GXNA 4URFA 3AM3A 1T5LA 2H3HA 2JFGA 1WAMA 4OHXA 4X90A 3KHUA 3T7AA 5LBIA 3N05A 2VH2A 3K6SB 4X85A 3ZDEA 3CWCA 3A2KA 3B7GA 3D8HA 4IOLA 4CKWB 2A9JA 4JJ8A 2WZCA 3P0EA 3IL2A 1EFDN 1M1ZA 3MF4A 4PPGA 2QORA 4Q21A 4GVPA 1YJBA 4EGAA 4JL8A 3V8QA 2QN3A 2WPDD 2IZ0A 4AC9A 3FYTA 5AK3A 5EHZA 1FP2A 1NNUA 2YXBA 2PGLA 3LKDA 5MFZA 2Q7XA 4IUDS 5CW2A 3IQWA 3JSAA 1EH5A 1OC2A 2BIFA 4DFDA 2IYYA 1HURA 1RKUA 1K5HA 4RBNA 3UMVA 4AS3A 1E63A 4EPWA 4OKIA 4BJHB 2BMVA 5A04A 2GPJA 3QVJA 1G5QA 2PXCA 1YL7A 3I2FA 4TXLA 4DMFA 4L7QA 5F64A 5AVRA 1LW6E 5DU2A 3F46A 4P7JA 2MWMA 2ZWAA 4EEKA 3WXBA 1GPJA 2J4DA 2QZZA 2FEXA 5A0TA 1SCJA 2IUEA 2OR3A 2GHIA 4P33A 4E2ZA 2HRZA 4G2NA 1G60A 1TA4A 4MUMA 3ZKAA 1DMSA 1I6LA 1EWTA 1DJMA 4M0KA 2WB4A 1K68A 3JPYA 4ZCMA 4H4EA 2FMIA 5AOCA 4MR9B 3G2KA 1N5KA 2JD1A 3D2CA 3VPCA 2C2HA 2AG1A 4Y2RA 5C5CA 3DL7A 4XX0B 1PT5A 1TAUA 1WL8A 1DAKA 4XM1A 1Q1GA 1L4LA 4L1KA 1UMDA 5FB3A 1DARA 3AF2A 5JSUA 2R68A 3DV2A 3UJ6A 1DTWB 2G76A 5BUCA 3B2NA 4Q7JB 1VIAA 3FRJA 1O89A 3UATA 1BN6A 1VYTA 2XQJA 1GUFA 4ZCSA 4F45A 4O4JF 1DAOA 2ZRNA 4XYBA 1P18A 3E8SA 4G2TA 1QRAA 3TZBA 4F9FA 3AUTA 4NYMQ 3G2PA 2WSMA 4X7MA 5T4HA 1J07A 2C2ZA 4OQXA 3AZOA 4Y2YA 5TEVA 4TLBA 5CIYA 3TIVA 1E9VA 2V7WA 2JDIA 1E1RD 5TPZD 2NPFA 3LBNA 4ZQBA 2WDPA 3HC7A 2FTKE 5HF5A 1DAIA 3M83A 2NUAB 3HJAA 4YMUA 3AXSA 3TIXB 4XLZA 4GS5A 2A86A 1UBRS 4Q3LA 4EEZA 1IBRA 4XW2A 1ZD9A 5KMGB 1DJQA 1FTNA 2FFRA 4I08A 4RE5A 2Z43A 1LFAA 1YOVB 4R2IA 2QAGB 2CLLB 1Y1QA 4FZ5A 5A2QA 2D28C 1RIFA 2FG5A 3H7AA 1QWSA 3Q9UA 1M74A 4LTNA 2R6CA 4MQ6A 5TPWB 4QSHA 1OR8A 3F78A 3QQ5A 3C7AA 3LYAA 4MI6A 5KMGA 1U6KA 3ZE6A 2FWBA 2PX6A 3U2QA 1L6RA 1YVUA 2NNLD 3SE7A 1SXJC 2CNOA 3ZJ4A 3NAZA 1NYLA 4R8LA 3W9UA 5EMHA 4Z5XA 3SDSA 3VC7A 2Q5CA 1C30B 2XUPA 1MAAA 2XMZA 1M6HA 3JZMA 4LBZA 5JCJA 3T5MA 4U7GA 1CZOA 2DBQA 4N6OA 4ETNA 4HFRA 4ENTA 2AHRA 3CF4A 5F7OA 1CF4A 1T6ZA 3EA4A 2Q4TA 4LWZA 3KSRA 3O92A 3T1YB 3AHFA 4TZTA 1YUNA 4U6NA 4UD6A 3HUFA 3ZVRA 1YQXA 4ZI7B 1R0CA 1QWOA 2C3MA 3CKLA 4I9HA 5KYGA 1JU9A 1DQYA 3GJ0A 1DAEA 5HXAA 1SCKA 3QFRA 4CUZA 3K0BA 1UOEA 1SKYE 3DEYX 1WIWA 3VPSA 3BIFA 1QONA 2Y27A 4Z0NA 1VSTA 3PEFA 3V1YA 4DR6B 4OFXA 3LTEA 1FFSA 4G85A 4BRUA 1QFSA 5C2JB 3UBTA 4G86A 1GSAA 1KC3A 3RG2A 4MLCA 2CKDA 1MC8A 4E7PA 2NTEA 3O4JA 4Q9KA 1GQYA 2RFLA 2WYVA 5AKGA 2ACVA 2VAVA 1O03A 2YICA 3CSDA 2O1SA 5FL7D 3H86A 1Y4AE 1TZCA 2QE7D 1H3FA 1YB5A 3BK2A 4KWIA 3LHSA 5A4AA 3AEYA 3T5GA 1QTRA 3AB3A 3T0GA 4RIEA 1OC4A 4X92A 2ONYA 4IAOA 4EGJA 3AVYA 1P77A 4J16A 1FX0A 1KVTA 4DTCA 3M6XA 2KBFA 2WQ7A 1N0UA 2EG9A 4IQ8A 1Q7RA 2B4YA 4LE0A 4X6YA 1RRPA 3QE2A 3JAMA 3RRBA 5CBPA 1SEVA 2A5YB 2YHUA 3NHMA 3QW2A 1CUAA 1LNSA 2AMYA 1UEJA 4ADSG 1D2CA 2IXBA 3THSA 3ER9A 2FSFA 2XCLA 3HSKA 1X0XA 1N9GB 2HBYA 3L93A 2F59A 2MOKA 1NULA 2I65A 2PH3A 2XKBA 4FUQA 4JLOA 4KYIB 5CP8A 4ZDJA 3A7DA 3NPAA 3WK9A 5BN5B 1JDNA 4G81A 3U4GA 5HM6A 1FVXA 4BV9A 4DLXA 5IWAB 1HPLA 1NRJB 4DNPA 3FF4A 1CNFA 4GX5A 2N1MA 5DM1A 1OQAA 3VM6A 3OT1B 1SU6A 2P9FA 5H16A 3MWGA 1NUPA 2JBAA 1KDPA 4Q7LA 1HLPA 4LJRA 1SPBS 5BUZA 1GYQA 2I4NA 1MNAA 1VJ1A 2ETXA 3R6VA 2NT3A 3IBYA 5C51B 3SYRA 4IQ0A 2JJ1D 2JFNA 3I3SR 2WJIA 4IDAA 5FJIA 3UXHA 5B55A 4YMLA 3QE9Y 1HSZA 3RS9A 3TK1A 5HR5A 3A36A 1XKQA 16PKA 4KO4S 4YN3A 3FCCA 4Q4JA 5J4HA 4MQ5A 1UBGA 4R9UC 1D2NA 1LZKA 1XCMA 1KFEB 2OXFA 4H7DA 4I6EA 3L7KA 4KRYA 3EDOA 2WJVA 2QTVA 4TS4A 4UD2A 4X20A 5IN4A 1QU3A 3PU6A 4D56A 1ORTA 2VK8A 2RD2A 1YIAA 1C3CA 3THWA 3DKIA 3HRKA 1DOZA 5LQJA 4QXAA 4HAVA 2D62A 4Q4JB 2Z2KA 5HZKA 2EC5A 3LDAA 3PPIA 1NOIA 4LXYA 1NXPA 1EJ0A 4B3CA 2YVLA 4Q3AA 5B1HA 3EQ7A 4X20B 1IONA 2FW1A 1HDRA 3CS3A 4YRLA 3SZMA 1X7DA 4HDNA 4LOHA 4M87A 3ZCRA 3ZCTA 2Z2XA 3KJHA 4F84A 4TZ6A 1O54A 4TRMA 2GJ4A 4C0HA 2W70A 4JUCA 4LE2A 3H2SA 4ND7A 5DYWA 4ZAZA 1L5MA 3HB5X 5IT0A 2LIPA 4Z7OB 1BH6A 5AICA 2XMPA 1S3SA 1QHHB 1KYQA 3DMFA 2GPAA 2NG1A 1RM4A 3OG9A 2CMGA 3M33A 4MDHA 4YAGA 4BFWA 1FYFA 4MUBA 2ZIZA 2R2GA 3K96A 4UQPA 4GYWA 3FI0A 2A33A 3LQ4A 5EP2A 1ONNA 2CSXA 3JWIA 4D74A 3EZGA 1CEYA 2MSKA 1V1RA 2PLFA 5JXHA 1JT2A 1U9IA 4FNGA 4IV0A 4N01A 4OLFA 2RK3A 3CNLA 4R4JA 3A70A 2OCPA 1OUMA 2CLOB 1SELA 3CKKA 2ET6A 1SR8A 3NOOA 4RSRA 4B2YA 1VSUA 3AIMA 4DC0A 5KNBH 3CRQA 3GBPA 2WTMA 5K0LA 2P91A 3MCTA 2FOLA 3HVKA 5CJ2A 1JU4A 3PDUA 4V1CB 2FKNA 4KLRA 2HF7A 3ZGVA 4K9QA 1DKMA 1SVLA 1CY8A 2XI4A 4OL0A 4EFDA 2V7EA 4JP1A 1SUPA 5JZOA 2Q1YA 3PNQA 1T9HA 3SHOA 4GMHA 3U7HB 5TIIA 2OZKA 3HKBA 2WYHA 1TDJA 3LZDA 3P0IA 1Q74A 4LDNA 1FIUA 1VG9B 1SK9A 1BX0A 5C0OE 3NHLA 1CR4A 1KKUA 4K03A 4E4RA 4ZRDA 2QL5A 4GX2A 4X7BA 5K99A 3I9JA 4WGFA 1P1FA 1RWPA 3NIBA 4E5YA 1BVHA 1Z26A 4DRYA 5CT8A 1XZEA 3C14C 1GL9B 4Q7EA 2VYFA 5GINE 2R7MA 1LBQA 2NVUA 3IUPA 1GAJA 3EIUA 1FMFA 5J23A 4PPQA 1KEEA 3PUXA 3TZHA 1XMOB 3N5KA 3PZBA 2D0DA 2QP4A 4EF5A 1KTIA 2B8JA 2OCGA 3RKRA 3KKPA 1E1CB 3D3QA 3OAAA 4PSKA 2VDWA 1VHTA 2QVBA 1M73E 1PV4A 5HKKD 4MGIR 3S2IA 2ZS9A 4K1XA 5CDTA 1XRPA 2VHCA 3SZLA 3DXZA 3VNAA 1KEEB 3I52A 1RYHA 4P9NA 5EPOA 1VSQA 3ZWDA 4S2UA 2C5LA 3AHGA 3SLKA 2WWYA 1KKMA 1EUCB 2PUFA 3K0HA 4TXJA 3GCXA 4RA9B 1GQQA 2WWWA 3I9NA 3KQSA 5ALKA 3WGTA 3NV7A 2YNMA 1CT9A 3QVOA 1N6OA 3L7BA 4AO6A 3QPUA 5KVCA 4R6WA 3B3FA 3UB4A 5EXPA 1L8AA 1QFXA 1V9LA 3ZKWA 5C81A 1KAGA 5NULA 3FMVA 3E3LA 4XIFA 1RQNA 1Y37A 4OJMX 1QQBA 5LKAA 3VJRA 1LV7A 1E66A 1EJ2A 1PNOA 2H5LA 2PSJA 3BMXA 2IQIA 5DM70 1SKYB 1K66A 4KE6A 2HQRA 4WOKA 3OE5A 2Z57A 5IJZA 3C1OA 1H8EA 2HDHA 3AUAA 2AA3A 1R0WA 1S9DA 1KQNA 4BO6A 1JHMA 4HY3A 3AJEA 3A32A 3VPXA 1Z0AA 1CEQA 4AZ0B 1U7UA 2JCSA 3WGUA 1V37A 1M0TA 4O4HB 5TMPA 5DCYA 1YR7A 3R4VA 3N59A 4UHHA 2HLHA 3V1NA 1NE7A 3ER6A 1Z35A 5BN4A 4C0QC 2DHDA 5CD9A 1IN8A 5FFFA 1I4TD 3PHCA 1IZ0A 3HU3A 3L9WA 5HE9A 4B3RB 4RV4A 1YI1A 3VHXA 1OWLA 1YR8A 4ZZ1A 2XVXA 1C3EA 1YQQA 2F64A 2GM3A 2GZMA 4ZXPA 1GFSA 1MRZA 1DT5A 3PQEA 4JKOA 4DR5B 5K4HA 1SUFA 2ECOA 4G26A 4EENA 2WIFA 1C80A 1XQ6A 2HIMA 2GN8A 4ZEMA 3LVQE 2H1HA 1D03A 1OXKB 2XA1A 2XYGA 1FFCA 3M2TA 4J9UE 4IIHA 3HCEA 5DFAA 3FB4A 3ADPA 3F8TA 1CPYA 4R9SA 4M38A 3LT2A 1PD0A 4ISCA 1NW7A 4MS1B 4LXTA 3W5DA 1RFGE 1WZCA 5GTDA 2I8CA 5LOVF 3D4PA 2OP0A 1KA9H 3QELB 2DT5A 2R25B 1BMDA 4RD3A 1PYOA 4ZZ2A 4BNTA 2A0KA 3Q7QA 4HXGA 4LJLA 5LB2A 2F8TA 5BYKA 4OQYA 4TMWA 1XMPA 5JQGF 3I9OA 4W1PA 4NBWA 4DSOA 4EJ6A 3V8RA 4A1OA 2G9VA 3ZHZA 1OXTA 4RS3A 1MXFA 3LHFA 2E1RA 3ET4A 3RVPA 3RWBA 2WKRA 3ILXA 4HB4A 5EMMA 5BYBA 1GA6A 3JU3A 2AI3A 3GEPA 4GD3Q 2QX9A 3L92A 4K6KA 3IP1A 2Z08A 2XOEA 3OA2A 2X9NA 1FDSA 1DO8A 1F60A 1MC5A 1VL6A 3BA6A 2WJJA 3OKCA 5F73A 5IKMA 4DLSA 1EBFA 4HLDA 4ZJZA 1JKJB 5CAEB 1NMQA 1T15A 4KN6A 4KBFA 1CRLA 1HRKA 1B4DA 1T9ZA 3SF8B 1JYFA 3D4OA 3H16A 4RPCA 4ZZIA 1GAXA 3T99A 1RJ9A 2EWWA 3GY0A 5BQOA 4AB1A 4ZMSA 2W6MA 3IIEA 4ZVUA 5I7FA 4BXOA 4CQLB 4XSHA 4YAOA 1HH4A 3TS1A 4ND6A 1KJJA 2BKVA 3D6NB 1Z6ZA 2EBWA 3KXLA 3VRHA 4AF7A 3NIFB 2FK7A 1KO5A 1PYGA 3S0JA 1NMYA 3QRWA 1GU7A 1P0QA 3QFTA 1P2BA 4HQKA 4O2AF 3MHTA 4ZOLA 3IAS6 3A3NA 2FEOA 1BMQA 1J5PA 1ELOA 1TJUA 2CCKA 3AR7A 4PCAA 4K6OA 1X38A 1CUDA 4NDAA 4KPEC 4CQLA 1YZGA 2GK7A 2W6ZA 2ZS8A 1ZOOA 2B2CA 3PCTA 1T5HX 4FD3A 4FTWA 3WLPA 3GLFA 4DS3A 1E2JA 2WJ4A 4ZDKA 1YZKA 3LXXA 3UJNA 4C30A 3MTBA 1NC3A 4TKZA 3ME5A 2JGDB 2DHCA 1D2MA 4NMMA 4R81A 1IEWA 3MJCA 4DC9A 1QX4A 2N75A 5KTMA 2XCRB 1SUAA 5BSUA 5T67A 1FLAA 2WOJA 3ISVA 2FRDA 3RIMA 3MWLA 3WV4A 1PK8A 1U0EA 3OJFA 3U16A 1P62B 1DDGA 1NBWB 1T0PA 1RE0A 1L3CA 4WI1A 1U0GA 2YCBA 4NFYA 4DY4A 5C1PA 3A3OA 4I0WB 2JFFA 4P36A 5HDBB 4O8CA 4Z0TA 3TXYA 5A7GA 4BQFA 2Q5HA 3DAGA 2EFDB 5JPDA 3BD6A 2D2IA 3HJTA 3IMEA 4LXQA 1QOPB 3IVAA 5IC5A 1GAWA 1LX7A 1GKIA 3CPJB 3F4SA 3NKFA 5ABPA 3IQFA 2YJTD 5E8RA 3MQ4A 1IY2A 2WU1A 3FPLA 1A7KA 2SCUB 4G37A 1MO5A 1M8PA 5D5QA 3UNXA 4I2NA 3VPFA 2E6UX 1R18A 1O94C 3NR2A 1I7NA 1A8SA 1GPAA 1PFWA 2FLWA 4B3FX 1KEPA 1PT6A 1C30A 1QG6A 2EF1A 3NTQA 3CONA 4LI0A 2IEAA 4S1NA 1B6GA 2VC2B 1I2MA 4K9PA 2GN9A 4XDYA 1NJ5A 1T8RA 2I66A 2ZBEA 3KLPX 2GJKA 1NF3A 4XA8A 1GT91 3CH6A 2GN2A 1ODLA 3JYHA 1M33A 1TEXA 2CVHA 1YA8A 3GPBA 5AD1A 5HJ7A 5EWJB 2P0AA 1G19A 2UZ1A 1J0BA 2IELA 1L5LA 4EWLA 3LS2A 5LQKA 3CKMA 4EY5A 2QN8A 4M83A 3U19A 1QGED 1KI6B 1J06A 1VJCA 3IDAA 4G41A 1PG0A 1ZRSA 3IULA 5FNVA 5FT9A 4BBJA 1Z16A 2QGZA 2XXJA 3FNBA 3FNIA 3PQ2A 3UJBA 3MHPA 3ECSA 1UJCA 2QE6A 3VZSA 1MOZA 4BDSA 1QHSA 1ZIOA 3KZMA 3SZ3A 3UWSA 4BV3A 1JH9A 1G7SA 2ZYGA 121PA 4TLCA 3C5WP 5DT9A 5J5CA 2Q8PA 3R74A 3IAM6 2CDCA 3L7IA 3LT0A 4RSMA 4JT9A 3SC6A 4RGBA 4DSNA 3OF5A 3GD7A 4DWOA 3V4VB 4ASUA 5JCOA 1J49A 3C1AA 2B4QA 2O1WA 3HL0A 5BV7A 1TO6A 3CT6A 1DI0A 1Z2PX 2NXWA 2EKQA 4FWIB 5HKOA 3CNNA 4D4LA 3HVJA 1RKQA 4HFMA 1K3UB 2R6AA 4WBXC 5REQA 2BGRA 1CJCA 5IDVA 1ISGA 1NLUA 4JFAA 4DLRA 1P2GA 1LLCA 2I6UA 2DKFA 2AYZA 1KFBB 3R7WA 2RGRA 2HA0A 1EDBA 4NPCA 2ZBFA 4IVQA 4RC9A 2ODAA 2LBPA 4H27A 5CBPB 1DE0A 1TD1A 3B1WA 5REQB 4NYJR 2UUCB 5I4IA 3AVVA 1U7DA 4WA8A 1S6YA 3V4ZA 4RELA 5A71A 5T3UA 4DR7B 1N9GA 1ZIDA 4GOOD 4M0MA 1N4DA 1U8XX 3WNVA 1XZBA 4IEFB 5AVWA 4Z2AA 1KS9A 1QLHA 4UW9A 2EFEB 1S8OA 2IUFA 1EUDA 1IM8A 4E22A 2WF7A 1J5EB 1AY0A 2JAUA 3Q5EA 2REXB 5G4LA 3IKTA 5AK0A 3JQFA 3WKDA 3P71T 4N5NA 5HS4A 1H3EA 3AV3A 1R10A 3ZI0A 5DHTA 5HCNA 2P67A 1L1RA 2H4YA 1A8HA 4LHSA 1GZ4A 2J7PD 5THXA 3PTAA 1ZOSA 2L2QA 4FHGA 2VCYA 2ODPA 1AV6A 2ERCA 2GB4A 2JFWA 1PDWA 1R6BX 3CF0A 3G17A 3G2HA 2F1IA 3LRPA 5H8WA 1NY6A 3EVBA 1EIWA 1L7BA 4NCBA 3LSYA 1PJQA 1RYBA 1WW2A 2AD1A 4RMNA 1K2VN 1EEXB 1PR3A 4MEBA 4OJTA 4RU1A 1JQDA 4D46A 1IY0A 3B3GA 2HJGA 3L8CA 3ZDCA 4IG4A 4XDZA 3IQZA 4YDSA 4QUJA 3B8HA 3KR9A 2JG3A 2I6TA 1JXOA 2J3IA 2QTVB 3SYTA 3NDBB 3DWGA 5KDDA 4ZMBA 1P2FA 4MRSA 1RZUA 4UARA 2Y99A 4H7HA 4GRAA 2VNKA 3PEEA 1FYWA 1AH2A 3KRTA 2PBZA 2O52A 2PGAA 4AN4A 1W94A 4AJ2A 2TMDA 4NH4A 4YI5A 3T5PA 4MWGA 5IMSA 1FTWA 1C5KA 1UFOA 2W90A 3AFOA 3QUQA 1EK0A 1K3FA 1FDRA 1PGOA 1XDGA 3ZY5A 5FCDA 1NURA 2XWSA 5CEFA 1W85B 4DCCA 2IBTA 2Y1LA 3Q3IA 4PLYA 4P7BA 1IUKA 2HRDA 1ZH8A 1PTJC 3TDMA 3K9QO 3KQOA 1L4KA 1ZWKA 3AI2A 3C5HA 4I50A 1W2GA 3I23A 2GARA 3TBHA 3IEXA 2VJBA 4AY5A 1HT0A 1TF5A 2GA8A 3FGOA 3F2IA 2C0PA 5JDCA 2PUEA 3LP6A 5ARDA 3VQTA 1YQDA 1RZVA 1BCRB 4OXKA 1US8B 3ZCVA 1PU2A 2EDCA 4F9GA 1HNZB 5A9TA 5DNYB 1H42A 1EBUA 5FFMA 3DT6A 3RIYA 4QXRA 1E6EA 3B53X 2QG6A 1QPBA 1VRWA 4KLCA 3D7SA 3QITA 1LSJA 1JA9A 1CIVA 2B61A 2DHQA 2ZIVB 1BWRA 3F49S 2W6IA 4FN5A 3RSGA 1KDYA 1ZMBA 4K26A 2BZ0A 4X8MA 1K4MA 3OJLA 4LMAA 2YC4C 4Z1OA 4WAUA 2CVZA 1R66A 3FKJA 2OAQ1 3DFUA 1ISJA 5IBCA 5CLJA 4ITRC 4NS1A 5LSAA 1TZ2A 5EP1A 4P4NA 1F4PA 3ZE1B 1JHOA 3KU1A 2G72A 3HXPA 3OCYA 4JYCA 3RUIA 1NBME 4MGYR 3WADA 4GGMX 3I6BA 1NBIA 1ORIA 2NXEA 4DL9A 1CBUA 5JD6A 3TG2A 1OBOA 3UC5A 1N2HA 1EX9A 1ZVJA 2ZYIA 1O5OA 3ETNA 3ZXSA 1XTPA 2HIGA 3IGFA 5JI3E 2ALJA 1U8EA 3T0FA 1Y8CA 1XBTA 3TDKA 4G0OA 4RZQA 4Z8XA 4AF8A 2WINI 3B5IA 3ZV3A 4BX0A 1ULZA 2JAOA 2QY6A 3MMZA 4IPTA 1TYEB 1TO1E 1WP4A 4ZAYA 5J2TF 3UKOA 2DXIA 5GAJA 3RG8A 4R8VA 5IMBA 3ZHBA 1KOLA 5BOSB 3N8DA 1XYYA 1EWYA 4B73A 3PC7A 1UAYA 2N0SA 4GR9A 1JAXA 1BDJA 1YCHA 4R05A 2ZRFA 2XGOA 3F6CA 3FKQA 4GOND 4XWOA 5BYAA 3DYIA 4Z9AA 2RH4A 4YRNA 5IH7A 2G0NA 5LXTB 5JH7B 4TSRA 1GPYA 1I33A 4LYAA 4LYFA 4D80A 3MAAC 1U3WA 3DDUA 2DLNA 3NGLA 5TJ9A 4QAJA 1OJLA 2O1XA 4TWJA 4N6NA 3X1ZA 2R1ZA 2VNJA 3SIXA 5MN5A 2ESRA 2B5OA 1A8IA 2CL7X 1TM1E 2NO1A 3R76A 5BUQA 3M5PA 5IKEA 5DGTA 4DLWA 4JUAA 5JSQA 1L1FA 2K4MA 2P2NA 3F9IA 1VKHA 3A2MA 2HUPA 3UW3A 3AP1A 2F1JA 4PG6A 1PWYE 1VI2A 3IHLA 2P1DA 2VHVA 1NF9A 2WJ6A 4IDHA 1WY7A 2WJPA 3D5QA 3H05A 3I73A 3PPYA 1F3LA 1NFQA 4NR0A 1UWKA 1SEPA 4EKDA 1ZNXA 2EHDA 2H06A 4KIGA 4YP5A 4G0PA 4MPTA 2C77A 1N0VC 3P0HA 3QBJA 4EFKA 1FF9A 5BN4B 3QTBA 1DV2A 1V3VA 2D1FA 4BJ5A 1O8BA 2VXYA 4BX8A 3WKEA 4JASB 3AI3A 4B7ZA 2HD4A 2GEUA 4R2MA 3TZLA 1KZGB 4ZCRA 4DLTA 2IHUA 2QTNA 3WX0A 5J2TA 1P2SA 3H5WA 4DUPA 2JGEA 2HHJA 2V6FA 3L7NA 1DMRA 2QWXA 3DBHB 1CXZA 1UBJS 4V0SA 1XTKA 3EGWA 1KJIA 4LPSA 4UFPA 1JUDA 1NI5A 1UKCA 2NTNA 2BBSA 4Q4LA 3PNSA 4FGUA 2BDUA 4R51A 4IEEA 2NZWA 4R2JA 4FFDA 4U63A 4Q00A 2C58A 5LQUA 1WPGA 4LZJA 4CDNA 2EFCB 4UTZA 4DADA 5J58A 2QB5A 2AJ8A 2JFQA 4I4CA 1PTJA 2OVBA 2YY5A 3IPRA 4CV1A 2N9UA 4Q39A 1XXHA 2V58A 1V26A 2W2QA 4L5CA 1E5QA 4RHXA 4DSAA 2W2LD 1NP3A 4C89A 3GEBA 1LBHA 4KODA 3DJFA 4XVHA 4Q34A 4KDEA 3H6GA 5JH7F 4WIAA 3UGJA 1XDSA 1I24A 1UR5A 3QX7A 3EEOA 2ANCA 1VMIA 4JR2A 3DDHA 1G7CA 3Q0EA 4U9UA 2K7FA 1UMKA 1ONOA 1YB6A 5FPSA 1Z25A 5AW8A 1WU8A 1GEEA 1FNMA 4M1SA 4C05A 1I3MA 4LDQA 4QGFA 3WA6A 4F4JA 4TYNA 4X93A 4CMEC 4DA8A 3AH8A 3PQ7A 1IHUA 1LZLA 4F6CA 4DARA 4DV4B 5HM8A 3SC2A 3A9SA 1Z0KA 1TYDE 1YZUA 2HK6A 2I6QA 2E1PA 1DG9A 2VT2A 4W82A 3TLKA 4CMCA 2Y1XA 4ABTA 2ZJOA 3JD2A 5EJMA 2HC9A 4DCGA 2ZYHA 2ONJA 1AN0A 2PKCA 3H9GA 1LPNA 2J87A 4I19A 4QTXA 4TYQA 2MTBA 2C7BA 2PWBA 3RANA 3RS4A 4DXAA 3GJTA 4ENWA 4QFCA 1W0KA 2CE7A 2W98A 3GCZA 3LF2A 3MGGA 2IU0A 3SC2B 2XDWA 3NDRA 3UB3A 4EHDA 1T13A 3RVRA 4Z4IA 2PNFA 2PUCA 4LYYA 4BJ6A 3GO4A 2G06A 4ENPA 3W5JA 4GKKB 1PZHA 1LPPA 3H0CA 1MAUA 1JWBB 1GZDA 2FXVA 2C9YA 2P9QA 3NKLA 3BREA 3OEYA 2NU6B 1OI3A 2Q1XA 4HRAA 4ODIA 4DLAA 3ZK7A 3EG9B 5IJXA 5IHPA 4MVJD 3JQ8B 5C7LO 4GFDA 3OZUA 1Y8RA 4FMDB 4JLMA 3BQNB 3FWHA 1TJ5A 3I6YA 1GLNA 1ONBA 1VOTA 2A2ZA 3CR3C 3B2EA 4A5OA 1LVGA 4H31A 1AHPA 1KEZA 1QYIA 4FCTA 1S2LA 4TLAA 3NAQA 4P83A 1P17A 4BKMA 1E7MA 1EXDA 1AMNA 2CKMA 5IYZB 3M8KA 4MP6A 2NU6A 4JS0A 3QKSB 4Q3OA 1IEVA 4GKJB 3W2TA 4UEJA 2VUSA 5MGBA 4XIIA 1F5SA 3LX8A 2W2OA 5T8KA 3JASA 2GN1A 3GLGE 3JATB 2AGVA 1V6CA 1CYDA 3GFTA 2OT3B 3QHPA 1NQWA 4FUTA 3EH2A 5C4GB 4ED9A 2IY7A 3O2NA 3WIDA 3KQUA 3EPJA 3K0FA 2FPGB 3LRXA 3VMMA 1Y9JA 2QJRA 3AO0B 4MV5A 5DW0A 4MW0A 2XMQA 4M88A 4TRNA 3BRCA 4BGIA 1JHXA 4N1AA 1IXZA 2HA4A 3EGXB 4U7WA 2BR5A 1P80A 4NPHA 4HEQA 3DZKA 1WF6A 4CQMD 5JFGA 1PIWA 2JAHA 1WBDA 1E2DA 3KT3A 5C3UA 5K0ZA 3DF7A 4YRBA 5KYUB 621PA 4FK8A 1NR1A 3F7TA 4F4DA 2QX4A 3FPJA 4OHRA 2WTXA 4HNUA 3CVXA 2CV0A 1Z4JA 1TKBA 4WXHA 1HNWB 3DVQX 1UK7A 3LL4A 1VMKA 4ND2A 1LB1B 1U65A 1NBMD 4G01B 4D9MA 5EUMA 1RM3A 1D7AA 1ACLA 3UMRA 2Q4EA 1Z17A 3RYCA 1L5VA 2Q6VA 3HACA 3VAAA 4AURA 2BLLA 3GROA 1SVOA 4NHOA 4XLLA 3WL8A 1QQ5A 2WPDA 3A3YA 3O5AA 3N28A 4TRRA 2XCUA 4CPDA 1G8PA 4H16A 1ES9A 4TKVB 3IUBA 4QXPA 1FNNA 5IRCD 3V34A 5C9ZA 3ZTYA 4XB6B 4ZZ3A 3COWA 3U3MA 1F4VA 4JJEA 2R00A 4WDRA 2WZQA 3A25A 5LZ7A 4FDMA 5L51A 4P7FA 4OJYA 4XJTA 1YE5A 5IAGA 4C20A 3SQNA 4MVJE 4NXMB 5TS2A 4TKVA 2RONA 3BQ9A 5THKA 2E4UA 3HCFA 2J3DA 2PS3A 3NIDB 2O7SA 4JYMA 1HF3A 4V03A 1KMNA 3UFXA 3KTFA 3DXXA 1N2JA 5FOWA 3FTCA 1GLVA 2XHZA 2ZUSA 5ICEA 1AS3A 2OCIA 3V4LA 5G2OA 4DAOA 5FWDA 3CVYA 1T4CB 1X2EA 3N76A 5I5GA 5LL6P 4HP8A 3JXEA 1KRWA 3HU2A 2DFTA 1RYFA 2W6ID 2FEMA 2JCGA 3HP4A 4OQDA 4PC1A 2WKSA 3V80A 3W06A 2VP4A 1JEQA 4J3JA 4DLBA 1QP8A 2SKEA 2V0CA 3CVVA 3TSZA 3PR3A 2GPWA 3AJ9A 2I7DA 2AMFA 1T4CA 2VF8A 5AW6A 3ROFA 4HDAA 1NW9B 1B6TA 4DGSA 3D6UA 1QYWA 2R7LA 4GP9A 2IV3A 4ER5A 1JFRA 2XUJA 3K0CA 3OT1A 2GBCA 2HRCA 2XUHA 4JIGA 4DVJA 1U9JA 4LZZA 5JYEA 2QTBA 1DDOA 4U2KA 4YRKA 1B0ZA 2YW2A 3ROKA 5IZ4A 1U2SA 1XSEA 2HWYA 1CY7A 2GCGA 4B6GA 2ECKA 4HDRB 4CMIB 1L7PA 2ISCA 5HQ3A 1JG6A 4QXOA 2RKOA 3KKLA 4KO1S 4DV0B 2BHLA 5BNWA 1CZRA 1QZTA 4ROSA 3PQ6A 4CLDA 1THTA 1Y80A 2WNHA 4GXTA 3M1IA 1KO1A 2R1VB 5EG5A 3SWWA 4YJ2F 2AG5A 3A1DA 3NHUA 1N6IA 2G88A 4HWRA 1Z73A 1XLTC 3BWCA 3MAJA 3VU3A 5E7IA 3G2IA 5EE0A 4Z54A 3ASZA 5HQ3B 3S8MA 2WD7B 2AXNA 2DOKA 4U9HS 1R4MA 3EGEA 3THRA 5AFSA 2CHVA 3UJ9A 2JEYA 4BVEA 3DZJA 3W1EA 4A1FA 1O8CA 2QTAA 4S1PA 4C0JA 4BVAA 2X5JO 1YS2X 1EK6A 2R9VA 4QC2A 2BGUA 3V2HA 3LA6A 1BOFA 3PZRA 4LDRA 3WFJA 1NIJA 1SC4A 2YHAA 2YHSA 3CEAA 4X24A 5TQ0B 1P60A 4YMWA 5AI5A 5BR4A 3GX1A 4N4AA 4XKJA 5KYVA 3T06B 1D6MA 1G3IA 3DHEA 2E7ZA 1I30A 2UKDA 5DRYA 1TJYA 3Q40A 3AVTA 1XNRB 2X8AA 3E0XA 2QSJA 3G8DA 2DTDA 2Q7OE 3RRNA 3RUFA 2E4VA 3FZYA 4ZANA 3JQBA 3ZTTA 3F1LA 4BKPA 1OT5A 4U0JA 4DJEC 1WOMA 2J9YB 3E6AA 3DE3X 3FHCB 4ZU3A 5I7EA 3COJA 1FJXA 3VKHA 5DO9A 4RDCA 1HEYA 4LYGA 1RHMA 5SY9A 1YC5A 3HZHA 3JRNA 1GPLA 3M4JA 1V1RB 2D0OB 3NQ41 1W30A 4KEAA 4BB0A 1IXKA 1U3UA 2FWMX 1QKJA 1YCGA 4KQ6A 1UJMA 4RESA 3LX4A 1N2ZA 2W93A 3QY9A 1BCRA 2PS1A 4KFTA 3OBBA 5SZKB 2AMVA 2JAWA 4L0CA 3TF5A 4RV9A 4KX3A 3LECA 5DOZA 1XKXA 5T4EA 5EZSA 3R7AA 1PSWA 1TQ2A 3KJIA 1G55A 3ZHXA 3S1SA 2GKGA 2IYLD 2OD7A 3HB4X 1FFXA 5MN6A 3WAKA 5EKSA 4FLFA 5GWXA 4DCUA 4ZI7F 1E3JA 4FJ0A 1XMSA 3SXJA 1Q1NA 2O3QA 4BO8A 5FWAA 5DTIA 2GDZA 1RYNA 2W6CX 5T7BA 3UK1A 2HCJB 3EPRA 3NAMA 4WFQA 1AUQA 2HPVA 4EB8A 2XUZA 2YN2A 3EZLA 4AZVA 3PJGA 3MWJA 2Q9BA 1TL7C 2ZJ5A 2IHZA 3GEEA 3RNLA 2FP3A 3W7AA 3KL2A 1ESZA 3AR4A 2JAPA 1PX0A 3IQIX 4K2HA 4PLCA 4R6XA 5CLQA 1Y9AA 3DEAA 1BTOA 3CRNA 3NW9A 1E6UA 3AONB 4IGFA 5CH5A 4KRGA 3OEEA 5DVZA 3S5UA 1YMQA 3GDHA 3GVCA 4JMPA 2FZCA 5HRUA 4OX9B 2VEOA 3OO1A 1VHLA 1ZK4A 4HGYA 1U7HA 2XXBA 1U2EA 4I1OA 3ROEA 2CDRA 3W2FA 4UCXA 4BVLA 3KLOA 3TPZA 1F14A 2CFTA 4KDFA 3R6TA 1EUZA 3LM8A 2O8BA 1X94A 1CHNA 1HE3A 5ALSA 2R4QA 2NIPA 1QKIA 1J8YF 1E3QA 2E82A 3OC6A 4GPD1 4XYMA 3OPMA 4S05A 2BLNA 1E1QD 3LSTA 1OA0A 5C1IA 1QZZA 4C5AA 1OZ0A 1TZBA 1KY2A 1CSEE 3K2EA 3UEOA 1XD8A 1CY0A 2X19A 4DLPA 2JJ1A 3EXIA 4MQUA 2F67A 3I9LA 5K8UA 2IITA 2VRWA 1DBIA 4JBNA 3GNLA 3N53A 3RHTA 2AOUA 4HBZA 2QUZA 3STVA 5I45A 2JFZA 2NO4A 2NZ8A 2BN4A 3SI7A 1UIMA 1TT7A 3AUFA 4IHJA 3N5CA 1B3BA 1NLZA 4HDQB 4I55B 1G8SA 1EVQA 3UJ7A 3L01A 4H35A 5KCZA 5L3QB 1NV8A 3IKLA 4X71A 2VYVA 1MGPA 3D2BA 3MJEA 4XJXA 3TTWA 5JHGB 3Q8LA 4QDKA 2PRKA 4LY3A 3RYFA 2IXDA 5KYNA 2Y1OA 1YZHA 4DZZA 1T1GA 4MW6A 3EGOA 4JELA 4HAXA 1F0NA 5YASA 3DLPX 3C3WA 5AXAA 3RJMA 5AH0A 4QWMA 1R9NA 2F9FA 4RAOA 2ZB3A 5LP6C 1Z5UA 2Q3EA 5G40A 2O1EA 3LZ6A 1W8DA 3UVEA 4WX2B 3VV3A 1WNTA 1TIPA 2YIVX 5EPEA 2GESA 1J42A 1ZY2A 5A3SA 3OPYB 5JE8A 4LJ9A 1FPMA 1HG1A 1A97A 1QS0A 3DG9A 3SR4A 2QDKA 4BGEA 1QVWA 3WFIA 2O05A 4OFBA 4LY0A 4WNCA 1BRMA 4YCCA 4XYGA 4DQVA 1YJXA 3L8YA 5B53A 4W63A 1HDCA 4G1FA 5TQVA 4HN4B 3RRXA 1L4EA 2I80A 3OPYA 4LJAA 2QIOA 4BUZA 1UDBA 2ODEA 2PUGA 4W9RA 4BJ3A 3GV0A 3IT0A 2V0NA 3LKVA 1QS0B 1TOAA 4H6WA 3BHNA 3X2FA 4RJIA 2HCRA 4LJKA 3ABIA 4IS3A 3FTEA 5BT8A 5NLLA 4XM0A 1C4XA 1VB3A 3PIDA 4UAVA 3G0CA 2LPMA 4WUVA 3MYYA 2KSQA 3TW0A 3B6KA 5BMVA 2ZKLA 4EJMA 2GJAA 4J3NA 3GG9A 1NNEA 2AEEA 1KI4A 1A72A 1UMBB 3BWMA 3GWGA 2VJLA 4OU5A 2HDWA 3WMGA 2H4JA 1ADYA 4E46A 2TRSB 4MTCA 5DWQA 3UWMA 3T1HB 3E7XA 2EZTA 4QPNA 4YONB 3L6UA 1KEVA 4EA9A 3OE1A 1E58A 3HRHA 2RCNA 1VDZA 3QP9A 5TMDA 3SF8A 1DWOA 1YVRA 4QYIB 3MGKA 3HLTA 1CY2A 1RJ9B 1N32B 1RQLA 1U9YA 3H9UA 3P2IA 1YVPA 3JQ9A 3U4QB 2X0NA 1T3HA 1Z6AA 1BSVA 2GWRA 2WJAA 4FD2A 5BSKA 1KF0A 1X1TA 4GI1A 4J1SA 3ERCA 1AOXA 3N0RA 5EGNA 4ZOLB 3IAUA 5C34B 3HY3A 3PFCA 4MKIA 3HDTA 4C0WA 3H18A 3ESQA 4GL4A 1KRXA 4UU1A 4RMJA 2EIXA 1MH9A 3K2QA 4EJSB 4TPKA 5FOVA 3U48A 3WQRA 4NMXB 3E1SA 1LK0A 2NU7A 2YL2A 2DPGA 1E1DA 3VYWA 1W5BA 2Z3WA 1RXVA 5F9HA 2WWRA 5CUQA 4BGUA 2JGDA 4IF4A 3EIFA 1G4UR 2A35A 5D85A 3CW9A 3KQVA 4C06A 2I3ZA 3FKSA 1P72A 1VE5A 3DL0A 3WDSA 2PAAA 3L8HA 1LTHR 1W49A 1DKQA 3DCYA 1CP3A 1YV9A 2ASEA 4MUYA 3FCAA 2N46A 5JOQA 4KSBA 1UQUA 1Z28A 2F8MA 2JGFA 3KE9A 4HDSB 1FYXA 5EJIA 1T9AA 1XOIA 2C9ZA 2I3BA 2HN9A 3E7PA 3F6SA 2J5QA 3I05A 1AXEA 3WGQA 2WQ6A 4MS3B 4L72A 3WHPA 3G68A 1H5UA 2QRZA 1KYVA 1VLVA 3MT9A 3SJBA 1NVEA 1JIUA 1U3GA 1F2TB 2JGRA 4CR7A 4GIBA 2GAFA 3UXYA 4L6CA 5IJ0A 5JCOC 1Z08A 3CLVA 3MTJA 1XEWY 4RM2A 1TM4E 3D1JA 4HJXA 3QTLA 3TM5A 4QDZA 2FPIA 1G64A 3EMBA 4HNQA 3CINA 4HQOA 4LXHA 1XZLA 3RRJA 2D1RA 2OD2A 5CDSA 3B70A 5K8TA 4A6DA 3WGYA 3GC6A 4BKUA 2XAAA 5AKLA 1O5IA 4X1OA 4EHAA 3V7FA 1Y1SA 2BBOA 5J4VA 1YKFA 4C3UA 4WWHA 3ADBA 1EGHA 1MEOA 2X2PA 3QNMA 4BVJA 2HNAA 4OXRA 4EH1A 1HYHA 2WAYA 5AXDA 2QBYB 4QNMA 2J6BA 3IMKA 4O4LB 2JLVA 4W1RA 1YACA 2OBYA 1KO7A 2O8DA 3RVBA 1NI4B 1IN4A 3U13A 2FXIA 1FSSA 3G49A 1A9RA 3TI9A 3WOVA 3GBSA 4AZSA 4BZZA 2PT7A 2ZRMA 5LD2B 2IXFA 2VNHA 4DUYB 3ETJA 1H4VB 3KB2A 2CLCX 3OY2A 1P4JA 3I37X 4NCXA 4EJFA 5LMUB 2FR1A 1I01A 4URVR 3H2GA 3L9XA 2ZJZA 2QM0A 3QLUC 4BYGA 3OJWA 4YCAA 3V8VA 4AM8A 4DCJA 4XWKA 1FFEA 2PK3A 3BCHA 4D02A 1Z3IX 3A6HA 1NY5A 3RB8A 1R9JA 2V7VA 221PA 3ZD7A 4MOWA 3DE4X 4OTZA 3LUGA 3TKLA 4UPVA 4YMHA 5TT0A 2FFJA 2VBGA 1TU3A 4DM3A 2HYIC 4ALNA 1PX2A 3B9PA 3F9RA 5J40A 4LS3A 1SB9A 1K6IA 2WIJA 5FWYB 4M2LA 4MUGA 2FWNA 1EX1A 2J45A 2QTMA 2IE0A 1KYZA 1INLA 1N1EA 3B7WA 2X4IA 2F00A 4A36A 1P7ZA 3IVRA 4C7BA 1ESDA 3LU1A 3BFXA 4YUWA 4OO3A 3PPXA 4DPLA 3TQCA 1C0PA 2VHWA 1YZ3A 1NN5A 2QS9A 5AVOA 1IU9A 1UT6A 3AHIA 4WY8A 3EF1A 1G2OA 3L4BA 3EVCA 2F3RA 1Y0BA 3QOWA 2Q07A 4XCVA 4NBSA 4V38A 4TROA 4CL2A 3NLLA 3OU2A 5E0OA 1KVUA 3LUKA 4MWZA 2PX4A 2AOTA 4GBED 4KAXA 2PU7A 1P73A 3IHWA 1C0IA 2HSJA 2B9EA 5CT6A 2WYOA 4LFCB 5JDCC 1OH7A 4A0GA 1U8AA 5KQPA 1OH5A 3Q11A 4Q3BA 1BMTA 2CF6A 2Q1TA 1AKMA 4EBBA 3WNZA 2PSDA 4R2HA 2AR0A 2FPPB 3WLLA 2Z9BA 4FHEA 2Q7DA 1IHYA 5FV7A 3Q0IA 3HCNA 3DBLB 3KG2A 3H84A 4JBWA 5FLEX 2ZRKA 2PGJA 1CJUC 1XN1A 2Z8ZA 4HDRA 4L5JA 3TSWA 4DJTA 1P4HA 1BC5A 4O2AB 1VM6A 1NRIA 4FBMA 4JI1B 3W9BA 3C6MA 4DV2B 3C6KA 5CX1A 1RSZA 3HTXA 2IUUA 3VKGA 4K3UA 3CT4A 1EI9A 2YJ5A 1QO9A 3MTEA 4V24A 3UK6A 4ZREA 3LQ2A 4CEHA 1C1DA 1PD1A 1N6LA 3FGPA 3X3HA 2DE0X 2A92A 3EN0A 4DJDC 1QANA 5SV2A 3I1YA 1SK8A 2O0LA 3OF2A 5IWCA 3UHFA 3V32A 4YV0A 4F46A 1S8NA 2QGAB 4KFUA 1JSLA 3B51X 4DM4A 1O87A 3Q3HA 2NACA 4QU5A 1JEYB 4OQEA 5AOBA 3ZCXA 4IOKA 1R1DA 1FUIA 2B4TO 1IRXA 3WMXA 2CV2A 3CZCA 1SUBA 2WHPA 4QLBA 2RI0A 2Z83A 3PSAA 4M3NA 4RHUA 3HA3A 1YR6A 1BA3A 4I50B 1WO8A 2P3SA 1U2DA 2R96A 4D9HA 2X13A 4KITB 1HDOA 2XWPA 4HVCA 1EHCA 2BFBB 1OGYA 1EBBA 1Z7BA 1R0RE 3GF4A 3MRSA 1FJHA 3FYSA 4XWYA 4ZV9A 3NBAA 4U2DA 2IYFA 1JR2A 3HDGA 4ZICA 3N2NA 4UC0A 3R7LA 2JLQA 3MMNA 1KDZA 3RYHB 1G2QA 1SUSA 1NI3A 3IJRA 3OKFA 4YDHB 4D9FA 4DIEA 3R24A 1IOWA 2P2YA 4YWHA 1U02A 1NQOA 5HE8A 4R2WA 2PO5A 3LLVA 2ARKA 5CCEA 2JFHA 4G1MB 2WB2A 2XMBA 3EMVA 3N6VA 4FLMA 4HVLA 1ICEA 1V8DA 2IT1A 4G09A 1SCUA 2W11A 1QJCA 3SJ7A 2FGKA 4ECAA 1FSGA 1FFXB 3QOXA 5L3VA 3BJIC 1ZH4A 4J1NA 3CUUA 3K71B 4I6JA 1W19A 2JKVA 4PLPA 4V0RA 1GQSA 2NXCA 4PQGA 3KKQA 2OCYC 1HTBA 3HNPA 3SM9A 3VH2A 3T6KA 2G9RA 3G13A 2X3UA 3B3QA 3HB0A 3GFGA 4G5YA 4XPZA 3QLUA 4ZVNA 3Q41A 2D5AA 2ZYSA 4FHZA 4HFNA 4X6UA 3BZUA 1KJZA 3P9PA 3M9XA 1HDXA 1YS7A 4U2BA 2PGXA 1IRIA 2PUHA 4B44A 1WVIA 1UL1X 4F3YA 1A5TA 4AI6A 1AQ6A 3BB3A 4GWGA 1JIIA 4M9UA 4D97A 1E1CA 1OH8A 1ENYA 3BRWD 3K7EA 2H52A 1EFLA 4YP7A 1N3BA 5IKPA 1GA4A 3O21A 1I4EB 1DTSA 2Y9MB 4MITA 5I9SA 4UZSA 3N2YA 2QMUA 1W1WA 3WWCA 4ES6A 1IPFA 2H51A 2QEQA 2QQGA 4HI0E 4LRTB 4S04A 1KH1A 5F1YA 1YA4A 2FLKA 1OBVA 2VJCA 3FNRA 3GJ7A 1P75A 3P9SA 5A05A 4YT2A 1AKUA 1HFEL 1FS6A 2B3TA 3MTIA 3ER8A 4R0MA 3HXTA 3PP8A 4K9LA 3WBFA 4DG9A 3G5LA 1WQ3A 2JI9A 5JXIA 4XWWA 2IYSA 1T6NA 2Y9PB 1WUYA 4FBLA 1H6CA 4ZOBA 5E1MA 5K8IA 5CXXA 1SBTA 1YS6A 5HDQA 2AV6A 1Q5NA 3RQSA 2PVCA 4H6VA 4QFDA 4GM4A 1B41A 1A3CA 5KTRA 5H3CA 1CCWA 4CFSA 3BTOA 2XEXA 2O0HA 3PFIA 3G5UA 3PQ5A 4HMQA 2P6RA 2C96A 1UKAA 2WSLA 3HCOA 3R20A 1RFLA 3T95A 5BSWA 2AZMA 3I6ZA 3O1JC 3QX8A 1Z4PX 1VJDA 1PZMA 3Q4GA 1A95A 4U1RA 1LVHA 3LQRA 4EG3A 1ECJA 1CUSA 5AKJA 5JRDS 2W4QA 2R8YA 2XCTB 1KYTA 1UKYA 3GIDA 3NETA 2G6TA 3LFHA 1XC7A 2XV1A 3H4MA 3P2KA 4P84A 3FCXA 4OQZA 5KEIA 1QO0D 4DV7B 4B75A 2PTQA 1JHQA 5HJEA 1JF8A 1NWCA 2FSPA 3HHPA 1I4OA 2C3OA 4XPIB 3P4YA 3RYFB 3ETDA 4B80A 2QU8A 5A06A 5CXSA 1H2HA 4WXYB 2PUDA 5DBOA 1XAJA 2HB6A 4XB1A 1XJCA 2OBLA 3T9DA 1KK0A 1XZNA 2AFIB 2VIIA 3OZ7A 3KZNA 4L02A 1D6SA 3TQRA 1AXRA 2W0SA 3PGVA 4HGPA 1Y5NA 5CFNA 1OAKA 2NAFA 1Z18A 4D8YA 1OAAA 1GR1A 2EERA 4MVJH 3FH0A 1KC1A 3GLHA 2B69A 2A5JA 1Y3DE 2OCAA 2PH7A 3A3PA 3HXKA 3WGZA 1Y6FA 1SXJD 4N49A 1E9EA 3U61B 1UJ2A 1PGJA 4GUAA 1U31A 1WDMA 1JBEA 1XTRA 3LL7A 4CQMA 2C42A 3L4SO 1GZUA 2J3HA 4BMZA 2P65A 4EHIA 4PBTA 4ZJPA 4CFZA 5FPPA 1QPZA 4U00A 3QX3A 4JXJA 4K9DA 3AR9A 3AHEA 1LVUA 1WKCA 3F0TA 1TVEA 3CVOA 5E2IA 1WX1A 1BFDA 1M2FA 3TFOA 2FZGA 3C45A 4YT4A 2MIIA 4DLUA 2ZDHA 2GZSA 3KYCB 1OSNA 2FSIA 3L49A 4JI7B 1BE0A 3H3XA 3ZOKA 2EF0A 1G63A 1RRFA 2QGFA 5D3MB 2DY1A 3RIHA 2DFPA 1V9SA 5CHEA 3U7FB 5DNVA 3IURA 2XWBF 4FW9A 1GTVA 1ZD1A 3DEIA 3NANA 3KYCA 2WSYB 4JENA 4LX8A 4AYXA 1HX7A 2LGJA 4GH5A 4RIIA 5JV5A 3VUFA 1PJ3A 3LHDA 2I2DA 4BNFA 5EEHA 1M34B 3P4XA 1G8FA 5FO0A 4CETA 3BUSA 4M36A 2FDXA 4CN9A 1R50A 1XV5A 2X5OA 1BQEA 5D84A 5AM0A 4Z4EA 1EE1A 2PLNA 4QQFA 4DQXA 3QZUA 4CTMA 4G4SO 3C1TA 4WXPA 1NF8A 3C6XA 2GF0A 3M1LA 2SECE 5AKIA 3F73A 4RE6A 1A9SA 2A30A 2H31A 4KACA 4Y0NA 4TKLA 1E2NA 4WJLA 1DQZA 2OCBA 1XF9A 4P31A 3DDWA 4H7JA 1E8MA 2NVWA 1BN7A 1K63A 4S3MA 4JEUA 4GR5A 4WZ6A 5AM4A 3WWZA 2M1ZA 4XQ9A 1V1MA 2EGUA 5HKKA 4IS2A 3GLFB 3RYIA 1I7LA 4BO3A 3MOIA 4BNHA 4BTVA 4B3GA 2XQVA 4HB3A 1M5UA 4DIOA 3C74A 3QWAA 4LDZA 4NYMR 5K45A 4TT3D 4DDWA 4HT3B 4G0YA 2O2XA 1PEAA 1FS4A 1ZL2A 4KMSA 1Q1AA 3U9TA 2DAPA 2AJTA 4E70A 2JJYA 3RYIB 2GBIA 1FURA 4DYVA 4DZTA 2I5PO 4RD6A 3GLUA 1YS1X 4D5GA 2QT1A 3INTA 1R88A 2FEAA 5JZMA 4M9ZA 4G8BA 2ZKIA 4JYPA 3PTZA 1DQNA 2IPXA 4JCOA 4Q4AB 2BZ1A 2ZULA 1WXFA 3JALB 2G4LA 4JP5A 4IDFA 3Q85A 3ZXYA 3EIEA 1QVAA 2C4NA 3VO1A 2BEJA 3AI1A 4LSGA 1LI4A 4GBGA 1OXSC 2ZYTX 3Q9LA 3D3WA 5J43A 4NJEA 4L57A 3LD9A 4F4IA 1DQPA 1EB8A 4HV4A 2FUG1 3IDOA 1BGVA 4B35A 1TGYA 1ZRHA 4WY2A 2WTNA 1MQAA 2WY2D 4N5LA 5CXQA 1V96A 4OBXA 4N39A 3NTLA 3EJ6A 4FCWA 1U4OA 5GPBA 3LV8A 5KOYA 3GLGA 4PG8A 2PTSA 3ZE7A 2QRKA 1Q84A 4CFYA 1A69A 1F2TA 4ID3A 1C3JA 4DHWA 1NBOA 3G9UA 2P9EA 2VJQA 1TZKA 4FCVA 3UH1A 5J47A 5IJ0B 3L0CA 2X0DA 1O57A 2R65A 4I8DA 3QI2A 3KVOA 4DCVA 2Z3ZA 3GLQA 3MERA 1MQSA 4LTMA 2OHIA 2XEDA 2NX2A 3FBGA 4IUBS 2YYAA 1R8SA 3ENZA 3RD5A 4TMVA 5LP1A 4UUNA 3Q8KA 3TLAA 5LMCA 4Z86A 3E22A 1EXWA 1RBYA 2N3ZA 2UZ1B 4MMXB 4CM4A 2WLTA 4A8PA 1NE2A 1XNGA 1PG2A 2DFDA 5EP3A 1HWYA 3ADDA 4G4GA 1J8FA 5EVJA 3WJ1A 2WWIA 4C7JA 3LIPA 4H0FA 5F4BA 1C2TA 1YF3A 3WLHA 1XZ8A 5KYYB 2PTRA 5JD4A 1DX4A 1LTQA 4LOAA 4WV3A 4WHMA 3AJRA 3QMVA 3IEVA 1SOWA 3FMGA 3PC4A 1KOGA 4YY3B 4ARIA 3IELA 4P08A 5GP1A 3L1VA 1FSZA 4PYMA 2QX7A 1RWKA 4RTRA 1FUPA 3DL2A 3SBDA 3A1WA 3K09A 1C0LA 3Q87B 3ETHA 3OKPA 3N2EA 4IIXA 3DPUA 1J56A 3V55A 4F72A 1UBKS 1VHWA 1WS6A 2VTVA 3NUGA 5DWVA 2DSNA 1KK1A 4PWYA 1QH0A 4FB4A 1N5JA 1N5DA 2I8LA 4YTEA 1QDLB 1BGWA 3FZNA 3RVQA 1MT0A 4PYJA 2QUJA 4F5EA 5E6RA 3A9TA 3BS4A 1GPWB 3GXBA 1UBFA 1UP7A 2J0EA 4S0ZA 4R3UC 2G67A 4TV9A 4X6LA 3T4XA 3WFZA 4J9VA 4EQ6A 4EL5A 4IMPA 1FW6A 4I4LA 3TN7A 3V7NA 1MJFA 2ZJYA 3NFYA 3QUTA 2QUKA 4I99A 4MUAA 5KJ6A 2V7UA 4X1YB 1FTYA 3GNTA 1MMFB 4RH0A 5KKCA 2QLTA 4TV9B 1CJKC 4EQ6B 3L18A 2JIPA 2PN1A 4EUHA 1MG5A 1H23A 8LDHA 4EUSA 4YASA 2ZRDA 5IF3A 3HPRA 3K30A 2IXEA 4FMBB 4KKXB 3TNDA 3URMA 5JJIA 5FYDA 1HDGO 1W0CA 2A7XA 2FQWA 1XL1A 3A4TA 4O1MA 1HNXB 5C8DA 3RRPA 4KLAA 3WBKA 1PQ4A 2YX1A 4QHTA 1UWLA 1D7OA 2QTTA 3E2IA 2XUDA 4ZXFA 5F35A 4Z4QA 2IZ1A 2CXNA 1T3ZA 2YWHA 2FSUA 4FKBA 1GZ5A 1AX9A 1BFKA 1WBBA 4EZBA 4CMIA 3M1YA 4S0XA 4ILEA 2CL6X 3FPHA 4HUQA 2JJ2A 1F5NA 3SS7X 2VHQA 3R0QA 4PLGA 5D6NA 3AHHA 2WLSA 5A7FA 3I5MA 1HL7A 2FF5A 3F4TA 1KMHB 1T2AA 4M8LA 1YWGO 2JS7A 4FMCF 4XUEA 4U2FA 3WBBA 1CUBA 1E1QA 3PL5A 5BR8B 2R1VA 1RBQA 2J4FA 2V96A 4INPA 3AEXA 4GI5A 4K88A 4RZIA 5F77A 1JIJA 5PNTA 4O2AA 1PI3A 1SUDA 3FVRA 2H2HA 4OHBA 3KALA 1J0CA 1TC1A 4CV0A 4RORA 4W7IA 1Z36A 1XZDA 1SVSA 2YJZA 4RD1A 5CX1B 5B12A 1H1TA 3SJUA 3EXEB 1FCJA 1D2AA 2J48A 4A16A 4ANFA 2BONA 2PL9A 2X75A 1AK1A 3HABA 3CLRC 2FR8C 1B8VA 1XZQA 2IEGA 4G3XA 3ZE9A 4MR8A 2QVZX 1ORHA 2X4DA 3FZEA 1UJNA 4KQIA 1QC5A 4RM3A 1FNSA 5CM9C 3U3DA 3GJ3A 4F2PA 3N7UA 2BEUB 4LC0A 4P4SA 3PX7A 1M75A 2LKDA 3P8ZA 3RU2A 3SKXA 1MTZA 5B4TA 2RH8A 4FNAA 2PVPA 4NQZA 1GITA 4HSEA 1J70A 4DBLE 5GJVC 4B4DA 1V4VA 1I0IA 1LJUA 1P1BA 4YI3A 3QXGA 2Y67A 1L7QA 1TK2A 1E79D 1FTQA 1V16A 2FX5A 1SHUX 1JPJA 2PVSA 3BCRA 3N3AC 4ZU6X 5JAUA 3SR3A 4MIOA 2AUMA 3W2GA 5J59A 4DXDA 1AKWA 1AURA 2Y2VA 3ZHUA 2ZTSA 2JI8A 1L2TA 1NJ2A 5HIKA 1OYWA 2NZVG 1QIGA 4NCKA 2D6FA 1IBLB 1RKBA 1MZVA 1ODKA 1T6BY 4L4ZA 4WOBA 4JYZA 4WY5A 1ZKDA 2IDMA 2QJOA 5JUWA 5LD2C 1TQHA 1EK2A 3NVAA 3MEQA 3W5IA 2WHXA 4LQLA 3FA2A 1KJQA 4C0KA 2I4LA 4EECA 3KAKA 2B92A 3WKAA 3SQMA 4B47A 1RCUA 4NFSA 4FE3A 2C88A 3ZW7A 1AV7A 1CUIA 4P7KA 3NWJA 1MO6A 3F4KA 1ZINA 4W9NC 3RK4A 4ZVSA 2CHFA 4EGQA 3NONA 3O94A 4HQLA 3TSOA 4PEVA 3VJMA 2WA1A 4IDNA 2HGZA 3I01A 1OTXA 4DLKA 5LQDA 2FOIA 3ZG6A 1Q0RA 1SBYA 4MX8A 2X0EA 3CVJA 2ZWOA 4F91B 3WMRA 3I5YA 3EWSA 2LRHA 1B1CA 2NU8A 3GGPA 3U7QB 2EW2A 1EM8A 4DRZA 4DPMA 4I6GA 1EIZA 3UUGA 1G4HA 5FWNA 2Y1GA 1FJ2A 2CZGA 2QMZA 4ZRNA 4JBHA 1JTFA 4DUGA 4IVRA 1GPH1 3OTQA 4FQ8A 4MYRA 1QBKC 3P52A 1WHTA 4PHTA 4B76A 1VIYA 1ZU4A 1TAGA 3NO4A 2YCLA 4FEYA 4WXMA 5T6BA 1EM8B 4HVTA 1GG9A 1W2WB 1ISRA 1P4AA 3T5DA 2FHSA 4LRXA 5F2EA 1ZK3A 5FO1A 2ID7A 1T3LA 3MIZA 4RSGA 2WSBA 2DR2A 1GPDG 3SVTA 1F9AA 4ZT7A 5E3JA 1T34A 2ZDQA 4IHAA 3K70D 5F98A 2PRSA 2X8LA 1V7QA 1J2YA 2NUPA 2R6GA 3PQ8A 5IVPA 4LNHA 4BZPA 2D7CA 2HA3A 3ABZA 2FSHA 1ARZA 4YAFA 4AECA 1YA6A 1U15A 4MA5A 5ALTA 4RH3A 1M54A 3SP1A 1AK2A 1N7HA 5I5EA 2AQIA 3A1CA 5J4LA 1RHRA 1T9KA 2VF2A 4N5MA 3SVLA 2NUPB 3N2IA 3FJYA 3QIVA 2AG8A 1ZI6A 2GJ8A 2Z1DA 2IYOA 2CHUA 1Q16A 2FU5C 5CJJA 1KERA 2EQBA 4DJ5X 2I9KA 4Z9FA 4BNDA 4IHJB 2CK3A 1SQ5A 1U0NA 2CFIA 2JGMA 3TRHA 3LP5A 2XGJA 4M1KA 5EN4A 1P3JA 4EQZA 3E9QA 2ERXA 1ETHA 4OM7A 1D3AA 1KSGA 4OSPA 1S1MA 1SBCA 2IDJA 3QVGA 5G0UA 4N12A 2GKOA 4B7AA 3VR2D 2ZIXA 1FK8A 1U0OC 5K09A 2O8EB 4XD2A 1BW9B 2J0VA 2ZCJA 3RFFA 1ZLYA 3IPLA 3S2SA 1IQRA 1SQ6A 1BNCA 3VDMA 5EVCA 1NXVA 5F9MA 3DO5A 1BGXT 4EL0A 1ZI9A 1W8IA 1UFQA 3DFZA 2XITA 3L8ZA 2D7DA 3SX4A 2OV4A 2BGIA 1N5LA 1JLLB 1FA9A 1VKRA 1XYVA 3KQLA 2Z6AA 3FLBA 3SZRA 4EAAA 3RRYA 3EUFA 1YHYA 2BFDA 4ZT6A 2HY7A 3DW1X 4JGIA 4KQJA 2O07A 3C87A 4UAJA 3FWKA 3DLHA 1P3Y1 3H0KA 4YIHA 4RGQA 3NT2A 4F2DA 1ZUIA 2AJCA 4I2VA 2M32A 2Q5EA 3UXEA 5KHLB 5KVSA 2IV2X 2BKLA 4N9QA 1ZJWA 1HOXA 4CKZA 4IIGA 1ECPA 2BTOA 2FFBA 5BPFA 1G0OA 1RRGA 5KYXA 1RADA 3T4PA 1U6JA 2RCYA 1E2UA 1L9KA 2H29A 3H17A 4S2EA 4WTOA 1MVOA 3K9BA 1I7DA 5AKHA 1XPJA 3DOUA 3TTYA 1QF6A 2EJTA 2O3SA 2Y93A 3D8SA 4IZIA 4MW7A 1ODIA 1M6VA 1TFUA 3W1WA 4AJNA 3CY6A 3LLSA 5I4BA 4W5RA 3UJDA 4DMKA 2Y92A 3S7ZA 3AF0A 1YULA 1K27A 2VDPB 4BLOA 4CVNA 2P4SA 4M9RA 3WIOA 4W6ZA 3NG1A 4WERA 1Q0ZA 3TL6A 1N2SA 3PNBA 1I80A 2P2SA 1J6UA 4ND5A 4C08A 5E7MA 3UT6A 3ZI7A 4EB6B 5I3ZA 5K05A 2HF2A 3SHFA 2ZJ1A 1CLEA 4UE6A 5EE1A 1UBMS 1PDVA 4E1VA 5HKBA 5CB4B 2QRMA 1I1QB 4RTMA 5FX2A 2BHNA 1DRKA 1LPAB 1VB5A 3CWZA 3EXG1 3X1YA 1SCBA 2Q8QA 3T9BA 1Z6GA 1UDRA 2EL7A 1GUBA 2OUIA 1RRVA 5JZVA 2ZFUA 4OYLA 3Q3GE 3GEGA 4QQNA 2HA7A 5E3HA 4EW6A 3TQSA 4PLHA 2R84A 1AS0A 1H94A 3DCNA 5E4FA 5FBHA 3VC2A 4EJSA 2V5UA 4BNYA 3KZOA 4YALA 1MHTA 3F3KA 4CM5A 1EG7A 2LR0A 1PJLA 5L6LB 4QJ5A 3C5CA 2GO7A 2B30A 4H3VA 1OW3B 2A8YA 1E5DA 2R5WA 3BMQB 3K5IA 3A4YA 4G0UA 1JPNA 2V7XA 3QKSA 4BQNA 4ZGWA 2PV0A 4ID9A 2F1RA 2R8XA 4NE9A 2R3SA 4V1CI 2BFPA 3HU5A 2HLDA 4KN9S 5ALFA 4RZ3A 3WLTA 1JR6A 3BE5A 3K73O 3KIPA 4QGAA 2E21A 3V2GA 3W5BA 1J1UA 4OVKA 1NNSA 3JZAA 4DMUB 4DTIA 3WGIA 5KKAA 1ST3A 3ZV6A 6REQA 3SHQA 5BSGA 5L7WA 1U5AA 1GSIA 2AEFA 3QENA 1KAEA 3PRKE 3KXIA 3MWFA 3QK7A 2UYYA 3C70A 1AKTA 2W6PA 4O1HA 2CXOA 1IN1A 5TF0A 2PCLA 2P4UA 2ODBA 5CPBA 3RROA 1XNHA 4LXUA 4NJEB 4BKOA 1Q14A 1KETA 1LBTA 1WWKA 4M86A 3W8FA 1CRZA 3OUTA 1UOQA 4BLQA 4YRAA 1RAAA 3QEOA 4OI0A 2CVQA 5KDOA 1V5FA 4YNBA 4TQUS 1Q1ZA 4CLRA 5KB3A 1U9ZA 4K9SA 3WDLA 1XYGA 1YBAA 2NT4A 1ZOIA 2WOOA 3EPPA 2R8EA 5KC9A 3AEUB 3OZBA 2IPMA 3CUTA 3EVAA 4PNZA 3KYIB 2CLEB 4TLEA 2A9PA 3B1XA 2FK8A 1XWWA 1TZMA 1QMPA 4G97A 3T3IA 2QBYA 3HO1A 3E3AA 4PM4A 1XQWA 3DE5X 5KPJA 3DEFA 2Q5QA 4UM9D 3KO8A 3MXOA 3PR2B 1QDEA 1YZYA 2G9UA 4E2YA 1SBQA 4L0DA 4QUDA 1FZTA 1P6XA 4KSYA 3KLMX 5IDYA 5FOSA 4A2QA 4HPWA 1M1YA 3FYDA 1XZFA 2NXJA 3BQMB 1AO0A 1CY4A 1HYGA 2GJ9A 2YZKA 1PR2A 3JAKB 4IV8A 5K3OA 1I3LA 3SYLA 5MN4A 4H7EA 4I1RA 1E3TA 4ALMA 4MQFA 2W2LA 4ZARA 1JLSA 1Z39A 4WZZA 1SRRA 3I12A 3V8BA 1G4AE 1QHFA 4UREA 1W34A 2AKAB 2QU7A 2F2TA 1IE3A 4JQOA 1JDZA 3DVSX 4AJEA 3GD5A 3LUAA 5DM4A 1P0IA 3DSRA 5ALLA 1UEXC 3GNSA 1SB8A 3IJPA 3A9VA 1PL0A 4FDUA 2ZIFA 4PAMA 4G9EA 3CMCO 1CWUA 3JQ9C 4AJPA 2DTEA 2J41A 2JVKA 4US1R 3AFHA 2GCEA 3ACDA 3HL4A 5FWYA 1YRBA 4EEXA 1Q3KA 2EP8A 1Y6ZA 1G9XA 2WFZA 4HHEA 1DG3A 4WK6A 4D57A 5B2FA 2OBXA 4S1OA 1JW9B 1Y4ZA 1JEQB 1V7PC 3AY6A 4RZ2A 1G8AA 5A6VA 1N2EA 5IM4A 4QULA 4U5XA 3D8UA 4B7UA 1BO6A 2PWYA 3QKRA 5E1OA 2YFYA 3KPVA 3P0JA 1Q6YA 1J2EA 2AW3A 4HBGA 5L4NA 2JH3A 3BDIA 2C3UA 4B2LA 5KVQA 4A2WA 5B58C 4ZTBA 2OZLB 3ORQA 2J0UB 3C6QA 1BOOA 3OLWA 3UG7A 3TGPA 1XTTA 4S1TA 3KWJA 4JITA 5ENZA 2IWRA 5IX8A 3BL5A 3TE7A 5EUBA 1JXAA 5HIMA 2C7RA 4BO7A 2JARA 2BFMA 5FBWB 1SA0B 3M6VA 2H1FA 4I3HA 4Y9RA 2ZBQA 3SBEA 1SKBA 2OYCA 2C5SA 3RVDA 1RLUA 3ILVA 5DXJA 1GL6A 1MTOA 1JB1A 3JQFC 5EIFA 1VLLA 4OHUA 5T57A 1PTKA 1QKKA 2HCFA 4IO1A 4JC8A 3QTTA 4AUKA 2ACWA 3O8OA 1JTVA 4PGHA 4EIWA 2BP7A 2LDBA 5ANRB 2PUJA 3TKAA 5I51A 4RLFA 1I36A 4YV2A 1VLZA 2XMRA 3GRRA 4PZZA 4PYKA 3FDZA 2ZQ5A 2WD7A 1TECE 3DH0A 4M6WB 5JY1A 2IYVA 4NE7A 2IQ5A 5KWJA 3PENA 3C98A 1U8CB 3IJ5A 1E1YA 2Q2VA 3ABQB 3DV9A 4L76A 2WILA 1XQ1A 1UDWA 2WVAA 3PJDA 3JZDA 1AQJA 1Y34E 1DL5A 2L17A 3NYRA 4HLCA 2NU9B 1OGJA 4BVGA 1OZHA 3HCDA 2ATEA 3THYB 3FDZB 3QPVA 4M6WA 5DHRA 4KQMA 1LUAA 2P90A 3IE2A 4NK4A 3TZ6A 4EKGA 3HSYA 5BVHA 4P4UA 3U5ZB 1POWA 3AEZA 4EG6A 3S3TA 5BWLA 4BNUA 4PFJA 8GPBA 4ZTUB 3L4JA 2RHHA 3AF5A 2Q1UA 1UJBA 4E2XA 5A3RA 1TF7A 1UJ5A 5JEEA 2ZUWA 3WYFA 3DMTA 4JEHA 2HF9A 3E4CA 5KQGA 4QM7A 1QJ4A 3FFXA 4JQZA 4NENB 3N70A 3W9SA 2IYEA 3D43A 4US2R 2G1PA 5FA5A 1V43A 3L1KA 1AUWA 4TZ0A 3NHAA 5K5EA 3HYNA 1F3OA 1NG1A 2WU4A 1GWNA 4ZV7A 1NPTO 4L78A 2RGYA 3WGLA 5AMXA 2JEOA 1DUVG 2D5CA 3R2JA 5FTKA 1UXJA 4H59A 2ZIAA 1N5RA 1R9GA 1RWQA 4BMCA 3KHKA 5AJTA 1MW8X 2RARA 1LWNA 3T5BA 5AVSA 3FPSA 2PX0A 1TK9A 5EQTA 1JEAA 1LD3A 3HCBA 4A0SA 1TJ7A 5GZ3A 3IEMA 2GD6A 2ZK7A 3ZWWA 1PT9A 3LI2A 2WJHA 3K09C 4GPTA 1ANKA 1QGAA 3NWOA 3QNWA 1PK9A 4I55F 4PONA 3O2SB 3HSSA 3PIIA 3UA4A 4DSTA 2OE2A 1PJ4A 1BEUB 2CHQA 2GJSA 3LO8A 4LW8A 4YP9A 1AMOA 2DUWA 3RS5A 3LOUA 1PHRA 5B58T 3WIVA 4GMKA 4HEJA 4BU1A 3A0UA 3AKEA 1ABFA 3TQFA 4EUKA 4P3YA 3EIXA 2OC9A 1RZRA 4CM3A 3PBKA 2XMDA 5IAKA 2WWXA 1SHLA 4H7FA 4Q9JA 3GP5A 2Q4RA 5CVJA 1K7CA 2CFCA 2FUNB 2ZJBA 4OOEA 4MRNA 4RLQA 3OKAA 4CM1A 1OOEA 1HQKA 1KO8A 1NUTA 5HFAA 2BEWA 3IUMA 3O8QA 5L9AA 3IB3A 2EQAA 2XNDA 3ABRB 3N74A 4I9UA 3GRPA 4O2BB 3NB0A 5IKOA 1MIHA 2PX2A 4MRVA 2FUSA 2OLJA 1IZZA 2YIJA 3GT3A 1J0EA 3NNDA 4K81B 3R3WA 2JLSA 5BMOA 3MQFA 1FMLA 2XDAA 3IV6A 1D9ZA 2IXAA 1ESEA 2QI9C 4FGSA 2ZR7A 4W6QA 2AZ4A 1G20E 2XODA 1Z2NX 2IFTA 5IZCC 3PWZA 2A7QA 4E31A 3S1AB 3H0EA 1YRQA 1D0VA 1X80A 2RGGA 5FPKA 2QJTA 4IHKA 1DIAA 2X3FA 3TRKA 2PYDA 4EMBA 3W90A 2ILVA 2IYQA 3PIRA 4FSHA 4AO7A 2XTNA 1F38A 4F56A 2V0GA 2ZUTA 2A1TR 3AB8A 4MVXA 4XH9B 1HDYA 2C8JA 5FBZA 1NT2A 4XGNA 1FYVA 3GNQA 2B5VA 1G0NA 3B1VA 1XU9A 3I1IA 3D6TB 4LF9B 4MV6A 4I55A 1MOSA 3DWIA 3X1MA 1EZ4A 4HWPA 2PIDA 2X8WA 3VSDA 4ZCLA 1WZ2A 2IU6A 4J0QA 1TM7E 2EGHA 5EC8A 3W79A 4K9RA 2M98A 1D0IA 1GQOA 3CB2A