4MWOA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor cpb-t
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
b'ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 66
structure length 193
sequence length 193
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mwoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mwoA01
4BEWA 2RAVA 5AESA 1MH9A 3DAOA 1Z4NA 2R8XA 2CFSA 4HGNA 5AW4A 2C8LA 2NO4A 3AR4A 3KBBA 3AR9A 5AM4A 3L0CA 3TLMA 2FPWA 2HI0A 1Q91A 1RQNA 4Y2QA 3SLRA 5AKZA 4NWIA 4BEVA 4EENA 3OCVA 5AVZA 1U02A 2FDRA 1YS9A 4CE6A 2W4MA 1RDFA 3BWVA 3ET4A 1QH9A 1RKQA 4G9BA 3ZX4A 4HAIA 3FM9A 3NIWA 5A3SA 5IS2A 1Z4JA 3E8MA 4ZEWA 3PGVA 1ZRNA 2ZG6A 4YCMA 3U13A 4UARA 3I28A 2WHEA 4OCZA 4CF4A 3U7GA 3N28A 2MSNA 3ZI4A 3ZW7A 2AGVA 5AW2A 2EATA 1Z5GA 3WKEA 3B8EA 4L57A 2PKEA 1N8NA 2AH5A 1JUDA 3KD3A 2C8KA 4C4SA 4YGYA 3WKAA 4NV0A 5AKJA 3W5CA 2FPUA 2IOFK 4BNDA 1EK2A 5ALQA 3WK5A 3ZWDA 1EK1A 3E58A 3N1UA 4UAVA 1RLMA 4HGPA 3QU4A 3W5BA 1Z4LA 4O8CA 4MWOA 5AVUA 4Y2PA 1QQ7A 3M1YA 1T5SA 3QU2A 1TJ4A 5AK4A 4UATA 3U7FB 2PR7A 1RMQA 1YMQA 3QUCA 1J97A 5AIAA 3GYGA 2P69A 3F9RA 3AR8A 3L8HA 3HLTA 1T9ZA 1ZOLA 2B0CA 4KYTA 5JJBA 3MMZA 3R9KA 1TE2A 1T5TA 3NRJA 3OCZA 5AVRA 5AICA 3OTQA 2B8JA 4CNQA 3A3YA 3R4CA 5AM1A 3ZUPA 4RESA 3L0BA 1XP5A 5AKEA 3WK6A 1Y8AA 1Z4KA 2GFHA 2GHTA 2YFYA 2IA5A 3SMVA 3NANA 3KDPA 1WZCA 4KNVA 5ALGA 1RPZA 1AQ6A 2G06A 2FUCA 1VFPA 5AK6A 5ALSA 1S2OA 3W5AA 3OCWA 1KYTA 2DQSA 3U7HB 5FP0A 3L1VA 2NYVA 1WR8A 2FPRA 3UMGA 5AI9A 1Z4OA 3B9RA 1U2SA 4L6CA 4KX3A 3HYCA 4IFTA 4XOUA 3IRUA 2G09A 2ZXEA 1XVIA 5ALNA 4EX7A 5AIBA 1RMTA 5AKXA 4NFLA 1L7MA 2ZBGA 1F5SA 1QQ6A 1RMYA 4UMEA 3MPOA 4AP9A 3W5DA 5AK5A 1Z4QA 3AR3A 5ALJA 5AW3A 3WKCA 4RETA 2WFAA 4HGRA 4UU1A 5AW0A 4UASA 1U7PA 1Z4IA 5AI6A 3KC2A 4YH1A 2R8EA 2ODAA 2B1RA 4BX3A 2X4DA 4Y3UA 1TA0A 2I54A 5AW6A 4YIHA 3L8FA 3ZWKA 2R8ZA 4DWOA 1VJRA 4UM7A 3RFUA 2CFTA 2YY6A 4FFDA 2RARA 4XQ0A 3ZVLA 3I76A 4PNHA 3ZVMA 5AI8A 2YJ3A 3DNPA 2OBBA 1XPJA 4BNDB 3N07A 1WPGA 5AI5A 3RF6A 2I6XA 2VKQA 5AKLA 5ALZA 3L8EA 4GXTA 1LTQA 2P11A 3I1YA 3R09A 2JAOA 2B30A 5AM2A 4YCNA 2NO5A 1L6RA 2YMMA 4AS2A 3OCUA 4CF5A 4ZEXA 3ESRA 2I55A 2I34A 2WF5A 3B9BA 5AVQA 3L0YA 4HYTA 3N5KA 4BX0A 3L1UA 3WK4A 3WGVA 3QU7A 1U2TA 1IWOA 1O03A 2WF7A 2ZOSA 3I6BA 2AUTA 3KOOA 3L5KA 1RQLA 2QLTA 4UM5A 1YJ5A 4Y2UA 5ALXA 3SHQA 2JAUA 3J7TA 2W11A 3QU9A 5ALPA 2CN1A 1ZD5A 3OCYA 4FE3A 2W43A 3WK7A 1ZD3A 1N9KA 4JDPA 3UM9A 4EX6A 2BDUA 1L7OA 5AKHA 2HCFA 3VAYA 4JB3A 1K1EA 2C9MA 1RC8A 4Y2SA 1Q92A 3CNHA 4HGQA 3M9LA 5AKGA 3A1EA 3IB6A 3FPSA 4C4TA 3ED5A 2JAWA 4FYPA 2R8YA 1YNSA 1Z4PX 2B82A 3NAMA 4KN8A 3E84A 2YMQA 2IYEA 4KNWA 1RKVA 4H1WA 1YV9A 4J2TA 2YJ5A 3ZU6A 2FUEA 1S8OA 4Y2YA 4BX2A 2BY4A 3MC1A 3QU5A 5AK3A 5ALHA 3L8GA 4OHFA 1L7PA 3FGOA 3PGLA 5A3RA 3WK8A 3MN1A 3A1DA 4EZEA 2WF8A 3L7YA 4YIKA 2EARA 3SKXA 2Q4TA 3FZQA 4YCLA 3AR2A 5AKIA 3U7EB 2B8EA 5AW9A 3ZVNA 5T41A 2YJ4A 3QXGA 4Y2VA 2YMLA 2IOHA 1RLOA 2OYCA 3UMCA 3NUQA 2ZBEA 1TJ3A 3D6JA 1L8LA 1SU4A 3PCTA 2YBDA 5AVXA 1TJ5A 2I33A 2G80A 2B1QA 2QYHA 3QUBA 5ALOA 4OFZA 4XPZA 3UMBA 2I7DA 4UMFA 4XE5A 4Y2RA 5ALLA 4NAVA 4NABA 3K1ZA 5ALRA 4I9GA 5AW1A 3AR7A 3AR6A 3CZ4A 2G0AA 5ALFA 2HF7A 5ALVA 1NRWA 1CQZA 3NALA 5ALWA 5E0OA 2FI1A 4Y2XA 4BKMA 4L6AA 3SKYA 3QGMA 2OA0A 4ZEVA 3PDWA 3U26A 5AVWA 2HHLA 1X42A 2WF9A 4C4RA 2WF6A 2ZBDA 5IT0A 2JARA 3NASA 4J03A 2ZBFA 1NF2A 3QUTA 3QUQA 5ALDA 5AM5A 3WK9A 4UMVA 1SWWA 5AKKA 5ALMA 1RLTA 2WM8A 1LVHA 1O08A 3QX7A 1ZS9A 3ESQA 2YJ6A 3OCXA 2G08A 3WGUA 5A3QA 4BYGA 4MUMA 2O9JA 2CFRA 5AKYA 2BDEA 3QYPA 1SWVA 4UU0A 4F72A 2OM6A 3WKBA 1RRCA 2PQ0A 2HSZA 3ONNA 2HX1A 2FPXA 4EEKA 1NNLA 2GHQA 3S6JA 4DCCA 4QJBA 5AVSA 4KX5A 1L8OA 1QYIA 3ZTYA 1ZRMA 5AVYA 3FPBA 2YMPA 1CR6A 1RKUA 4Y2TA 3QLEA 1U7OA 1Z5UA 2JGAA 5AHXA 3E81A 5AM3A 2EAUA 5AW7A 1FEZA 2HOQA 5AI0A 1Z88A 1WVIA 5AM0A 2FEAA 1PW5A 3N8GA 4HGOA 2RBKA 2YN4A 4UAUA 3EF0A 3U19A 3ZX5A 1L7NA 5ALUA 4Y2JA 3DV9A 3OPXA 1J8DA 2D2VA 3KZXA 4G63A 5ALIA 4GIBA 4AS3A 3QNMA 4DFDA 5IT4A 2GO7A 4DW8A 2FPSA 2HO4A 2O2XA 2MU1A 1ZD4A 3FVVA 2Q4RA 3ET5A 3AR5A 5ALKA 2HF2A 4EELA 5AVVA 3EF1A 4UMDA 5AW8A 5ALYA 3BA6A 3SF0A 4F71A 1Z4MA 5ALEA 2RB5A 1ZD2P 2HDOA 2GMWA 1VJ5A 3EWIA 1YDFA 5AI4A 2Q5EA 3IJ5A 2G1AA 2P27A 2AMYA 3DDHA 4UW9A 3EPRA 4I9FA 3WKDA 3SD7A 5AVTA 4CF3A 4IG4A 3A1CA 1ZJJA 2C88A 4E88A 2P9JA 5AW5A 2IOFA 4QQFA 2C4NA 1QQ5A 2HEGA 4OD0A 4B6JA 3P96A 2G07A 4BBJA 5ALTA 3ZTWA
chains in the Genus database with same CATH superfamily
4K46A 2AWOA 2YIJA 5AESA 3ZU4A 1QPGA 4FR5A 1SQGA 4RZXA 1F6WA 2IEDA 4AWAA 3OJEA 4RLFA 1T3HA 4YMTA 2ZTVA 3DPIA 3OECA 4BNMA 3C48A 5JS2A 1E3MA 2DUWA 5G1NA 4RQUA 3PT9A 2ZJ8A 3HXMA 5EC8A 4C2TA 5E1OA 2AEJA 2R97A 4EQZA 4D9GA 3PDUA 2FPWA 1ZK0A 1MT0A 5ADVA 5CJJA 6REQB 3MM4A 1A1VA 1O1YA 3KFVA 3FKSD 3IELA 1J1IA 4QQRA 1N5JA 1Z8NA 3Q3CA 3IBFA 1IY8A 3QVGA 1VLZA 4H3HB 3LVQE 4N8EA 4IIVA 3LKDA 3LT4A 2X75A 1LI5A 1WLSA 2FN9A 4IH1A 4MVJM 4GM4A 1V8DA 2CLIB 2VDVE 1HORA 3KQLA 1L5HB 4Q9IA 1VE7A 1US8B 1N33B 1QCYA 4KI7A 4IILA 4WESB 5DRTA 2EFHB 4XVUA 2QN3A 3L93A 2BFOA 1A2BA 1EJ0A 4OL9A 4ZOQI 4CKYA 4UXHA 3VHRA 5JAHA 4DEXA 1U2PA 1XVAA 1YB1A 1WMAA 3MJCA 4M7PA 4ENPA 5FQNA 3T9FA 3GJXC 3IJPA 3ENZA 1UAYA 2AE2A 2PDAA 1OXKB 3N28A 5GAJA 3ZE0B 4BMPB 4EJ2A 5ED4A 2AYYA 2AQ8A 1QO7A 2V1XA 3T35A 1W4RA 1WP4A 1X9GA 4F46A 1IOVA 3UT6A 1K4YA 1I4DD 3KVRA 3O31A 2FZ5A 1P0MA 2OO5A 2ZIVB 4GPZA 3WBFA 4UEQA 2FPUA 1IHXA 4GXRA 4NEHB 2H9IA 5EE3A 4LPSA 5E3JA 1UP6A 2H11A 4FT4A 5TQ0A 2M6SA 2NV0A 3AZOA 3ESYA 3GELA 2G7ZA 3LL7A 2FG5A 2VZLA 5BVHA 5JROA 6ABPA 3I5XA 1FQJA 1OZHA 1JXOA 1SCNE 4P0TA 2X2OA 3TW8B 3T1TA 3W5BA 2JL1A 2OK7A 2D74A 2O50A 1FX0A 4B80A 1RQ2A 4KGZA 3V55A 1NFRA 4TZ6A 4D0RA 5K8IA 4X93A 1C9KA 5J2TB 3NNDA 3LFHA 1ZGCA 4JP1A 3HSYA 3PYLA 4PRLA 5I4IA 1YFEA 3LNCA 2J08A 2VBGA 3LW8A 4A8JA 4BVAA 3INTA 4RADA 4WZBB 1HY1A 4WOJA 1L5SA 3FNRA 3H2KA 1RI2A 1KGSA 1J5EB 1M0WA 1RWQA 2CNDA 2V6BA 3CWCA 3ECCA 3GDWA 5EIOA 1H2BA 1JHPA 2A33A 4DA7A 3EAFA 3TZCA 2JLZA 3OLWA 4IG9A 2WWRA 3ZUPA 4Q4JA 1YRLA 2J3QA 2OVBA 2UUPA 3GGGA 1QVZA 2VRWA 2CF6A 3F5DA 2A7XA 3DAGA 2IYXA 2IH2A 1G3RA 4J0JA 5F5XA 2AOXA 2X2EA 3R5XA 2BEWB 3L8YA 1WZCA 3ORYA 5BOVA 2IJGX 2G9VA 4DQXA 5JRDS 3TCXB 2JFYA 3NR2A 1NVTA 1A9SA 4NDNE 3JQDA 4QWMA 4B2PA 4EHFA 1KI3A 4GEGA 3B6KA 4ZC8A 3IXMA 3QFRA 1XTPA 2RGYA 1ZQ1A 2ASEA 2N46A 3LBYA 4K9KA 5DJ5A 1CSEE 1Z2OX 5KNCH 2OT3B 1X2BA 5ALSA 4PS1A 3KR0A 5K45A 2XTJA 4MAFA 2DTXA 3I58A 2JAQA 2QN2A 4JI0B 1NJFA 1AGXA 3CH7A 2PKQP 3OC6A 2FLVA 4MTCA 5DLDA 2ZRAA 3V4FA 2EFCB 3HGQA 4EKEA 1A69A 4NONA 4MJ3A 3RRJA 1WNFA 4MVJI 1NYQA 1TJYA 4XYBA 1TW2A 1EJ2A 1F3LA 3L0IB 3VI3B 2W2LA 2I2WA 3DMRA 3I83A 3L92A 2RC6A 4IFTA 5CK4A 1P18A 1Q0SA 2JFVA 3RFCA 2CNNA 4MCIA 4WESA 3CR8A 1SVOA 1W0JD 2FQ1A 1AV6A 4KXYA 1MG0A 3LHFA 1F5SA 4Z1OA 3PNMA 1SC1A 3BMNA 3MPOA 3NC0C 3WWZA 3TG2A 1P4GA 3LZDA 4AS1A 3NAQA 2IXBA 4GZMA 2VJDA 5AOVA 5FOXA 1OTYA 2NU9A 3H3XA 2H3EA 4K9DA 3VO2A 4PHCA 3HM9A 3RAEC 1K2VN 3H4TA 4JENA 1I24A 5H16A 4B4KA 3WX0A 4EA7A 1NXSA 2MYPA 4G1CA 3OM1A 2GJSA 4FJ1A 3DL0A 4V02A 2NV6A 4CL8A 2V6IA 2C5EA 2C97A 3L6RA 3MUOA 3N9IA 4W8GA 2OTCA 3AEQA 1RHKA 2WFMA 5EPUA 3SFTA 2WV7A 3GXOA 3NBYC 4HWGA 4XD7D 4S3MA 3ZVMA 3GA5A 2QYOA 4B83A 1G3IA 3ANNA 3IKVA 1I2MA 3Q7SA 4H6PA 1W1UA 1R0WA 3LJKA 3MTAA 4LJAA 4PTLA 3NBXX 4XA8A 3GK3A 2JCVA 3B1ZA 3ZJ5A 621PA 4ZVOA 1QP0A 3AGPA 4C0XA 4BIIA 3B12A 1W85B 2E7ZA 5KTNA 1BWPA 2CVPA 1GUYA 2WPDD 1SCAA 1JA0A 4NZ9A 5F76A 1ULZA 1JTFA 3S8YA 2NP7A 1CQIB 5I7HA 4OQLA 5DXJA 1ZXXA 1VLHA 4CMEA 4MIOA 1ISFA 2JKVA 1W44A 1P39A 5G3YA 4BP8A 2AOVA 2QGAB 2Q7XA 1D5CA 4ZEXA 2QTMA 1OJ7A 3AWIA 2BV3A 3EEIA 4RJLA 3S2SA 4E5KA 2NUTA 1FTYA 3ZWXA 4HLCA 4J1QA 4I8DA 2VNIA 1EM8B 1ORWA 2VP9A 1JXAA 3KB2A 4MRRA 1M1NA 4ROTA 4XIGS 2PFGA 4ZCSA 4YCBA 3ZV7A 4O4IB 3LBAA 2R5FA 4Q02A 3HU2A 1YTUA 3O2SB 3L5KA 1GN8A 1WUKS 1XDGA 3EEYA 3T1YB 1G9TA 3Q4GA 4OHVA 4YROA 4UNPA 3SOPA 2H1LA 4KO4S 2R8PA 3D7RA 1D2GA 3B85A 4YRIA 3OICA 5AXBA 3HLKA 1P7YA 2PJUA 2W11A 3JD2A 3J7TA 3LGSA 3TMAA 3V2UA 4EK9A 1GCGA 2VDOB 5D6NA 5B55A 3HU1A 2M1ZA 4INPA 5DCWA 1M34E 4H4EA 5FAXA 3EQ8A 1N9KA 2J3LA 3O4GA 5E9JA 5AR1A 4N03A 4O2AA 1RLJA 3T3MB 1EZZA 2PL9A 1MORA 2A1UA 3MCTA 4FLMA 4RV9A 5IW8A 3RDPA 4MLPA 1I6MA 1K1EA 2FRDC 3B38A 4CN9A 4JITA 2B36A 2H4FA 2XMRA 1N8TA 2RK6A 4X6YA 2HSDA 3H1PA 5DWQA 2QBYA 3IUNA 4AO8A 4MUJA 1DKQA 4OLAA 4LJSA 1VHWA 2FX3A 3ED5A 3IESA 3MWYW 1O96B 5M29A 2V7PA 3B9PA 1I5OA 2Q0QA 1U1IA 3KOXA 4CKWA 2ZM6B 5FJIA 2G17A 3E84A 3ZYZA 3T3DA 2QZ4A 4ZJUA 5F35A 4Z54A 1XCBA 3TTVA 3DE7X 3GFFA 4EY6A 1IEVA 1NQVA 2HH9A 4RV4A 2YWDA 2FF5A 1ZM3A 4EW1A 1N36B 3T9CA 2O57A 3PGXA 3IBTA 1YVPA 3R3SA 4QFMA 4IKEA 4EG8A 1F4LA 4P2GA 3IQGX 3MD9A 5JLJA 4IEEA 3W5VA 1Z6XA 1EVQA 1KY3A 2Q2NA 3KEOA 3FGOA 2PT6A 4CKCB 3T61A 1IUPA 1DUIA 1PWYE 3ROKA 3TTSA 3WK8A 5IU6A 3QRWA 4JAVC 4AMUA 3A6FA 1R9JA 4ZI2A 5GZ3A 4J1TA 3FFTA 4EFKA 3TLGA 2A5FA 5A4AA 5DM2A 4V2UA 3G3EA 3LPAA 2EG9A 2FSVC 5ICSA 2Z58A 4J91A 4PZYA 1H4SA 4JI7B 4MPRA 1TTPB 3EJWA 3ICCA 3K5HA 4JIMA 1VPTA 1FNMA 5ES3A 4BMNA 2QJWA 5J9FA 2ZANA 5G0SA 2YWJA 1TADA 3L9WA 2YNMA 1RRFA 4A2CA 4CM4B 4ZTZB 4RVGA 4YP5A 4XX0A 1PVVA 4P5DA 4RK7A 3WLRA 3OIDA 2DKOA 3N6XA 1X94A 9LDTA 3QG5A 2GEKA 1GGEA 3BZUA 4JYMA 1BAPA 4DYHA 5AVXA 1W52X 3VVBA 4AU1A 4NAUA 4ZIRA 1H9CA 5ALOA 2IPLA 4LRQA 1QG2A 2V7VA 5KSWB 3HV0A 1U8AA 4BNJA 5T4BA 3VBEA 4YRAA 2PZKA 4XE5A 5EHZA 1V3UA 3NIFB 4OJYA 4NABA 4ZEMA 1HY3A 1XD9A 2P2NA 2HA0A 2ID7A 1JIJA 1W4BA 3VNRA 2ERYA 5ALRA 1DG9A 1P9WA 3PJEA 1JHOA 1POXA 1YFZA 1ZCZA 1U90A 4JDUA 4X8LA 3H11B 1QHEA 3NALA 4UEJA 4CHTA 1B8UA 4EG7A 5CB8A 2FZEA 1I6KA 4HNQA 1PYGA 1DC5A 2HREA 4UC0A 2DX7A 5G0VA 4U2BA 5A5DA 2X3YA 5CD9A 1PV1A 3ZBTA 2C7QA 5JYEA 2O2JA 3E2IA 4I6JA 4QYIA 2OHXA 1X77A 3U26A 2C77A 1UC4B 2AHOA 4NPCA 4P7BA 2W2PA 3MCUA 1RAEA 1N5MA 1VIMA 4PPQA 3IVCA 3ORHA 1M8PA 1WCIB 4O2AF 3FYUC 1DBWA 1QIHA 1LKZA 4CM6A 2VOEA 4FQ7A 4D82A 4EI9A 3DWFA 2O19A 1IMOA 1NJ6A 3H2JA 3JQ7B 4WCFA 1FNBA 1OTHA 4NG5A 3F46A 5F78A 2GLUA 1VBKA 4X24A 3SE0A 2ZUBA 2G6BA 4H31A 3SHFA 5EVCA 3U0VA 3UH0A 2YYAA 5ALMA 3KVNA 3X0DA 4LV5B 5LA6A 5LIPA 4ZVUA 5BV7A 2HQ1A 2YDYA 1CU1A 2ETXA 2G08A 1N6RA 3M6WA 3O5AA 4MS1B 4EH1A 4UD2A 3FUCA 1EAYA 1P2SA 2VF4X 2BMVA 4KUHA 2H5LA 4GDFA 1Y1QA 4ABYA 2HLDD 3B89A 4Z4IA 1I80A 1CEQA 2IVFA 2IIPA 3AVYA 3JYLA 5FUBA 3FYCA 2EBUA 2OWDA 3G9QA 2O8DA 3CM0A 3D6MA 3SEZA 4OKIA 5IBPA 3RUEA 4HAWA 3SLGA 3P2IA 3FYTA 1KDVA 4QPJC 3A4NA 4RNDB 3ZU2A 2IPMA 2DPGA 4UQOA 5LP6B 4B76A 3V8BA 4R8VA 1E79A 1NNUA 1EFKA 2F1KA 1FRFS 3EEQA 4DJJA 1WMSA 3FTPA 3GVHA 1C30A 1MIOB 3C14C 3GN1A 4GYYA 4RK6A 2F2TA 4P8RA 4PHGA 4C0KA 3UJ7A 1OVGA 1YO6A 2XR1A 3O47A 2W37A 4TL9A 3AJDA 4F3TA 4OSOA 3S8EA 1QZ3A 1PCXA 5F9FA 2RHTA 2ZAIA 2POQX 3HCNA 1CNEA 2E1RA 1NBMD 4CQMD 1ODJA 3OX3A 1EDOA 4FFWA 1BVRA 3O3CA 4MR8A 3OX4A 2P8SA 2QYTA 4FJ2A 3ILVA 2GBLA 1WVIA 4CBVA 2PJRA 5F2OA 3UNXA 3CLSD 3EZLA 3I8SA 1PW5A 3RLIA 2BVNA 4B3DA 4TM8A 1KMCA 1MW8X 5DEIA 4UTPA 4X3OA 4BO3A 1CF4A 1F9EA 2GZ3A 2YN4A 3O8OB 4MEJA 3FHTA 4FGUA 4BVJA 1TM3E 5BSFA 4DUYB 1QOQB 2IU6A 4MINA 3I9JA 2J30A 1FCJA 1M8KA 5G41A 3HUTA 3VR1A 1QH8A 1GYPA 4OQDA 4EG5A 3K15A 1G3UA 1IHDA 3EIUA 1B93A 3KZXA 1W87A 2GBFA 5TVGA 1J90A 1FP2A 3W2EA 4YJKA 4PXSA 1LV7A 5K6TA 5HRAA 2JEOA 3VJRA 4WW0A 4LF6B 3H87A 2OORA 3NLLA 1QQTA 3E6AA 5EXTA 4TZ0A 1RHQA 3HBMA 5EI5A 1DTWA 3NX4A 4KKXB 4BRWA 4ZAFA 4XB2A 2MSLA 3M6LA 4CM3A 1D8AA 3ZGLA 1T0PA 3HXQA 4GKVA 2LVBA 1T6XA 4J0QA 1FU4A 3X1ZA 2CL6X 3JQFC 1N2CB 2WTBA 3H5WA 4GBMA 1KJZA 2VDJA 3PLRA 1KDYA 4IR7A 1UDAA 3VPXA 2OCLA 2QAIA 1I0AA 1VMEA 2PY6A 2PZLA 4KLNA 1U8FO 2XQKA 4MO9A 3TD2A 1GOTA 2FE4A 2QGZA 4LRUA 2EX1A 4AC9A 4CODB 5GJBA 5DK4A 5JQGB 2Z95A 4TROA 1NGSA 2EW8A 1GG9A 2P3SA 3OTGA 5COAA 4KXQA 1JAYA 2CDCA 2RGNC 3D8NA 5IJXA 3C3EA 3EWIA 1E2UA 1IEWA 2IF2A 4MITA 1WKCA 4JQZA 3DTVA 2B4KA 2WWXA 4EHLA 4I9FA 4I46A 4CDRA 1OW3B 4IX9A 2B7LA 5EJGA 1YIAA 1FDWA 1FNSA 2I3BA 2ZS7A 3FVRA 1VG8A 4Q1AA 4UREA 5FI5A 5LA6F 2HN9A 1SU6A 1ZMXA 3W2FA 3WNZA 5J3JA 1C3JA 1C4XA 2B94A 1O5TA 3D6HA 3LO5A 5L9AA 5KKAA 4DMLA 1T1SA 3ETNA 2GTIA 2GSWA 3ABQB 2ON6A 3LBNA 3LCCA 3Q9SA 3ETEA 2Z3VA 1ULSA 1ONOA 4JT8A 4QOEA 3WSVA 1ENOA 2IU3A 5HMLA 2VHJA 4BEWA 2R1UA 3O95A 5LNK6 3VPFA 4E4TA 2Q1TA 1HZZA 3CCFA 3THXB 1YS7A 1P3Y1 2AEEA 4YV2A 1S89A 4ZYVA 4RACA 3RVSA 3L84A 3P7MA 1R0LA 5FKJA 4EEIA 4GSKA 4QOSA 1BYUA 4JLWA 4R1QA 1PJCA 3SXJA 1RP7A 1Y5LA 1H85A 3M6IA 2XYPA 4OO3A 4PXAA 2H31A 3M7IA 3D5TA 3ONWA 3OIYA 5F64A 4HPXB 4YUWA 3QKRB 1VYHA 3QMMA 4D02A 4F06A 4DEVA 4J7UA 4C3OB 4K9MA 5HK8A 4A9AA 3JY6A 3EMVA 4BVGA 3UOWA 1E2QA 4US0R 1WDTA 4KJXA 1RDFA 4DLXA 2OYRA 4DWWA 4YAGA 1OBOA 4JBIA 3C5WP 2B7BA 4Q0MA 1GY8A 2X0EA 1WCWA 1G2IA 4FSDA 2I2DA 2A4KA 1XD8A 1QIJA 5A3SA 4WKBA 4Z8YA 4BY9E 1XQXA 4C30A 3HB5X 4HJRA 1KFEB 2WIDA 3K9LA 3BCUA 4TLLB 4XGIA 4ZEWA 4YUAA 4HBGA 3NDBB 1KKLA 5F12A 1I3OA 4UHFA 2X0FA 1AGNA 1T34A 4ER3A 5IVKA 4QDXA 1JJVA 3I28A 4W63A 4G8CA 5IHXA 1C81A 1VLJA 1ADYA 1LZKA 1P5RA 4N6NA 2PRYA 5EXDA 5P21A 3UK0A 2ACEA 3KHTA 3T1QA 4IO1A 1XPUA 3OJLA 3PPYA 4K7JA 1AKYA 1Q0LA 1RPNA 2WJ4A 4S1TA 1DIGA 2XAAA 2VDPB 2VNKA 3NHBA 2Z6UA 4YAIA 1EVIA 1ONPA 1KRHA 3UMMA 1N8SA 3ENVA 3F3KA 3OOEA 3L7KA 1UFOA 4HN4B 3ID6C 3OFKA 1NW7A 5CD1A 3IFSA 1MO5A 3GA0A 4M21A 2W6JD 3OM0A 4MZDA 1K5GA 4P92A 2L0XA 2MMGA 4HYEA 2Q2OA 1OWMA 5E6RA 3MXTA 2F3SA 4EEXA 1SXJE 3M1YA 3NHPA 4Y6GB 3BF8A 1W4AA 5CHYA 2GR9A 1WS6A 3RBAA 3EXEA 5KDOA 1G64A 1XD2A 1E4EA 5BYJA 2P69A 1UEXC 1H05A 1PT6A 4UCQA 5CEFA 4IXWA 1OVMA 1G4UR 2H9AA 1H1LB 1RTTA 5JJBA 1KETA 1PGNA 2QUZA 3ILXA 3FOBA 2NTEA 1NVAA 2I3AA 3QPVA 4R0NA 3VR5A 5EJAA 1ATZA 3TLKA 3EVAA 4HWKA 4KQMA 3A14A 4IFIA 5B1DA 5TRTA 4CVNA 2GSDA 2W8ZA 3RYFB 2O59A 3T06B 3IDSA 5AIBA 4LYJA 4DNPA 4FFSA 2CK3D 4IIJA 1Y5IA 5TT0A 4CM7A 4EUKA 4DV6B 2WWGA 3M70A 2Y1KA 3REOA 2IYWA 1IN4A 1DMSA 3NU1A 2PTSA 4KQXA 4YACA 4YBRA 1BOOA 4Q24A 1Z4KA 1E59A 4ZCMA 5E9QA 2NP6A 3BMCA 2YFYA 1Q50A 1IZZA 1Z7GA 3VYSB 3QA9A 1GUFA 4CJXA 1PIWA 2XQJA 1AHNA 1A9YA 1GG5A 1KI2A 1G20E 1Y6RA 1YS4A 2NAPA 4BMVA 2JJQA 3K35A 2P9QA 1NRIA 2WU1A 3FR7A 3JU3A 3JW8A 3LXRA 1HNNA 1K66A 2BGMA 3OBIA 5GY7A 4KK3A 4BJHB 3W5AA 1VLLA 1U16A 2PRKA 3C3MA 4QL3A 3C3YA 4BAGA 5IF9A 2VS1A 5FWDA 2WABA 1C1DA 3ITNA 2EZ8A 3WRVA 3SIXA 5CDUA 3BH6A 4N7BA 3IEIA 1BWQA 2YXPX 4EL5A 2YCLA 1ZWKA 1XTUA 4YT5A 2G04A 3W79A 1DELA 1R8QA 3HB0A 3WRWA 2GJ9A 3BE4A 2IXDA 3HYCA 1PT7A 2Q4EA 3RV4A 5DXFA 2IBSA 1SOMA 1Z56C 4NJMB 5DMHA 5DT2A 1YWGO 1XI2A 2B92A 3CNNA 2V6MA 4EX7A 5EJ7A 4Y6OA 3GAAA 4RTPA 3LYLA 3ZK8A 4H77A 4JC5A 3H6GA 4KDFA 5BWNA 1IMJA 4M9SA 4ZT6A 3QBTA 2H29A 2VSYA 2EJUA 4D56A 4EPWA 3X1WA 1FSGA 1BW9A 4UJ3A 5E6SA 1JILA 3HGMA 3IUQA 1WM1A 1IBRA 3GLGE 1JS1X 3L4SO 4LOJA 1KYVA 4YN3A 2V4MA 3H9CA 3F4KA 3PZRA 5C1PA 4LJYA 1R00A 2FSUA 3KOZA 3HCPA 3DL7A 5KYNA 2MMCA 4PC6A 1I5RA 2JGRA 2G36A 2F43A 2OBMA 4ENSA 3L41A 3FHCB 3GU3A 2ZVJA 5SYNA 3H2ZA 3P9YA 2IITA 5A0VA 4GMXA 2AEFA 2ZAMA 3MGKA 2A5JA 5EEGA 5FTMA 8ATCA 1LBEA 1LDEA 2BYTA 3HP4A 1NMZA 4NZPA 1SCBA 3RUHA 3BWMA 3WAKA 4JUAA 4EUSA 1I1QB 3NHLA 3LGXA 3ZU5A 5BVHB 4QQ8A 3FOWA 5CPFA 2P6OA 4KSCA 3JVEA 2D62A 3RF6A 1Z6AA 1YI1A 1L5ZA 1P3JA 1R74A 1K8XB 1U3DA 3ZYCA 4PLZA 4FZJA 1NQOA 1B7GO 2BKEA 2H0AA 4BVBA 4CR7A 4K2HA 4LE0A 2XKJE 4PLHA 4AJ9A 5AM2A 3TFOA 4PSAA 2I9PA 2JK1A 1TT7A 5EPEA 2RHMA 5CVVA 5FBKA 4EPTA 4V0SA 1G2PA 4EA9A 2R6CA 3PR2B 1YRBA 3IE1A 3KKMA 5A7GA 2B9VA 1HRKA 4ND6A 4WUTA 3H05A 3U09A 3ZNQA 1CFJA 3EW9A 4BX0A 4JJKA 4HNTA 5FEUA 3B7GA 4IIJF 5LQUA 3VGJA 2LP4Y 3VPGA 2FX2A 1JX6A 4J16C 5H68A 5INTA 3JPWA 4F9GA 1CYEA 4ZOAA 1NAHA 3PS9A 1HKHA 1GKLA 2VSFA 4Q4JB 4WH0A 5TPZD 4AG3A 3NYIA 4I3HA 4QYTA 3U16A 3VU0A 1JR3D 1EFRD 2A92A 4YR9A 3DYIA 3MIIA 4RM3A 2WAXA 2NZ8A 5B6PA 1Q14A 1P73A 1LBQA 1VRWA 3AF6A 2HDNB 1Z75A 1J6UA 5CEJA 3WXBA 5KVCA 4MXDA 1X74A 2FFQA 3MWEB 2ZI6A 1C2TA 1XQWA 2QXTA 4PE5B 4N6OA 1RRVA 2NXCA 3EG9A 2E9FA 4S1VA 4KWCA 4WK6A 1X7WA 3GV0A 2H06A 3VC3A 2BELA 2CXTA 1O4WA 2RONA 3ZD6A 3VAYA 3GT0A 3AVVA 3KQTA 5TQJA 2EKQA 4S1PA 3R0VA 2ZBPA 5H9VA 2YJZA 1AK9A 4B9EA 1ISMA 3M6UA 1RI3A 3N2EA 4I3FA 3HLYA 4O2RA 4QOGA 4E5DA 3MSCA 4F7DA 1PYDA 4TPKA 3OPQA 3FGNA 3FDZB 1KAGA 2PXCA 1BZYA 5HILA 5ITWA 2I87A 3DKIA 2DY1A 4NICA 4L6IA 4R40A 4YRRA 1CRWG 3RVJA 1QYVA 1R27A 2VXBA 3SC2B 1WXXA 2JI6A 2N0SA 4LJ6A 2AG8A 2JLUA 5GM2A 2AFHA 1L4MA 3FUTA 2GB4A 3H1AA 3BMQA 3BZWA 1UBHS 2IP4A 3BMNB 5COBA 3E9RA 2WJJA 2RGAA 4YO7A 4I50A 5IJAA 4YONB 4WDQA 2V5AA 5CIYA 4PSVA 1E99A 3A36A 2PMCA 1KAQA 4CI0B 1R3DA 4FFBB 2QTFA 2IEAA 4KB5A 1FFSA 5B4TA 3QMWA 1OX5A 1JLHA 2HWUA 2QRZA 4OHFA 1WKVA 2ECFA 3CLSC 3KEQA 4M49A 5FBRB 4P3XA 1RJ9B 4F3YA 4KN9S 4MDYA 2HZBA 4DB2A 1GA1A 2DPLA 1MENA 3V97A 2H4JA 2ZRJA 1X86B 4HH1A 4DSTA 3TLZA 2ATCA 3IR7A 3LLUA 4PN3A 1J22A 1JG2A 3ZR4B 3K1TA 5FL7D 5AW9A 4DV0B 5T41A 3NFYA 3A4TA 4Y2VA 4BNZA 2YMLA 3CT4A 3CRVA 3DAYA 4FYJA 4MICA 4U7PB 5JOQA 3QYFA 3KT6A 2Y68A 1O8CA 2EW1A 3DG9A 2Z0MA 3NUQA 4NATA 3DLHA 3O7WA 2H7YA 2OHGA 3KB6A 1A7KA 3O1LA 2QL6A 4DIOA 1C7IA 4AMZA 4KSBA 3QBEA 4PLCA 2W83A 1BXGB 4DLRA 1OBHA 1NQXA 4FN4A 3UK7A 4TVSA 1YS2X 3TOVA 2A7QA 1N1DA 1CJCA 1VIYA 2J8ZA 2J9ZB 4X7MA 4RVUA 2R1ZA 4EO9A 2VDWA 2ZIEA 1Y98A 4IOLA 5ALLA 3GRZA 4EUNA 4U7WA 1E63A 1MABA 2ZSEA 5BUSA 1A95A 2WB4A 3PHIA 1G5QA 2NUTB 3KHUA 2OHHA 3WIBA 5DTEA 3ZIDA 5JHGB 5JRZA 1Q77A 2HBZA 3AR7A 3FWYA 3NH6A 3RPEA 4D42A 5D2CA 1KQFA 3UXMA 1C4OA 3DUFB 3LX4A 5I7VA 2YRWA 4DG9A 4X85A 4MX2A 1PFYA 5U9CA 1Y1RA 2VA9A 3GJ7A 1BD4A 3DHYA 3FNEA 1EBBA 1YK0A 2DFPA 2PZEA 4L2IA 2HCBA 3E4DA 1SU7A 2HMTA 4YP0A 1Y1TA 5IAEA 3K5PA 3K2IA 2W0SA 4U5XA 2A57A 3TTWA 3OHPA 3VO1A 2Q6VA 3GR6A 3QVSA 5CLGA 4ZA2A 1K3FA 3WLMA 2P4EA 3BXEA 3TKLA 2EX0A 3V7FA 3VZDA 5B12A 1IPFA 3PFHA 3NEAA 4R9NA 4XDZA 1K6IA 2F8LA 4MJ7A 2BFPA 5CEEA 3I34X 5CCXA 4O2AB 4R68A 2ZJ0A 4MQUA 2ZBFA 2HU7A 2R62A 3PC4A 2NSDA 3ZGNA 4E2ZA 3FF1A 3N3BC 4L4RA 1DO8A 2SBTA 3BIFA 1UPAA 5B3JC 3CNEA 5MN5A 2H1OA 2WHPB 1XDSA 1UBRS 1WBBA 2A9PA 4Q15A 3CQ9A 1UPCA 1LRJA 5F1YA 2VF2A 1ZIYA 2W2VA 2WTAA 2X3FA 4ZWNA 4MUMA 1PEKE 1R2QA 4CKWB 4PLVA 4BZQA 3RB8A 1JXMA 2VEDA 1QVAA 3G0CA 1DAGA 4L28A 3ASUA 3AKYA 4RHXA 2XIJA 4BO4A 2REQA 4X6UA 4PPYA 3Q5EA 3ON5A 3BG5A 3KQHA 1PU2A 2H48A 2B34A 3DJFA 4FEEA 4I50F 5JJ5A 3BTUA 3L0OA 2FPXA 3I6ZA 3ZDZB 1Y3IA 2J3EA 2QRQA 3RBZA 3KQUA 2P9EA 3AGQA 3QHPA 1L8AA 6Q21A 5HS6A 3GXBA 4DA8A 1Z0KA 2DWQA 4V39A 5GV8A 3V1LA 4EYKA 5D5QA 2HO5A 3Q2IA 3ZTYA 2O8FB 1I01A 1N0HA 1J07A 4L74A 4E5UA 2PG3A 2EJWA 4MK4A 1JHAA 3LT5A 4RHYA 4O1HA 3KJGA 3Q5GA 4Y2TA 4DLSA 4AY4A 4L4SA 1ISHA 2KJQA 3TLGB 5AI0A 1W5AA 2HQRA 4B84A 1JW9B 3G68A 4F0JA 4DMUB 1RLUA 4LUCA 4KAJA 5D6BA 1EK5A 2BM0A 3D6TB 3IP7A 4NKRA 5JAOA 3LY9A 1GHTA 3GMTA 4TQAA 1LXCA 4HOYA 3I9MA 1SPXA 4ML3A 4MKIA 1CQWA 4LDPA 1RZRA 1W25A 2ZWOA 1WDMA 1QC5A 2ZB2A 2ZRIA 3F6YA 3JV7A 3HJNA 4URWR 2LGJA 3RGWS 1KYQA 1RBYA 5HTKA 2MCFA 3V1MA 4XX0B 1UOPA 4L5AA 4EYQA 3L01A 1QNLA 1ZA2A 4QUHA 4HEA1 2RH4A 4P5EA 3ZDYB 5HF9A 1LH0A 4TKLA 3KYDB 4LHYA 4P84A 3WWPA 1BHQ1 2CLSA 4FFVA 3EXHC 2JJYA 4AJJA 4F11A 2C3YA 4XM0A 3H3JA 2FXVA 4MUAA 4QIHA 2BEVB 2VT2A 5M3BA 2R68A 5K3FB 1HSOA 1Q7GA 3BXXA 4G5FA 4HL6A 1QWSA 4CPDA 5AVVA 1EXVA 5CVTA 1JJIA 1C7EA 2YIDA 2XRZA 3WO1A 1U7TA 1OH6A 1ZNZA 1UBNA 2PUTA 3GFRA 1L4KA 4G4GA 3SF0A 4HS9A 1ICEA 1MJHA 2P3LA 3K8YA 4BLWA 4AURA 2YOFA 3AEKA 1ICIA 2YBEA 3OJWA 1WXEA 2BBTA 5K3AA 4A16A 3JVVA 2XQVA 3DVAA 3T8YA 5FPHA 4IGEA 4LF5B 2NACA 5DNUA 3UV6A 1IJBA 4OXRA 8ABPA 5JVDA 4LJLA 3DE2X 4ZQCB 4WI1A 1JHYA 2JLBA 2B20A 1YMVA 3ITEA 4AQYB 1H42A 5BSEA 4S12A 3FWZA 3NKFA 2C88A 1Q6YA 3R24A 3Q8WA 1FLDA 3KOUA 1V9SA 3RS9A 2X7XA 4E5NA 4FHGA 5GADl 3W3AA 1Q0HA 1XC7A 3MWKA 5JBQA 1Q7CA 4YP7A 3F71A 2PRSA 4KLCA 1PS9A 3F9CA 1XHFA 5IDQA 4YY3B 4Z4EA 3UK6A 1FYEA 4CLOA 2EOAA 3THYB 1XTTA 1HT2E 1V0JA 1W36D 3BZBA 2RAVA 3PL1A 5FDFA 3R23A 4ETNA 4HGNA 3IHLA 5DYWA 3C4JA 4KWHA 3CUTA 1SO8A 2C5GA 2G40A 4QOFA 1FSZA 3PFKA 1O0BA 4HB3A 4JNKA 1WCYA 3BCHA 3F4TA 1S4QA 3I0NA 4KAXA 2P5UA 3IEXA 8AT1A 3KSAC 1WOMA 3UKOA 4LYDA 2PT5A 2H7VA 3EA4A 3W9SA 1Q91A 4HB0A 5L4NA 5AH0A 1M2VA 3K4HA 4J49A 4IV8A 1BSVA 1C30B 4EENA 2GHRA 1XEFA 1GPWB 3IPXA 1OZGA 3L6EA 2FR8C 1F2TB 2Y67A 3A4IA 2WKSA 5CGZA 5E6UB 4J0FA 5TARA 4HDOB 3UPDA 3V4PB 4E33A 2EV9A 3I0MA 1RKQA 1UKYA 3KALA 1U15A 4DAEA 4W9RA 4AF6A 1BRMA 1U8UA 4UFNA 4ZEOA 4OKNA 3EGVA 3MB8A 3QUSA 4G67A 4MR8B 3JWHA 1U1EA 3QPUA 5EKXA 5ADHA 3WDLA 3EOAI 5IS2A 2F3RA 3VNBA 3FMVA 2QZJA 4EMUA 5IT9A 4CEJA 2J5KA 1JIKA 3V48A 4BC1A 2GVDC 4BPBA 2XUHA 3FBWA 4IS3A 3QVLA 4EVRA 1SD5A 3MJRA 3KJZA 4AZSA 1D0VA 5K2OA 5K3BA 2OHOA 4C4XA 3AFGA 1S8FA 1GPMA 2AOUA 2OPHA 4JKOA 2V7XA 3UAXA 1AX9A 2JFOA 1ABBA 3FKSA 3R6DA 3PRHA 1RE5A 2AXEA 2HIAA 4H7DA 4JY7A 4TSKA 4W1PA 4IHAA 2VP4A 5LFAA 3VTKA 4M53A 2H54A 2IS6A 3WK5A 1ISRA 3RT1A 4JU8A 2B1IA 4U2FA 1RLMA 3AW8A 3JR7A 1G16A 1PZMA 4BX8A 3DYVA 2W8BA 2X3UA 4HPWA 1Z3IX 4IINA 1LUAA 3KQPA 5ARCA 4D46A 1EZ1A 2I99A 2B99A 1LQ2A 3W9BA 1YD7A 2EGHA 4K05A 4P58A 4PWZA 1UZMA 2JDIA 4X6XA 4CV3A 1QVRA 2JBWA 2COKA 4U1RA 1PR1A 2V0NA 3HLTA 4P3PA 1V5IA 5JVDF 1YZQA 2FP4A 5K8LA 3R3ZA 4PANA 4KYTA 4B45A 4Z7JA 4QDUA 1FUUA 1Z8DA 2I6SA 4ZZ0A 3U5TA 2CBGA 3GMDA 1XF9A 1PDWA 1YDMA 3WNCA 5C3MA 4NECA 1N2SA 1QZUA 5JMOA 5NLLA 5JZMA 5LP1A 1NFQA 1Z7BA 3AG6A 3U9SA 5B64A 1N25A 1L5VA 2D0PB 1I0IA 2D4AA 4N4AA 4RXTA 4RZSA 5TEWA 5BURA 5LOVA 5C46F 4NL4H 4XLTA 4X63A 4C1BA 1KKMA 3JVIA 1HK7A 4MR9B 4WE3A 1QOPB 1BCRA 1LPBB 1KORA 4IDQA 5H80A 2XMZA 5HUHA 4WZZA 3V00A 4QXQA 1GGNA 2A5DA 3QVWA 3A3OA 4MVJD 5KQGA 2ZR9A 3LBHA 1FVHA 1B8OA 1JR4A 1JQDA 3UK2A 3C8HA 3CF0A 4II2A 2UVDA 2ECPA 1H4QA 1L4UA 1DI0A 4RIEA 2QZ9A 2IDZA 3CUVA 5DEOA 2BSQA 3AL3A 4H7EA 4U39A 2H1RA 2RHGB 3R6LA 3GJSA 2OAP1 2OLKA 3HFRA 3G7SA 3JRNA 1IHUA 1O89A 3L3BA 4W4TA 2XE8A 5KYWA 4BGIA 3SR4A 3AUUA 3M9XA 3R41A 4RHEA 3ZY3A 1TJUA 3O4VA 4DIMA 2AD1A 3HV2A 1OZ0A 3D4IA 4KX3A 1Z17A 4RZUA 4ZVNA 3HS3A 4FE7A 1Z22A 2W00A 2Q41A 4XW2A 1P91A 4DPMA 4DQKA 3LYHA 1RMTA 3OM8A 1A8SA 4C4YA 4NFLA 2YW9A 5I7EA 3DZJA 1ZGHA 1CBUA 2GLTA 1YKGA 1K6MA 2ZBGA 2FR1A 3RVNA 2Q49A 3PD0A 4I1UA 1AXGA 3JQ8A 3EZ7A 3JYOA 4ZAXA 4F4IA 3AR3A 5AW3A 4ZI5A 1N2GA 1FUPA 2OYSA 1V1RA 2ECKA 4RETA 1ML4A 4J0DA 1EDDA 2AK3A 3KHKA 4HGRA 4D4KA 3QEAZ 4U6SA 5DOZA 4MQEA 3QENA 4A1FA 2KMLA 4J2OA 3DSRA 2NN3C 4BIMA 4H3KB 4C6RA 2VF5X 4ZODA 4MCAA 2OOSA 2Y9MB 2JEZA 4L3OA 4X5OA 2GBIA 3V1KA 4LCJA 4XM2A 3RRYA 3T7RA 4J3FA 2H1CA 2D54A 4EHKA 1H2AS 3TX2A 5DBHX 1TIKA 1XKTA 2ZYRA 5IVHA 4I5EA 3PLAE 3K16A 1Y9JA 5I9IA 5C32A 9MHTA 3ZY4A 1XXHE 1TJ7A 3G23A 4MROA 3DMTA 3EIXA 3VU8A 1EVJA 4R1NA 5DH9A 4EHJA 4OHMA 5JNLA 3N74A 4IX1A 1Q95A 2JANA 5BR1A 5IDWA 2JCYA 4KQWA 4NBRA 4L1KA 1VKRA 3JATB 1XJQA 3QNWA 4OHBA 3H0KA 1X1DA 2HCRA 5IXJA 3TAHA 1H4TA 1KAHA 3NM6B 4J94A 4MP8A 4N7MA 1G1AA 1G7RA 3VSCA 5KSOA 1XD2B 4GYWA 1UZUA 2QRHA 1XA4A 3NMUF 5LMUB 1R6AA 4CF5A 4QU9A 4DY6A 2W42A 4KZPA 4E4RA 4PFSA 4P3KA 4RA6A 5E4FA 3GEMA 4DMCA 4PLGA 5ITZA 5LKAA 3LPDA 5ARDA 1E5XA 1C8LA 5LOVF 4E31A 1CNFA 2CVOA 5BT8A 4BTEA 4LOHA 4EX6A 1T8YA 2PQ2A 4CCAA 4IIJB 4XD7A 5I6DA 1U8TA 1J49A 2VAMA 1SXGA 4DIDA 2OK8A 4FHZA 3F0TA 1NIPA 5LQSA 3RVBA 1TL7C 3BMOA 4HYQA 3TL3A 3PTLA 3BMCB 4CCWA 3QVUA 3ZVNA 3RYIA 4HMPA 4MS3A 5EN4A 5IUNC 5DHPA 1H6BA 2IIBA 3LY7A 3IHTA 5EJ9A 4P5PA 3P9NA 4P1ZA 2FHPA 3D4PA 4KIFA 1PFQA 4QSHA 1NVGA 3HFGA 3HUUA 2XE6A 2H1SA 2PFSA 4QBHA 4R81A 3NPMA 4TYMA 4QQKA 3CXUA 4OQQA 2WYOA 2C9MA 1OASA 4C01A 4OQ4A 1U2DA 4RTNA 4W5RA 3KQNA 1R4AA 5TF0A 2DBVO 2G77B 3GCZA 2QGFA 2Y76A 4C06A 1X14A 2KSQA 4NZMA 1M1UA 1ZHHA 3A4LA 4HPJB 4QUGA 1NVVQ 5DTIA 4F92B 3INGA 1MN6A 1X1TA 2VJAA 4NCIA 4O4HB 2V4ZA 4EZIA 9ABPA 4RY9A 4Z9BA 1BOFA 2QT0A 3O8NA 3RC1A 3GDHA 1HYHA 4A0RA 1R0KA 1NLZA 3ADDA 4QSMA 2VJYA 4J2TA 1E5VA 2C59A 1Z0AA 2G1PA 1G7CA 4JJ7A 3C43A 2FUSA 1MV5A 1ST2A 2X0NA 4FINA 4I9UA 4JSTA 4L5JA 4LRYA 5DXAA 3T7TA 1GAJA 5K0EA 2JIZA 1D2CA 3P2OA 1Z34A 4FXOA 3WWOA 2IYUA 1BW9B 1CFZA 4P31A 2PX4A 5E6SB 5IAAA 4PAOA 3AQ4A 3A3NA 3M81A 3CUWA 4L75A 4EKDA 4A15A 3PJFA 1NBIA 821PA 4QYWA 3MWFA 1TJVA 4K9RA 1IE3A 3E9CA 1OAOC 3I64A 2JIMA 4JT9A 3DBRA 1GRVA 2WT4A 1Z0UA 4RMJA 3RK0A 2IP1A 5M34A 1S2GA 1L4NA 3NT5A 1NN0A 4DR6B 1WMDA 1JQ3A 2H1WA 3I23A 1GT6A 1P0CA 1LK5A 1KAMA 2F43B 1D4ZA 3RRZA 1OBCA 5KYVA 1JPVA 1MRNA 3B1YA 3FDJA 3KYCB 2Z08A 2JHGA 1A4IA 3WWDA 1K7EB 1EDBA 1EVZA 4IH9A 4DVGA 3TIGA 3OEYA 4QBKA 1K4MA 1L5FA 1LPMA 2GDZA 2OZLA 2FSIA 2I8AA 2UYYA 5K03A 3QPCA 2FMTA 4HXFB 3O8LA 2QX8A 4LNUB 1ARZA 1AUXA 1Z82A 2XCOA 2ZK7A 1T13A 3HBAA 4IDPA 4YHHB 5G1OA 5GIOE 4G1EB 1P60A 1GPDG 4OAQA 1XF1A 1U7HA 3N5CA 1KOLA 3UPTA 2EJVA 4WK0B 1OU0A 3QXXA 3K6KA 1CDDA 4LOLA 4PIPA 2J85A 3WZLA 5C2JB 5JCXA 1CVLA 1WX1A 3X44A 3SC6A 4ACBA 5IAGA 4ESHA 1MQ9A 4HH3C 4UMFA 5ELXA 3PPIA 4L0QA 5G3ZA 4CR6A 4AUNA 1M1ZA 4HQLA 4RE5A 3H5RA 4HQ0A 4G6ZA 3O8QB 1SZJG 5EOVA 1I10A 4IWNA 1X1EA 2KW5A 3PI7A 4IIGA 2NZYA 4OP3A 3WB1A 3WGQA 5IYZA 2JJ2A 5E0OA 5JSQA 1O95A 3D0QA 1KEEB 3DT8A 3WFZA 4ZQFA 2ZIZA 3OIVA 3MT7A 2Z9BA 1TZCA 2DPXA 3BF7A 4NH0A 1J42A 1PL6A 1XXLA 2R1VA 5K0SA 3WFIA 4WOBA 1EFHA 4WFQA 4WJKB 4MYUA 1T6BY 3UT0A 2J6HA 3WWCA 2VTKA 2EBHX 2DCUA 1X6VA 1P9OA 2J46A 2HIGA 3D81A 1L3IA 4IVRA 3KQWA 4QDOA 3CKYA 3EG9B 3H16A 4J03A 4MYSA 4G1FA 1C0EA 2W48A 3RAFC 2QTZA 1FURA 4DR4B 3QUQA 2B1GA 4KPYA 5JZSA 1SWWA 5KU1A 2PBFA 4ZN6A 5I9MA 3LUAA 4WT7A 2WTNA 1YCDA 1QZXA 3AEXA 5EP2A 2EW2A 1EHYA 1FW8A 5K0JA 1NBME 2WQ7A 3F73A 1WZNA 4ZQGA 1S7CA 1TLFA 1NKVA 1NE2A 4B6GA 3OZCA 5KNLA 2IYOA 1TF2A 1RKBA 4LNHA 1CD5A 1MJGA 4CMBA 3VU9B 3IUSA 3L06A 4W7SA 2AFHB 4BLOA 4MNTA 1B2RA 1SBQA 2LV8A 3BMQB 2GHQA 4KQ9A 1QRTA 4CG0A 1NQUA 4HVCA 4H15A 5DNCA 5ERYA 3ZI0A 2ZIAA 1IXSB 5B58T 3RKSA 1ZBQA 3F7NA 4LECA 4AAYA 5D5HA 5KQSA 2IDJA 4MGZR 3MOSA 5CDYA 4A3SA 2ZJ3A 1ZRMA 1XA3A 1B0ZA 1N5RA 3KXKA 2IGTA 4EHAA 2HEIA 2PMFA 1ORVA 1TQ4A 1WVGA 2YMPA 3KUKA 1XE3A 3OEWA 4LSMA 4BN4A 2WK1A 1RZ3A 1SXQA 1PBNA 1AA9A 3QLEA 2V45A 1F51E 1XWWA 3IEPA 5AW7A 5D01A 2CUNA 2C5AA 1FEZA 3E70C 1N2IA 1JYSA 1VXRA 2RKOA 3BWCA 2BOVA 1VHTA 1DWUA 2RHDA 4HDNA 4NZZA 1OX4A 2HLDA 3FYHA 3B53X 2JJMA 1H22A 1QK3A 4HGOA 4Y6SA 5JS8A 4UTRA 4L72A 3VR5H 1IHPA 1E1YA 4A0HA 4OLFA 1QAMA 3WLEA 5JEEA 4DCGA 2BW0A 1V96A 3JD1A 4D99A 1S02A 4DDUA 2PVCA 3PJGA 4YQZA 4INAA 3SJCA 2XTNA 5H4GA 5P8WA 2B0JA 4R8RA 2ID4A 1JA9A 3ECSA 5K01A 2ZU0C 2IXFA 4CM8B 3Q7PA 1THGA 2BGTA 2AN1A 4FGWA 2QTWB 2IEBA 3DHEA 5LB4A 1GRCA 1EFCA 1N3YA 2G82A 3BK1A 4QAJA 1NV8A 3SYMA 2ZYHA 4RY0A 4CFYA 3R7SA 3AR5A 3AUXA 3LBFA 1XRNA 2AF4C 3BJIC 3EOZA 4AZ0A 2V55B 5IYZF 3UJAA 3K6RA 3CURA 5ABPA 4J0EA 5DNAA 1PJBA 1GKKA 2PFMA 1Y7PA 1CULC 4QXAA 5K5EA 4DQVA 4B75A 5I5EA 5ALYA 3DWEX 2ZCUA 2WYVA 1E9RA 3X1DA 1WZEA 5HX7A 3ZWYA 4WHMA 3DS8A 1YRAA 2ZJ7A 3ZQUA 1MTOA 1O6ZA 1N3BA 2WUVA 1I6LA 4UOZA 1JB9A 2IL1A 4U0KA 3V4LA 1LI4A 2LCQA 1EB8A 2QRUA 3L40A 4BLRA 3R9WA 2X6QA 4OQNA 3NTXA 4KXFB 5KTPA 4EPYA 3BDVA 3I09A 4NDAA 3O74A 3T5AA 4RPIA 1U28A 3U4AA 1V35A 1R0SA 2ZSBA 4QXRA 3UC5A 1V8OA 3B6IA 3KXDA 4C1NA 1SBHA 4LDJA 1L1EA 1Z2NX 1GFWA 2OV8A 1PD1A 2ZTMA 3K05A 4MKFA 3KAPA 2I67A 4OQXA 3MJEA 2C4NA 4GPEA 3G2IA 3VSEA 4Z9YA 2Q9UA 4LF8B 1O2DA 2FJPA 4FNOA 1N0WA 3DT6A 3NDJA 4R9SA 1QQAA 3NNNA 2VP0A 3MJDA 5CTAA 3MYYA 4OPMA 3Q40A 2GD0A 5IEJA 5KTMA 1AHIA 4HGZA 1VE5A 4HXEB 3QKWA 4FIDA 1CZUA 1U0OC 5KHAA 4RKRA 1W6RA 2YDXA 3P9CA 4Q39A 1R16A 5HF6A 4V2IA 5GV7A 5IMBA 4UAJA 3W06A 5AJUA 5H3HA 1JMKC 4IUBS 5ITVA 1M9NA 4UPVA 1F17A 1VL6A 5CVCA 3T9DA 5K3DA 5F2EA 4HFRA 4IXMA 5FUMA 1MO2A 3K8ZA 2TMDA 1RIFA 1A71A 5JUWA 3K71B 3QE9Y 1CRPA 1Q7BA 4UUMA 3EC7A 1OH5A 2BI8A 1GLVA 3WQBA 3I01A 1SRQA 3N76A 1PNQA 4E11A 3ZG6A 2YASA 1NP6A 2BLNA 3PV0A 4U2CA 5L40A 3OQIA 4OV6B 4JB0A 2BZSA 1MT3A 1VPVA 5DPMA 2DWCA 2XGJA 3OE4A 4FR2A 1SK9A 2DCMA 2H6EA 2X86A 1T0BA 4TLMB 3EASA 4PPFA 2XUAA 1ZMTA 1YT5A 2ACVA 3E0XA 3R5KA 4Z0HO 5SICE 1EJBA 3SM3A 3CZQA 4BGEA 2LRHA 2RGEA 2CHFA 3WR5A 3A3KA 1Z0SA 2GNOA 3BRWA 1QC5B 1RWBA 3VYTB 4WNAA 5B57C 1JJ7A 5FLXA 3PSAA 4DV4B 3KUDA 5F7XA 4S0ZA 2BKUA 5CNIA 4OCZA 5IDVA 2OCKA 5MHTA 2VRNA 3C3XA 3MWJA 4JS0A 3S28A 4JFRA 1HI9A 4GI3A 3RSOA 2O8EA 1B42A 1G55A 2FPPB 3GFGA 1JEJA 4BBAA 1ECGA 2E3JA 4UNSA 1MGOA 3B8EA 1N8NA 3EBOA 4K3UA 2BMJA 5LPNA 1JJFA 3D2LA 1R0ZA 2XEXA 3QJ5A 1JYFA 2BBWA 2FGKA 3I5UA 1UZNA 4FU0A 1PG0A 8LDHA 1BE0A 4UAVA 5K6AC 3EZNA 4KV7A 1QJCA 3SJBA 4X7BA 1LNQA 4BRUA 1K97A 3JAWA 3MS4A 5IC6A 1I3LA 2GJ4A 2NG1A 2QX6A 2VT6A 3HUFA 4O8CA 4ZVQA 2VCYA 5JSYA 1XNJA 3VOSA 2GPTA 2PNFA 5FV7A 1ZL2A 1JE0A 5JCOA 1NLFA 1SG0A 1X39A 1DAMA 4KZKA 5C8YA 3BB4A 2LCIA 5JDIA 3AYZB 4P36A 3ROXA 1G7SA 2BFNA 4JX8A 2IYZA 3HRHA 1RCFA 4XVQA 5KNCD 5IXSA 3P4UA 4B6SA 1G8FA 2IHVA 3IV6A 3N8NA 4GT1A 4G84A 5CFPA 1MTZA 4MGEA 3HWWA 3OCZA 3U4MA 1UOQA 1OLXB 1FQKA 1Q0PA 1O0SA 1ZM2A 3FJ1A 4JEIA 4OI2A 1TNDA 3SFZA 1GNQA 5AHKA 3N2YA 2FZWA 3P9RA 2DQKA 3H8VA 4P4NA 2ZRHA 2OCGA 2A0XA 3HCCA 4GPIB 2HDWA 2M1XA 2ZRFA 1JQAA 3GJ0A 1U0BB 4PGFA 2JZNA 2QTGA 2W6JA 3RVLA 2W2MA 3NANA 5ARBA 3GPBA 3OA0A 1I9CA 5JD4A 3V1TC 5EXEA 1TFRA 4UXIA 1TGYA 1C9NA 2BTEA 1GQQA 1NUPA 2QN9A 2YHSA 4LK3A 4GR9A 5GM1A 1BMFD 1T0IA 1W94A 4NI5A 3U3DA 4OHOA 4BP1A 5JY1A 4REQA 4ZZIA 4BNVA 4MKRA 2V7UA 3PYMA 5A9SA 2CMHA 5F5NA 3WYBA 5J5CA 4X64B 2C00A 3MZ0A 3A2KA 1CEEA 2G7MC 3WOVA 5AK0A 5FL3A 3TW0A 5HYVA 4R2KA 3LSYA 3T95A 1V5WA 3WQHA 2R66A 1ECJA 4EG3A 2W6PA 1AGYA 4HXGA 2VWPA 3I53A 1IHOA 2C95A 3CVJA 4L5YA 2KYRA 3U9TA 2Q99A 2GN0A 5K8UA 2CK3A 1ENPA 1DXOA 1NPYA 2D28C 1VRCA 5BR4A 2QW1A 1WMBA 3M82A 5I48A 3KE8A 1CF2O 3ABIA 4XQEA 1EVYA 2EZTA 3AT1A 4IJQA 4BV8A 3GJ5A 5A62A 3I9LA 3OUZA 3FMIA 3KLOA 1YAJA 2JFQA 2GF0A 3EUFA 4MQFB 5FUYA 1PGQA 1O94D 4U7HA 4JV5B 1CR1A 3CRMA 4HX2A 4JI2B 1J8QA 1SVSA 4MUGA 3ZZUA 4HTAA 2RDMA 4DZRA 2WNHA 5EINA 2NSYA 3L46A 1TXGA 3Q88A 2JAPA 1D0SA 4DLAA 3K1JA 4LCBA 4QECA 1U9IA 4NLLA 5AHOA 3ZQJA 4A03A 4MYTA 2AOUB 4D4IA 3N2KB 5HQ3A 1T9BA 3AC0A 5J4HA 4FNAA 3QSGA 2QORA 3EODA 4DR1B 1Q1NA 4Q9DA 5EJ2A 2P9TA 3OA2A 4EW6A 1Z5WA 1QONA 3E48A 1V7PC 2YJ3A 4HEA6 3U3JA 4TWAA 4BN0A 4ETIA 2GUGA 1W7AA 1NMEA 3HI6A 2VYCA 3IP5A 3N07A 5BP7A 1QGUB 3ICWA 2XZPA 3F8TA 4OHWA 3BK2A 5CJ2A 3E9YA 1LLUA 4CN8A 5KC9A 2VDNB 2WSBA 5ALZA 4OHCA 2D8MA 3PPWA 1C0PA 1FDIA 1S9DA 4AMYA 1N7HA 5TJHA 4OLJA 3VSAA 4P7KA 5C8YF 3O82A 4B4OA 1BHSA 2Z4RA 2B30A 3GH1A 4PW0A 1UMDB 5DGDA 5E7IA 1O54A 1RM0A 3OJFA 4UTOA 3BDAA 2ADMA 1Z83A 3BC1A 4IXTA 5G4KA 2WKPA 1WF6A 3ETDA 3N8IA 5CNMA 4QU5A 3WHLA 2JLRA 2I34A 2JLCA 4A5OA 1C4KA 3FAZA 3PHLA 5I3ZA 3N5KA 2V3VA 4IF4A 5H7XA 2Z1NA 4IQFA 4JVOA 3WNVA 4LZLA 4C9BA 3A9SA 1GGKA 1U7DA 2ZULA 3PVCA 4L0CA 1B43A 4G0VA 4L16A 4N5NA 4XDHA 2GXUA 5LOVB 5ECDA 3NEYA 3WGIA 4KWEA 3DLTA 4C4ZA 1A0OA 2DECA 4PZPA 2JFXA 5FNVB 2HA4A 4BUZA 3UF0A 3EIQA 5HJ7A 4J3NA 1ZI9A 1NF3A 4RDHA 1FTSA 3KCNA 5A0FA 1JF8A 3A1VA 3FBGA 5F91A 1V8BA 1Y9DA 4ZXFA 3GD7A 5A5FA 1SOWA 2A5YB 1KO8A 2C7RA 2P9FA 2ZSDA 1KBZA 5CT6A 3QLVC 5T4HA 4R1SA 3Q2KA 4LXIA 4FDTA 3T7AA 3TSAA 3W5UA 3WICA 4R41A 4EG6A 1HRDA 1NSFA 2P90A 5EQDA 2NU8A 2P77A 3PEFA 1NC3A 1T5DX 2HV8A 2X0RA 3F1KA 3ORRA 2I8LA 3E2MA 2PT7A 1THTA 2X9LA 3MILA 3P9PA 1ORTA 4I1SA 5DLYA 5EZ5A 4FNGA 1RAGA 3AUAA 1WF3A 1HEYA 4HGQA 5CLJA 1DJOA 3OQOA 1ISPA 1ILEA 3DVQX 1G41A 1KYZA 1LC0A 1YB7A 2YC4C 1CP3A 3EUEA 1UF9A 1X7XB 3PL5A 4G26A 5EIHA 1EDEA 1THZA 2WMNB 5J5VA 5EZYA 3IQDB 3KLBA 4OGLA 2ZB4A 1HTWA 2V97A 4KR3A 1AV7A 5IH7A 1E77A 1HQYE 2C4HA 3LY5A 3DFIA 1FW6A 5EWJB 2VFAA 5A4JA 1TK9A 1YV9A 2GQ0A 5MF6A 2VZ0A 1JR3A 1T1GA 3GW8A 1UDRA 1KIAA 1V4NA 4JLSA 1UKCA 4PAGA 4WOKA 1N7GA 3I2YX 4O0MA 4Y2YA 2GZMA 2PUJA 1FXSA 3JQ8B 4RDCA 2QTBA 2XPCA 4XLZA 3T99A 2DP4E 1KSGA 4BMSA 1LK7A 1PK7A 1V1RB 4L4YA 3I1JA 2MT9A 1NW6A 3PKIA 4HDKA 1D04A 2VSOA 5A6SB 1ISGA 3KCQA 2QSJA 1WPQA 3T3NA 1DBRA 1FZTA 2CYCA 3CX8A 1JWLA 3HKBA 3FPFA 3AI7A 4XAQA 2E82A 3DEAA 1XRMA 4FGKA 3WIDA 4D97A 3UJNA 5AVOA 3I2FA 3RRBA 2HJWA 3FUUA 3C3PA 3COVA 3GPCA 1P29A 2C5LA 5FBVB 2W22A 4UUBA 2IYQA 5C3UA 3PFWO 5F21A 3N8KA 2Y66A 3IIMA 4Q6WA 2PX8A 2RHOA 4Q1VA 3VC1A 1P4SA 2AF3C 4PY2A 4AECA 4P4TA 1L5HA 4DADA 1O5IA 2JIDA 3LWZA 5CK5A 3AVOA 4CQNA 1RFGE 3GX1A 5JCZA 3D9QX 2VHZA 3X2SA 5H3LA 2Q3BA 1PTKA 1U04A 2QYHA 1TCCA 4TTSA 3ZWBA 4DQUA 4C14A 3AB8A 4LXXA 4DLWA 3BULA 3W3AH 2C4KA 1B6SA 3BEOA 1SBCA 3L4BA 4QDKA 1U0NA 1QX4A 5K3SA 4ENVA 3LFTA 4MJXA 1RXWA 2TSYB 1DOAA 3QHQA 1D5WA 2ZIXA 4WKGA 1ZKDA 5ITZB 4YJ2A 3IPLA 1ADBA 1ODTC 3F5QA 2FWMX 1GWNA 3WL8A 1II9A 1FRZA 3U3KA 2HF7A 4LI3X 4AJ4A 2HJRA 3G6WA 5ALWA 5GONB 2EG5A 1XRLA 4P4UA 1F7VA 3FTEA 4Y2XA 3UBTA 4L6AA 1J5XA 1NMQA 3ZDBA 1P9NA 4TKVB 1JRLA 4PM4A 1QIDA 2QG6A 2NZVG 2WG2A 1UXKA 4UHBA 5JZOA 3LOUA 4MV7A 1OXMA 2JH9A 3K20A 1Z9BA 4EJFA 4N5LA 3JVDA 1GJRA 1NYTA 3OJCA 3LQKA 3EC1A 2F6RA 2JHFA 4MQMA 1BYIA 2DPHA 2C3OA 3DCNA 4NFHA 5F33A 2P30A 3UO8B 1P2UA 3IOMA 1KJIA 2PKCA 1I4LD 4UDYX 5AM5A 1CTQA 4QGSA 1XZ8A 5EUQB 4C6HA 1NMYA 5EZYF 2YXBA 2JVIA 1ZS9A 4AN0A 1QF9A 2RAUA 3DAHA 1L5NA 2XMCA 2J0EA 4C0WA 1H6AA 3FTQA 3P0FA 5ADUS 1G9XA 1VCNA 2BFCB 1SKYE 1QS0B 1P1JA 2ZPAA 5JSUA 5KO2A 1Y48E 4BPRA 1FNDA 2ZCVA 1G21A 2G63A 2FZLA 2M2IA 3EGEA 2BE7A 1A2QA 2KX7A 1IAQA 2C4WA 3K6JA 3G89A 4LC9A 3ZE2B 2GHIA 2UZIR 1EUDB 2QG9A 4JCCA 4Q21A 1BDMA 1BMTA 2CMDA 4FKZA 5BOSB 1NKSA 2HTEA 1NG9A 1AMUA 4NZYA 3H5IA 4KX5A 4RL4A 3OAAD 4ALNA 1EX1A 2QVBA 4GWLA 2JAXA 2JLYA 16PKA 2V98A 1NDUA 1HC7A 2IV3A 1HQDA 1R4MA 1YZKA 2JFGA 2ZAGA 3EBLA 4J0IA 4XCQA 1UWKA 1I2CA 1NVEA 1YH3A 1IQRA 1M1YA 1Q21A 3A1TA 3ROFA 3KTAB 3DBRB 2Y8EA 3VDRA 1RKUA 1VP3A 3BS4A 3LUGA 1H6CA 3B2NA 3PTAA 1HH4A 5HS4A 2J48A 1OI7A 1IUOA 4MGHA 5EUMA 4BXOB 1KDTA 1U2RA 3F3MA 4V3CA 4ZD6A 1G3MA 4OBEA 5K0FA 3C0KA 1SZPA 4JZYA 4DVJA 3EMDA 3DDNA 3TAUA 3SOZA 4HX5A 4BP3A 5HDQA 1TM5E 3DMGA 1UC8A 2OZLB 1V3QE 1WHSA 3NTLA 2HIHA 3LOQA 1CJMA 1N6IA 1WW3A 4CU2A 4FB5A 3UCEA 1FTGA 1HE5A 1KHHA 2H1VA 4WN9A 4PAQA 4L8FA 5C7YA 2IS4A 2GCOA 3NJ8A 1SN7A 4A6PA 5B3AA 1WMEA 2QTHA 3VNUA 1J0BA 1T4BA 2P67A 5C31A 2PX6A 3H84A 2VTVA 2A30A 4C7MA 4EYGA 1BJKA 2IE0A 3O3OB 3RSSA 4BYMA 1B23P 4PYKA 2Z4TA 4QAQA 2GN2A 1EFUA 1C9YA 5L7TA 3AU8A 1ITZA 2V8OA 4LKRA 1HY0A 2QL7A 3SJAA 4YJ2F 5TS3A 2VL7A 1QGAA 4FBLA 3TNYA 2PVSA 5TMPA 1UEJA 1OBFO 3BPSA 3TPFA 1T9GS 3L0DA 4MW1A 3NAGA 4EELA 5LMZA 4AKSA 3LS2A 4ZDJA 1C0IA 2HLHA 3CRW1 4M46A 4HLDA 1X15A 4ITUA 5L3SA 3UWOA 1OLSA 1TT5B 2XE4A 3KWMA 3R3HA 1G5FA 3KVOA 4J8PA 3PNPA 1O97D 1IPEA 2PZBA 3F4RA 1ZLXA 4N40A 5IBRA 4CIVA 2ZWAA 5CYGA 5JW6A 3S1SA 3ABZA 1PUIA 1TLTA 4GBGA 2GVNA 4GMDA 2R1VB 3ELYA 4YC7A 4CU5A 5CT5A 4HNUA 4R3UC 2XAUA 5B36A 4HWRA 4C89A 3R7NA 4B0PA 2IODA 2PR2A 4G0NA 1SB8A 4N82A 1XEXB 3RVOA 4F6RA 4XJSA 5CB4B 1DNPA 3LPMA 2FJUA 1UC5B 4G5RA 4TRNA 4FDUA 1B1AA 1N1EA 1D6JA 4XYGA 3SVLA 2Q0HA 4JR0A 3SZMA 4PQEA 4D2IA 1T2NA 1A8HA 1LBHA 3II6X 1ZK1A 2DG2A 3K0FA 4Q16A 3ZDRA 3PXCX 3R20A 5HUJA 2YIVX 1IN1A 5EY5B 1PNOA 1HYEA 2VAVA 2HB6A 4KK4A 1XYVA 2AFRA 3D4BA 3HUEA 1ZJ4A 1DKUA 1TD9A 1Z8HA 1W0KD 3P9IA 1XEWX 1LEHA 1Y3HA 3DFZA 4K40A 1MOZA 3F4LA 5TF4A 5HZKA 4IZ6A 3CV3A 3E9ZA 1XMOB 1U80A 3OZAA 2GLXA 4O2LA 4DSZA 1TO6A 3UWDA 5F98A 5LLSA 2ZI9A 2ZXUA 2ZT5A 2ZE5A 3I5AA 5ITSA 5CXQA 4BFTA 4R54A 2IE8A 3VAAA 1GZ4A 3L0CA 1UDBA 1M6VA 3VTAA 4D0NA 3HFJA 4AJPA 3BGOS 3L4EA 2UUBB 5EZ6B 1JKJA 4LN1A 5F9MA 3U4DA 1XFDA 3TZHA 1HV8A 5A5VA 2F62A 1R8YA 2FOXA 1K88A 5DGXA 3IPYA 4DCUA 1L4LA 2EIHA 3AHCA 1SUPA 3V6LA 4KL8S 1ECFA 4BEVA 1M6WA 1C14A 3G85A 1DBSA 3OCVA 4CWAA 3MT9A 2O07A 3MLEA 5FPSA 4MWEA 1MC1A 1O94C 2W6ZA 3M4NA 3HCEA 2J7PD 3OZEA 4LX8A 2XYRA 4ZOEA 4FMCB 2QTRA 4KAFA 1BQ3A 5JI3E 1R6UA 1CIJA 421PA 3OSUA 5GGXA 3NP7A 4PG7A 2FW1A 2VRCD 2IW1A 1XZBA 4WY2A 3R5TA 4BNXA 1PFWA 2TS1A 1ZM4A 2UVPA 4NQZA 3CW9A 1FDOA 4JQCA 1DXQA 2ICAA 3OP1A 5ULLA 1MKYA 1W59A 2W2KB 3GA7A 3W5HA 1HURA 4AUMA 3UHFA 1PJRA 1CUXA 2AOTB 2GA9A 1YB2A 3R6GA 1T8WA 2ZR8A 3BQ9A 1QB8A 1J1ZA 3GN2A 3OKAA 5HKLA 3W8DA 3BMXA 3O1HB 4IQGA 1ISSA 1DT3A 2AGVA 5JASA 5KWJA 5TB5A 1MNAA 5TJ9A 4PC2A 3FCOA 1JUDA 3RNOA 3LUDA 2BONA 3CKLA 3NBMA 4NFSA 4Y9SA 5AKJA 1TU0A 2IUFA 3A4VA 2XUIA 2XNJA 4GO1A 4ZK2A 3D31A 2VDLB 3V32A 2Z1DA 1U2ZA 1EK2A 1I0ZA 3MWLA 3QPBA 3OURA 4FONA 4BWGA 2FUNB 3D8HA 3Q0IA 2CHUA 1MF7A 2E1PA 3Q15C 1YVDA 3KL4A 1L5LA 3R3JA 3BERA 4IMPA 4MVJE 2NVBA 4BNWA 5A4KA 3QH4A 3KNZA 3PUHA 3RJ5A 3QK7A 3O26A 3ZXIA 5JNVA 4UUNA 4R8MA 1HT1E 2PR7A 3EMKA 3S5JA 1V3VA 4J7AA 5HKKD 4INOA 1F4PA 3NUZA 5DCLA 3W4JA 4P0QB 3HTXA 2H0QA 2IYNA 1QG6A 4BBPA 1E2HA 4RMNA 4ZKDA 1R0BA 2R8BA 5AUNB 3G2HA 4BE4A 5FORA 5A1JA 1KARA 2ZUDA 4KXVA 1QRUA 3DEYX 1K4KA 1OXVA 1QKIA 1UBGA 1BS2A 1YZNA 4ERXA 3QLUC 2PLAA 3LKBA 1XWOA 3HL0A 1TD1A 4FXPA 2XB9A 2YWRA 3RAPR 4RELA 2O8BB 1GP2A 1VP9A 3LQYA 1QHSA 3A3YA 4OGWA 2IYAA 1HNXB 2NT4A 3DCJA 1QTQA 2Z4SA 4QODA 4C87A 1JR6A 4QVGA 3GGOA 4EA8A 5AMXA 5K3OA 1EXDA 3CCCA 1ZOPA 4CUJA 3RBXA 4DQ0A 3HL4A 2GFHA 2IWRA 2X9VA 1ZD9A 2A78A 3HE3A 4EGQA 1U2GC 1A7JA 1D4AA 3PUVA 4MTLA 4OJQA 4X1YA 2ZW9A 1Z2PX 1P0IA 2SCUA 3CSDA 3ESZA 4KNVA 5EESA 2OFWA 3LF1A 5ALGA 3OQVA 4W7IA 2QZPA 2HK9A 1QORA 3L5OA 1IL0A 4FD3A 2GXSA 1GSAA 2CJPA 3KJEA 4L4XA 5D51S 3L7CA 1RPZA 1KPHA 5AK6A 2ZPUA 2E4UA 5HXAA 4FS3A 4M1EA 4N76A 1KI4A 3LC0A 3MUEA 5DP1A 5K51A 3DFKA 4GBJA 3U7HB 4HQRA 3FG9A 4UBLA 4X8MA 2NYVA 1T2DA 7ABPA 4IIXA 2ZZNA 1S7GA 1LVUA 2GN4A 3GEHA 3DL2A 3Q72A 3U7JA 2C3MA 4A23A 2BGLA 4Q7EA 2VDQB 5I7OA 2H2WA 4HEQA 1OILA 4DCTA 5IG2A 4HATA 4XOUA 4ED9A 2WBLC 1K62A 1JQEA 4R3NA 5HNKA 5IFKA 2WNSA 3GB9A 3HUDA 3QP9A 4A27A 1K7XB 1E60A 1EP9A 4K8OA 3R8XA 1SUWA 3MBKA 1I2AA 3QI7A 4NBWA 4S24A 2HY7A 3C8ZA 5HJ2A 4KR6A 1U98A 1W0CA 2V7QD 3VXKA 4XEHA 3WO0A 2XYHA 3V8VA 3HFSA 3VYWA 2UUOA 4AP9A 1CY8A 2BEKA 4WXEA 5IZCC 1JFRA 2GK4A 1YQWA 3EE6A 3H65A 3DOUA 4PHHA 1EK6A 1UK7A 1ZNXA 2QWXA 2WM2A 3D3JA 3A1NA 1I4EB 1ZZGA 4BNNA 1Z4IA 3CLRD 2I6GA 1LVGA 5AI6A 1EM6A 3MELA 2HXYA 2PUCA 1WL8A 4P08A 1DHRA 4XSGA 4NCAA 4NYMR 2B1RA 3LA8A 4BX3A 5F52A 3NVMB 2AFIA 1Z12A 2O0HA 1EINA 3DAFA 1G42A 4YJFB 3ZDDA 2FQYA 4COOA 4BZPA 5KTTA 5EIXA 1LTHR 1TF5A 3F98A 1Y63A 1KZ7B 4KXUA 4MB2A 2Q5CA 2POCA 2Y1LA 1Z18A 2YY6A 3LAWA 2VZ9A 5L3ZA 4U2KA 1STOA 1CDEA 2BEUB 5FO1A 3WNBA 3K2BA 1GYQA 4RPHA 5EQJB 4ZCTA 3HC7A 4KRYA 5IABA 2I4MA 2XUQA 1O9GA 4I19A 1QYRA 1HR0B 3AETA 1AB5A 4HC4A 2QUBA 3DE4X 3JAWB 5A0TA 1BA2A 1XKLA 1PFUA 4LHZA 1B16A 1S2IA 4RVOA 3R74A 1P5FA 2CXHA 1ESNA 2IY9A 1HLPA 1L8XA 2AB0A 2R5WA 1WQ1R 1WBJB 3ZEAA 3T4XA 5LZ8A 4WA7A 2YMMA 4E46A 1WB4A 2Y1FA 1YZHA 3A3PA 2Q5IA 3E7FA 4EHDA 1T4CA 4ZAYA 4Y1FA 2GEDA 3VKHA 4CFZA 1FP7A 3H99A 3IA2A 3EDOA 1E3IA 4H6WA 1KZ4A 4MWDA 3ANMA 4QX6A 4GICA 3AF4A 2WF7A 1RJGA 2ZYWX 2I03A 4V38A 3O73A 3VR0A 1E3SA 3NHWA 4OP2A 1QP4A 5D00A 3NRCA 1FZQA 2H8GA 3OD1A 2GUWA 4BKUA 4BNFA 3WGYA 1JNYA 1BDIA 3WMRA 1I1OA 2P9GA 4Y2UA 3SBOA 2NYAA 1VJGA 3G9UA 1RJFA 2HNAA 5DGHA 3ILYA 2I62A 3ENQA 4BO2A 3JVUA 4MH0R 4YRMA 5BY2A 4BQNA 2VN8A 4TWIA 3OOYA 4F96A 1AH2A 4PLYA 1AOXA 4PSUA 1VL5A 4Z0TA 1HDYA 3WHIA 3W7BA 2W6CX 1ULAA 1GPLA 1ZD3A 5F2NA 3QITA 1OI3A 2Q5OA 3BFXA 5A9SB 2BDUA 5BQOA 2CJXA 1VMDA 5AKHA 2WMYA 1OC4A 5D1NA 3TUJC 5L53A 5F1OA 3C7DB 5IULC 1NPTO 4EGSA 5EKUA 3C15C 3UMJA 4E2XA 1M34B 4PG5A 2QN1A 3TZBA 2DAPA 3DDUA 1AA6A 4MUEA 4GUDA 2OC9A 2EWMA 2ZRLA 1HFKA 1Y3BE 3JASA 3JQGA 3LRTA 2Z3ZA 4HR7A 4RJKA 3MLAA 2BFFA 4LI0A 1YNSA 1Q3HA 2B82A 3C1AA 5DM4A 5DYIA 5J5AA 3WYNA 2ZJZA 4ZFNA 3EPJA 3FCUB 4IO0A 1YL6A 4KNWA 4PRZA 4WUVA 1Z35A 4DQLA 3DTTA 1SC3A 1DTEA 4WKPA 1VQ1A 3PC8C 4JOSA 1XZAA 5I47A 1YJQA 3K53A 2G8NA 1NURA 5FPTA 4BQOA 1R4NA 1ZAKA 4AJOA 3LMKA 3D2CA 2D3WA 4KE6A 3NTRA 3IHWA 3KO8A 2B6HA 4QFCA 1Z6QA 3IMGA 3PIDA 3JD3A 4RMHA 2X8LA 5J4LA 2FSVA 4DRXA 3PDJA 3NW9A 4M6WA 4HNRA 5K2MA 4XZ3A 3GLVA 3SZOA 2YJGA 1GD1O 2BHTA 1AY0A 4JLVA 4ILKA 4Q12A 1QMPA 2FPIA 3BDIA 3DT9A 2NU7A 2R84A 1RPAA 1DLIA 2PV0A 2H1FA 2QSZA 3GGSA 4Q4LA 1NN1A 1T36B 1DARA 4L8VA 4EKIA 2GCEA 3NBFA 1H2ZA 2A0KA 3WGNA 1T0JB 3CZCA 4WXPA 3GGDA 3ZKWA 3G5LA 1ZU5A 3VO9A 4BGUA 4CHGA 2XLCA 1Q2UA 3C3WA 3L7JA 4BFWA 4BVEA 5HBRA 4OYHA 3U4QB 1W93A 2ZBEA 3Q1LA 2PJDA 3THRA 3H5VA 2M98A 3ZZ0A 3IKMB 1BS1A 2GYYA 1W1WA 5HTOA 4H0CA 5KVSA 3DZKA 4QLBA 1L7AA 2MJLA 4ANFA 5ER6A 1U6IA 3TF5A 4MVWA 4BMYA 1TK2A 4K9NA 3G8YA 4UDNA 1KMIY 4J43A 5CDFE 1USVA 3QA3E 2JC3A 2QQGA 3HR8A 3IQEA 3IXQA 3W6NA 4XVRA 4E2YA 4QU0A 4MUNA 5G4KB 3SX2A 2O2EA 4Y2RA 4L5IA 1T9KA 1O97C 3CWQA 4NQRA 3LE8A 4AYWA 3MD0A 2QROA 3CZ5A 1YZGA 4M54A 1WB5A 1P75A 2ZI7A 4ZJZA 3KV1A 4KXLA 1VE6A 1DBPA 1MDBA 2ZYGA 4I1VA 4IUCS 4MR7A 3RWOA 5DU2A 3SHOA 2XNSA 4U7JA 1KIFA 5ALVA 4Y9TA 3ZV6A 4EARA 2HPVA 5K0ZA 2UXBB 3OT5A 3ZD9A 4RWEA 1ESMA 2IV2X 1IJEA 4YRZA 2HQOA 2PU5A 3FYUA 4EUEA 1YACA 1JU3A 5F3DA 3TS1A 2YXEA 5AVWA 3LT2A 3AKCA 2FVXA 3CX7A 1KK3A 1KO4A 3P26A 1KIMA 1ST3A 3DVLA 3O4IA 4U9IS 3RTDA 4F5EA 1QHFA 4F8EA 1CUSA 3COJA 1DRWA 4Q1BA 2NU8B 3KT0A 1KTIA 4QYMA 4AD8A 3CH6A 3GEBA 3IP9A 4DNXA 3AH8A 4FFNA 2MSKA 3ZHOA 4M9XA 1T5LA 4N41A 2VH1A 4UBIA 2HADA 4HWOA 1RLTA 3T1NA 3VFDA 1HLDA 1SHKA 4H1TA 2PE5A 1EUCB 3DBLA 1OX6A 4EDHA 5L4LA 4GLLA 1GQ2A 4HB2A 3DM5A 1F12A 2CLLB 2P0AA 4N54A 2R5NA 2WV9A 3FX2A 5EZYB 5HUQA 3AOEC 3UGJA 2E49A 1T9GR 4IDBA 4LTNA 5FAKA 4UNRA 2FPGB 1KKUA 4UU0A 2AIRA 4DG8A 4XWAA 1EA7A 3JYNA 3S68A 1W46A 3IQXA 3GUHA 2XD4A 1EX7A 4NU5A 1V2GA 1XRPA 4G0WA 3ICEA 2VPTA 4CG2A 1YR7A 1YKSA 4L15A 1M6E<