4MWOA

Crystal structure of human mitochondrial 5'(3')-deoxyribonucleotidase in complex with the inhibitor cpb-t
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
193
structure length
193
Chain Sequence
ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase, mitochondrial
publication title Conformationally constrained nucleoside phosphonic acids - potent inhibitors of human mitochondrial and cytosolic 5'(3')-nucleotidases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 66
structure length 193
sequence length 193
ec nomenclature ec 3.1.3.-:
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 4mwoA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4mwoA01
4J03A 2YJ6A 5AVYA 5ALDA 2JAWA 4UM7A 3ZU6A 2B30A 5AM5A 5AESA 4YCNA 2O2XA 2ZBGA 3U13A 3W5BA 3ET5A 4E88A 3QU9A 4MWOA 2FPWA 3MPOA 3VAYA 4BX0A 3UMBA 1LVHA 2RARA 1S2OA 5AVSA 5A3QA 4JB3A 5AIBA 2ZBFA 3WKBA 5ALTA 3ED5A 2JARA 5AICA 2Q5EA 3ET4A 1VFPA 4UU1A 3R09A 2C9MA 1QH9A 1X42A 3QU5A 5AW4A 2B1QA 4EX7A 3QUBA 4ZEVA 3GYGA 5ALXA 3L5KA 4HGRA 3ZVLA 1F5SA 4H1WA 1Z4QA 2G07A 4HGOA 3U19A 3WKAA 4BNDA 2G80A 1T9ZA 2D2VA 4UU0A 4EZEA 5AI4A 2YMQA 4YCMA 3PCTA 3EF1A 3ESQA 2IYEA 3N28A 4KNVA 5AKLA 3L8EA 5AVTA 3CNHA 2B8JA 1CQZA 4HYTA 4CF3A 4NABA 2ODAA 1T5TA 5ALQA 3AR6A 4UASA 3ZWKA 3U7FB 4L6CA 5AVUA 1YV9A 3QU7A 1TE2A 1Z5GA 3U7HB 1YS9A 3NANA 4OHFA 4Y2QA 5ALZA 1FEZA 3NIWA 4IFTA 2CFRA 2WM8A 1AQ6A 1RMTA 2P11A 5AM1A 5AI5A 4UATA 5ALFA 3FGOA 3WGVA 2BDEA 5AW8A 2PQ0A 4HGQA 4Y2XA 3I6BA 3ZWDA 5AKJA 4C4RA 3A3YA 2FUCA 2FI1A 3HYCA 4G63A 2B8EA 2QYHA 5AW1A 4KYTA 3NAMA 1RDFA 3MN1A 4AS3A 4YH1A 3NUQA 4AS2A 3L8GA 3AR3A 5AM0A 3QU2A 2I6XA 2YMMA 2FEAA 2JAUA 1RQNA 1NRWA 4EELA 1LTQA 4UAVA 1ZJJA 3EWIA 5AW6A 2OA0A 3ZW7A 2Q4RA 3KDPA 3WGUA 4YCLA 2NO4A 2IOFK 3ZUPA 5JJBA 4L6AA 1L7NA 3QU4A 4DW8A 4MUMA 4Y2SA 3ZVMA 3L8FA 4J2TA 1SWVA 3ZVNA 2GO7A 3FPBA 4Y3UA 3AR9A 3ZTYA 1RMQA 2HO4A 3K1ZA 5AK4A 3ZX4A 3KBBA 4YGYA 2I55A 5AKXA 2HSZA 5ALVA 3UMGA 4DWOA 5ALOA 5AM3A 5IS2A 1QYIA 3UMCA 4AP9A 3RF6A 2AH5A 2X4DA 3OCWA 1WZCA 1U7PA 1ZD5A 2YY6A 4UAUA 4EX6A 1O03A 1PW5A 4NFLA 1U7OA 2WF6A 1RMYA 3SD7A 4FE3A 3P96A 3OTQA 3J7TA 2C88A 3U26A 2RAVA 3E58A 5ALUA 3N8GA 4PNHA 1N8NA 4DCCA 1RLTA 5IT0A 2MSNA 1Z4KA 2HF7A 2CN1A 3QNMA 3I28A 1Y8AA 2AMYA 3QUCA 4I9FA 1SU4A 5AKZA 1YNSA 3L0BA 4EENA 2IA5A 3B8EA 2EARA 4B6JA 1RKQA 2VKQA 3A1CA 3B9RA 1TA0A 3MC1A 5AW5A 2YJ3A 5AI9A 3N1UA 1Z4NA 1XPJA 3ZTWA 1L6RA 4OCZA 3WK7A 2HEGA 3QUTA 1WVIA 5ALMA 2PR7A 5AI0A 5AW9A 3W5AA 3OCZA 2BY4A 2GFHA 2HX1A 4QJBA 1RQLA 3KC2A 4FFDA 1RRCA 3HLTA 2FUEA 3WK4A 5AVQA 2G0AA 2ZBDA 4YIHA 1RKUA 2ZBEA 2OM6A 3WKDA 4OFZA 4YIKA 5AHXA 2AGVA 5FP0A 3I76A 3IB6A 5AKYA 1L8LA 2B0CA 4UM5A 5ALHA 2HI0A 1WR8A 5AK6A 3W5DA 1ZRMA 3OCYA 1RC8A 3IJ5A 3PDWA 4KX3A 2WF7A 4JDPA 4Y2YA 3E84A 4Y2VA 4QQFA 2ZOSA 3ESRA 2WHEA 3FZQA 3WKCA 4I9GA 3SF0A 2HF2A 5A3SA 1XVIA 4BX3A 1Q92A 5AM2A 4ZEXA 3SLRA 1VJRA 2HHLA 3ZX5A 1QQ6A 1JUDA 3AR2A 3FM9A 5AM4A 2HCFA 1RLMA 3B9BA 2P9JA 2R8XA 2NO5A 5ALNA 3KOOA 2Q4TA 5AW7A 1ZS9A 1VJ5A 4HGNA 3WK8A 2QLTA 5AKEA 4Y2UA 1K1EA 5T41A 3R9KA 3AR4A 2WF8A 3PGVA 2C8KA 1L7PA 3D6JA 1Z4MA 2B1RA 3WKEA 1L7MA 4RETA 5ALPA 3A1DA 4CNQA 1ZRNA 2HDOA 4C4TA 3M1YA 2IOFA 1RLOA 5AKIA 1ZOLA 2DQSA 3SMVA 4BX2A 3RFUA 2YMPA 2WF5A 5ALYA 1S8OA 2BDUA 1N9KA 5ALSA 3S6JA 4CF4A 2G06A 2FPUA 1QQ7A 2OBBA 2PKEA 3OCXA 4KX5A 2I33A 3MMZA 2FPRA 1ZD3A 2RB5A 2GMWA 5AKKA 5ALLA 1QQ5A 2RBKA 2OYCA 4Y2RA 5ALEA 4XPZA 3KD3A 4DFDA 1L7OA 2YBDA 5IT4A 5ALJA 5AVZA 3BWVA 4UMDA 4FYPA 2R8ZA 1YDFA 4UW9A 5AVRA 4XQ0A 3AR7A 1U02A 4KNWA 1Z4PX 4BEVA 1Z4IA 4GXTA 5AVXA 2FPXA 2YJ5A 3QGMA 5AK5A 2W4MA 2CFSA 3DV9A 3M9LA 2R8EA 2P69A 2IOHA 1KYTA 3L7YA 4RESA 2I7DA 2O9JA 2R8YA 1WPGA 5AW3A 2I54A 4UMVA 1ZD4A 4UMEA 2G1AA 2EAUA 3QX7A 3SKXA 2G09A 3AR8A 5AI6A 4UARA 5ALKA 3OPXA 3U7EB 3AR5A 1EK1A 5AW0A 4OD0A 1RKVA 3L0CA 1CR6A 3UM9A 4EEKA 3E81A 3QYPA 3NASA 1TJ3A 3SKYA 4G9BA 3PGLA 5AKHA 2CFTA 3EPRA 3L8HA 4Y2PA 1Z4LA 2C8LA 2I34A 1ZD2P 3QLEA 4UMFA 1YJ5A 1NF2A 1TJ4A 2YMLA 3DDHA 4Y2JA 4BNDB 4XE5A 2G08A 5ALIA 3L1VA 1EK2A 1MH9A 1NNLA 1SWWA 5AI8A 2P27A 2FDRA 3WK6A 5ALGA 5E0OA 3W5CA 1Z4JA 4BBJA 3OCUA 2AUTA 2WF9A 4F71A 3L0YA 3U7GA 1Z88A 5AVVA 4GIBA 3FVVA 1J97A 3FPSA 2ZG6A 4XOUA 5AW2A 3WK9A 4CF5A 4NAVA 3TLMA 3I1YA 2HOQA 4Y2TA 3WK5A 1O08A 2EATA 2W11A 2GHTA 4BKMA 2W43A 2C4NA 2YJ4A 3ONNA 3N5KA 3EF0A 5AVWA 2MU1A 1U2SA 3N07A 4NV0A 3L1UA 4KN8A 1U2TA 2WFAA 3OCVA 4L57A 2YN4A 3R4CA 3BA6A 4C4SA 2YFYA 4O8CA 2JAOA 1YMQA 4CE6A 4NWIA 4BEWA 3E8MA 3IRUA 5AIAA 4F72A 2FPSA 3QXGA 1RPZA 3NRJA 5AKGA 1IWOA 3NALA 2B82A 3A1EA 2ZXEA 3DNPA 1Z4OA 5ALRA 1Z5UA 3KZXA 5ALWA 4HGPA 1T5SA 3ZI4A 4HAIA 3F9RA 4ZEWA 1J8DA 2JGAA 3DAOA 5A3RA 1L8OA 5AK3A 3SHQA 3CZ4A 4BYGA 2NYVA 2GHQA 1TJ5A 1Q91A 3QUQA 1XP5A 4IG4A
chains in the Genus database with same CATH superfamily
1JHMA 2YJ6A 2ZAGA 2QG9A 2RC5A 3FUCA 4JMLA 3EAGA 2MSCB 3LDGA 3NIFB 4Q24A 2Y6VA 2PH3A 4FFRA 4O1HA 4TMXA 2QQGA 2WYUA 1ZGJA 3U16A 3WNQA 4XUCA 3ZHXA 3RG2A 3AY7A 1GY8A 621PA 4MV1A 4K03A 4IUYA 1P3DA 3DF7A 3OBIA 3WLJA 2CLSA 4A5SA 4II3A 3QBJA 4DWVA 5KREA 5D01A 3PP8A 5IJAA 2EC5A 1CW2B 4FHDA 2O8BB 1IBCA 2PZGA 1HTWA 2EWVA 3EVDA 5GGYA 2PRIA 4HBGA 1K92A 3ESCA 1SHKA 4EA6A 4EHJA 2O8FB 1QOQB 2IW1A 4OVKA 1G8YA 2NIPA 2QV7A 2BUCA 4Z4FA 4B4OA 3BWCA 1QKKA 4E5UA 4BQNA 2EZ4A 4MRPA 4F06A 2C7PA 1E0JA 3RS0A 1Q0HA 3EMVA 3DXYA 4BJHB 3COSA 4DRXA 2GLUA 3FPJA 3FSEA 4WADA 4EGQA 5CB6A 2GJ8A 4OMFG 4BTVA 3AYZB 5DN6D 1W4RA 3EVZA 3D43A 4ZVSA 4LY0A 5IZCC 3HHPA 3VUFA 4CJXA 4P3YA 3MCTA 2C3PA 5P8WA 4EQ6A 2DCUA 1NPTO 4D3YA 1N6OA 2A9VA 2QT0A 4QYXA 3LG2A 4L5IA 4P31A 3NETA 4H1WA 5DSXA 1HGXA 3PXUA 1LDYA 1VI6A 5K5EA 4LHEA 3PA8A 2R3SA 4YRTA 2DC1A 1TW3A 2QW0X 3N2LA 4GOOD 4IEIA 3C3MA 3QMWA 4KHPB 2QGNA 3ZKWA 2CD7A 2PX6A 3WZMA 4BQEA 1UEJA 5HEKA 2A1TR 4ER7A 1QGDA 1KY4A 2RIRA 3K1AB 1OYYA 3A3PA 5AVTA 2G9NA 4JQCA 1JU4A 4HB0A 3CLUC 1T0JB 2WUEA 1JZQA 3OPYA 4NBVA 2OLKA 3C45A 3S2YA 3I0NA 3T7AA 3RVLA 3T3MB 1EG2A 2OKCA 1QHEA 5I51A 2IXAA 2W6QA 4J0JA 5FPKA 1KBZA 4KLZA 4ZDKA 3EDMA 3X2SA 1Y98A 4M7PA 4LNUA 2NXNA 1ZZEA 2HDHA 2C7VA 4C6HA 4IFTA 1IU9A 3PV0A 2X6TA 3BF8A 1VKOA 4XDZA 4KQMA 4XVHA 5TX7A 3OX2A 4B44A 4B83A 4MARA 1TLFA 4LE0A 1FFWA 1MPXA 4FZRA 1BJKA 2DECA 3O5AA 3HFRA 1X7XA 1U2PA 5BORA 2B0JA 1V11A 1AQYA 4RVGA 5LP6C 1Q7BA 2LKCA 4UCXA 4CDRA 1DIRA 2YQZA 1XK7A 4J0QA 3S3TA 4BASA 1T1IA 2D59A 2A94A 2WRZA 3ZVKA 2AZXA 1VG0B 1GAJA 4YASA 5LLSA 5ES3A 3TJMA 4BVAA 2DHCA 4C4RA 3F0TA 2OZKA 3HYCA 4CM3A 5J4YA 3ZD8A 1ZUNB 1ZUIA 1GQSA 3BXEA 3DF9A 5A3VA 5AW1A 2P3OA 2G04A 4FHCA 4P4UA 1XRLA 3TDMA 1AN0A 1E2EA 1YT5A 3CVUA 1M7HA 3UVEA 1G8SA 2X1MA 4AMZA 1QP8A 3VTFA 5L3VA 1EDBA 2GBPA 3P1JA 3RYCB 1XXHE 1AJEA 1X7YA 1QCZA 4J9UE 4D9EA 4FLEA 4HD8A 1CS0A 4E1BA 3GT3A 1FTWA 3DTNA 4RVDA 1VHQA 5K0SA 4EPWA 1H94A 1UKEA 2CHVA 4JBWA 3S81A 1LNSA 1I7SB 2ZVDA 1E3TA 1ZCBA 2XQFA 2HU2A 4UBNA 5CM8B 3LT0A 5KVQA 5JJBA 3I64A 2IU3A 4PYKA 3FPBA 4IZ6A 1O95C 4NJEA 2IYZA 2ZSFA 1WSBA 3WL3A 3NTLA 5D6BA 4HDSA 3RVKA 3PKZA 2GB4A 1CUCA 2A0KA 2FPIB 3LCVB 1NE2A 2ZS7A 3UICA 3TXAA 5B7QA 4YY3B 4U39A 3MK31 4G8CA 5DI3B 4B43A 3O1LA 1XVLA 2QTRA 3AL0C 4F2DA 1G6Q1 4O08A 2A78A 3OE5A 2G67A 2WKWA 3GLTA 4PYOA 4QHTA 3ZWWA 1NW6A 3C24A 3RAEC 2V55B 1QR2A 3ROKA 2A0YA 3R3WA 4WRRA 2GJ9A 4D9CA 4QM6A 2FOIA 2AIRA 4JGGA 3B85A 3REOA 2NG1A 3K8ZA 3CRZA 2VUSA 4JP8A 4K28A 2VDMB 3WRYA 3FJOA 5B4TA 3NBAA 4IHJF 2HZ7A 1QGUB 3TOCA 4BU1A 4CT5A 5LIPA 1AA9A 3C3DA 3ILHA 3OI7A 1OAAA 3LY7A 3AG6A 3EHDA 3L7CA 1Q2XA 5AXCA 5E6RA 4RACA 4EWLA 5F9HA 2JFOA 2PGJA 5DN6A 2GCOA 1VLHA 1PWHA 4B48A 2CXNA 2IH2A 1FSSA 2VRCA 4DSZA 1PT9A 1EWVA 10MHA 3PB3A 1XZDA 4WWHA 1Z75A 2QMEA 3B1ZA 4WZBB 1M6EX 4D25A 1SUCA 2DCMA 4Z4QA 3OTQA 2O8EA 1D1SA 3BE5A 5HKBA 2BGUA 3BERA 3MGCA 1VMKA 4JAVC 4IRXA 4XM2A 4Y2HA 4YFYA 3A4NA 1JSCA 3U81A 2HAEA 2JHGA 2E5FA 1F48A 1PZXA 2W2TA 2X8JA 3C3WA 2MSNA 3EXFA 1NWHA 4PQGA 4JYMA 2BFEB 4LJ9A 5IHPA 1W4BA 1Q7GA 1Z07A 3JV7A 1FSGA 2GDJA 1QGED 4MIYA 4PRLA 4I14A 2C57A 2J32A 5K8UA 5AUNB 3NAZA 3LDFA 3KQMA 1QNFA 3FBGA 4M6WA 2ZROA 3WDSA 1PNRA 2F8LA 1P0CA 1DMRA 2ZGVA 3D5EA 5FL7D 3UKDA 4CEJA 4EECA 1B7GO 3ETLA 5G1PA 5JAZA 1Z4NA 2WIKA 3EFEA 3BREA 3HP1A 3ZTWA 2BTEA 3S1AB 2OOKA 1QFXA 3GNQA 5JYCA 1EGVB 5HVNA 4KPEC 1MAAA 1ADJA 2I4MA 1LSUA 2X4GA 4JYCA 2QB5A 3S40A 5AW9A 1Z0ZA 3WLIA 5EIXA 3OWHA 5AXAA 2PEYA 3P2YA 3THWB 1W88B 4GC9A 2CJPA 4K3VA 3UXHA 4KR9A 3RT9A 4RDXA 2ZBEA 3IT1A 3NHYA 3WKDA 3X0DA 1T3SA 4X90A 3TX2A 4CG3A 1IN1A 3SEAA 4NIMA 3WGNA 3PNVA 5FUQA 1NTOA 4B3SB 4D6XA 1OV6A 1VBNA 1XK6A 5AKYA 3SP1A 3CNNA 2Y1FA 3DW1X 4F5DA 4F56A 3TM5A 5GV8A 4Z7OB 3GFVA 1KAMA 4INJA 1KK2A 4OKSA 4XIIA 1JDZA 3IOEA 1ZM9A 2Q5OA 2H0QA 5K1ZA 3TDKA 4DR6B 1FRZA 4H3KB 5TGZA 3RCBA 1C3VA 2FR0A 4HLNA 5CA0B 1GQQA 2ONYA 4NZMA 3PC4A 3FZQA 4J0IA 3GYBA 5FFFA 3SS9X 4HATA 3VHQA 1TUEA 2DBQA 2JIQA 3IR5A 4HGYA 4L8VA 2Q6TA 5I9BA 1Q92A 1GVHA 3G88A 1DAGA 3AUYA 1FUUA 1Y8RB 1EWKA 2HIGA 2ZJOA 3QTLA 4BTEA 5DLDA 3N9IA 1QAQA 4AG3A 2KBEA 1P80A 5I6DA 3AOGA 1JAZA 4LGCA 1FU7A 3EWSA 4LDZA 4S1NA 1G60A 2NZ8A 1KQNA 4A0RA 1T6XA 3CF0A 2Q4BA 3HVHA 1AD2A 1NJ5A 3PZRA 1JL3A 2O7QA 2PXXA 1U8ZA 5DEOA 4BY9E 2GF9A 4C14A 3IVCA 4CKCB 1W4LA 1R6AA 1W0CA 4BX8A 4RADA 2CVHA 3S99A 2PL3A 3F5QA 3EQ2A 4ZKDA 1ISFA 1K1EA 1KPHA 1Z68A 1B42A 2ATIA 5U9CA 1EFKA 5JPIA 3QFTA 4M83A 2WF8A 1E2JA 1R0KA 2FU5C 4CKBA 5J58A 4KR3A 2IPLA 3IVGA 4NBLA 3EZ7A 3D6JA 4ZI5A 3LUPA 1LBSA 1NVBA 1JJIA 2P62A 1N2OA 1RCFA 1XZHA 3EY4A 4ZI2A 2O8CA 1MN6A 1JQBA 3W8DA 3OJEA 2XNJA 4DNPA 4EKDA 1WQ3A 5SZHB 4JX9A 5EE1A 5K8JB 2YYZA 4WLUA 4RPCA 2AZTA 4GOMD 4Q02A 4URFA 1IVNA 2J3JA 5KU7A 1RLOA 3JYNA 1I33A 1ZOLA 2B6HA 2YWDA 3RK4A 1DUVG 1UP6A 4FGWA 1Y1SA 1YCHA 4ZT2A 4PN7A 4M3NA 1BCSB 3M33A 5NULA 3VU1A 2BJHA 2ZB3A 1IQRA 1SHJA 2WJZB 5K9ZA 4RTPA 2X75A 3KD2A 3EMBA 1SVIA 1FE8A 2I33A 3WBKA 2NSJA 3MMZA 1PFWA 3L0DA 1Z56C 5TIIA 1QTRA 1QCDA 1UMBB 2H48A 4I1PA 1CZNA 1YVEI 4QIHA 3E9DA 4QYIB 4HDQB 1L2TA 1SBIA 3FOAA 4IIUA 3G9QA 3SQMA 4I8XA 2W8BB 4H3HB 1NI5A 5K4GA 5LMNB 2LD4A 1EVEA 2IV3A 4EHDA 3ZXXA 3AVOA 1Z0JA 1LDGA 4MO2A 1FUEA 1ZXBA 3QE0A 4DLWA 4LSZA 1I0AA 4P3NA 1XCJA 1BVRA 3HPRA 3NM6B 2DPHA 3TLYA 3ZI7A 1GPBA 4BKRA 4JT9A 1PKEA 2QV0A 2QSUA 3PUIA 4QAQA 3LGXA 4K1XA 4JJEA 4YMSA 3WRYC 3ZDFA 4JJZA 4R0NA 1EFAA 1XN4A 1SCDA 3AEQA 1DIBA 7GPBA 2IHYA 2WVJA 1XP8A 9LDBA 3DMNA 1K2WA 4JNKA 4K6GA 4F93B 3AT1A 4C0SA 1N0VC 2VQEB 1BXKA 1X1RA 1REQB 1HMYA 2GILA 2CYAA 3MWEB 4Y6RA 1ND6A 2F3RA 3CISA 3TSCA 1AKQA 4OM7A 1M2VB 3FBWA 2F48A 3OZSA 5JTUA 1OC2A 1JQDA 1ZM7A 1FRQA 4YR9A 1YA8A 1QXSA 2C3OA 4MX8A 2B3TA 5EJ4A 2QW8A 4B3IA 2LXNA 4R9NA 3DBLB 5BSKA 3C6YA 3TFOA 3NBMA 1YS7A 4C22A 2JLUA 3B1KA 2GI4A 1BGVA 1Z28A 2OK8A 2PZKA 2XA1A 1A96A 4RJLA 3RVOA 1UXOA 2MSKA 4RZXA 4DCMA 3D6VA 3W9SA 2B7BA 3ZJVA 1TDJA 3MRVA 3HCPA 1YZYA 3S27A 4OQPA 1L5MA 2GZHA 4JROA 3ZCVA 4G9BA 3KJQA 1ESMA 1C0KA 4AMUA 1C3EA 1PV4A 4I1OA 2ZYAA 1HNWB 4WLEA 3VC3A 3TTSA 4F4UA 3MWDB 3LXXA 4P82A 1SMKA 1O58A 3JYHA 4JC0A 4D3DA 1RTKA 3C43A 1Y34E 2PSFA 2DBVO 5FI1B 3OMXA 1JQKA 1H2RS 3U3XA 1ZGHA 4DV0B 1SUBA 4CLOB 2JHCA 1PJTA 4MR9A 4HZIA 2MYNA 1GYRA 2J08A 4FNMA 3CBGA 3W78A 1NN1A 3PFWO 4K46A 1SWWA 3Q5GA 5DHFA 3ORHA 1YS4A 3LQQA 2FX2A 4NK4A 1DS6A 5JLAA 4JT2A 2NQ2C 4Y30A 1BXRB 1C7ZA 3H42B 1B26A 5CLFA 1NURA 2VSOA 1UDAA 2WF9A 3GOHA 1J21A 3L4BA 5EKTA 1CY6A 4D3FA 5BNWA 3CR3C 1NMQA 5I3CA 1ODTC 3FVVA 3P9RA 4LXHA 5E9WA 1Y6QA 2QJTA 4IY1A 4PAGA 2YJGA 2O2HA 3CW9A 1SO8A 2GM5A 5B1EA 1YGPA 1ZKMA 4JJ6A 4CCWA 3K9QO 1QIMA 4DRZA 3M6UA 4PZPA 3ZU2A 4FS8A 4B8WA 1O6GA 5BT8A 3ZLVA 1V5IA 3R6QA 2W43A 3ZW9A 3CM0A 2Y77A 3N5KA 5CVJA 1NBMA 2R6FA 1U7XA 1P2FA 2OFPA 3JARA 3P19A 4EY3A 3CC8A 5K6RA 1MFPA 4YYZA 3LHIA 4FCCA 3ZJYA 5EXTA 3PEFA 4Y9UA 4HFRA 3GJ3A 4P86A 4J2HA 4FFWA 2PG3A 4WBNA 6CHYA 1E60A 5EPEA 5I8ZA 1ZVVA 1Z15A 3ZQJA 5IKEA 1DBPA 2J9FB 4UTZA 5CP8A 3S28A 3KLBA 5DTEA 4I4IA 4H18A 1UMKA 3FD8A 3A4MA 3EW9A 1FDUA 3H19A 1SM4A 1JBEA 3NRJA 3PUHA 4HPXB 3RIEA 1PFKA 1YVPA 1UT6A 2ZYWX 1P1JA 5CEFA 2VSFA 5HKKA 2QM7A 4WGFA 4JZKA 1T35A 3IP9A 3HDGA 4QBHA 2HCRA 3F6BX 1GDHA 5A4DA 5KCZA 4WY2A 4YJ2F 1Z4OA 5LZ8A 4EVIA 3VJKA 2IHJA 1Z5UA 2N47A 3GAFA 1VM6A 1FFYA 1DPGA 4F7DA 1SFRA 2AN3A 4HGPA 3TTTA 5FUXA 1R88A 3FHLA 1T29A 3GBSA 1IK4A 3MJTA 4NVRA 3TAHA 4BB9A 2WPDA 1AN9A 2C4VA 4TSKA 6YASA 1JXMA 1H23A 4DC0A 4XW2A 4CM6A 2A5JA 2BHTA 2ZUDA 4GECA 1J8DA 3K0FA 1NLUA 4BFZA 3R5SA 1XJ5A 1HM5A 1M34B 1USVA 2QLBA 2VJOA 3CZ4A 1CIVA 3H2ZA 5D51S 1DHRA 3UNXA 1F51E 3E2IA 3UUFA 1MRNA 5MGNA 5JZBA 4B46A 5FOWA 1Q16A 3ORYA 2BE7A 1OV4A 2Y0BA 3T3PB 2NYAA 4YALA 1MTOA 3OCEA 1U3DA 2GKSA 2HL6A 1DIGA 2O7RA 4QQ8A 4AG6A 4GVLA 3T5AA 4NZNA 4QASA 3MTAA 4LDNA 5EP2A 2X7JA 4M38A 2BFNA 3V55A 2YWHA 3QM1A 1U8YA 1ZESA 4GGPA 2PMKA 1M7BA 3TEFA 4JL6A 5IDQA 1VMDA 2BN4A 2IJGX 2JPDA 3AV0B 1D9XA 3P5BA 4PZ0A 1LI4A 4O2AB 1P1RA 1V3VA 1GEEA 4DDWA 3IUNA 4IDOA 4OQMA 3VAYA 1XWFA 5IXSA 1IVSA 1F8UA 1T2UA 3ZKAA 3A2LA 3GGSA 4W8OA 3A27A 1A50B 5AP9A 4ZQEA 2O2SA 2O3JA 4B3XA 2VJCA 3CF2A 4M49A 4MMZB 4E6PA 1KERA 5AIBA 2WE7A 5KJ1A 2XRZA 3L7BA 1B23P 4NMMA 3SE0A 1XF9A 3T3GA 1KP9A 1EJ2A 2JARA 1PU2A 2OMKA 1TZBA 2QTTA 3MEQA 2GO1A 2ZTVA 3IA2A 4MZDA 2UZ4A 1SU8A 3EXAA 2NT3A 5AOCA 5JNWA 3RU2A 1GVNB 5JECA 1FNNA 5AJTA 4HFJA 3C87A 1UKBA 4JIGA 1ITZA 2JD1A 4XJTA 2J1LA 3KTOA 4EHLA 3DM9B 2FWRA 4XPIB 1XPUA 2GN0A 1B3BA 3ITDA 2BBWA 1TMYA 2SHKA 2J7PD 2ZATA 3PBKA 3RAJA 4CV2A 1PZMA 4QODA 1MABA 4OBEA 2XXAA 1TT5A 3UUEA 4G1VA 3LNCA 4ZQGA 1KI8A 5HRAA 2AS0A 2BEWA 4MKFA 4HT3B 1BS2A 5JJCA 2DERA 5LXTB 4KDRA 4UTOA 1KK3A 1SCQA 3EF1A 4NBTA 3W1WA 1JEYB 1NV8A 3HB0A 2BKEA 1PG0A 1PQYA 5KNDD 4AQYB 4ANFA 5FWAA 2CZQA 1NW3A 3KX2A 1KAQA 3FLMA 3DL4A 4MVXA 4HYTA 4R8SA 3CZPA 4D45A 2NX2A 4L0DA 3U6BA 1XU4A 4RVCA 2RI0A 1IK6A 2W2NA 5JAPA 3B1WA 3KFLA 3VPFA 5EMKA 2PX3A 4E5VA 1ADFA 4B9EA 1C3UA 1TE2A 1QAMA 1F14A 2WWXA 3HYTA 1ZNYA 2B25A 1R0XA 3LUAA 3OOEA 4CKWA 5LKAA 2P79A 4HTAA 1NC3A 3LA8A 1WCXA 2G83A 3MT8A 2FK7A 3Q6NA 3KJIA 3E27A 4HLDA 3V3KA 5FV4A 2PKWA 1K88A 1P7WA 2F55A 2WHQA 1XL1A 1I4LD 3IDZA 3WA6A 1GPLA 2ZSHA 4LNAA 2CFRA 3H5NA 4K1LA 3T7IA 4E09A 3OZVA 4JC4A 5FFMA 1EGMB 3OIUA 3OJOA 4LAFA 2ZJ7A 3LW7A 1H22A 1QH8A 4RHXA 1AO0A 3WVNA 1LFAA 2M6RA 2EBHX 3CW2A 3L4BC 4GOKA 4JBLA 4Q47A 5AI5A 2CUKA 4QT4A 1W6UA 4I2VA 3KKLA 2AR7A 2O0KA 4CL2A 5IXYA 4EUFA 4R81A 5MFZA 3V1LA 4QECA 1G3RA 5AKJA 5IRCD 2N1BA 3DWGA 3FOFC 4NENA 4Q82A 4O4LA 3SC2A 1X87A 2JFYA 4W7SA 3U9LA 4CMEA 2J5QA 1GSIA 3LKDA 1IBMB 1KAHA 5CAEB 2C4HA 3LD9A 4LSMA 4BFUA 4OXXA 5JZ9A 4C78A 4C4ZA 1DWQA 2I2WA 2P1ZA 1I5OA 1NP6A 2A35A 4H17A 4PIPA 5DYWA 2ZYGA 3KZKA 3VR3A 4MQ6A 3RRJA 3FNEA 2NWQA 4FB5A 4FDTA 2I6XA 3OTHA 1R6UA 2C5FA 3CPJB 4IOLA 2QXUA 1RQNA 2OCAA 5F9MA 2XCOA 2FE4A 4LKRA 4EDFA 3MCUA 4FJ0A 3VZSA 5B58C 1UBEA 5B64A 4V1CB 3GD7A 2WTMA 2DP4E 4AJPA 1ZJ5A 4WBXC 3WYCA 2DR3A 5CYPA 3HB7A 3R41A 5CB0A 4DLUA 4G86A 4LZWA 4ZQHA 4A5OA 1Q2UA 1E5VA 2O3SA 4CU5A 1XJQA 1IAQA 2JJ2D 1QCYA 3H9UA 1SWVA 3ZVNA 4WX2B 4FZJA 2CF6A 5DWVA 3GRCA 1IZ7A 2G5PA 4S04A 4RTOA 3W8RA 3OT1A 3ZE8A 1T8WA 4MVJH 4DQDA 5FWXB 4URWR 3LKBA 1GGFA 1UQUA 1Z22A 2X1LA 4FGLA 4GPEA 5E3IA 4BYMA 5DI3A 4IIJA 3M9WA 3RO7A 2PD6A 2ZCJA 2PJDA 4C2TA 1CUFA 3HCBA 2E9SA 2QTVA 3DEIA 5I9MA 1RYYA 3OETA 2OTCA 4OQLA 4PW0A 3T7DA 3RQIA 3TNYA 1KJNA 1UMDA 3FNIA 1R9GA 4LTDA 4AMBA 2W70A 1O6BA 4I50B 4R3NA 4JWKA 4AP9A 1FS5A 4RLQA 5IFKA 1EUDA 3LC0A 5ADVA 2ID8A 1ORDA 3WLPA 3DE7X 1BFDA 1TOAA 2WOOA 2J3EA 4K8OA 1HG1A 4MLPA 1B8PA 1PGOA 4ZARA 2J9YB 3LI2A 1YZFA 3GEGA 4QPNA 2FZ5A 3R0VA 3NM4A 1L5YA 4TZKA 4ZXFA 4KC0A 2VHCA 4M9CA 3W79A 4D92A 1YR2A 3WY9A 2N42A 3E82A 3E3LA 4JI1B 4BL5A 1Y6RA 3HI6A 1B0ZA 2HTFA 3EVBA 4I66A 4H6PA 4D43A 3NORA 1N33B 2IYXA 1MB2A 3SD7A 4FE3A 1AS0A 3WGTA 2FEWB 1KJZA 1DP4A 3QWFA 4QUAA 3H8JA 5F76A 2A84A 2H65A 4OGWA 4X95A 2QM3A 1V1JA 4QXOA 2JGRA 4P7BA 5C51B 5KYVA 4DE5A 5DXFA 4XSHA 4J2OA 3OEWA 5CR9A 1N5KA 3OE7A 1AO3A 2NUAA 4DCCA 1CNFA 3Q7SA 4IFBA 2QTZA 1GNSA 3FZYA 4LYHA 4ZIRB 3TOZA 3U4AA 2FMXA 2G9ZA 3OFSA 2PX2A 2XRFA 4D8XA 3TAUA 3LYAA 2L2QA 4LPSA 1P9OA 5ER6A 2W48A 1QE5A 1SHZA 3LYUA 4ND7A 1YL7A 2MSDB 2OHFA 3JWHA 3B8EA 4GEGA 3S2IA 2GVNA 4ZDIA 3KQNA 3S44A 4AJKA 4MVJG 2AXEA 1PK7A 1RWNA 3B9RA 3OLVA 4NZZA 5ECWA 5EERA 3ETCA 3HRIA 3OOSA 4FEAA 3GGPA 1WMFA 3G79A 1GQYA 2WDPA 3WJ7A 3I37X 1AC5A 1E92A 3QUTA 4WK4B 5F9FA 1O57A 1EQAA 3LPDA 1PF7E 3KKNA 3DOEA 4GSLA 4HH4A 5KQMA 5HK8A 4XGIA 2YV2A 4XDHA 3PHGA 3ZBQA 3B78A 5JXHA 2WIJA 4OP1A 4DIBA 4X64B 1N2HA 4EB6A 1RQLA 4S1WA 3DFMA 1B2RA 3OTWA 4CEIB 3NS7A 1ZVKA 4RS4A 2AEJA 5EPOA 1VFNA 1U5BB 3WK4A 3FDXA 2VXYA 1DT5A 4G85A 3PNKA 3DV0A 3L6CA 3DVQX 4GW3A 4HEJA 4RKEA 4TXNA 4X1KB 3IV9A 4F46A 5JJIA 4I9UA 1HOXA 3G2OA 4Z9FA 3IIIA 3KSBC 1QB8A 4HNQA 1GJRA 3KUDA 1XHLA 1WR8A 2QR2A 1RU3A 1YC5A 2TRSB 1A4RA 1ZRMA 1N2CB 3D6MA 2VHYA 4JEIA 4CQMA 1V71A 2GHRA 1Z7GA 5CA0A 1EBBA 2FQXA 4HN4B 3EBOA 4QQFA 2BM1A 4AN1A 2FRVA 4DEXA 3LVRE 3RBVA 2M9MA 1SC3A 3H7AA 2BTQA 4MRVA 2NW6A 4GU5A 1DV2A 4DHEA 2Z83A 2HLPA 4B84A 3G2MA 5KYUB 2BKXA 1ESCA 1VIDA 2HHLA 3V48A 2YQ4A 3DE4X 1JSXA 4GC5A 3J81A 1CUXA 1JE0A 2QUZA 3A9WA 1CQXA 3L82B 4HKTA 3WIEA 5BYAA 2QTAA 1PZGA 1UFKA 2XCLA 1D7OA 3B9BA 1F1JA 2FPGA 2R8XA 3D4BA 3OLCX 2GGSA 2P9CA 1T9KA 4M0EA 4P83A 4HQFA 3GLIE 3OLQA 2ZT5A 4EL5A 4ZK2A 3C8DA 3CNBA 1FQWA 1ZGGA 5TLSA 3SX0A 1TEVA 3IKMB 5JBNA 2QLTA 5LBTA 4QRDA 3HEMA 3ASZA 3TZCA 4DNQA 4ADMA 1E1QD 4NU6A 3SDBA 1ND5A 1I01A 2Z3WA 2C0QA 1H1LA 5K8TA 4BZWA 5K3FB 1JF8A 1PKXA 2G72A 4CWAA 2OD9A 1GQOA 1RAHA 1VMEA 5EZYA 1WKCA 3PF9A 3NKFA 1O96B 4GMXA 4B3RB 4CMEC 4ZI7F 2V7PA 3NBUA 5BVGB 2MHCA 2HU8A 4MV3A 5H16A 5C32A 5JV5A 4KR2A 3GLGE 3BJRA 2CMFA 3KHTA 1YFZA 3EEBA 1V48A 3QYAA 1GTRA 2C07A 4L3OA 4QRHA 3R6TA 4AMGA 1BEUB 2K7ZA 4ALMA 4R3WA 4RPIA 4ZQBA 1NVVQ 2X1HA 2WWRA 1S8OA 3OT5A 1AKNA 1N9KA 3PQCA 4QT0A 2VQFB 1QB7A 3B1YA 2WSMA 2X6QA 2CCKA 1ZCFA 1KORA 4QNMA 5ERGB 2GOYA 5T57A 2GJSA 1PTJA 2OBBA 1K8YB 2F9FA 2RK6A 3I12A 1ZWKA 3IE2A 3F2IA 2X0NA 3JQFA 2Q6KA 3PHCA 4ZI3A 5LQDA 3BWEA 2OCPA 3Q8MA 1C4OA 3KBOA 3WV5A 2QL7A 4G0MA 4QYIA 2E6UX 1W36B 5E7IA 2X9QA 1RWOA 3SF8B 2BR4A 2XJ4A 3ISJA 3BFKA 3QA3E 5LQRA 2I91A 2W5UA 1CJMA 2IODA 1KGDA 3H9JA 2FFRA 3F6RA 3PPWA 2R1VA 4PGHA 1T34A 3PFKA 1V3TA 2G7MC 5GVRA 1LB1B 1UJMA 5AVRA 3NHAA 3PGKA 4L95C 2I7VA 4ZCIA 3JRWA 4TRJA 2XUFA 4O2BB 3ZLJA 1E2NA 4R01A 3V1YA 1AT1A 2C9ZA 3DE2X 3HWWA 4Q7MB 4RNDB 3ILSA 1XYGA 3EYAA 1K5GA 1L3CA 3H2SA 1QG0A 2WKPA 4KIGA 1WBJB 2YY5A 2IXEA 2FSHA 3AESB 3WMFA 2Y4OA 2NYUA 2Q6LA 3DQPA 4TV8B 3GROA 2XQIA 2AC2A 4A0HA 2AEFA 3MWEA 2C1ZA 5FOXA 4DY4A 4RCVA 3GJ0A 1QQTA 3IKJA 3LK6A 1JE1A 3PE3A 3KQUA 4KDEA 2R5WA 4LQDA 3AHJA 4LZZA 2EQBA 3GRPA 4RENA 1XLVA 2IK8A 1N5LA 5AI6A 4WUVA 1XD9A 1MAWA 1R4NA 2C98A 3VGJA 3VO1A 4GYWA 4KIUA 1NP3A 1A76A 3K9BA 5C46F 3W4JA 3L0CA 1KE1A 5JSFA 2KPOA 3WA7A 1QRDA 1Z5OA 3NASA 2J6BA 2BGJA 2PMDA 3LZCA 5A5VA 3VJRA 1KEVA 1GPWB 1EI9A 2V65A 1TVKB 3NP7A 2G25A 4C4YA 4P81A 3L8HA 2Q0XA 4DQXA 4I4NA 4JS0A 2OG2A 1X8KA 1LSSA 2ZUTA 1O3YA 4U7WA 1ZIXA 3RFVA 1NF2A 1PDWA 4BNDB 4CG0A 5MDHA 5FBLB 4CLOA 3U44B 1JU3A 4NAHA 3QE2A 4WNIA 1YCFA 2H7XA 4OHPA 1V5EA 4KKXB 4DUPA 1CVLA 5AJVB 4KHZA 4AJIA 3TBHA 1M2GA 4DPKA 4ASUD 4DMHA 1N1MA 4OX9Y 4CTKA 3FN4A 3CQ9A 4DLBA 2ANCA 1UZAA 1VHJA 3PQEA 5HDBB 5C34B 4PZYA 3FHCB 1LUAA 5HW2A 2D0OB 2D0PB 1AV7A 3UAGA 3LSTA 2Z5LA 4JCCA 3SS8A 2DWCA 3KLOA 4HSGA 4B7CA 1ML3A 5I9IA 4KBGA 1B0UA 1RI1A 4IDBA 4I08A 1TQ8A 5EMHA 1FW6A 2YDXA 5JXIA 4HFNA 3Q7TA 1SBTA 3TZBA 5IPFA 5EUQB 3FOCA 4CCSA 4LJKA 1QNLA 3Q3JB 4HDRA 4RV9A 3TW0A 4XOIA 3WYGA 5JARA 3EGOA 3BVPA 1IEVA 3EGVA 4KKVA 2ZRAA 4AZ0A 1NW9B 2AUMA 5YASA 2UV8A 3ZGZA 1F38A 5HXAA 2ISSD 4A8TA 3UBTA 3AJRA 1Z33A 1GCOA 1MVNA 2ONJA 5FOQA 3N07A 4IEFB 4IIBA 2CY0A 2XUHA 4MV8A 3DV2A 5E7JA 5EZQA 1RWQA 5KKNB 4IDQA 3EVNA 5LWHA 4HYQA 1J2JA 1NXSA 1XU9A 1PHRA 1ZD8A 2DXIA 2J9FA 1IHUA 2HXGA 3A4VA 2HT1A 4G5HA 2IUYA 2UVPB 3ZV6A 4MEJA 5AKGA 1JP7A 1RYBA 2QRVA 3PPXA 3EQ7A 4QQRA 4E5SA 3NALA 1EGAA 4DNXA 1AV6A 3BRWA 3KWJA 1ZN2A 3A1EA 4IJ5A 4XDGA 4CN8A 3HLYA 1GNLA 1FDRA 3GNSA 5DVZA 1J2YA 2HQRA 4JVMA 5TEVA 2WIAA 3HP7A 4CNBA 4JENA 1EHIA 1SCNE 3IOYA 4FFSA 2D06A 1Z6TA 2BGIA 3KQQA 5L3RA 3X1ZA 3BWBA 2Q3BA 3OJLA 3V8VA 4EB3A 1J49A 5CLLA 4HAIA 1AY0A 3SZUA 1J23A 5FKJA 3PF8A 3VHXA 3OP1A 4AY3A 2A2ZA 4EEXA 1P1IA 1Z7YA 3S7TA 3GZ4A 2FSUA 4N8DA 5FD8A 3HRKA 5A3RA 4PYMA 2OCBA 1POXA 1WHTB 2P2GA 4PX5A 4AVYA 4EFMA 1B1CA 2ATVA 1DLJA 4RF2A 2N75A 1NFRA 4FFMA 1I9CA 2GBLA 3NG1A 3T6KA 3G2NA 5DGIA 2JASA 4E2FA 2Q1YA 1QQBA 3DNFA 1U90A 4R7GA 1PTJC 1NDHA 3TMKA 3JQFC 5K0BA 1E2FA 3E9QA 2ZI7A 5FTWA 3ANSA 3NWOA 3R7BA 3O4JA 4BQIA 1YRBA 2B30A 3QH4A 4D3SA 2RMKA 2UZ1A 2ZBGA 1Z3CA 1SG9A 3EEYA 5IVPA 4EKGA 2HMTA 3ET5A 3PG5A 1RYZA 2JFNA 1NN0A 1XYYA 2ZRGA 1E5DA 4RVHA 2M6SA 3W7BA 5KTNA 4LJ8A 5DGTA 1RC1A 2X5OA 5IAEA 4I3GA 1WXFA 3C3KA 4UM9B 5FOVA 4HXGA 3BQMB 2AE1A 2RARA 2HBZA 4NFHA 3X1WA 5C7IO 2E1PA 3KHUA 4NBSA 1USIA 3N0TA 2NUBA 3OQIA 3FLBA 1JB1A 5JSHA 2AFHE 3GR6A 4D5EA 1OTXA 2PXCA 2JVKA 4X93A 2EDAA 3I1JA 4MI1A 5AICA 2JDIA 5K03A 5EWJA 4GZLA 1HI9A 3Q98A 4KXLA 3SHFA 3TD2A 4CMBA 1YHYA 2JCXA 2CKMA 1O54A 2VA8A 2H9AA 2BGTA 4IAOA 4F6LA 4XVCA 4US2R 1DBSA 3R3XA 4XPIA 3MJHA 3IAS6 1WF6A 1P73A 2PVPA 4IQGA 1H8HA 3UC5A 2IYQA 3F7TA 4F2WA 1G2PA 1A8QA 3DDZX 1CZRA 4HGOA 2IDMA 5CJPA 4ZOEA 4FWIB 3K0KA 1C3JA 2Q41A 2I4IA 3T94A 2WD7B 3ELYA 3UV7A 3RHFA 1P60A 4Z8YA 2GAJA 5CTAA 3G49A 4QTXA 3ENVA 4Z49A 3R3UA 3R4VA 1DOAA 4IRMA 4ZJUA 1TM4E 2GN9A 4LWZA 3M70A 5J47A 1KFBB 3QIAA 5BUQA 4YJGB 2BZ1A 4OQFA 1ECJA 5BWCA 1H42A 1JKMA 1LPOA 3P32A 2XMQA 1HC7A 1HL7A 2ZS9A 3PNQA 3Q72A 1LI5A 4CF3A 5JOQA 3C4JA 2ZB4A 1SH7A 5CYOA 2C2OA 1D8AA 2VP5A 3IUMA 3MLBA 3R8CA 4BQOA 2XXBA 2XZOA 1CUHA 5JS1A 4YVFA 3DFFA 2AYZA 2JKVA 4JSYA 4WK6A 1EBUA 3NZEA 3HVJA 2R8BA 2V7GA 1JR3E 2VK2A 1HV8A 1YS9A 3NUGA 3ZIDA 1N2EA 4EEZA 4F6RB 1B14A 3COJA 1ZZGA 2LWIA 4KJZA 3NYIA 3JTMA 5LVAA 2QJFA 3JVDA 5HSGA 5EJ5A 2GM4A 4OGFA 3QVOA 1CRWG 3TAXA 2CDNA 2JCYA 3RVPA 3DOFA 2HM7A 5J4VA 1KKMA 3N2KB 3QNWA 2J3KA 5J4KA 2GWRA 1E1KA 1LW7A 4JL8A 2BDEA 1QG2A 3DZFA 1FUQA 4PVCA 1NNEA 2F4VB 2QENA 1RI2A 1V9SA 1Y37A 2ZYDA 4HGQA 3VZCA 4IZIA 2QVXX 3I6BA 3VQTA 4DPMA 1ODLA 1BQEA 3A3YA 5DHPA 2X19A 2CLDX 4ZK6A 2ZJ5A 2FI1A 1K6MA 3AB3A 1JHYA 2C2BA 3GH1A 2J46A 4MI6A 4ZALA 3HGTA 1RM3A 4S2UA 4Z9YA 3GK3A 4PLHA 3WDKA 2G8NA 3GLVA 3WDMA 3PUJA 4UCQA 3JAWB 4GBED 4JI6B 1ECCA 1QZTA 2RSLA 4GRDA 1JT9A 1WKBA 1J00A 2TMKA 2DLCX 5BV2P 4CMAA 3PC3A 1JNXX 1EJ6A 1U3CA 1JHXA 4MEBA 1C0IA 2VF5X 3WV4A 4X20A 2ZM6B 4J0DA 5CX1A 1QX3A 2IQIA 3NTRA 3FI9A 2FEAA 5HNKA 3VO9A 2G82A 1PD1A 5BMOA 1J99A 3LCCA 1VXRA 2QE7A 1TXGA 2EKZA 3P0EA 4BN0A 2FPKA 2IOYA 3NTUA 4IHAA 4RJTA 1HY0A 3DMTA 4V1CA 4Z1MD 4KSYA 4YP6A 4N0DA 4PBTA 1YQTA 1RXVA 5T64A 3UPTA 2ECFA 2G77B 4UTXA 3RS9A 3DCNA 2GYWA 1OIVA 4RTNA 1DO2A 1JHQA 1YCDA 2D4HA 5PNTA 4FC6A 2FFQA 4DLRA 5EA2A 5IDWA 2CEAA 2UUPA 3ZQUA 2EJCA 2CV1A 1C7FA 2RHBA 3AL2A 3MXTA 1IBSA 2XDQB 5DHTA 3ZYZA 3J81k 5CFMA 1GNRA 1CUBA 3PT5A 4I5GA 2ZTHA 5DGXA 1TTQB 3EW7A 1IPEA 4CV3A 2NZJA 7MHTA 4B8YA 1JXAA 1NFFA 3N59A 1GFSA 2EZ8A 4F97A 4R71A 1FL9A 1J1IA 2CLOB 3K7EA 3CVXA 1I4EB 1DU4A 2ZBPA 2ZCUA 3IERA 1FRFS 4LJ6A 2C83A 3CE6A 2GSDA 3KTAB 1S3IA 4BMOB 2G5GX 5B6JA 3Q8LA 1QP4A 1GTSA 3KYDB 1CDDA 5EIOA 3OFVA 3AIMA 3ZHTA 1SIWA 3CJQA 1JWAB 1SD2A 4ABYA 1GZ4A 3ME5A 1FUPA 2UKDA 2YWEA 4LGMA 5CBKA 3DZBA 3L4EA 1B73A 3NHSA 1BWQA 4EX6A 1TCAA 2GBLC 2I6GA 3E7FA 3D0OA 3IPXA 5JNTA 1JWLA 4IJ6A 5D5QA 1FJXA 4WKPA 4EYEA 2ZRBA 1QP0A 1QVRA 4Q4CA 3V4RA 1QDEA 1LD3A 4Y6LA 1V45E 1X3LA 4OLFA 1KAEA 2Z6UA 1PZNA 1X80B 1KIFA 1K06A 1QG6A 5EHXA 3D8TA 3J7TA 4XSGA 1W36D 5DBGA 4RK4A 4XJXA 3HE3A 1RS0A 2QGFA 2YFKA 1TJPB 4KO1S 3FYSA 3MUEA 1SA0A 3NHWA 3KQOA 1N7HA 3JYOA 1HQKA 3HCDA 2J9RA 3F4LA 4K6HA 1T3TA 5EVJA 4BO0A 3ZDDA 4I9FA 4I3HA 4BXOA 1AF7A 2HRZA 1HRDA 3P9ZA 4GLLA 3NYRA 2VK1A 1ATIA 1SCAA 2BFFA 3RVDA 3UHFA 1GPAA 3PGMA 5C4IA 5G3YA 1XNGA 2VHWA 5AW5A 2RGDA 2A5DA 2DHQA 2FG6C 1AB5A 1WOYA 1XPJA 2KSQA 2PYZA 1PQ4A 1LZLA 1C4XA 1VYVA 1WLSA 2WZCA 4PSUA 3TD9A 3GDGA 5JH7A 2GNAA 3AMVA 4ZA2A 3T7KA 1YZNA 2FMTA 2P2DA 1MZPA 2KYRA 5D3KA 2A8YA 2BY4A 4K8RB 4ZT5A 5F73A 5CVTA 1KMQA 4WZZA 1I1OA 4DNOA 3C6XA 2BEUB 3WZLA 1COZA 3H1AA 5JAQA 1RWWA 3LBFA 4HZGA 4AZVA 3QG5A 1KPIA 5JTTA 3Q0EA 4YIKA 2G63A 4TS3A 1U99A 3I61A 3NWJA 1IDOA 1E3IA 1QH1A 1P6XA 3TNJA 2HR1A 4DSNA 2B0CA 5DOVA 3ZWMA 4KSBA 3D0QA 4CMGA 4TTSA 4F4IA 1T1GA 1P8JA 3TQQA 5EFOA 2V98A 2MSEB 3M9XA 1YA6A 1FUOA 1L7BA 1N2CA 1XOIA 4KDCA 1RC8A 3PPVA 3GFOA 5BYBA 4COOA 1YSCA 1I2ZA 4I1YA 3D4OA 3MILA 4RSRA 3AUJB 5BR1A 4Y2VA 1E6CA 1YZVA 4KAFA 1ICEA 4BC0A 3COWA 1J42A 1P39A 3PNBA 4QJIA 1NULA 2BZ0A 3SBOA 2QG4A 5LLTA 3TE6A 3IJPA 2ICAA 2O48X 5TMBA 1KXJA 3I2GA 4EG0A 4I55A 5BQ3A 5LQUA 4NOMA 4S1VA 1I5EA 2B6NA 2BGRA 3AR2A 5I9NA 2WIDA 5COQA 4Q5IA 2PS3A 3A4YA 4X00A 3W05A 2AK3A 1H0KA 1Q1BA 2REQB 3CLTD 4UCFA 2IT1A 2QYTA 4ZQFA 4GUAA 4ENUA 1OI2A 2CZCA 4IBOA 1X19A 1Z5VA 1OAKA 1AGNA 1HF3A 1GIAA 3HCEA 1XMQB 1C9KA 3OAAD 4P53A 5EESA 3ZZNA 1L1RA 4OKIA 4B47A 1ENYA 4XX1A 2P4UA 1ZMXA 3QJYA 4GE0A 4KRGA 4R9VA 3R9KA 4AC9A 3HTXA 3WICA 1YK0A 4QVKA 1DBQA 4TWJA 2HRQA 3R7SA 1KBOA 5CCBA 1UBNA 1Z8HA 1CNEA 4P36A 2XKJE 3OSUA 3MS7A 3HR8A 3O8DA 2GRJA 5IC6A 4YQFA 1M0TA 4IQ8A 1GO2A 1IL0A 4ZVUA 5HIIA 4FN5A 1K08A 1U4SA 3ABZA 3T12A 1XTKA 3LF2A 2OM2A 5DBFA 3DHYA 5DYGA 2HUPA 4RO0A 1GRQA 2I3DA 5T5QA 3TIXB 3JVIA 1MEJA 2OSVA 5LBIA 2EP8A 4M0FA 5LZ9A 1Y7HA 4Q9DA 3HN7A 4B17A 3BAZA 3LIIA 4YXWD 4FKZA 2HVGA 1G21E 3DMTC 4PPQA 1WNFA 2FWIA 3GZTB 4CF7A 5LMCA 1UK8A 3GOQA 3P2MA 5FEMA 4OHBA 1Z7EA 4C0LA 1Q95A 3ZJUA 4NRDA 1WP9A 1QIJA 1A04A 4WERA 4XUGB 4CUJA 3GUUA 3I42A 1TUBB 1XTZA 1XD8A 2ETVA 4MR7B 3K9FC 3ECSA 1W8DA 1MIHA 2QQEA 2YV4A 3DBHA 3JQAA 4EJSB 3MOSA 5E38A 2D2IA 3HJGA 4CDMA 1VHDA 3TZKA 2GYYA 3HO8A 3INRA 4UVDA 1IZ8A 4X54A 5TNXA 1VE6A 1RJ9B 2J9GA 2AHOA 2PD3A 4Y18A 1QHYA 5KQPA 5JZOA 3QEMB 1L7OA 1QLHA 4G01B 1K63A 2IX9A 4IKPA 1SXIA 2VPPA 3B1VA 3YASA 3WHLA 3M34A 1ZIDA 5TQJA 1JFFA 3FNRA 1FTYA 2XSZD 4O2BA 5AK5A 2X41A 1IOWA 4HMOA 1WPXA 1X38A 4QYMA 1B41A 3FYUB 4I1SA 1HX7A 1M6VB 3PRHA 1SQ0A 4NMXB 5IAGA 4RESA 2PE5A 1G9XA 3OOJA 2B4YA 2OQIA 4FYIA 4YPFA 3F78A 2GAOA 1YRYE 2IGBA 4X24A 1XDGA 1LNQA 3GLFB 4U3JA 2GTHA 4QULA 2EW1A 3BTSA 3L6EA 1EFVA 1GGNA 2AOUA 2I54A 4HAXA 4RW0A 4UMVA 5J63A 2G1AA 4OU4A 2WKQA 4MQFB 1A9SA 1G5FA 5HGXA 3QPDA 1P77A 3OWOA 3LYLA 3B70A 3OPXA 5G3ZA 4WFQA 2OBXA 4TMVA 1FDOA 1ZM2A 5IJZA 1RXIA 5H68A 4Z4EA 2NN3C 3HCFA 1U0OC 4RTSA 3QYPA 4ESHA 5KOHB 2EWWA 1HDIA 3D5TA 5KNBD 4UM9D 1B00A 4W8HA 3KAPA 1UPXA 1B6SA 3L1KA 2PLFA 1HDYA 3DONA 4Y1RB 1DC7A 3QVKA 4REMA 4IVPA 5EIEA 1PR2A 3H2BA 1YJ5A 2G71A 4XH9B 1A2OA 4UEKA 2H2GA 4GE3A 3PX7A 2PYDA 3HVKA 1QGAA 1SKAA 2Y0EA 4DKXA 2JH9A 4MKIA 4O29A 2IWHA 3UMJA 4K05A 1BXZA 1M5RA 4OU5A 1BYIA 1NZDA 1NNLA 2OHOA 1T2VA 2PUHA 3DGFC 3U4IA 4KQHA 4WCDA 5EJGA 3HK2A 4ERNA 5CGZA 1TLTA 4YDQA 3KYCB 1YASA 1JYEA 3EA0A 1YQGA 3OZGA 5REQB 3T9FA 1SKMA 4D1YA 3ETEA 3TECE 2QMUA 1MJHA 5FEUA 2QTMA 1ZCZA 2CXUA 5KX5B 3ZHOA 2IZ1A 2BKVA 1NRIA 2DQYA 2E37A 5ULLA 2P6UA 4PS1A 5JO0A 2PUEA 2KI5A 4WAUA 4L3VA 5JDIA 1RLUA 4FJ1A 1SK8A 2C96A 3MWGA 2O1SA 1NSYA 4N6OA 3CXUA 4DADA 1Z0AA 1MC1A 5DJ5A 3UGKA 4OX9B 1L5SA 3AEKB 4QM7A 4CF5A 3F5SA 4TRNA 4ETIA 1WO8A 1P7VA 3ONEA 1UCFA 2GAAA 2PLRA 2QRUA 4U6SA 4URVR 3J80A 1NZFA 1KPGA 5F12A 2PXHA 1RXWA 4K6KA 2W11A 4PC2A 5JAIA 1T25A 2HWYA 3C5CA 2IV2X 1DELA 3FPFA 3QVGA 1W9MA 3WIVA 3TLZA 4JYAB 5GOZA 2PKQP 3VYUB 4M8SA 1JDVA 2H2IA 1EDOA 3LA6A 4UTNA 2J4CA 2WYWA 3H5WA 1CY4A 3GPLA 1YQDA 1JFVA 1MIOB 1T24A 3KZMA 5HF5A 2PBZA 5LU9A 4QPCA 5CLGA 5ARDA 3AX6A 2WM3A 3H0KA 3EEFA 3WMRA 1CJBA 4CE6A 1XVTA 3N74A 1DNPA 1FFBA 3ZTYA 1Y63A 5CEJA 4ZVPA 1I5RA 3H1BA 1LZKA 2JAPA 1U8AA 2P1DA 3DVRX 2PGAA 3LFUA 3ORSA 3VC7A 1JDUA 3WYDA 1G20B 1YIAA 5L95A 1RPZA 4X71A 1CRQA 3GUVA 1IWOA 3N8KA 2QL6A 4XEHA 3HEAA 4JJ4A 3TR5A 1C2YA 2X76A 4KO2S 4G0OA 2B35A 2P9HA 3QJGA 2CT8A 2LDBA 3PQDA 2MR6A 4JASB 3GVIA 4KGXA 1JQEA 1MDBA 2YYYA 3KSMA 1GL7A 4NQZA 1S9DA 4J7CA 4JY7A 5IN4A 3BH0A 3LJKA 4N8EA 3I8SA 2C97A 4TLAA 4JEHA 3ZI4A 2F1JA 4Q3BA 1FFXA 3QFFA 3OM0A 4C87A 4P2GA 2ZPUA 3T0IA 4KIFA 2FKAA 2YV3A 2ETXA 1ECLA 4P4LA 3G5UA 3KKPA 2A0FA 4FFBA 4X97A 3SE7A 4YRKA 3FJYA 1U2QA 2JANA 2P9QA 4ZU1X 4E4TA 4XARA 4JLWA 4G89A 2F59A 3V2GA 2C1EA 4OQQA 1V16A 3R3ZA 2Q1SA 4KMRA 2P9TA 3C5HA 2GN4A 4GAEA 4D9HA 1GSAA 2W9XA 5AHOA 3OZRA 2AOWA 5CVDA 3UJPA 1E9VA 5AVYA 5I7SA 3IAM1 4Z4IA 3JQ8A 2DM6A 1JZTA 3WMXA 3QXHA 1GFZA 3KJNA 3F49S 3T7JA 1JFLA 1KI7A 4WZBE 3C3AA 1WY7A 1NNI1 1THTA 3OHMA 1JG4A 3O9ZA 3M6VA 3I8XA 2AXNA 4CEHB 3KSUA 4PIVA 2R7LA 2CGEA 4LMAA 4BFSA 1LU9A 4NYMR 4BU0A 4EYQA 1V8OA 2J07A 4B6OA 2DJ5A 2QHXA 3KJXA 3CF4G 1QHXA 3F6PA 5B3JA 3VOSA 1R3DA 5BQOA 4KFTA 3QQ5A 4PCLA 3R74A 2IZ6A 3AJ8A 1KK1A 2HB6A 3IUSA 5D1NA 3AETB 3WL4A 3EIFA 3S8EA 2EWMA 5D84A 4XIGS 4PFKA 3TNLA 2W2OA 4L9WA 4LYDA 2Z30A 4POAA 2MWMA 2JFPA 2ZDGA 4MJLA 1CEYA 2JCGA 2NPIA 3NBXX 4POOA 4CXMA 3ENKA 4AIRA 3AGQA 8MHTA 4U2DA 1TF7A 3T9BA 3V2HA 3Q5EA 4FJ2A 4BQQA 5LOVA 2FX3A 2CE2X 2GZ3A 2ZAIA 2X0KA 4O4HF 2R1TB 3SYMA 3GYGA 3UWDA 3ZZMA 4X61A 1KEKA 3FOEC 3H2JA 2BPOA 2XT6A 3IGFA 3JALB 4QVGA 1RSZA 3ZVLA 3ICEA 2XEDA 2G07A 4YMUA 1LPSA 4EVSA 3B38A 1GCIA 4GH5A 1KMNA 1U3VA 1KRHA 1X7HA 1TA4A 4HMPA 3RSHA 1F2VA 4A9AA 4DDKA 3FDZA 1NM5A 4M7WA 2D5LA 8OHMA 4RYDA 2EZUA 1QK5A 2QI9C 3KYIB 3LMKA 4G9GA 3ECCA 5AKLA 4KQ6A 2E9FA 3JQRA 5EJFA 3LPCA 2WU8A 1FPMA 2NU9A 4HDCA 4EW6A 5I7OA 1AMUA 1WEHA 1R0RE 1OA0A 1PR3A 1U7UA 2RGUA 3D3JA 3OEYA 5B4VA 3C5EA 3LHSA 2QMQA 4A8JA 2W2LA 1YV9A 4Q3KA 1ZJYA 2VK4A 4X7PA 4B7ZA 4AN4A 3AERB 3H04A 4OHFA 4EFDA 1ZNXA 4F6RA 3F8WA 2K4MA 5DNCA 3F46A 3VV2A 4B3BA 3NDRA 3WADA 4E2WA 4MICA 3WL6A 1AQ6A 4FHFA 3P27A 3R9XB 3IJRA 1CDOA 3HDHA 1O6CA 2OZLB 4OQDA 4Q19A 2GXAA 2ERCA 1VJDA 2ZBQA 1UZUA 4MUGA 3KU4A 5P21A 2ZPTX 2ZRLA 1KO1A 1H66A 3Q8WA 5JDIC 4C05A 4JITA 4KR7A 4HX9A 3M3PA 4ZGBA 3TKAA 1OY1A 2QI9F 3L41A 4BDTA 4E0BA 3FGPA 1F4PA 5LA6A 4QWMA 1P5RA 1KFEB 2WUWE 1JA0A 4GLOA 4H4DA 4EAQA 2ECPA 1Q12A 1SCUB 2NZ2A 2I3ZA 1RAAA 1EX9A 2C2WA 1NPDA 3LVFO 3MINA 1TECE 2OD2A 2C1XA 4KUEA 5D8DA 4F92B 3KSDO 4I81A 5E4JA 5C1DA 2QWXA 1JB9A 2AOTA 2M1XA 3QX8A 3KOZA 2DY1A 1P8AA 3JRXA 2I3BA 4MVJA 3TR6A 1C3CA 2XKBA 1U0SY 1Z34A 2AD1A 5B3AA 5ENDA 1NRWA 4H08A 5T67A 4YMHA 1NR1A 4GPAA 5HTKA 1J5PA 4UHBA 1DTEA 3T41A 2VWQA 821PA 3W6UA 4PLCA 4U7FA 4Z2AA 5KHOC 3ZHRA 5IT9A 1DXHA 1FXUA 4ROTA 2I7XA 4CQLB 2WFMA 3RKUA 1K2VN 3SWWA 2FUSA 1Q44A 1V35A 2CF5A 3KDAA 3QVMA 2PPVA 3FW1A 2EXXA 4M1WA 4I99A 4KRYA 2HA3A 2WT8A 3EVEA 1LGYA 2CD9A 4IYJA 4NECA 1RMQA 2BYTA 1DFIA 4RTKA 3C74A 2ORYA 1PL0A 3QBDA 4EI9A 4RULA 2XDQA 2IBSA 1IOLA 1OTYA 3H05A 3M6IA 3O8QB 4EK9A 1Z36A 1YJ8A 1TYCA 1FP7A 2EFHB 2Q9UA 4U6NA 4OLAA 1JMVA 4UE2A 4TV9B 3REGA 5ALOA 1V5WA 4XCXA 4B2PA 4KQIA 2GK4A 2WFZA 4GI5A 4OAOA 2ZYIA 3O82A 2VDPB 1E4VA 3KTAA 3NATA 6REQB 5EHQA 4M0LA 4C2AA 1AKWA 2H63A 1VGVA 2Z3ZA 3FPKA 2QU8A 3R7DA 4W5QA 1E2HA 2CLLB 1QIFA 3G8CA 4DXDA 2VEDA 1ODIA 4ZGWA 2Z2XA 3PSAA 3KVYA 5CPBA 1TA9A 1ESNA 3FYDA 1ZM4A 5IEBA 3A6PC 4UAUA 2GEKA 1W5FA 4ZV7A 1GU0A 4IMIB 3AV3A 4AKEA 3B6IA 4ITRC 2QSJA 4PZAA 5EKSA 3SN6A 4AO7A 2FGKA 5IJ0B 4U4AA 4K6MA 1QIGA 2R84A 4U02A 4ZVLA 3VC1A 1SIBE 3AY6A 1RRFA 3E7WA 4IUBS 2REXB 2GETA 2DBYA 3P96A 1KKLA 4JQSA 5CK5A 3NT2A 2E5LB 3GF4A 3F3KA 4ZRDA 3C3CA 1M6HA 3JW8A 2VJLA 2QD1A 2Z95A 3U48A 4D5GA 2AKAB 2KJQA 2VJPA 4J76A 3V7FA 1A9ZA 4EEIA 1Q83A 4DDUA 4TQUS 2OXFA 3CA8A 1KQ7A 3F96A 3QEJA 5E4TA 4MI3A 1Y8AA 5KDLA 1DX6A 2VBGA 3FWPA 2ZBUA 4RLSA 3UAZA 2BEVB 2IYWA 2YZNA 2GCEA 2G5CA 4HEA1 4JJ7A 4QBIA 5B3JC 2IA5A 2J7KA 4IVQA 4I4TA 5J5AA 1ZX1A 4MYCA 3WBFA 4CM4A 4B6GA 2YJ3A 4DIMA 2YWFA 3E35A 5FO1A 3W2TA 2H2DA 4JUBA 1OSNA 1HZJA 5BP7A 1P29A 2JBAB 4DIUA 1RRMA 2G36A 3BMQA 3ZCRA 3LM8A 3RWOA 1WCIB 4RANA 4FD2A 3I4FA 1T3HA 2JLBA 4RSMA 4CGZA 3DZKA 1DHTA 3SJ7A 4JR1A 2JHFA 3BTUA 1IUPA 5EWMB 3WLKX 5M7EA 2YY7A 3GT4A 5DNYB 3MUFA 5JAMA 2Q6IA 1OU4A 1SHUX 3NGXA 4B0OA 4IDAA 1RKUA 4UD2A 1ESEA 2IYUA 1G291 2YH2A 1ORVA 3UANA 5A5EA 2HI0A 5JNVA 3RABA 1SB8A 2FZLA 4M7RA 3BG5A 3MTBA 1NM5C 1SKBA 3IMEA 3PDJA 3TRIA 2W6IA 4KX3A 1NR5A 4EB8A 1DOZA 4NESA 4YAIA 2EQ5A 2GSWA 1JRLA 2ZUVA 3E8SA 1SG0A 1UBHS 3KTFA 1XZKA 2DAPA 1T9HA 4LS3A 4BX3A 3RS3A 5ICSA 2H1SA 2R00A 1S1MA 4A8JC 3UH0A 1GADO 1YO6A 5JMOA 3JWPA 4OHWA 4OHOA 1NLZA 2FSPA 1BVYF 1EVZA 1Y82A 1BD3A 2HCJB 3T34A 1S2LA 1W5SA 2I6QA 4N18A 4TUYB 3ZBPA 4KZPA 3RVRA 4E5KA 5C5CA 4M9XA 1LVGA 1Z82A 2GBCA 1A9XA 4DV2B 1VECA 2REBA 3OVMA 2VLBA 1G63A 1ILEA 5AJZA 1EXDA 1PR4A 3FX2A 1JKXA 1KWKA 2CNWD 4H60A 3O4RA 1OXKB 5HKOA 4GZMA 3URMA 3KQPA 4G26A 5DYYA 2ZIXB 3BK7A 5CJ2A 1BU5A 2I71A 2WV9A 1KSFX 1NRJB 3CONA 2CLCX 3LWBA 4NYJQ 3HSKA 1NXXA 5A4FS 1OLUB 4J0HA 2MINA 3P4XA 2N3ZA 3NBKA 4LYGA 1L5ZA 5E9AA 2HDOA 4B6EA 4B2YA 1A27A 4DVGA 3I5YA 3M3HA 5BOSA 4PBRA 4C03A 4NCKA 3W90A 4AWBA 4M76B 1K7SN 1UJCA 3NOQA 3H6GA 1TJ7A 3D6UA 4MUNA 4BGDA 4F7WA 1EDEA 4P3PA 4I5FA 4NZ9A 1ETUA 2W6CX 3VJMA 1W2WB 2HU5A 1M34E 5HCIA 2Q6VA 4QUDA 2OYSA 3RSQA 3IQGX 3AU8A 1QHHB 3HSSA 3H18A 4EJ6A 1AGPA 2Q3JA 3I2FA 4J3FA 2GTPA 3C5VA 3IO5A 4XYLA 2NV0A 4F4CA 2FPRA 2WSLA 3OG9A 4L9SA 1TQDA 4ZOAA 3E9CA 3TD6A 3T3IA 3WRVA 4N40A 2JLZA 2JEZA 1WBBA 2GFQA 1KA9H 3RVJA 1TUBA 6GPBA 4A0GA 2C5LA 5CCEA 3PDUA 3HCWA 1FUIA 1Z0DA 3OU7A 4IX1A 4DCTA 2IY8A 3LT1A 2WZBA 4L07A 3G13A 1GAWA 1HWYA 3HA5A 1S01A 3LIPA 1V5FA 4GG1A 4J6EA 4JFAA 4WFIA 4LF7B 4E4RA 2X6RA 3EH1A 1PFYA 1XD2B 4LGVA 2SBTA 2YBDA 2GAIA 3I9NA 7REQA 1R10A 1RZRA 2XGOA 2EFGA 4WN9B 3EG9B 4F3YA 2VHXA 3DD1A 3O26A 4U2FA 2NQ8A 2W71A 4DLAA 3H5VA 3MB5A 5E6UB 4ZAWA 4IQ4A 4QG7A 2ECOA 3WGYA 3VPSA 4LF6B 1RJFA 4ZMSA 1DJQA 3SHTA 3N8NA 4FR0A 4W63A 4JJ8A 4JOCA 3KZOA 5H80A 1A77A 2R8YA 3KQVA 1M2HA 3WNBA 4TL8A 4HWTA 4HTFB 5CDFE 3GLFA 1FLVA 2CXPA 4KXVA 5C5DA 3F74A 5AW3A 2JD0A 2VFAA 1EESA 3O4HA 1KL7A 3FGZA 2O2ZA 4AUMA 1GXSB 3AVYA 4D57A 4E07A 3SQDA 1IN6A 4PZCA 3DT6A 1Z0FA 1JLKA 1CR1A 3E2MA 1U98A 4TMZA 1W34A 5GONB 2ZVPX 3N76A 5ALKA 3U7EB 4ALNA 5BN3A 1JHUA 4RHFA 2OXRA 5AW0A 5FWYA 4DB2A 2Q5QA 4ZOCA 1R27A 3PE6A 4JH0A 5KOJA 1ID8A 3EIWA 5D5PA 3PXCX 3W2HA 1UJNA 1U7WA 4IDFA 2NUTB 3CWCA 3VR2D 3SKYA 1HLFA 5KMGA 2OECA 2CNOA 2IYTA 1MO3A 2CFTA 4TKUB 4ER0A 2ZJBA 4NFSA 1EWTA 4DUGA 3L4KA 3M6LA 2XYQA 4DA7A 3IE1A 1QYDA 1OYVA 4MWEA 5JFGA 4Y1RA 3U60B 1Z7BA 2VP9A 3WLEA 1YJCA 3K35A 1UFRA 4H0FA 1FP4B 3SEFA 4KPUB 3NT4A 4HEHA 3F3SA 3ANXA 3PXXA 4G84A 4XYMA 2R6HA 4XA8A 2JEOA 1D6SA 1P9NA 3G8BA 1KP2A 1CXZA 3W3AH 3FWZA 3WK6A 1VKRA 3SZGA 1E0KA 3M3DA 3KYCA 3RYHB 2ZQ5A 4KMMA 4LZAA 1MOQA 3UG6A 5TQ0B 3UY4A 1U1IA 4FOOA 4KQJA 4QDXA 5L6LB 1YFJA 1I1QB 1TX4B 4KXWA 1L8AA 3WAJA 4L7QA 2JAXA 5EFZA 4L50A 4EHNA 1G3IA 5TSDA 1NATA 4BAGA 1Y4ZA 1OXXK 2Q28A 3MWLA 2G88A 2XTNA 4TLDA 4B40A 5JMPA 5EE5B 3B3JA 4EIWA 4M87A 3NOOA 4BAUA 4YUZA 1NC1A 1QFYA 1UFQA 2YOHA 3OM8A 3QW4B 4DA4A 4C3UA 2Q50A 1VYHA 1WXDA 4UAJA 3NEJA 1ULZA 1JHRA 5KYYA 4BIMA 3QKSA 4I4TF 1P0QA 4TZTA 3VSCA 3UW3A 1ZXXA 1SUSA 3QY0A 3QVXA 5C8DA 3KCNA 2YJ4A 3L02A 4JXZA 3FPEA 4TS9A 2MU1A 5AVWA 4LDAA 1C2TA 3CLVA 1TM2A 4MPDA 2R00C 2ZYVX 1IY8A 4Y9RA 3IQFA 2C7GA 3CT4A 3ZGYA 4KH0A 3BCSA 3L05A 4L57A 1XTJA 2VJNA 1P7YA 2R8PA 4UKDA 1E1LA 3ZR4B 2BGMA 4U7DA 3QWHA 3JQ7B 4D8UA 3W5UA 3DL0A 5HILA 5LU8A 3AVUA 1H1TA 4HHEA 1KO5A 3K30A 1UFOA 1DARA 1VL5A 1P7PA 4O4JA 5J2TF 5KWEA 4LSWA 3Q9NA 4Q1DA 2HLDD 4GX5A 2DULA 1H6DA 3TOVA 4A0FA 3IQEA 1UAYA 4JYPA 1M73E 4V0RA 1VLZA 1T9AA 2HK7A 1KC1A 4WECA 2BOVA 2VKTA 2FZEA 2I1WA 1QS0A 3EK2A 4D4LA 4CFSA 3GPIA 1ZIYA 2ZK7A 3L4JA 1UJBA 2LKDA 3ROQA 1U15A 1ISMA 1BAPA 5J59A 2MYPA 4C1NA 5HR5A 3F9RA 2NVUA 1T3LA 2N9UA 3GI1A 3G2JA 1RM4A 1ODCA 4WK2B 3M8KA 3QKUA 2BFOA 4NYIR 1QGOA 4R16A 3VAZA 4W5NA 2J3HA 1DBRA 4ZVQA 3T4XA 3O4IA 1OWOA 2HV9A 4BVHA 4IHQA 4P5PA 4MWGA 3ROGA 5E7QA 3W77A 4E22A 3ZD6A 3JSAA 5A9TA 3PR1A 1E98A 2A1IA 1TMGE 3D81A 1JFRA 2FJUA 2NGRA 3GRKA 3NH9A 4R1TA 1TAQA 4JIMA 2ECKA 4FMCF 3OPMA 4OQNA 3SM9A 1E7SA 1HLDA 2O2XA 2XCQA 2BM8A 1XJCA 1GA1A 5C8YA 2BKUA 4EHAA 4ND3A 4DV7B 1UUFA 3VR4H 1NMXA 1MHPA 2WJVA 2JFZA 4KREA 1E1CB 2FPWA 4NOLA 3ZU4A 4F2HA 2ZRPA 4NHEA 2IPOA 3ADOA 3WJ2A 5BUCA 1MHTA 3UB2A 4EUNA 2ZJ3A 4WMLA 1T6NA 3T0FA 4D8VA 1HRKA 3ICVA 3NXSA 1R7RA 1XCLA 2AOXA 5FL3A 4ZO6A 4YYEA 4DCNA 2Q3FA 1UAAA 1BMFD 1MBZA 2EFDB 3WKBA 3QX9A 3FSRA 1FB5A 3GDFA 1DEXA 2CMHA 1ICIA 2F3PA 2QT1A 2QN7A 3CWQA 4F38A 2O2DA 1CUVA 3GJSA 2IEIA 1QIDA 2QK4A 3A0RB 3IIJA 1XEFA 4TWAA 5ESRA 4J3NA 3VNSA 4MGHA 3T9CA 4W9MC 5JC8A 4ZJZA 3OICA 4JU8A 3VPAA 3KB2A 1HT3A 3EZ6A 1QBKC 3HC7A 1V2HE 3MRTA 2D2XA 3FSGD 4QAJA 2IEAA 5SYAA 2M6LA 3EODA 2R1TA 4EA7A 4D79A 4CHGA 1BWPA 2G17A 1QUEA 2BZSA 2XOXA 5K09A 3IEXA 1IN7A 1O6FA 2CLIB 3CSSA 5D3MA 3TO5A 3WFIA 2IS1A 3EZLA 2AG8A 3K4QA 5IKMA 3O4VA 1VIVA 2JGFA 1FUYB 4IPTA 3H0EA 2C4WA 4HQNA 4PG4A 4OK6A 2F1RA 4GMFA 3JD1A 3V6MA 1DKRA 4N01A 4RA6B 3I9FA 3ZZTA 3IYLW 4EGAA 4P93A 4NDAA 1WRBA 1A2KC 4BP1A 3IBFA 2O8DA 2HQBA 2X0FA 4AG5A 4N82A 2YJNA 4YAEA 4CIVA 1T3GA 4MJ7A 4ZVTA 3OQOA 3NDBB 2GERA 1JHPA 4WNAA 2LP4Y 3CO0S 1XX6A 1Q20A 4ND5A 5FCDA 4LOHA 5IP5A 3HB4X 2QUHA 1LTKA 4RHYA 4L6CA 4HGVA 2OQ2A 3HL4A 2GPTA 2LE0A 3NNNA 5JVDA 5KYTA 1OH8A 4BV9A 1D7AA 2JGJA 3E70C 4IJMA 4U2EA 1WULS 3K5IA 3KL2A 2X3FA 3AOEA 2K6GA 3NHMA 5AOAA 4EPXA 1KQGA 1FEZA 1X2EA 1Z5PA 4AB1A 1Z45A 1H2ZA 1M1YA 3CTMA 1L7VC 3FUVA 3JQQA 1Q1EA 4LUCA 3C97A 2QRJA 5DWDA 4DB4A 1PWZA 3R9XA 1BYUA 2YKGA 3H11A 4L08A 2AI3A 3WGQA 2EKBA 2C2HA 2P5SA 3WGVA 1LC3A 4L4YA 2J48A 5CUQA 2C20A 4LMRA 2LCQA 5TARA 1X6VA 1PR0A 4AZSA 5B2EA 5CCXA 1LWNA 2FN9A 1KO4A 1NVTA 1AKVA 3OFJA 4EJ2A 4KO8A 3KOUA 4D2IA 2XQJA 5BYKA 1C3OB 1OR8A 3NO9A 3K5WA 2PJRA 2HA5A 1OB2A 4D02A 1PJSA 4KUGA 1V9LA 4ZAYA 5ISMA 2Y71A 4KIJA 3HGQA 3OX4A 3VKGA 5DNWA 5ADWA 1NJ2A 5C53B 2DRIA 2VYQA 3PL1A 1Q5NA 2C2XA 2D7CA 4CI9A 1FYXA 2YMMA 5IM4F 3JAKA 1D1QA 2HCTA 1GAEO 2ZI6A 2FHPA 3DCJA 1PAUA 1TYEB 3E1KA 4MRSA 5A71A 1RFGE 2JIDA 1Y1RA 3QV2A 1OMOA 4DFDA 1WB4A 1MV5A 2NO4A 4N5NA 1MCZA 1BKDR 2D3WA 4L6AA 1OXTA 2Y1WA 2VZ8A 3O8OB 3RK0A 2YW9A 4NATA 1Y3DE 2YN0A 3K8YA 3RWMB 5F1PA 2R6R1 5FQNA 5B3KA 3K1ZA 5AK4A 3GCWA 1L4KA 4RSGA 2PTRA 2ZIWB 3JD4A 1XZPA 5LNK6 1XRSB 4MRAA 5B1IA 2B37A 2I55A 3ZGXA 3HVIA 5DH9A 5ECGC 5FADA 5A4AA 5FAKA 1SBZA 2GM3A 4Z99A 1FFCA 5CA1B 1S3SA 1U7HA 1UKYA 2E1RA 3O9MA 1UMCA 3H17A 4OHUA 4Q4HB 3SQNA 1KFJB 3W6NA 5SY9A 4Q9LA 1ESDA 2Q8PA 3PX2A 3SM3A 1CZKA 2VP3A 3FE2A 4V24A 1KZYC 2COEA 3A06A 4YJ3B 5EIWA 1J90A 4RELA 5FHQA 3ZDEA 4HZUA 4ENPA 3PZBA 3CZ5A 2C5BA 5CBPA 2C92A 2DUMA 2W6PA 2A4MA 3L7JA 2WLTA 2VJMB 2I2BA 4KAAA 1LX6A 4AF8A 3N2ZB 2X86A 1HE8B 3FVRA 2JLVA 2O3RA 2EGHA 1PQPA 1QHSA 2BFBA 4OMUA 1VL0A 3EXHB 2VAVA 4PXAA 3J7AC 3NWPA 2FP4B 1BMQA 3NKVA 1I94B 3CPEA 1I0LA 2FCRA 1U7OA 2BGLA 1JAHA 1UBUS 1GT6A 1R5JA 2QUJA 2NMVA 4JR0A 2DWUA 4C0BA 3ZDRA 2ZETA 4AU1A 1AH2A 3ZHSA 1E2QA 2EKQA 4F3TA 1BEEA 1ULAA 1B8OA 1UR5A 2NQTA 1TVMA 2V58A 3VO2A 4ZCSA 4K7JA 4JI3B 1C8VB 3CT6A 1NDQA 2HD4A 5IVHA 4M60A 4JQOA 4DF3A 3BD8A 5KYWB 4GNKA 4YQEA 4PM4A 4FP9A 4DBLC 1TGVA 4F1JA 4RL6A 1ZA2A 4YT2A 2HK6A 3D8HA 1WQ4A 1TK9A 3L0OA 1UJ4A 4GX0A 3E5MA 3C8ZA 4N6GA 4EPVA 4A3SA 1MENA 2EARA 5JD4A 4KV7A 2P2ZA 3SJUA 4UD6A 2PT9A 5LKRA 4P5EA 4JJKA 3OKPA 3EE6A 1GR1A 1P61B 2RAUA 3R5XA 4JFRA 4NQRA 3EXG2 4P4SB 2QQ5A 4YP0A 3LLSA 4OCZA 2Y05A 2ZUSA 4R8MA 1A5AB 1Z8FA 4UFPA 3N8DA 4LOLA 2ONZA 5CD9A 4RU1A 2PR7A 3MWYW 3QFCA 1YDHA 2H8KA 3D5QA 3QQPA 2HSGA 3KK0A 2ZIZA 5DP1A 5IXJA 5CLQA 1DWPA 2AWNA 4HDNB 2DJIA 5T4HA 2H29A 4NCIA 1DV1A 2HWKA 4MKZA 4NS4A 3TW8A 3KKZA 1L4EA 4JA0A 5AHXA 1Q15A 1DRJA 1NIJA 2RJ3A 3PIIA 2JVJA 1W1UA 3QEKA 2ZU6A 4K9DA 4KG7A 5A4KA 5BW6B 1DGQA 3GMTA 1G18A 1L8LA 2D27A 4RV5A 3M1AA 5CPFA 2H2WA 1X8LA 4TPKA 4KK3A 3ICCA 4LHXA 3V32A 4LKOA 1NE7A 4I2NA 4CG1A 1S02A 4PHTA 1NJ6A 2YXEA 3N0WA 1B2LA 3PDIB 4GR5A 1CRZA 2X9LA 5FOTA 3ZPXA 3E84A 4YUWA 3BXFA 4GXNA 1QQAA 2Z2KA 3B53X 2HKIA 4K9KA 1YWGO 1FVOA 3ZDXB 1NU6A 2W6JD 5MN4A 5GVSA 3DZCA 3EFOA 3H5AA 4MNTA 3STHA 1EK0A 1FS6A 2P40A 2NAPA 3AF2A 1JH8A 1M2EA 1JIQA 3DP7A 3IT3A 4M0KA 4WXHA 4JNCA 1LNZA 3IBCA 5AM2A 2VQDA 2OY0A 4WW0A 3PD7A 1TD9A 1SXJB 3ADCA 4H0CA 4FFLA 3AOEC 3H5TA 1QM5A 1WZEA 4HQKA 4ZZIA 1OCEA 3O8RA 2Y1OA 2BR3A 4ZVRA 4P4GA 4QO8A 4OJYA 2YRFA 3ABOB 2WWVD 4N7RA 3U17A 4C0QC 7MDHA 2YZ2A 1PS9A 1IAVA 2ERYA 1NWCA 4TSRA 2CSUA 2P41A 3M82A 5DTQA 1US8A 2FMKA 4TLCA 4B76A 4D9JA 1JLLA 3F8SA 4OV6B 4Y2UA 1ZK4A 1U7DA 3RUAA 2AMVA 1DJNA 1AZLA 3O3MB 4R5HA 1KK0A 2PKCA 3C8UA 2D62A 2RHWA 1YDMA 4MJ3A 2Q62A 2FFHA 2CXOA 1DJLA 2DLDA 4BMNA 4E03A 2OZEA 1OLUA 4TZ0A 3CH6A 3W2EA 4JXKA 1SVUA 3EA4A 5L3SB 3B12A 1UAGA 3KEFA 1JIKA 3VYWA 4IO1A 1LK5A 5E9JA 3HPQA 3CI0K 5L7TA 4C9BA 4IFEA 2GZ1A 5AKIA 4ECAA 2DQSA 1F4LA 3MD9A 3KE8A 1TQHA 4LTMA 4LZPA 4TLMB 2IZOA 2ZSJA 3D3QA 4YI3A 3VU9B 5JS7A 5CD1A 3RT7A 2ZWIA 4GI1A 1XDUA 4LXGA 3I6QA 4RKRA 4KDFA 2HWUA 3C7CB 4ZO9A 5DDIP 2WAXA 5DISB 5HIMA 4ZDWA 1QYWA 3I9MA 1QHHA 1GKKA 1YR1A 3FYHA 4WA7A 4EFNA 3IBYA 3OCXA 2PMFA 2WKRA 1XVAA 1BX3A 5U1PA 5BY2A 4G0VA 2XB6A 2C31A 3G0DA 4UUQA 4MCJA 1OHHD 4C4AA 5ILOA 4IKEA 1VLMA 4PICA 4FCTA 1YCGA 3I9V6 5ALLA 1FFHA 3TQOA 5K7SA 3IUYA 1J2UA 3S8YA 2B2CA 4X7RA 3PNLA 4C20A 4OJNA 1XTIA 3K5HA 3KZNA 1U04A 3B9PA 5ALEA 3IB3A 5C52B 4IZOA 5A1TA 4X7MA 3D6HA 4CL3A 3F8TA 4DR1B 1MW9X 1NW7A 5ED0A 8AT1A 4XLZA 1QE3A 1U81A 2OV4A 4ZT3A 1ZONA 2X15A 3C3YA 1B74A 1HYQA 1U2RA 3KKMA 2EW8A 3THYB 1UKZA 3HJRA 2RBEA 1T5DX 4UJ3A 1P9LA 3ZH2A 1C1DB 3T95A 3DE6X 3DV9A 1RXCA