4MWSA

Crystal structure of human ppca (trigonal crystal form 1)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Lysosomal protective protein
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwsA00
5CMLA 2QT9A 4BYMA 4YPVA 4MJ3A 2P8SA 4DIUA 3R3ZA 3STVA 3WA6A 3ICVA 1LPPA 2OQIA 2JGLA 2CZQA 1L7QA 4J0DA 1CV2A 2RI6A 1VA4A 3WL5A 2GYUA 2DQZA 2CB9A 2AJ8A 4J7AA 2V9ZA 1Z68A 5CXUA 4UHEA 3ANSA 2QM0A 1EDEA 3R41A 5A7HA 3D4LA 3FLBA 4E14A 3WWEA 5ALHA 2B61A 4BBZA 3C8HA 3EIOA 4X92A 3G9ZA 4IO0A 2QJRA 4PNZA 5DTIA 3V48A 3NOXA 2G63A 1MTZA 1CUXA 2C4HA 3I2FA 1EA5A 2XUHA 2FJ0A 2BUBA 5AKLA 2ROQA 1DT3A 5LZ5A 1FFDA 4B80A 1GPLA 3V1NA 5ALLA 3EQ7A 2QZPA 1T4MA 4HS9A 1YSCA 2XUAA 4QZVA 5FRDA 1NX9A 3G9UA 2J3QA 5T4EA 4Y2YA 3D2CA 1ODSA 5FKJA 5AIBA 4LIPD 1J2EA 3MUNA 4UFNA 1U2EA 3FLEA 4MXDA 2DCMA 3IUMA 3G8YA 3B5EA 3C5WP 2AJBA 3DQZA 5ALSA 3HEAA 5AOBA 2WHQA 4GXNA 1W75A 1QIKA 2QUAA 1TQHA 4UBOA 1EVEA 4CG1A 2R11A 4G1FA 4I19A 1GQRA 4KYVA 4UBLA 3U1TA 3BIWA 1YASA 3O0DA 2X5XA 2JEZA 2XUJA 3DL7A 4PW0A 4B7ZA 5AICA 1L7AA 3CN9A 4B0PA 1E3QA 1O6FA 1EVQA 5AI5A 1N5RA 1RYYA 1GKLA 2G5PA 4A16A 1WPRA 4BVJA 1JJBA 4HXEB 3T52A 2O7VA 1KU0A 1GZ7A 4U2GA 4QNNA 3H0CA 2B20A 4N8SA 4K6HA 4FLEA 4HAIA 2HL6A 1U4NA 4UBJA 1DQZA 1AC5A 3VDXA 5ALKA 4U2CA 1MO2A 4EZIA 3IA2A 5CT8A 2OLEA 4WDQA 3GZJA 2HFKA 4U2FA 1TAHA 2HA6A 1P0MA 4AMZA 4BCDA 4WDRA 4DTCA 3PF8A 5K3DA 1A7UA 1BN6A 2XMZA 3H2GA 1AQLA 3I2HA 1G4HA 5JZSA 1XRLA 2C7BA 4CG2A 4QDTA 1QIDA 4G4IA 4X6XA 1IUNA 4W63A 1QLWA 4J03A 3STXA 2IITA 2PSFA 5AKKA 3OURA 1IUPA 1W76A 1DWQA 1UOPA 4ZREA 2BCEA 4HVTA 4OB7A 4ARAA 5BWBA 1S8OA 3NGMA 1CQWA 5ALIA 3WKDA 1SFRA 4Y2VA 5LKAA 4FFVA 3RLIA 1XZJA 3D7RA 1HKHA 5FP0A 4G9GA 3HSSA 2C58A 1B6GA 4QE3A 5ALVA 5JZBA 3O9VA 1JU3A 3H2JA 4XX1A 4PO3X 4NZZA 6YASA 1ZIYA 1MX5A 1VKHA 2XQFA 4INZA 3I2JA 4U2BA 3L1IA 2QKYA 1EHYA 1C7IA 4Q3KA 1WCYA 4FFWA 1CUVA 4Y2JA 1QJ4A 4Q34A 1THTA 1Y37A 4QLOA 1TIBA 4UPDA 3W05A 1UXOA 3DKRA 3I28A 4KE7A 2JGFA 4EA6A 3SK0A 4DLNA 4JYPA 3ESAA 5KBYA 4FOLA 4EY5A 5HZGA 1XZDA 2W22A 1J07A 1BCSA 4BP8A 4EBBA 2XUFA 3I1YA 4UBNA 2OGZA 1UFOA 3IB3A 1F0PA 3C6ZA 3D0KA 3FCYA 4N5IX 1DTEA 2RAUA 2Z3ZA 2QXUA 3C43A 4QLAA 3RARA 2I3DA 1MNAA 2BJHA 1SOMA 1N5MA 4YX9A 1VOTA 2Z8ZA 3O9MA 2XQJA 3WLAA 1ZJ4A 1VJ5A 3DS8A 3W9BA 5ALNA 5AO9A 3L1HA 2HA4A 3Q8WA 2J4FA 3ZV7A 1E66A 3SWWA 1PJAA 4QEKA 3QYJA 4AX4A 4C6HA 3W9UA 5T4HA 3E0XA 4C01A 4W1QA 2RGUA 4FNGA 3W2TA 5HF8A 2WFLA 2WHPB 5LZ4A 2IIVA 1ETHA 3N2ZB 4LXIA 2WUGA 1K8QA 4G8CA 1BRTA 1G5FA 1H22A 1XZMA 3I2IA 5K5EA 2VAXA 5I8PA 4AN0A 2QUBA 2HA2A 3RKSA 3CN7A 5ALWA 4ZRDA 5EGNA 1XLUA 5AKYA 3QBJA 2XB6A 3AIMA 5LZ8A 4EHBA 3V1MA 1F0NA 3NWOA 2VF2A 5FV4A 3FYUC 1TCCA 3WL7A 2Q0XA 4NVRA 2JBWA 2XUIA 3B12A 4WY8A 5JADA 2XQKA 1I6WA 1ZD5A 5HF6A 4JH0A 5HQ3A 5EHNA 4ROTA 1MNQA 5JD4A 4B9AA 4CFSA 4PSDA 4GLBA 1E8DA 4MEBA 2OGSA 1UT6A 2CJPA 4BVKA 3IUJA 1N1MA 5AM2A 5EHQA 3ZWQA 2YXPX 3VJKA 2BFNA 4BC0A 1OXMA 4TGLA 2ECFA 2XLBA 3WYDA 1DWOA 5HKBA 3MUOA 3AJAA 1XRNA 2GZSA 2WUDA 3AZOA 5DWDA 1WB4A 2E3JA 2PSEA 2WFZA 2WU4A 1E5TA 3M81A 2HFJA 1IMJA 4X94A 5LZ2A 4FLFA 1A88A 4UHBA 2XLCA 1EH5A 3BE8A 3R3WA 1ZI8A 1XZKA 5JALA 1MPXA 3HC7A 5K3FA 3FCXA 3OG9A 3I6ZA 2WUEA 3HRHA 2JGMA 4H77A 5D7BA 2IX9A 5DYTA 1E8NA 4Y2UA 4G4JA 1EX9A 1CUYA 2VJBA 1CUZA 3DCNA 5EHXA 5CW2A 1ACLA 5JARA 3SX4A 3HZOA 1QONA 1W1IA 1FFBA 1PV1A 4NS4A 4RGYA 2XMCA 4X97A 1ODTC 1CVLA 4G9EA 3AZQA 5HFNA 1T2NA 3WWDA 1LPSA 2EEPA 3KXPA 1QIFA 2HU8A 1CRLA 4BC1A 1XZCA 3L1JA 1EI9A 3O4GA 1VE6A 1BCRA 1F8UA 2OAEA 1NU8A 4E11A 4UHFA 3AIKA 4J0GA 1BEZA 5JD6A 4WCVA 3JWEA 3H04A 3ZLUA 3R3XA 2FX5A 5DNVA 3OM8A 1P0PA 4FLMA 5JAOA 1HDEA 2K2QB 5FLKA 5C8XA 5JZ9A 5ISMA 2WG0A 5CT5A 3WL6A 1ZI6A 4AO6A 2VQ6A 1AX9A 2WFMA 4I3FA 2JGKA 1ZICA 2H7XA 4Q3OA 4BAUA 2WSLA 4B9EA 1EK2A 2PU5A 3FWHA 1USWA 3A2LA 4KE6A 5DTJA 5T4FA 3G9XA 2JEYA 4KACA 1HBJA 5SYNA 1AMNA 4BDTA 1XKLA 3AFIA 1QZ3A 1PFQA 4OB6A 4Y9SA 4BE4A 2GYVA 4L9AA 1FFAA 5AP9A 5CT9A 3VJMA 2WJ4A 1CUFA 2RHTA 4CCYA 1M33A 3V1LA 4H7IA 3DNMA 5A2GA 2VJCA 2HA7A 3WK5A 4KAAA 4Q1VA 3H17A 1XZAA 2QMQA 3MVEA 4DYHA 4DNFA 3WMRA 1VXRA 3M83A 2XUQA 3HLKA 1ZIXA 3W04A 1THGA 4I4CA 3EQ8A 3WIOA 2Z3WA 2I3ZA 5AKHA 4X00A 4HRXA 4P93A 1U8EA 2G5TA 3GBSA 3ZPXA 2WUFA 4FBMA 1CUBA 1MN6A 5AM0A 1MX1A 2C0PA 5AM3A 4J0KA 5AK6A 1H23A 4FNMA 4WFKA 1HQDA 5AK3A 2QVBA 2V98A 4OPMA 2YASA 1ZD4A 4RE5A 3FYTA 1H2YA 5SYMA 3ZLTA 1EINA 2VEOA 3MGAA 1Q0RA 2ZSHA 3IUQA 4E46A 1K4YA 3TRDA 4FDMA 3C6YA 2V97A 4UBMA 4FMPA 5JAHA 1SCQA 1G42A 2QR5A 2AJDA 1UOQA 2OGTA 3WJ1A 3NUZA 3BJMA 3PUHA 4MQMA 3HJUA 5I7UA 3UUFA 5JD5A 2BUAA 1MJ5A 3OOSA 3M3DA 3WA7A 5A6VA 1XRMA 3QPCA 5CT4A 4GHWA 3E3AA 3BL8A 1NU6A 1DWPA 4FHZA 4B81A 3D59A 4JYMA 3PFBA 4BVLA 1RP1A 4LYDA 1ZOIA 4AMYA 1ACJA 1WB5A 1A8QA 4H7HA 3AINA 4RPCA 4CIAA 2EDAA 2BAGA 3WWPA 1WHTA 1AGYA 3DOHA 3DD5A 4X95A 4AN1A 1R1DA 1X2EA 2JGIA 2XMDA 4E15A 2X8BA 4AO8A 2JF0A 2PU7A 1LPMA 4H18A 3WWOA 4KE8A 4BDSA 1K6EA 5K3BA 3DYIA 1QIEA 2NW6A 4H35A 2BGNA 2HADA 1IZ8A 2DFPA 5HCUA 4D9JA 3JW8A 5AIAA 1CFJA 4MEAA 1F6WA 2WILA 1K63A 4DNQA 5LP1A 1DQYA 4L0CA 4B84A 2HU7A 2PUHA 4J0IA 2PVSA 4F0JA 3QZUA 1LBSA 1WM1A 4G5XA 1LLFA 1GXSA 3LS2A 4GBGA 3WK9A 4A5SA 2OCLA 1R9MA 2PL5A 3D2AA 4DMHA 2VATA 1GKKA 4C4YA 4WFIA 5EFZA 1CR6A 1XQYA 3H1AA 5JAUA 1G66A 3C70A 3F67A 4PSUA 3PFCA 2Y1KA 5AOCA 3UUEA 3F9CA 1MAAA 5EHZA 2VJAA 4KRXA 4V2IA 2HDWA 5CURA 3O4JA 3STTA 2CEKA 5ALGA 3PE6A 1VLQA 3D3NA 2ZVDA 5AK4A 4XVCA 2VA9A 3QITA 1DX4A 2PUJA 4EUSA 4OU5A 4UHCA 2Y6UA 1FSSA 1CUIA 1XQXA 1CUDA 1N8SA 5E2IA 2W6CX 1JJFA 3B3QA 3BF8A 5A71A 2FUKA 5YASA 2C5FA 3AUKA 2ZJFA 2LIPA 4C89A 2XUKA 1QTRA 4Y2TA 5JIBA 1P0QA 4HRYA 5LZ9A 1X2BA 1QO9A 3ZI7A 1O6GA 2JGEA 1CPYA 3G0CA 4AZ3A 2XI4A 5AM4A 3H1BA 4W1SA 3EQ9A 4DNPA 1Y7IA 1J06A 1UKCA 1UK9A 4OCZA 1AKNA 5HQ3B 5K3CA 2ORYA 3C5VA 4MQLA 3STUA 5AKEA 3WK7A 3TEJA 3WL8A 1ZJ5A 3R0VA 5T4BA 4BP9A 1E89A 1WB6A 5JANA 1VE7A 5HKAA 5AKXA 3LIPA 3ED1A 5EIEA 2YH2A 3QPAA 5AH0A 2WLSA 3FYUB 1EB8A 1BN7A 2OCKA 3WYNA 1QGED 3DDUA 3FVRA 5DJ5A 1B41A 1LBTA 2OG1A 3EBLA 2JIDA 3BDVA 2WM2A 3G9TA 3LLCA 3WI7A 5AI4A 2WIGA 5EI5A 5IH7A 1YR2A 1LPOA 1LPBB 1HPLA 1BEEA 3R3VA 1CUSA 1FJ2A 4J0CA 3VKFA 1W4LA 2PKYX 4EY8A 2PSDA 4HXFB 1JT2A 2EDCA 2WHRA 4LYEA 4H7FA 3FOBA 3DL4A 3KSRA 5AHXA 5BOVA 4CCYB 1ORVA 2HIHA 4N8EA 4HZGA 2ZSIA 4KJXA 4S0XA 2WIJA 3BWXA 3WK8A 5ALOA 3WKCA 4K6GA 4UBIA 4QDOA 2OCGA 5K3AA 1UOOA 1IUOA 5JYCA 4BE9A 1XRQA 2O2GA 1XLVA 2H7CA 2QOEA 3HABA 3IURA 1A8SA 3FSGA 1LPNA 2ACEA 2FJPA 4Y2XA 3BJRA 3VXKA 3F98A 1XZLA 5LZ7A 1UK8A 1QIMA 1ZGBA 4F5ZA 3FSGD 1ORWA 4G8BA 4MYDA 1XZEA 1YA4A 3F8SA 3Q0TA 1OCEA 4UFOA 5ALFA 5ALYA 4F60A 3FAKA 1CQZA 2GBCA 5LIPA 3I1IA 3H2KA 4ARBA 5LLSA 3CCBA 1TRHA 4EB0A 4L72A 5KWJA 1WOMA 1XQVA 4LXHA 1UZAA 3G0BA 4FKBA 4K6KA 2XQIA 2XMBA 1XLWA 3I6MA 3IDAA 2QXTA 1KU6A 2Y2VA 3UMJA 4PV7A 3A2MA 4B85A 4QDUA 1ODCA 3PDCA 4QWMA 3KOOA 4BAGA 3F96A 4FBLA 5E4TA 3H19A 3V1KA 2HU5A 3OTQA 1JMYA 1YAHA 5AI0A 2VSQA 2HHAA 5E4JA 3GA7A 4WJLA 5ALXA 2AJCA 2WTMA 4OYYA 2RIPA 4IQ4A 4CI9A 5ALRA 4LHEA 4J0JA 3TGLA 4QDZA 3M82A 1E8MA 2HA3A 1FFEA 3K2IA 4ZWNA 1W52X 1LGYA 4KAFA 3IULA 5CH8A 2WJ3A 5ALTA 4RE6A 3SC2A 4ZGBA 3OPMA 1CLEA 5FPQA 3I6YA 4BTVA 3QMWA 4BRSA 4MWTA 3T4UA 1MU0A 4OSEA 4ZV7A 1U65A 3DJYA 1JMKC 4ETWA 4RNCA 4X3CA 4UBKA 3ESCA 4PF1A 5KREA 3HACA 3VVLA 5J3JA 1XZIA 2VTVA 5E4YA 4F21A 1L7RA 1ZD2P 1GGVA 4K5QA 1EDDA 2O2HA 5BV7A 4CG3A 1YB7A 1HLGA 2XMQA 5A62A 1SC9A 4YASA 5AM1A 3U0VA 3S2ZA 1MAHA 4N5HX 4X71A 4BZZA 4DGQA 3H2HA 1TCBA 5IVIA 4K2AA 1SCKA 4H7EA 5ALQA 5IKXA 3HYSA 3QH4A 1EDBA 1XZBA 2XT0A 2XUGA 5CTAA 2CUTA 3ZLVA 5H3HA 5FDFA 4DSZA 4AO7A 4P92A 4X6YA 2Y6VA 4Y2SA 1JKMA 5ALUA 4H0CA 4X6UA 4BTLA 2WHPA 4G4GA 4Q05A 4C4XA 4KRYA 1R4ZA 3O4HA 1Q83A 1VZ3A 2DQYA 5HFAA 2VT6A 2CKMA 5CH3A 4M0FA 3QMMA 1D07A 1QTIA 3RK4A 3VJLA 4GDMA 1QO7A 2WIKA 3FYUA 2Z5GA 1CUWA 1QOZA 4QWWA 2H7YA 2WIDA 1LNSA 1QIJA 2Y2UA 1XQWA 2V96A 3STWA 3DYVA 4U2DA 4JUIA 4C87A 3RM3A 4KEAA 5AI9A 4LKOA 4TVKA 2C0QA 2PX6A 2RHWA 1C4XA 5HK9A 1R88A 4EY7A 1VA5A 3X3HA 3ESBA 2J3DA 2BKLA 2O7RA 3FBWA 1BROA 4BZWA 4DSAA 4IH9A 3PUIA 1CUGA 2WJ6A 3ESDA 2OXEA 3R3UA 4CCWA 1BS9A 3VVMA 3BIXA 5A7GA 2C5GA 1EXWA 3FLAA 4X90A 3STYA 5JATA 1XRRA 1UK6A 1H2XA 3IVMA 2HA5A 3PICA 1YA8A 5C81A 5AKJA 4B82A 2VT7A 1TKRA 3E1GA 5AOAA 4DMFA 3R3YA 1XROA 2OCIA 3JYHA 2PSJA 2VJDA 1XZGA 4M0MA 1WPXA 4UHHA 3VISA 3GUUA 2J4CA 4O08A 3IIIA 2H1IA 3F97A 2HM7A 5ALZA 4GEGA 4P9NA 2ZJ7A 3G7NA 4IH4A 3QVMA 4KE9A 3QPDA 2UZ0A 4OUKX 4C4ZA 1SCIA 5I9IA 4WY5A 4Q3LA 1X70A 3C87A 1UKAA 5CRIA 3EF3A 1ZD3A 4OU4A 2XUOA 4MYSA 2ZJ6A 5D3KA 1BU8A 2XDWA 5A7FA 3WQHA 4QA9A 5AI6A 2HRRA 1YAJA 3FNBA 3GFFA 3K6KA 1JI3A 4ZXFA 5BWCA 1AUOA 1DINA 4IH1A 4N8DA 2DR0A 3YASA 3S8YA 2XUDA 2WG2A 3CCCA 1R3DA 4YK7A 1QFMA 5CH5A 2OAGA 3G0DA 3WWCA 2XUPA 3O4IA 3D5EA 3KWFA 3IBTA 1CUHA 5D6OA 4JNCA 1KEZA 2ZYIA 4NMWA 4H7KA 5IVHA 5IVKA 4Y2RA 1EK1A 5DNWA 2PBLA 2PPLA 1GT6A 1A8UA 4BATA 4DNOA 1EB9A 4DM7A 2ZYSA 4PSCA 1CUEA 2I03A 3BDIA 5HF5A 2G4LA 5FOQA 1GQSA 3ICWA 1QIGA 1JU4A 4ZV9A 3WZMA 4ZI5A 3E4DA 1YS1X 3LP5A 4IHAA 2WKWA 4A23A 1P0IA 2XQGA 1H2WA 3O95A 3W06A 4OB8A 1YS2X 1XZFA 3OC0A 4J3JA 2DSNA 4UFPA 1CEXA 5JAPA 5HK8A 3DKKA 1LZKA 1AURA 1HL7A 3ANTA 5ESRA 1YB6A 4C88A 2CMFA 1OILA 4KAJA 5KWIA 5FPPA 4M0EA 4JEIA 5LYYA 1AZWA 5ALMA 1R9NA 2ONCA 4LXGA 1DX6A 3LIIA 4GI1A 5EIHA 3WJ2A 1XRPA 4DMKA 1DU4A 5ALEA 5EIAA 3R40A 4UHDA 2OQVA 4X91A 4PQEA 1GPNA 2WTNA 2RONA 1IVYA 1XKTA 4P08A 3C6BA 1UWCA 3G0IA 3WK6A 1CUCA 3TJMA 2GZRA 1UKBA 3HI4A 1ZI9A 4L3WA 3CXUA 2XE4A 4Z49A 5JASA 4FTWA 4KR0A 1IZ7A 3WZLA 4W1PA 3A2NA 3WK4A 4GW3A 5DLPA 5FUMA 1RWQA 2DHCA 2X76A 4Y7DA 4AZ0A 5C8ZA 2HRQA 4OD0A 4BCCA 3V9AA 4W1RA 4GWLA 1UK7A 4UUQA 4H7JA 2BGRA 4J0HA 5AKZA 5FXMA 4Q82A 1GPKA 4X93A 2QS9A 3FVTA 2WQZA 5CT6A 1FFCA 2XMRA 2WG1A 2GBFA 4Y2QA 4GECA 4X7BA 4B83A 4DMCA 1BE0A 1ISPA 5AJHA 3H18A 5HF9A 2XMGA 3BXPA 2GBIA 3WKAA 1JFRA 5ALPA 3WKEA 4X85A 2PM8A 1R50A 2QTBA 3KWJA 2DHEA 1JJIA 3N0TA 1QE3A 2Z8XA 3A6ZA 3ILSA 1DT5A 1Q84A 3LCRA 2WFLB 3GROA 2PSHA 3PI6A 1CUJA 3WKBA 4G8DA 4XJVA 1MT3A 3QM1A 3G02A 3C45A 3AILA 2GYWA 3DEAA 1VXOA 2CBGA 1LPAB 2HA0A 3I2GA 4OYLA 1J1IA 2B9VA 3HXKA 1WHSA 1LZLA 3IUNA 2YYSA 5C7YA 3DLTA 1CUAA 5AKGA 4FWBA 1YCDA 5IVDA 4AB1A 2ACKA 3H2IA 4ITVA 3QMVA 5AI8A 1VZ2A 4H7DA 3D2BA 4HTAA 1MX9A 5F4ZA 2BUCA 2XMSA 1TK3A 5AK5A 2JGJA 3C6XA 3WIBA 2H9YA 2R8BA 2WU3A 2B4KA 1QIIA 3A70A 1Y7HA 3K9BA 4EY6A 2GBGA 3C8DA 3DOIA 4BRZA 1Q0ZA 2ZYHA 2D0DA 1K5PA 4BAZA 5ALDA 5DYYA 1QFSA 2D5LA 5D3ZA 5K3FB 4HXGA 4W9RA 1CUUA 1TCAA 4BB0A 1C7JA 1XFDA 3GELA 2QJWA 4CIBA 4TPKA 5CBKA 4QDXA 3P2MA 4Y2PA 3I2KA 5DNUA 7YASA 1XZHA 2DHDA 3KD2A 5ALJA 2O2IA 2QRUA 4EY4A 4BCBA 2ZYRA 4WFJA 5DYWA 4AXBA 2I78A 2ES4A 5K3EA 3AIOA 4U2EA 4XWGA 5CXXA 4AQDA 2WIFA 1H2ZA 1ZGCA 3KDAA 2VAVA 5AKIA 5C8VA 1W6RA 2OPHA 3BF7A 4XIIA 2AXEA 4B0OA 5LKRA 3AZPA 1CIJA 2AJLI 3G0GA 4B6GA 5AM5A 3PF9A 4MWSA 1QIHA
chains in the Genus database with same CATH superfamily
3FPBA 2XVAA 3JWHA 4NJEB 4DLAA 1BE8A 1TD1A 7MDHA 2CZGA 4NYIQ 2HSEA 3S8EA 1ZOLA 4ISCA 4DIUA 3QI7A 3IALA 4K6CA 4PLGA 2JFZA 3BYZA 1A9RA 1LSJA 3T5MA 3AUUA 4MVCA 3PPYA 1LPPA 4O0MA 4XVQA 4B17A 3TSWA 4QLBA 2IW3A 4CTJA 4DJJA 1CNMA 2WKSA 2QTGA 4AURA 3L1KA 5LUAA 1EE9A 1KC3A 1XCBA 2RI6A 3AO0B 3DZIA 3GBPA 1U4SA 4RVDA 4WXYB 3TR6A 4EHJA 2PMDA 2ZBUA 4NOMA 4OBXA 4UHJA 5F35A 3TLKA 4HQRA 2GYUA 3TE7A 3JALA 4UM8B 3WL5A 3A9TA 4DIFA 2CB9A 2RFLA 2IEIA 5FOUA 1Z2PX 4G25A 3LXUX 2J3HA 1E1RD 3LZDA 5FJJA 2XRZA 1CJVC 1E5VA 4DRYA 4W7SA 3E9MA 1SUWA 4WH0A 2G25A 3ANSA 2RGWA 2REQA 2ORWA 4NH0A 4R41A 4X8MA 3ZTWA 1D5WA 3ZBUA 3JQAA 2VNKA 3IKVA 4I1OA 1YZUA 4GR9A 2BM8A 4RVSA 3K92A 2OBBA 3D4LA 1ADYA 3L8EA 4B5LA 1W47A 3VH1A 2YWXA 1NXQA 5ALHA 2WKPA 5IUKC 1KXZA 4BBZA 2NP7A 2PUBA 2DBYA 2PANA 3EMKA 4KXQA 2BM0A 1JFFA 2GJKA 3EG5A 1H4SA 3T7TA 2MIIA 5AR1A 4NFHA 2A0UA 2IHBA 1NMSA 2Q49A 2RH5A 4HSEA 2VNSA 3T35A 1M2WA 3JZFA 4C22A 2X0IA 2WZQA 5K9ZA 5CEFA 4PNZA 3Q10A 3ED5A 4IEFB 3R7FA 3V48A 3U3ZA 4XVCA 2DR2A 2G63A 3BFKA 4LMRA 3GT7A 2XYRA 2VAWA 2F9MA 3IQFA 4PVCA 2C4HA 3L8ZA 4MKIA 4QELA 3V4FA 4L73A 4X45A 4ZU1X 3ZHBA 4KIGA 3I2FA 4CI0B 2A9FA 4D0NA 4MUAA 1G8FA 3WGLA 4CMIB 2FJ0A 3OH8A 3PJEA 3URKA 4DLWA 1PAUA 3BA6A 3T3HA 4BFYA 3ZCSA 3VR1A 2I54A 2FPSA 5BSTA 3CC8A 5CAEB 2X8JA 3OMLA 1U1DA 2BKEA 2ZB4A 1PW7A 3PTLA 4GRAA 5LDGA 1DT3A 1AQYA 2ZWAA 1VSQA 5BV0A 2QP4A 5LZ5A 1F5SA 3IVXA 2IT1A 4YGYA 5FAKA 3UIEA 3EQ7A 4ARIA 4EP1A 1M54A 3PZRA 4M9ZA 4WKGA 3P19A 4MVJE 2OY0A 3CX6A 1YZHA 1MBZA 5AVOA 5T4EA 1OZ0A 2DUWA 1E1NA 3ONFA 5KNCH 1W4ZA 2WF9A 4ZK2A 3RGWS 2J0EA 3PDIA 4YCSA 2CJWB 3EVTA 3RSZA 1TUEA 2GYYA 2O2XA 3JY6A 3ROZA 4U7DA 1QE5A 2DCMA 3UJNA 1R0KA 1V6AA 1K66A 3QX7A 3EIXA 1RABA 3G5MA 1KBQA 4LJRA 5D00A 2WHQA 3EIQA 4GXNA 1W75A 2AX4A 3IB6A 2QUAA 4WNAA 1TQHA 1H8ED 3LTNC 1KWGA 2PZKA 2IZ5A 4MKHA 1EVEA 2VPXA 4KDCA 2BFAA 3OMWA 1ZJWA 3Q8XB 1R4MA 2R11A 1JEYB 1UQRA 2PGNA 4PLFA 5CM8B 1FY2A 1U7HA 3N3AC 3KZCA 3SYMA 4HZIA 1GQRA 5EZQA 3GRUA 4KYVA 4XRGA 4OQXA 3E5NA 1M0WA 1C14A 3K9GA 6LDHA 2XQVA 5JZOA 5I4KA 1B6RA 1MIHA 1U0EA 4H08A 3U1TA 3SHTA 4D7AA 2JEZA 3TG8A 3ZIDA 1XNGA 4CBVA 5TXGA 2FSVC 2K6GA 2XOKD 4Q1BA 4B7ZA 4EITA 3RWBA 5KAMA 3VOAA 3Q0EA 4PZUA 3BMNB 3DT8A 1O77A 1ZPDA 3CN9A 4RSRA 2X1VA 1JIXA 4F4CA 4OI4A 3ZGXA 4CIDA 5G4KB 2NXEA 4EVSA 3P26A 1VL1A 3HPQA 3T52A 5LYJF 4CGZA 4DSNA 3QLUC 5JS2A 2VCHA 1T9ZA 1XJ0A 4JMLA 2WD9A 1IN8A 3QLTA 4S2EA 4RY8A 1PJSA 5KSYA 3RU3A 2XODA 4K6HA 1MTOA 1NXVA 3BM5A 5ADVA 4UBJA 4HUQA 2BFCA 3N2LA 4L07A 3VZQA 2PQ2A 1AC5A 2QQEA 3CGGA 3GFSA 3ND7A 4RF2A 3ROTA 3PUKA 4EYKA 5ALKA 5IN4A 5KOJB 4AS3A 1RLUA 4BMOB 1I3KA 3ZVKA 2BBSA 5HUHA 3CU5A 3LK7A 4ENPA 1C30B 3ECAA 1UMCB 3IA2A 1TO6A 5EYPB 2IKQA 2CJFA 1F1JA 1JP7A 2DBVO 2CFTA 3RT7A 2H29A 2OLEA 4WDQA 4AYTA 4BWGA 1IC6A 2ZE8A 2HFKA 5EKTA 3LT5A 1MJNA 3DV0B 3OQMA 2HLNA 4B46A 1BVHA 2NZVG 5DGCA 4JLMA 2J5QA 4FUQA 1EFVB 3CF6R 4UPEA 2AGVA 1GTG1 4OAQA 4ZOLB 4KP7A 1UMBB 3QKSB 3LX4A 4XDHA 1A7UA 3V3KA 1S8AA 2PVPA 3UENA 2E87A 4D6XA 2P9HA 2P9JA 5E3IA 3U5TA 1Y9ZA 3X1KA 1T24A 2QTNA 3TOSA 2P6UA 2XYGA 3QEAZ 1XRLA 4UU8A 4EKNB 3WLLA 3L4KA 2B9EA 4QJ3A 3UGKA 1EJ0A 2ZI7A 1TA4A 4K87A 4B4OA 1C3OB 5FV7A 3AETA 3EVFA 2ZSAA 4JXXA 3OF2A 5HXAA 5FB3A 4PTYA 5HA5A 1WIWA 2DCUA 3DAFA 4PHTA 3WLMA 4HMOA 4Y6RA 1T9GR 3RNOA 1H0RA 4YMWA 1JDUA 4YMHA 1Q7BA 3BHIA 1YD7A 2Q99A 2QD4A 3JQGA 1NQUA 4KMMA 4BHTA 1YOBA 2DH5A 3ETCA 4FYYA 1T6BY 1JEEA 3KQWA 3B6IA 3I8SA 2IITA 3ZGOA 1U2TA 1UBHS 3HDGA 1KP9A 1U11A 3LOUA 2UUOA 5AKKA 5KKAA 5C3MA 3AESB 5ELLA 5THKA 3WMXA 4KVFA 4R9NA 3UAYA 1UOPA 5IT9A 2P65A 4DZTA 3ANNA 2AUNA 2CHEA 3HADA 5JD3A 5BT8A 1MW9X 4LJ9A 4O2AB 1JA1A 4QHSA 4X9XA 4RNDB 5BWBA 1S8OA 4TKZA 1Z07A 3E2MA 1F3OA 4ETIA 4LF9B 2ZS7A 2O8NA 4MZDA 1NBWB 1TKBA 1TYBE 4J16C 4I1RA 3QOXA 4IG9A 3C85A 3QPBA 3T7JA 4BKPA 4FFVA 5B55A 1GGKA 5JTUA 3RLIA 4L51A 2BKAA 4ICIA 4JXJA 3D7RA 3MWDB 3GARA 3ODGA 4UDXX 1X3SA 5F7XA 1F4VA 1JAZA 1ENYA 2FSIA 2Y8EA 1M1YE 1IXSB 4G9GA 5FP0A 1YIAA 2GXSA 2P2CA 3HSSA 2ZWVA 4WBNF 3OEED 3SSNA 3I3SR 1B6GA 1CSEE 4IF6A 4LE2A 4RENA 3EDMA 5JZBA 3OZXA 3MS7A 1GARA 1D0IA 1SOAA 4Y1RA 2B1IA 4JC0A 5JS6A 4A15A 4URFA 5FEMA 5EZ6B 1FLAA 3UOWA 2E82A 4M7OA 2XQFA 4S12A 2RD2A 3ZCVA 1JL3A 2AK3A 2VXBA 4TTTS 5DEOA 1H0HA 2Y4NA 4MKGA 2ZKLA 3FNGA 3R7WB 3AHCA 3KPWA 4BQEA 3AP2A 3L1IA 5BUQA 4W5QA 1EHYA 1C7IA 1Y3CE 3NEYA 1GWNA 1DIRA 1YDGA 3HB5X 3HCPA 3OIYA 2ZTMA 2PIAA 3ZI4A 4WE3A 1L5RA 5F2NA 3QJ5A 1JAYA 1KFEB 2CDBA 4Q34A 1X9GA 4TS3A 4Y3UA 2AFHB 5ERGB 3Q40A 3WFIA 4ES6A 4F84A 2PH7A 3EGXA 3TFWA 1J00A 1XAIA 3HY6A 3C3KA 3SZLA 4IFIA 2WAAA 1QDLB 1NDQA 3QXGA 3C3YA 3LKVA 4JJ4A 5D5HA 5AMXA 2YRWA 1TIBA 2ECKA 1RJEA 1W2GA 1GUBA 1FF9A 1YB5A 1A4XA 4IX1A 4PGGA 3RRJA 4AMUA 2OVFA 4GZ3A 3C2QA 1UODA 1RQGA 3SJAA 2CYAA 3I28A 3VTFA 4RHUA 3ZNOA 2BEKA 5JSZA 2GFHA 3LT2A 3SK0A 3CLHA 4ERXA 4NJEA 1E3SA 3JS5A 2V9CA 5IAOA 5M7EA 1NNEA 2AG6A 2H1CA 3PXBA 5BR7A 3TNJA 4LF7B 4KUGA 3IAUA 2FW9A 4PY2A 4DMGA 1NUTA 1J20A 4IYRA 4FOLA 5BWMA 3OZUA 4RD0A 2IZ6A 2YW2A 2ZBQA 4MV5A 5DWQA 2BR3A 3E7XA 4FS3A 1J07A 3OJEA 3FDIA 3RUDA 2JI4A 1DARA 4MPJA 3I1YA 2DSTA 1UXKA 3AJDA 1W85B 2OGZA 5SYAA 5DE3A 5DOZA 2D7DA 2HXYA 1NNUA 5MGBA 3U19A 3NALA 4OHPA 1CZNA 3NHSA 4KFRA 4YDQA 2ZJZA 4KPGA 2H1HA 4EW3A 1IPEA 4US2R 4WXEA 1W44A 3LY5A 1JVBA 3GYGA 5JYBA 2JCYA 121PA 1QKJA 4YRGA 1VFNA 2H9AA 2Z3ZA 3GNTA 1PJQA 4YJHA 3AG5A 1F7VA 1MFPA 4Q3CA 4QLAA 2YHIA 5IK2D 4XPIB 4BY9E 3MGBA 2HCTA 3RARA 1HNXB 4L1KA 5KSOA 2G17A 1L8OA 4HATA 1TZ2A 2BJHA 4PX2A 4YX9A 4BQOA 3GFGA 2X1HA 1CY7A 2OV1A 3B3AA 4P3YA 3NPMA 2F3RA 1LCIA 2BSXA 4DJTA 1LSSA 3W3ZB 1VOTA 4GL2A 4C1BA 2BMJA 3JQBA 4EHHA 2VVTA 3COZA 4Q66C 1ZJ4A 2GPJA 2XEXA 3C15C 2YRFA 1Y3DE 1Y5MA 3OZ7A 5DI3A 1COZA 1XVAA 1G3RA 2IOHA 2NNLD 4IIVA 4YCCA 5BN4A 5KWEA 2HA4A 4EWLA 3WLEA 3LDHA 1E9RA 2QE7D 4YREA 1CQPA 1RI4A 4CMIA 5LP6A 4DEYA 1G55A 5IASA 1T4GA 4BNIA 4AX4A 2CLHB 1JPJA 1Q22A 2ODAA 4L76A 4EL5A 3S6JA 5D3MB 2A9RA 3NBAA 1TZKA 4IX9A 4W1QA 4HN2A 3GN2A 4F7WA 1BOFA 2P5YA 2RGUA 1IM5A 2HNKA 4DRXA 1JIKA 2A86A 4DVJA 2JFXA 2J9XB 2WHPB 4WERA 3KKNA 2IZ1A 3CH6A 2ZTSA 4M0DA 3V00A 4TYWA 4B33A 4G0OA 5ARDA 2DUMA 2XKJE 4LXIA 1RFLA 2CVHA 2ILVA 3ND5A 4NHEA 3GUHA 3TTUA 2YWJA 3UMFA 2AZMA 3M6MD 1KI9A 1SZPA 3T5AA 2ODTX 5BSWA 1JXAA 4LJLA 4CKEA 5K5EA 4QHTA 3HZRA 2VAXA 4RJTA 5EP1A 1N0HA 2BDUA 4L7VA 1KYQA 4LRYA 1T3ZA 4QFMA 5J59A 5JV5A 3HJNA 1ZAYA 3CN7A 3LWBA 4P0PB 4OF4A 1L4BA 4MP8A 4X0EA 1OC2A 1QR2A 1R0YA 5ALWA 1RPTA 3UATA 4QG3A 4W5NA 2VZ9A 5JH7F 3QU5A 4TLAA 2I6FA 4WNAB 4XXHA 4CMJA 1KL7A 2VK8A 3N53A 1HQKA 1JWAB 5HZHA 3V1MA 4HAXA 1JEJA 4KQHA 5H59A 2ZT8A 1RKXA 3WQQA 1SHZA 4KIJA 1C3EA 1K6JA 1XSEA 2J9FB 1N5KA 3AEQA 4MWGA 3UAGA 1F0NA 3BFVA 4XB2A 5DKFA 5FPTA 5D3QA 3FHCB 2MSDB 3EYAA 4RGBA 3W5HA 3UANA 3I01M 2C4VA 2GAAA 1HNWB 3OJFA 1C0LA 4QBHA 5CXSA 3WYAA 2CE7A 3K1AB 5DTMA 3HO6A 2R9VA 1D03A 1SU6A 4YJGA 5LP6C 3SGLA 5HR5A 1I2ZA 1OFUX 3AF4A 3JYNA 5D85A 1N6IA 2QA5A 1MNQA 2WAXA 3HP7A 1T0IA 2QD1A 3RSCA 3LQQA 1GV0A 3A3OA 3R4VA 1YC2A 1TUGA 1E9EA 2FGKA 4LRWA 4B9AA 2ZW9A 3KALA 4CFSA 4PSDA 5H4HA 5FL7D 1D9XA 4I3GA 3R5TA 4OXIA 3HCWA 4U9HS 1P1FA 3R8XA 1E8DA 3QPVA 3GRZA 2QN7A 3NJ8A 1T9DA 2A0KA 4GUDA 2FPGA 1W5BA 1IU9A 3TRFA 1PBTA 3ZTTA 2WNHA 4R2MA 3EXEA 4LA4A 2CFOA 4LMAA 4IRMA 2PGAA 4UXIA 5C34B 1VIMA 3Q7EA 2OOKA 3ISTA 4O02B 4TRJA 3FTQA 3WL6A 4KNYA 1RRMA 1AUVA 3GDOA 1ZINA 5I6DA 1R37A 4QC2A 4BVEA 2Q29A 2BC9A 1DQSA 3OIUA 5J58A 2H63A 4DQVA 1DBIA 2UZIR 3G85A 2JCVA 5BO5A 1PW5A 1XF1A 3KUXA 1KK1A 4CEIA 4EHIA 3GLGB 1OIXA 2PS0A 4HP8A 3WDSA 1P33A 4CUJA 2QPLA 2EJWA 5H0IA 1WDTA 4BV8A 3N58A 5BN3B 2ZLBA 4ZA2A 1UMBA 3QKSA 2GZSA 5J63A 3ZE8A 4Z54A 2Z5VA 3AZOA 4Y9RA 1ZH8A 4ZOCA 1T0JB 3NDPA 1DLJA 1XVIA 3EQ2A 3L2OB 4LDPA 1RYEA 3H16A 1OAOC 1LVHA 1WXEA 1YJBA 2VSNA 2B21A 1OMOA 5EMHA 3T7SA 4D0SA 1KRWA 9ABPA 4QQFA 5J4HA 4MTLA 1M74A 1H6AA 3Q7PA 1DEHA 2DBZA 1JLSA 2GXUA 3NHFA 1WPQA 3Q3EA 4KQXA 5K03A 1P1RA 3GJ8A 4FLFA 1SOUA 3AEKA 3I9KA 3BIJA 4EJSB 4RM2A 3C4QA 3A32A 2C7PA 3BE8A 3R3WA 1HDYA 2CYCA 1ZI8A 2AC2A 4WADA 4I50B 1XZKA 3IOCA 3KUUA 5TY0A 1M1UA 1ZH2A 5BSEA 3JQGB 3DPIA 5JALA 1NJSA 2OL4A 1JA9A 4MRAA 5IN5A 1P3JA 1W6UA 3TLYA 3TZ6A 5JRJA 1CQXA 2P5TB 2ZETA 4HAUA 1RD4A 5CGQB 2JLZA 2LKDA 1NG1A 4N0QA 5CJ2A 3CWCA 2WUEA 3EODA 3VYTB 2HH9A 3OHMA 3TJZA 1G8KA 2IX9A 4EMSA 4Y2UA 4UU1A 4UOEA 3ZHRA 4B6PA 4MQEB 2GZMA 3JD0A 4NESA 3SHVA 2LR0A 1TKAA 2YHSA 3R4CA 5H81A 5TVKA 4KR9A 1YQGA 3S99A 3K0FA 3KB8A 2PLFA 3HYCA 2ZUUA 1ACMA 4GVXA 3GJ5A 2D4AA 4KK3A 1G7TA 3HZOA 4BNDB 4CPDA 5IULC 4Q93A 1XMVA 2O54A 2QRJA 4Q3BA 1QONA 3T99A 4DR5B 2FF7A 3B5IA 1PV1A 2M1XA 3PPIA 1KZ4A 5FO1A 3RHTA 3UWKA 1XTVA 4FFLA 5EPEA 2FPIB 1POXA 4JBLA 2XMCA 3IVRA 3HKCB 2EGUA 1F8XA 4MUJA 2ZIZA 2GEKA 2PRIA 3ZHUA 1Z88A 1ODTC 3RJ9A 1BMTA 4IZHA 1B7GO 4BLPA 4KPFC 4GX2A 4Y1EA 1B3BA 4D4GA 5BV8A 1I10A 1B4DA 2AMYA 4JXZA 4B6RA 4TRNA 3CT6A 1ZLYA 4YRSA 2VK4A 4OHBA 1CRLA 3W5UA 2IYZA 4ZHSA 2P11A 4CT0A 2FGJA 2B3DA 4BNUA 3TS1A 4EJ6A 4A2PA 4EABA 3L1JA 1M1NA 3BTOA 1EI9A 4JS0A 1NQVA 3PDHA 4GQIA 2GCIA 1BCRA 3ICQB 2BR5A 1NU8A 5TARA 1XTPA 2CMKA 1CY2A 1JA0A 2QMOA 3CNEA 3CXRA 2ZREA 3MLAA 4RD6A 4UHFA 4E11A 1BEZA 5A4AA 3WBFA 3BMQA 5JJLA 1J0EA 3BREA 4CTNA 2D5IA 3ZLUA 4B2YA 4D9MA 4YQZA 2FX5A 1LF0A 1P0PA 1GZ4A 3RAGA 4FLMA 5JAOA 1KS9A 5LQAA 1Z6XA 1Z73A 4DCGA 1SIWA 4PO9A 5FLKA 4UAUA 5CYFA 2FZKA 3ZW9A 5C8XA 5JZ9A 3AW9A 5JY6A 1W1WA 2QLMA 5DBIA 1KVQA 4CKBB 1UBOS 3KSBC 4ZANA 1EFLA 1U3DA 1ZI6A 2Z2KA 1OA0A 3DEYX 2I76A 4PX5A 2VQ6A 1AX9A 2F1OA 2TMDA 4GD3Q 4I3FA 2WVJA 2VNJA 1GILA 3A7EA 4KQ2A 3ZHYA 4QQ8A 5CPFA 1AKRA 3VA7A 3DTVB 4TZKA 3NYQA 3AVWA 1FA9A 1KVSA 4BAUA 3JWJA 3UHFA 4FKZA 1NVUQ 1RRPA 4LNUB 4XH9B 4B9EA 1IK4A 1W49A 3U60B 3LCVB 2QRMA 1VHDA 1QAQA 2JEOA 4BO1A 3RVJA 3DXYA 4FYXA 1MRNA 2WJZB 2FP4A 3KT0A 4S1TA 5REQA 3DDCA 1USWA 1Y7TA 2AOTA 3HKDA 3NBUA 3U3JA 1QF7A 4IR7A 4KFSA 1E5DA 4EG4A 4ZI2A 2CDCA 5FX2A 5BVHB 4OMUA 2NXCA 5I4CA 3CRZA 4W5OA 2B8WA 3I5MA 5T67A 1AO3A 5I9BA 3RUHA 2ANBA 4A10A 4EX7A 1APBA 3T3IA 1QU3A 1REQB 4GSLA 4BDTA 5BQXA 1H2RS 1E3EA 1QZ3A 1XQ6A 2QR3A 1XNQB 4BWVA 1Q6ZA 3CF4A 3QWFA 4M0UA 4Y9SA 4A6XA 5IX8A 4BE4A 4DOMA 3ZE6A 1X38A 2Q5JA 3A1NA 2ZJBA 2ZROA 2QX4A 3RKRA 3PQEA 2WJ4A 1CUFA 3IMCA 3K53A 2Q62A 3L8GA 3PIRA 4RIEA 1P6XA 4PBSA 4X54A 3QEBZ 3V1LA 2IUFA 3MINB 2O6HA 1XHLA 4FSDA 3DNMA 1R6AA 1L4UA 2R62A 3HLYA 1PD1A 4Q3NA 3P9QA 5A9TA 2R2AA 3U61B 1Y8RB 1P7WA 3HCOA 1QVWA 1N2XA 1M2GA 3WLSA 3ETNA 5IBPA 2IYNA 1Z5VA 3T94A 4Q1VA 3NBFA 4F9TA 2WPDA 4NENA 1CE8A 2EKDA 3H17A 1XZAA 2QMQA 1KMHA 3DE6X 3MJRA 1MRSA 1XHEA 2V0CA 4Z1MA 4DYHA 1O9GA 3NEPX 4TLLB 4NYJR 2CXUA 4DNFA 3A4VA 5JO9A 1VXRA 4CDMA 3ECCA 4PC3A 3AGPA 4ZFNA 1EHIA 1DSSG 1RXUA 1ZIXA 2NV0A 3EQZA 5D3MA 2AYXA 2ZRFA 3DBRB 5JCOA 2HMAA 1BXGB 2C9ZA 2ZB3A 3IRUA 3UJPA 3AKEA 1Q5PA 4Z3OA 1ZH0A 2Z3WA 2J45A 3IHKA 5EUCA 4AWBA 5AVUA 1OHHD 3KXLA 4PM4A 3HJAA 3U3MA 3DXZA 4LFAB 2IEGA 2I3ZA 4LBZA 3GJ7A 1JDZA 3D7KA 2PUTA 3F74A 4PCAA 3ROEA 2XZDA 2V1UA 1M5RA 1LX7A 2BZSA 2IYVA 3PG5A 5HIAA 2HF7A 5G2OA 5CFRA 4WMLA 3T3NA 1YMUA 1MQ9A 3O82A 4RTLA 2WUFA 1XXHA 2QQ0A 2R2GA 4FBMA 1CUBA 1ETUA 1XD9A 2W71A 2VPIA 1X7ZB 3EGDA 4K9RA 3L93A 4CKEB 4NV3A 4BTEA 4OQYA 3RREA 1D2AA 4ZK6A 2ERYA 1QQAA 1HYEA 3EVBA 2OYRA 1NKVA 2QT0A 1UWLA 2Q4TA 3LC2O 4J0KA 3UMSA 1PNRA 4FXOA 3KSUA 3TDKA 4DEVA 4DLKA 2QLNA 5BNWA 1MW8X 1J4AA 2QVBA 5IYZA 3L02A 4XQ9A 1R2QA 2HDNB 2V5VA 1ZD4A 2MSKA 3RNLA 3PQ4A 2PUFA 1G16A 3OBIA 1FJGB 3EZ7A 3ONEA 3SY8A 1E1DA 4YRFA 4WBNB 5KB3A 4K2HA 3GJ3A 4MW5A 4N0MA 3H99A 4H16A 1J8VA 3ASYA 4MRRA 2OWDA 2YV3A 4EPTA 4REQB 1RE1A 5IBQA 1B73A 1C9EA 3AP1A 3FRHA 4CEIB 2WA2A 3SYTA 1EUQA 4Z1MD 2I2BA 5AD1A 2A9QA 2WWIA 1U94A 3LBYA 3K0CC 4MYRA 3WYFA 3MAJA 3UYKA 4E46A 1K4YA 4MUEA 1PJ8A 1Q0LA 2QRKA 3QKWA 4M46A 1RQRA 1JH9A 3C6YA 1FFXB 1TADA 1N2BA 2OG2A 2YV4A 2V97A 3SJZA 2FWAA 2G7MC 1RSZA 2WDPA 5DXAA 5JVDB 2MYUA 3B78A 3SXUB 3I76A 1QV9A 1JEOA 1EGAA 1NYRA 4JLOA 2I9PA 4EAQA 1JW9B 1QFXA 3P9XA 5B1YA 1G42A 3T0GA 3E18A 1P81A 2W4IA 3EGEA 4JKIA 4HEA6 3D6NB 5AJZA 3TZEA 2OGTA 5U9CA 3BKXA 5B1IA 4YALA 4ZT4A 1KJZA 3PUHA 1YQXA 4ZVSA 1Z0IA 3ZC3A 3H42B 3CS3A 1I3OA 5JPIA 5JCJA 3HJUA 3FF4A 3UUFA 1ADFA 4WOKA 2BUAA 4IEEA 1R4NB 4CMEA 4IPTA 2IHKA 2WMOB 4TKLA 1XTIA 3B38A 3NTUA 3WOVA 4BWYA 4B3IA 1UXIA 1HTBA 1U3TA 3M3DA 3TCXB 4RTSA 1YOVA 5HIIA 3FWZA 3TXYA 5CITA 3TQOA 3DAPA 4UULA 1QHIA 1XRMA 3QPCA 4I81A 2PKQO 1EFUA 1ZZGA 1YR1A 2NUAB 2C4UA 4MULA 3DE7X 4LX0A 1OV4A 4Y1GA 4E08A 1D4ZA 3UMBA 3PWKA 1NU6A 2JJ2D 1DWPA 2IOQA 1GO2A 4K03A 2XWPA 4QL3A 4V0KA 4B81A 4HWOA 3DEFA 3SNHA 5DSZA 3PFBA 5GONF 2BT4A 3O84A 1RP1A 2G77B 2GO1A 4JJAA 4AMYA 1EP1B 4M86A 1XALA 4JY7A 2P1RA 4PRZA 3HO1A 1FVXA 4UNRA 1UJ2A 1N2GA 4IEIA 1A8QA 1H2BA 3LCJA 4RPCA 1PNOA 3TO5A 1TRKA 1VL2A 2JFVA 3TKLA 3CZ5A 3HKCA 3BD9A 4EZBA 2C61A 2XHEA 2EDAA 1VSUA 2BAGA 4RFLA 4Z7OB 1RXYA 2VTEA 5ITZA 3HWSA 1WTCA 3OU7A 2NTVA 3QIVA 1JKXA 3HN2A 5IWAB 1EDZA 4D43A 1R1DA 1U7ZA 3L0YA 2F3UA 3HJFA 2C2ZA 2JFPA 4XGRA 3CH5A 2GUGA 3KYDB 5KCZA 4ZAGA 3VC2A 3X2SA 4EQ6B 3L4BA 1Y4ZA 3FGPA 4XM0A 1YQ9A 1UIMA 5DMXA 3T15A 4CN8A 4MHTA 2Q3HA 4PAMA 4RDIA 1NJGA 1T1RA 1V5IA 4HO1X 3T3OA 1Z0ZA 1CJSA 2V7PA 3H0KA 2VP4A 2X6QA 3GFRA 3QELA 2HU2A 3CPSA 3LFTA 5CYPA 4FDTA 4DCVA 3O1JC 1DRKA 3ZLJA 4LV5B 3WB9A 4PFKA 1IB0A 3X1MA 1XTTA 5E9QA 5CDFA 1ZN9A 2HKIA 4FE3A 5F5NA 3ZBPA 5F9HA 5MFZA 4UJ5A 1K8RA 4KQGA 9ATCA 2YXEA 5BWOA 3GG9A 2UZ3A 4DR7B 2BFDA 1GKYA 2ONZA 2DECA 1QIEA 3BRWA 4UCXA 2DPMA 2VNAA 2NW6A 4POAA 3OPNA 2DT8A 4BFCA 2OEPA 2ZRLA 1U7TA 2W37A 1E4OA 2P41A 3GN1A 4QXMA 4LCBA 2E89A 4NV1A 4UNIA 5DM60 4BLQA 2O2ZA 1Z5PA 1X86B 4OGGA 1VHQA 2O8DB 2XW6A 1CFJA 2E48A 2I3AA 3GLHB 3UCXA 4CMKA 1HR0B 1F6WA 2WILA 5KYUB 1AV6A 4EG3A 4Y6OA 3AHIA 3SIRA 2CVFA 4DNQA 5FFFA 1VLLA 1KH3A 4J0IA 4D2IA 4YV7A 1FPQA 2IZOA 3N2GA 1LBSA 4UUMA 5DSTA 2HCBA 1CYEA 3GAAA 3ONNA 2C3PA 4G5XA 3KJIA 5E4FA 4ARUA 1QH8B 4R8LA 3OX2A 4F2DA 1O94C 3SVZA 2OCLA 4DIEA 5DN6A 1EXNA 1K27A 3WGHA 1BCRB 1WPGA 4GYYA 1SC4A 3DCJA 3GLVA 3AKCA 5FO0A 4IMIB 4DMHA 3CG4A 2VATA 4GMGA 1B2RA 5K09A 1K92A 2PZLA 3KELA 5I5EA 3KYCB 4B43A 5KX5B 2P68A 2R4QA 1NUSA 4IZOA 4NMHA 1GN9A 1G17A 4RS4A 3RS9A 3AOGA 1PVOA 1NLZA 1ZQ9A 5EFZA 4TTPA 4AKHA 2O7QA 3DD1A 3H1AA 1V1JA 4M76B 2N47A 1W8DA 3ZI7A 1J21A 5K4GA 3C70A 4EKYA 3GT4A 3QE3A 4R0NA 3OZWA 4CKBA 3UMCA 2AC4A 1GG8A 3RTEA 1Y6FA 4JAVC 2Y1KA 3GEDA 2RGXA 1SGWA 3GJRA 4HZUA 3PL5A 1Y6QA 4PYMA 4WY2A 3TBKA 5LIRA 1G18A 3MELA 2IH5A 1DDOA 5FI5A 3TL6A 2OZPA 1FW8A 2R00C 3ZIAA 1ZM9A 3DTVA 1YR8A 3PXCX 3VKGA 1R5OA 1LU9A 1U2DC 3FOCA 5TEWA 2QVCA 1I8TA 5LOVA 5U1PA 1X1BA 3DWEX 2EJUA 2NQTA 2QX6A 2VBFA 2JIMA 5DDIP 1VSBA 3NTQA 5FBLB 5IAJA 3VVBA 3DVRX 4AWXA 2NUTA 3FTCA 1HZJA 1U0JA 3LRTA 1NMZA 3U62A 4YT8A 3O4JA 4QM7A 1ZRMA 3R5HA 4JV5B 1KY5A 3NVAA 2QD5A 2GPAA 3HI6A 4YMTA 5CB4B 4I1UA 5ER6A 2CEKA 3HU2A 2C8LA 1M2OB 1H3FA 4TKMA 5AJYA 2PTGA 1BDMA 4NNJA 1MDFA 4ENRA 4EKEA 1QGOA 4ZTBA 1NR5A 3TVDA 4RC9A 2Q0SA 3OA2A 1EBFA 1NN1A 4CMHA 4EYEA 4N03A 4LN1A 3Q0IA 1T1EA 2WKQA 1WSDA 3ORRA 1JG7A 1MV5A 2VRWA 4B47A 2YY6A 3LC1O 1IIRA 3AUAA 4ZCIA 4A36A 1K8ZB 4NR0A 2JAOA 2OILA 4YI3A 2Q4RA 3RJ5A 3P2KA 3CE9A 2A1IA 2D0IA 4OXKA 2VHCA 4OU5A 5DCYA 3AGQA 2ONJA 3ZH9B 2GN8A 2IEYA 1EIWA 2ZRHA 4JBGA 1NW9B 3LXRA 3M34A 4ZMSA 1S6YA 3U49A 4UDNA 3JWIA 1CUDA 4TKVB 3E03A 4NAHA 2AYYA 1W0KA 3NH9A 1OX4B 5H4GA 1T10A 3F5FA 1W36B 2FE4A 1L7OA 4EB6A 3MAAC 2PYDA 2D2VA 2DTXA 4QXAA 5EZ5A 3MS4A 3B3QA 3EG9B 3HMQA 2RG7A 3TQSA 3U17A 4LYGA 3NFYA 5K0LA 4YAGA 1R0SA 2FUKA 2QM8A 3PNVA 4XSGA 1M2KA 1XJQA 1U04A 2A7XA 2C5FA 2F3QA 3B60A 3M6VA 2K2WA 1K8YB 5D87A 5EZYA 4QQKA 5CVEA 3CLUD 3FYSA 1IEWA 4ALNA 2OKCA 2FCRA 2LIPA 2ZJFA 3R20A 4F04A 1L5MA 2XUZA 1P9WA 5GPBA 3EXG2 3U3DA 3Q72A 5E9JA 5KYKA 1QTRA 2ZIVB 2PSSA 2I99A 4ZP1A 4HRYA 1N0IA 4JIMA 1X2BA 1QHFA 1U8ZA 3UK6A 4UATA 1O8BA 3D3WB 3N74A 1RYDA 3PIIA 1RHRA 4OY3A 4YP1A 2E6KA 1NZFA 1Z25A 1XEXB 3GR6A 4J16A 3G0CA 4WK6A 3TW6A 1BWSA 2XI4A 3BB4A 5AM4A 4YY3B 3OM0A 3COSA 3H1BA 2HJ9A 3EQ9A 4HH3C 5LQNA 1U2DA 5KEIA 3HA7A 3DP7A 3VPDA 1CG6A 3PNBA 3DZJA 1Y9JA 4BKQA 3GT3A 4QM6A 4MICA 5E3HA 3F7TA 5LWQA 5EWMB 2I6UA 4UUOA 1JLLB 1AKNA 2XYQA 2EG5A 3OE1A 4HUTA 1ZOOA 2B5WA 1QKIA 1Q1ZA 3PUYA 4YRQA 1GL6A 1M9NA 2ORYA 3BJIC 3AR6A 1AA9A 3PPWA 1C5KA 3T9EA 1A2OA 3JSXA 5AKEA 2MSNA 3WNVA 4AYWA 5BQFA 5I7OA 4ARZA 2AYZA 3HBLA 1JS1X 3HBMA 1IHDA 3GPCA 2XDAA 4TUYB 2UUCB 3TUJC 3GLQA 3K0HA 5T4BA 1X19A 4WNCA 1XJCA 3ZYCA 4RDXA 5JANA 1R3UA 2XBLA 4ESOA 5HKAA 4L8GA 5C0OE 5HJEA 2OZVA 3GU3A 1KYYA 3P2IA 3KEOA 3H2SA 3QXXA 3H11B 1QFYA 4ACAA 5EJ7A 4MGZR 4US1R 5JQGB 1ZYUA 1QQ7A 2H2AA 2HMTA 1UBKS 3QPAA 3CJQA 3FYUB 3G8AA 1CF9A 4ZVPA 2OMEA 4JL5A 1BN7A 2Q21A 5IF9A 2F64A 2HRDA 4ZPXA 1IEQA 3H5LA 1HYQA 3WYNA 1X80B 1Z15A 3EVNA 3WRYC 2Q27A 2P6OA 3GGSA 3KVOA 2X3FA 1FTQA 3DLBA 1XTUA 1OI4A 1Q2UA 2NG1A 2ADFA 1JEYA 2WBLC 5CLFA 1N3IA 3OWXA 4JJKA 2Z3VA 3EBLA 2MDTA 4LYYA 5CJPA 4CMAA 5KYWA 3FPAA 5G0TA 3AERA 1I24A 3TLCA 1WQ1R 2IPMA 1V35A 4I9HA 4IGIA 4CVNA 3GOQA 4TQUS 5FF9A 2V0GA 1EK5A 5AI4A 5EFOA 3A6HA 4AMGA 2WIGA 1H0SA 2O2CA 1WEHA 2ZITA 3A9WA 4HBZA 4YV0A 2HRZA 5EI5A 1CXZA 4TWAA 1N2IA 1OROA 5H02A 5IH7A 2YN0A 1OFVA 1CULC 4AJEA 4EW6A 5JXIA 3R3VA 2GLUA 3VC7A 2CWDA 3T12A 1BA3A 1Z4PX 2BJVA 4J0CA 5JSYA 1W4LA 4JCCA 4YVFA 2PSDA 5JCXA 4TZ0A 4QJIA 2W6NA 3D6TB 3S2EA 3DZGA 1L0BA 7GPBA 3MWEB 3M8KA 1NQXA 2WNSA 2ZB7A 1OI3A 3NKLA 5K4AA 3R7AA 2HXSA 1KJ9A 3KCNA 5LN1A 4RH3A 3IPRA 4MW2A 3D8RA 3I2YX 2BFCB 4NBVA 1JAXA 3DL4A 5FH9A 1FX0A 3R24A 1NBME 3KSRA 1BTOA 2XD9A 2Z5FA 3PU6A 2NSYA 4HPXB 4RPGA 4KQMA 4XD7A 5BOVA 4CCYB 2XIJA 2HIHA 1O87A 3MWGA 4HZGA 2NXNA 2FW8A 1S02A 4JSRA 4ZOAA 2YUTA 5CFOA 4DUYB 4FXPA 2GM9A 3GJYA 1Z2OX 4RFSB 4QTTB 1WXWA 5DGXA 1YDFA 4MUBA 4OBBA 1ZM2A 4PRKA 4R68A 3MXTA 3X2EA 3SLKA 2OD7A 5KTMA 3T1TA 4ZT3A 3AC0A 1YHNA 5FL7A 1WKBA 4H0FA 3RKUA 2XKKA 3AL0C 5JSKA 2OCGA 2J0QA 2ZBPA 1WQ4A 3QENA 2H4ZA 4LVNA 4UTRA 4IILA 4F9EA 3RBXA 1X8LA 2C9DA 1T43A 3FYDA 3HNRA 1I4WA 2Y1DA 4W4TA 5FI0B 5JNRA 1WW3A 1PLKA 3WWZA 4EQ6A 3F4LA 2ZUFA 3TLMA 3GVXA 5MGNA 1A8SA 1G9SA 4Y6GB 3FSGA 2A7QA 5F1KA 4UTPA 3ZGYA 2C96A 2FJPA 3EE6A 4C0SA 4E5NA 1SKMA 4XOUA 3BE5A 1G20E 1O97C 1XZLA 4IDCA 1TQ2A 2ZRNA 3M89A 1Z4IA 1H2AS 4OXRA 1K89A 5A3VA 4B3SB 1PJTA 1J2JA 1FVOA 3EA4A 2EATA 2OORA 2O1SA 3SEQA 4DDTA 1TU0A 1NUQA 3FX2A 3REQB 4ECEA 2WEKA 3IDOA 1EZZA 4G8BA 1BXZA 3G17A 1Y3IA 4IZIA 4FGSA 4RPLA 1LWOA 1RU3A 1YA4A 2WB4A 3QKUA 4KKVA 2BOVA 2JHPA 1OCEA 3H4MA 3P2EA 3Q0TA 1NVAA 4V39A 4UM9D 2LD4A 3L6BA 4CETA 2DFLA 3OPXA 1U7OA 4J29A 1R10A 4EFKA 4HRAA 1CQZA 2H4YA 4RPKA 3AVPA 3H2KA 4F3YA 4ARBA 4HAYA 5A5VA 1MENA 4DA7A 3OFJA 2QE6A 2CLIB 1XMQB 5KVQA 1MOSA 1TRHA 2ONKA 1Q17A 2ST1A 5JQWA 1UBEA 6Q21A 3ZHOA 1T8YA 3GLHA 1KI2A 5KVVA 2GM4A 3QWIA 5F5XA 3DNFA 4LXQA 4MI6A 3FRIA 2R8ZA 4TYPA 2G0AA 2XGGA 4M0KA 1BMQA 2VBIA 2YX1A 1WOMA 4FFRA 4LXXA 4LXHA 2JA1A 3BILA 1TVKB 2W8BA 3F78A 3G0BA 1GNQA 1TXGA 4LG1A 1C8BA 2P40A 2ZAYA 2OLJA 1E69A 3WMEA 1QO0A 2XQIA 1O4VA 1XLWA 2XMBA 3O8QA 4AJJA 3D0RA 3IDAA 1Z28A 4MUHA 4M1KA 2X9NA 4TV8A 4KK4A 5C5IA 3C3CA 4M1EA 4EK9A 1QHSA 1EK6A 2DFVA 1TLFA 1DXOA 2WJYA 4HDRB 4QDUA 3PDCA 3QHQA 1O1YA 2CXQA 5IJZA 2J6CA 3M1LA 2CSXA 2NNWB 3W5AA 4Z9XA 3V1KA 1EBUA 5J2TA 4XJSA 10MHA 1BC5A 3NGLA 5LB2A 4BNLA 2HV9A 2PWYA 4QUGA 4NX2A 1RVV1 2QDXA 3H5RA 4WJLA 2BBOA 2NPFA 3ROKA 4E4YA 1VLJA 1Z4LA 3BQNB 4TV8F 2R3SA 1P4SA 3Q3JB 4TXJA 5ALRA 3VPAA 3LA6A 3DMDA 3H1PA 4I5EA 4NL4H 3U48A 4QDZA 2BKXA 2V59A 4HDSB 2Q1YA 3TIVA 3MJDA 1WXHA 2HA3A 2WVGA 4YJ2A 4CU5A 2YV5A 4I36A 4YO8A 4YP0A 2JASA 4PGFA 4QODA 1YZNA 4D41A 2NX2A 2J41A 5B58C 2YDYA 5ALTA 5TR9A 2IUYA 4QJ4A 2ETVA 4DIMA 3T1HB 4E30A 5CB4A 2GO7A 2HPAA 1GSIA 2HEIA 3M9XA 1Z13A 2Y4OA 1ODLA 4IGEA 5LVAA 3OZRA 4Z2YA 1TJ5A 4IG4A 3EBPA 1WLYA 2Q2VA 3IQZA 5GV8A 5IKEA 2NZJA 4C9BA 1YJ8A 3LOPA 1UH5A 3DNPA 5DM4A 1RRCA 1TMOA 1U65A 1NIJA 2VRNA 3HVUA 3IBFA 4C0HA 1ZM4A 4PR0A 4RTOA 5BYAA 2IK8A 2WVHA 1QAOA 4M7WA 4RXUA 1HT3A 1P62B 4JIGA 2CUZA 4LJ8A 3EEOA 3B2EA 2O3QA 2W4MA 3IDSA 3IXQA 3TXAA 2AN1A 1XZIA 3IAS6 1NBIA 4JLDA 1EVLA 3O8NA 1JVNA 1K2WA 2ABWA 2PR2A 1I36A 3EIHA 3HE3A 3SZMA 1QHEA 2GMWA 3B8EA 3ENWA 1E3LA 1VHTA 1WZNA 3IVCA 4YLYA 3TPFA 3D4IA 3OPYB 4WLNA 2CV1A 4MR9A 3E53A 3BMOB 4P4TA 1HLGA 2PWPA 3H6KA 5KMGB 1SC9A 4YASA 5FA8A 4KI0A 3VHLB 3WHIA 1KEVA 2PNFA 1B0ZA 1G2PA 1S9DA 4LZAA 3UXYA 3KZXA 3DXXA 4ZVQA 4LZZA 4FGUA 4BZZA 4L4UA 1Z82A 5LBIA 3PFFA 1Y8AA 4K2AA 3B8HA 2M98A 1FPMA 4H7EA 1V1RA 5ALQA 5IKXA 5JWRA 2X8WA 3KKZA 4FI3F 1Y3AA 1Y4AE 3FKQA 5BYBA 4IDNA 4BNTA 1SEPA 1YBVA 1XZBA 2H4FA 1XD8A 2BFFB 2A9JA 3OJCA 4GZLA 4DA8A 1ILEA 2IBSA 3KJFA 4GXQA 2I1QA 4A8JC 2XUGA 4WXRA 3Q98A 4CV1A 3PTAA 1N6HA 3U7FB 1ZSVA 2CUTA 3AY3A 4L8WB 3F71A 4WVFA 3OX1A 2IV3A 2NVBA 1YRLA 1WD5A 5L8VA 5BY2A 1SWVA 3ZWWA 2P2DA 4QPCA 4QU0A 4J6FA 5K8VA 4I5IA 3GUYA 3GXBA 1GEGA 4S3MA 5TX7A 1JLLA 1Z6TA 2XB4A 1JKMA 2FPUA 3FFAA 1MH1A 5ALUA 3ZS8A 4X6UA 5JAIA 3JQ9A 2IXEA 3R5SA 3AM1A 2WHPA 3V7UA 2R6HA 2ZATA 3DEHA 2BLNA 3U4MA 3OJOA 3QVLA 4XYGA 2PRKA 4C1NA 1SBTA 5K8LA 3FTEA 1R4ZA 3DO8A 2NACA 3QHPA 4KN5A 1M8GA 2A1UB 4ALLA 3BXEA 3V4SA 1N5JA 1Q1EA 1XPUA 1Q83A 5FOXA 4IS2A 1H2HA 3DFUA 1N8TA 2NVOA 1U9JA 1Q11A 3G1TA 5JI2E 3NHPA 3RYCA 1LW7A 2EX4A 2UVPA 2ZT7A 1PJ2A 2IKSA 1VL0A 2LKCA 2Z58A 3QMMA 3HJGA 1N7GA 2FXIA 3K2QA 4IZ6A 3BGVA 4QEDA 2QN3A 2Z2XA 4Y6QA 2CBXA 2A3NA 1QGUB 4W8OA 1S7GA 1Y0BA 1KYXA 3LF1A 3K8ZA 3FYUA 5U4QA 3NZEA 4O1HA 2CE2X 5KYYA 2CNKA 3K9NA 1A1VA 4K40A 2YV1A 1QRDA 3L0CA 3RRNA 1E1CB 1OBFO 2E1PA 3A4IA 4CDGA 3ZWVA 2H7YA 3INNA 4E70A 2AQ8A 1GCGA 1V6SA 1GFSA 1OUMA 2WIDA 2Q45A 1LNSA 1TTHA 1X9HA 4WKNA 1IY2A 2AFIB 2VKTA 2ZRGA 2ISQA 3EXFB 3KKMA 3PNQA 1ZITA 2JD1A 3CGWA 3DYVA 2J9FA 3KV3O 4UASA 3WMFA 1YQWA 1UBTS 1NA5A 3S29A 2VWPA 1OXSC 4FK8A 4UVEA 2QYSA 1U6KA 2RE8A 2MHCA 2DBQA 2PX6A 3CHYA 4BXOA 2R1TA 1SBYA 1XDWA 2V7EA 3KJXA 5EXDA 3D1JA 3W5BA 1CY1A 3EEYA 2QAIA 3PDJA 4JDUA 5L9AA 4DNPA 4Q1FA 5CFMA 1QP8A 5LU8A 3GLGA 3JVUA 1V41E 4KBFA 3C8UA 4DWOA 4HKTA 4I1PA 2CK3D 2P6PA 1CT9A 4BZWA 5BSUA 1PZMA 2W6ID 4YJ2F 4F4IA 3IHTA 2XRMA 1JXOA 2OP0A 1ZA1A 5ICFA 2ZM5A 1IOVA 4FGJA 3EQ6A 2BTOA 2HNBA 2OCAA 3PGKA 1P2DA 4FYWA 3KK0A 5THQA 4O4IB 3RIHA 2WJ6A 3I39X 3KOXA 5I7VA 1GGFA 1OLSA 4Q9HA 3LTEA 4FNAA 3LWNA 1JF8A 2VJQA 4GGPA 1IBCA 3LDUA 4PRYA 4LVCA 4CCWA 3ER8A 3RS0A 4KR6A 1R6VA 2QN9A 3NIBA 3S55A 4N9QA 3I6BA 1KNQA 1MB4A 5A7GA 3RD5A 1ZVVA 4X90A 5JATA 2A35A 2J87A 1XRRA 3D4BA 2PIDA 1UK6A 3QG1A 4RFSA 2R00A 4I55A 3I9MA 3FZNA 2HWYA 1QHYA 4PLVA 1NT4A 1SVNA 1YVEI 5BW5A 1OWOA 1P18A 1Q0UA 2GCGA 4KC0A 3DM5A 2P75A 5C81A 5AKJA 5T5QA 2B2NA 4YAEA 4DWJA 3E1GA 1IWPB 3VGPA 3W5CA 1C29B 2GZ1A 5K6RA 2IS2A 3IXLA 1E6UA 4AKTA 4DCNA 4ZVTA 1HRKA 4HWGA 3UCEA 2WF8A 4AQ7A 2JKVA 4GOOD 3KHSA 5HJ2A 3NBYC 3TINA 2PX3A 3MMSA 1ZAKA 4XR4A 1M75A 1QCCA 1OD6A 2QM7A 4YFYA 2PSJA 4AP6A 5JBNA 4QUEA 3THWB 4R71A 3W8RA 2HIGA 5JE8A 4BBPA 1NQTA 4V0LA 4M0MA 2OCDA 2Y1WA 2ZDHA 1PLJA 4UHHA 2C1EA 3GUUA 3KVYA 3OEWA 2XNDD 2W6IA 4X62B 4O08A 4J4TA 2UUBB 3PFKA 5BNZA 3LUHA 2AT1A 2HF9A 1I7PA 1O94A 1Z6YA 3F97A 5EXTA 4GEGA 4A27A 4QGHA 2ZJOA 1M0EA 3KZMA 1SK9A 2D3WA 4RV9A 4EELA 3OLQA 5A0TA 4JI7B 2J0VA 3G7NA 1N75A 2VC2B 3O1LA 2CD9A 3K1YA 3ETGA 2CEAA 1QO0D 4F8YA 1A4IA 4IBOA 5HBRA 3N2EA 2CVZA 4UU0A 3ZWDA 4KE9A 5D51S 3KB2A 5K51A 1N7IA 3UKOA 3QPDA 3W90A 3I23A 4HDNB 1QMGA 1V95A 1N3BA 1ZRHA 2QLBA 3EXG1 3X43A 4Q9KA 1E2DA 4HDSA 4L8YA 3CW2A 3CKMA 1JHRA 4RLSA 4G24A 5TF0A 3IQWA 3VV2A 4UXHA 2F43B 1P1CA 2FWNA 1OFIA 2Q1TA 4C7MA 1I2DA 5TGTA 3UAWA 2FOXA 1X70A 2YVUA 4RSMA 1XYGA 4RXTA 4F38A 4L4ZA 1UKAA 5HKOA 2XCOA 4OU4A 2EYQA 3C3BA 3S7ZA 3D8SA 1HKUA 1P0CA 1T5IA 3ICEA 5JU6A 1E2LA 4PPNA 1M8FA 4CEJB 5GP1A 5IJAA 2R751 1YS6A 3I34X 5TS3A 4R7TA 4AJPA 3D8TA 4DA9A 2XB2A 2L69A 1KSGA 4AJ4A 5KOJA 2HHHB 1P91A 4JWKA 4HLNA 5E6SB 5FPHA 4UVGA 5I4IA 1UDXA 3OZIA 1PL0A 2Q6TA 5T8KC 4E5SA 4IV8A 4IUBS 4CQNA 1DRVA 2HBYA 4F6LA 4RTJA 2VLBA 3SG0A 1TT5A 3GEIA 3UYLA 2GPSA 3RGGA 4PANA 1YBMA 1EK0A 3LP8A 3LHIA 4AY3A 5J47A 1SC6A 1YS4A 1AUOA 1V3QE 2ZBFA 4NY1A 4N8DA 2QZ9A 1SUCA 2A84A 4URVR 1JSRA 2GAFA 4I8DA 2FSGA 2IYLD 2XUDA 3PLAE 1CDDA 1NX6A 1PEDA 1CQJB 4L95C 2PY6A 2OVBA 1Z36A 1WHSB 3MILA 2J09A 2R84A 2OAGA 4KQ6A 3JYOA 3PR2B 3K32A 1U0RA 1G1MA 2C2MA 3W0LB 3I5UA 3VTZA 1V8ZA 3BMOA 3DWGA 4UMDA 4RA6A 3EH2A 4JLVA 2PXAA 1G60A 5F76A 4YR7A 3P9NA 4NMWA 1NM5A 1PJBA 5IVKA 5F2OA 5JI3E 1CZRA 3LKDA 1NJ5A 1JIJA 2C9MA 2AZXA 5GTDA 1A8UA 3BK7A 4HWTA 2FOLA 1GD1O 4DNOA 1KAMA 1FRVA 5HYVA 4TVOA 4BGUA 1CUEA 1DPFA 3BDIA 2CXPA 1P8JA 1EAMA 1RRFA 4WD3A 5EOVA 5A3SA 4M0PA 4BX2A 1NI5A 1USUA 1YJ5A 2F3PA 5AW8A 3WGTA 5TMBA 2KHZA 3RVDA 1CFZA 1NNI1 1C80A 2VZ8A 3KLPX 2A6PA 2P0YA 1VG1A 3WZMA 3E4DA 1YS1X 2F00A 5GJBA 1EIZA 2H6EA 2B98A 1H2WA 1U28A 4UNSA 4YLEA 1AU9A 1LTQA 1L8AA 1P5RA 4G81A 5F77A 1NW7A 2AW5A 2VZLA 3OEHD 3WGIA 5I01A 5IK2A 3UBMA 8ABPA 1PYGA 1REQA 4JYBA 4ZI3A 2DFTA 4MUGA 2UU9B 2QTMA 4ZC1A 3OPYA 2B8TA 2A1UA 1EUZA 1AVTA 1CRZA 1E2JA 1RRGA 1T4CA 2PV0A 4GC5A 1Q7GA 4B3JA 1CZLA 2V45A 721PA 2BEWB 1IQRA 2H9IA 4WN9B 5DSXA 1YCHA 1G5PA 4FSHA 1RC1A 4YUAA 1C3VA 3RV4A 3ZBQA 1TW2A 3L0SA 2P78A 1Y63A 2GTHA 1KEUA 1BD4A 2HTFA 2M6RA 3BX1A 5ESRA 3C41J 3V8MA 2Z8YM 4CMCA 4HNVA 1U2GC 4C88A 4BQSA 4CF7A 2BP7A 3GHHA 1C1XB 1OXKB 3TYXA 3F4KA 5HGXA 3CUEF 1ZNXA 1YVDA 5JJIA 5FBQB 3HWX1 1P5HA 3T9FA 5KWIA 1UKVY 1NUPA 1YE8A 2ILTA 2ICAA 2ID9A 3G2OA 3GH1A 5DK6A 3HNPA 1T9AA 4QRHA 5LYYA 4Q4LA 3A2KA 4Q7QA 5ALMA 4F3TA 2VJLA 3EC2A 1TVCA 2C7RA 2WF6A 3OHSX 4JEHA 4FGWA 3HEBA 4DG8A 1R9NA 3LQ1A 3VJRA 4IQFA 1JEDA 4MW0A 3F49S 2XNKA 2WWGA 3LIIA 3WJ2A 5T7BA 1J23A 1XRPA 2JGRA 2O8VA 2X42A 3FPKA 2P9TA 3GZNB 3KJEA 4HGPA 1FDSA 1BH2A 2UYGA 3GBVA 4Z4IA 3VU1A 2DH6A 2PMEA 2LTAA 3D02A 1DADA 3PFGA 2AXPA 2ECOA 3FPSA 3SOPA 3WO1A 2R1TB 4A5OA 3NGXA 3ZJ4A 1Y8ZA 2YJ4A 4IXMA 5EIAA 5LJIA 3R40A 2VHQA 2G9QA 1K4MA 2R47A 1O3YA 3DGFC 4HB3A 5A04A 3NQ41 2IQ5A 4XASA 1O54A 2OQVA 1QDUA 4NCJA 3T5DA 4X91A 1NVKA 3PGA1 4B6EA 3ZWYA 2N1MA 3HCBA 1F6DA 5AUOB 3NTLA 1UWVA 3BZWA 1ARZA 1KDOA 1XDUA 2OA0A 4AQYB 3U6KA 2WTNA 3L6DA 4MQ4A 3A4MA 4X6LA 3OE7D 3WHLA 4GQAA 2HJHA 2WWWA 2AW3A 1O5TA 2HCJB 3RYIA 1M2JA 1MCZA 5I9NA 4NOJA 3WSTA 2REOA 1QGUA 5ER9A 5AVXA 3B1JA 2FEXA 3G0IA 3GMDA 4QX6A 5TQ2B 4D4KA 3JPWA 2Y1OA 4B7AA 2F2TA 4E09A 2GZRA 2JIZA 4Z0TA 2XE6A 1P44A 4ND1A 1NF8A 1U6JA 3EGCA 4DARA 1RP7A 1J1UA 4ZYXA 3IOMA 4M0LA 5IXSA 3CXUA 5GGYA 4AD8A 1S2MA 3K2EA 2A0WA 2P9CA 4YCDA 2GK7A 3PENA 4JP3A 4UQPA 1UIRA 5BN5A 1AO0A 4MPPA 1GAWA 1V1MA 4ALIA 2RH9B 4GIBA 2RIRA 4KR0A 3GXOA 5FUYA 3RK0A 4MVJF 7REQB 2O05A 1A1SA 2FQQA 3SJ7A 4AKGA 2C57A 3O2QB 2L19A 3WZLA 3AVOA 1MJFA 3A2NA 4E7PA 1L4KA 3EPKA 1WY7A 3WNBA 5FUMA 1C9MA 1RWQA 4D4HA 1L4YA 4B3DA 5F9FA 3HM2A 1SUIA 2QN6A 4AZ0A 3RABA 1G63A 2CNWD 1EXVA 4LOIA 1ODIA 1ECJA 1TMGE 3KYBA 4I5DA 2FH5B 4OSOA 1SY7A 3TOXA 2RGGA 1WXFA 3DC2A 4A1OA 1W7AA 1FYDA 1LI4A 1ODKA 4N0PA 5C53B 1GV1A 3ER9A 4FT2A 2X3YA 2ZIGA 5E6UA 5HW0A 1PDVA 3OJWA 3LQKA 1FNSA 2DUNA 4J0HA 1UAGA 1AK2A 4FYKA 5AKZA 4CM4A 3I61A 1R8YA 4TQAA 4DJAA 3P52A 4PYKA 1UC8A 4Q82A 3EXIA 1U0HC 1GPKA 4JFAA 1JKJB 1F20A 1PFUA 4A73A 1NVVR 3DV9A 5EKDA 3RT9A 1OLSB 1KDTA 3L46A 3PP8A 4OIFA 3FVTA 1MB0A 2O48X 3OE7A 4D81A 4ZZ0A 5A5GA 2C9OA 2WQZA 4KGDA 1FFCA 4K0RA 3UAXA 1PK9A 2BFPA 2AI2A 2IHJA 2WPNA 2HMUA 3TQFA 1DQPA 1JT9A 3CUVA 3G6KA 2IDKA 3NUGA 3S44A 2J6HA 1EU1A 4QNMA 2RKOA 4CQLA 1PLLA 3AUSA 4LEIA 4AFNA 4DMCA 1FMFA 4MJLA 1L4NA 3RADC 1UC4B 4XUDA 4XX0B 5D84A 1M83A 4DGSA 1DCTA 1T3HA 4HDNA 1I4TD 2NUAA 1JG6A 1C0EA 1BDBA 4BMXA 2K4MA 1UDCA 2VHYA 2YXLA 4XARA 3EZXA 4YXWA 4NXNB 2SCUA 1K0UA 2FK8A 4P35A 4YJ3B 5A1JA 5HF9A 3A3KA 1KAGA 4E6PA 2XMGA 1SO8A 5M5BA 3RVLA 4MKFA 4XIFA 3Q6NA 1U7UA 1SJ9A 1E2KA 2GBIA 3WKAA 2ZAIA 1L9KA 2EW8A 2Z6AA 3UG6A 1GQFA 3WKEA 2P2GA 5EUQB 1Y5LA 4X3PA 4X85A 5IKMA 2NVUA 4DV2B 2FTKE 1GAQA 1Z3IX 1YI8A 3MS2A 5EMLA 1Y42X 1JJIA 3N0TA 3U81A 2Z8XA 3K1TA 5A5FA 3A6ZA 3RRBA 1DT5A 1T3GA 3RYTC 2QVYX 4RSGA 3RANA 3USCS 8ATCA 4FCVA 3RVPA 1WA5A 3QFFA 3B53X 1T1JA 3PC8A 2X41A 3CEAA 4C4SA 1JQ3A 1BS2A 3KYDA 2OHOA 2DT5A 4B3HA 1ZR2A 4RZHA 3A6LA 4R5HA 3ZDZB 3ZK8A 4XJVA 4R6XA 4CKCB 1MT3A 1Y1SA 1XLTC 3KKOA 1WX1A 2E18A 2JHFA 5CBPB 4IGKA 2YICA 4NPAA 1DDIA 2JANA 3LHFA 3N59A 3V8RA 4A8PA 2COKA 3QJGA 4Q47A 2JH3A 3VSEA 1XKQA 4QDJA 1OB5A 2EZ4A 3KEFA 4UAVA 4RY9A 3O8OB 1WHSA 3ZJYA 2G1KA 4LWPA 1JQKA 4OH7A 1NXOA 5JXJA 1UFKA 4ZVKA 1L4LA 1OZHA 1WKCA 3IAHA 4FFNA 3V4RA 1GR0A 1GU7A 3L43A 1SKUA 4C14A 1F2UA 4FWBA 1HNZB 5KTSA 4KLRA 1PYDA 2I1LA 1C81A 5IVDA 2AFRA 3REGA 3DUFA 1O2DA 4CF4A 4PZDA 1Z0DA 1XTRA 1E6EA 4XYBA 4XJTA 4ZMBA 1GQ2A 2O8FB 4XEUA 3WFZA 1NFQA 3BOSA 3B2NA 1N6OA 5HIJA 2Z5LA 1V9CA 4L22A 2J9GA 2NVWA 3FOWA 5F3RA 4DC9A 2O8DA 3CO5A 3KZKA 1E18A 2H51A 1VPLA 5KYUA 4F21A 4PINA 3BSFA 2YHBA 3M6LA 3WC4A 3TFQA 1K3TA 3H5AA 4Q1EA 5JSFA 3I01A 1Y9AA 5GIPE 1F0YA 2PWZA 5FL3A 3LCUA 1L5ZA 2QJTA 1KJ8A 3ENZA 3G89A 5BNIA 5AVTA 4YMSA 2QJFA 1KJYA 3D31A 5AK5A 2FKNA 4PSAA 3K9CA 4UQOA 4EARA 4B3GA 3BRSA 3Q7RA 1BVUA 1QF6A 4BMDA 4JC5A 3A70A 2POQX 3U13A 2H8KA 1ZH4A 3B5JA 2I2AA 5JZVA 3C8DA 1VL6A 3DOIA 1SD1A 2J33A 4B8WA 3LPMA 1NAHA 3KYCA 1VG8A 2M32A 4BAZA 1AGRA 3TTTA 2XB9A 4O4LA 3E9CA 4G2TA 4X20A 3BEOA 3TDMA 1QFSA 3PE4A 3AW8A 4ZVMA 1JQLB 1BD3A 1I32A 1PZNA 5K3FB 4P84A 1IN4A 4DE5A 1FE8A 3HV0A 4W9RA 1JLKA 2YNMC 1CUUA 3MMNA 4BX9A 1QRAA 1WAMA 2OP1A 2B92A 1WETA 1I5OA 4FD2A 1RACA 3OKAA 1C1XA 1I4OA 1SB9A 5EJGA 4AU1A 4N5LA 5IBCA 1ANKA 3RIXA 1E9VA 4BMNA 4DCJA 5LPNA 4CIBA 3O5AA 4NDNE 2G8NA 2GKOA 3WISA 1YRYE 3B6JA 2VSYA 2ZRDA 3DMRA 4TMWA 4ZAVA 5A4FS 2PGDA 5L6LB 1EUDA 2XXBA 2XZOA 4DXHA 4FYJA 4Q16A 1FQKA 2P90A 3VR3D 3PEVA 3THRA 2EBWA 2JIBA 2B6NA 2FSPA 4KX5A 4WZBE 2W48A 3CX7A 5T6MA 1N2CE 4HH4A 3CNHA 4QECA 4OLBA 2O2IA 4KGVA 2H5IA 2ZQYA 1J90A 3Q9NA 2PT5A 3U1VA 1X8JA 3OT1A 1SVLA 2X8AA 3SCZA 3H8JA 2IELA 4R9VA 1PCXA 4URYR 4YAJA 1JBEA 4JL6A 2H4XA 3AYXB 4G26A 4QOSA 3E8MA 3KLBA 3V7FA 1EUCA 2HO5A 3GP5A 1PR1A 3N2NA 3S2FA 4RHYA 1ENPA 1ONSA 2GESA 4HX9A 2ES4A 2QYOA 4UKDA 3UJCA