4MWSA

Crystal structure of human ppca (trigonal crystal form 1)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Lysosomal protective protein
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwsA00
1XKTA 4OU4A 1ZJ4A 3FYTA 1ZICA 2DQZA 3WYDA 3C43A 2ZYIA 5DTJA 4XVCA 1WB6A 3AIOA 4N5IX 4YPVA 2HIHA 4UBNA 4B6GA 4MQLA 3W2TA 1GZ7A 1XZDA 4E15A 4OB7A 4DNQA 4H0CA 5IH7A 1Y7HA 5LZ7A 3D59A 2OGTA 4WJLA 2ZSIA 1QIDA 1FSSA 2XB6A 1U65A 3VJMA 1DTEA 1UK7A 5ALRA 5KWJA 3O0DA 4WFJA 3FNBA 2JGLA 3R3XA 4J0DA 1QFMA 5AKZA 2Y6VA 2PUJA 4UHCA 2ZSHA 3WQHA 4F5ZA 2XQIA 1XROA 3RARA 2XE4A 3I6MA 3WKDA 5LZ2A 5LZ8A 4C89A 2D5LA 2WHPB 5AK4A 1WB4A 4KE8A 1O6GA 3HC7A 3X3HA 1LPSA 4CCWA 4G8CA 3G0GA 2GZRA 4G9GA 5C8XA 2X76A 1VZ3A 3W9BA 2Z8XA 2I78A 4U2EA 4HRYA 4HS9A 4JH0A 3QMWA 3D0KA 1TCCA 4Q34A 5FXMA 5AK6A 3ZLTA 1EDBA 1WHSA 2JGMA 3O4JA 2ZYHA 2PPLA 3I6ZA 1CUCA 1HQDA 3AZQA 5BV7A 3WZLA 1W1IA 5BWCA 4WY8A 5DNWA 2HA2A 4BAUA 4C4YA 2C58A 4UBKA 1HDEA 2WFLB 5ALPA 3D3NA 3O95A 5AICA 1H22A 4W1RA 4J0IA 3WK7A 1CUUA 2H1IA 1VZ2A 1TRHA 1TQHA 2XQGA 3EBLA 3WIBA 1DINA 4FOLA 2J3DA 1GQRA 4I19A 5AJHA 4H7JA 4L0CA 1CUXA 4KYVA 4CG2A 5LZ5A 4F21A 2PX6A 1MN6A 5BWBA 5DNUA 4AX4A 1LGYA 4B83A 2ZJFA 4L9AA 4CFSA 4FBMA 2HA0A 3BDIA 1E3QA 3V1KA 4K2AA 2OGZA 1J07A 2OPHA 1UOQA 1LLFA 2XMRA 2WUDA 2VAVA 4FFVA 3F96A 3LP5A 2QKYA 3VDXA 3DNMA 3KOOA 3AINA 2HADA 1LNSA 1PJAA 3I2IA 4IHAA 1YAHA 4QEKA 2ECFA 3B5EA 5K5EA 5K3DA 4ZRDA 2FX5A 3EF3A 3QM1A 5T4FA 4A5SA 1ZOIA 4Q3KA 2Q0XA 3DDUA 2Y6UA 2XMDA 1PFQA 5E4TA 1SFRA 1ZI8A 3P2MA 3E4DA 1WPXA 4CG1A 3KD2A 2B9VA 4LIPD 5A62A 3C6YA 5JD5A 1XZCA 1CUAA 4C87A 2E3JA 3E3AA 1F6WA 4GLBA 1CLEA 3ILSA 4X00A 1GKKA 4QDXA 2XMGA 4X93A 4BTVA 4X95A 3HACA 2OAEA 4UPDA 5F4ZA 1E8DA 5DTIA 4UUQA 3D2CA 5JANA 1VXOA 5DJ5A 5AO9A 3WWCA 2HU8A 4KACA 4YK7A 4B85A 4MEAA 1VJ5A 1D07A 5IKXA 4PSCA 3GA7A 4FNGA 1IZ8A 3H18A 1VOTA 2C7BA 4K6GA 2XUGA 2VJAA 2QXTA 5EFZA 4EA6A 1X2BA 5IVIA 1BE0A 2BGNA 3STWA 5AKJA 1UKBA 4PSUA 2VF2A 1GGVA 4V2IA 3PICA 1L7RA 1VXRA 2Z5GA 3F98A 5E4YA 1IUNA 2WLSA 1EK2A 3R3VA 5JIBA 3F67A 4IH4A 5ALQA 1XKLA 4UHDA 3WA7A 1SCIA 3FLAA 4WCVA 4IH9A 4BC1A 3WL7A 1LPPA 4OSEA 5SYMA 2O2GA 5K3AA 3QBJA 4XJVA 3MGAA 5C8VA 5HF6A 1ZD3A 3V48A 4AN1A 2WG2A 5FPQA 1CR6A 1JJBA 3Q8WA 1A88A 1VE7A 3LS2A 3K6KA 1MAAA 3O4IA 2YXPX 4KEAA 1G66A 2Z3WA 2JGFA 1DQYA 3NGMA 4LXGA 2D0DA 5CBKA 1F8UA 3E1GA 3G9TA 4GECA 1VKHA 1ACJA 4QLOA 3QH4A 1ZD2P 4N8EA 4CCYA 1QLWA 5FV4A 5E4JA 4CIAA 3G9UA 3UUEA 4EY4A 1IUOA 5K3FB 4J0GA 4UFNA 4K6KA 5FDFA 5CMLA 2WJ3A 3E0XA 3ED1A 3C5VA 4G5XA 2PSEA 5AK5A 1DT3A 5AH0A 5AM1A 4N5HX 1XZJA 3H2IA 2WUGA 5DYYA 3WWPA 5HK8A 3WK8A 3QPAA 1R9MA 4RE6A 1QIKA 1LBSA 3DKKA 1UKCA 3O4HA 2QJRA 4M0FA 3WL6A 5DYWA 4C4XA 3GBSA 4M0EA 4YX9A 1DU4A 1IVYA 2GYVA 4W1SA 2Z8ZA 1CPYA 4BC0A 2WM2A 4PF1A 4UHFA 2FJ0A 2QMQA 2AJ8A 2XUIA 1CVLA 3IA2A 2J4CA 1QOZA 4J0KA 1Q0RA 4Q82A 1EINA 5SYNA 5HKAA 1CUVA 1MX1A 1GPLA 4GHWA 4RGYA 2G5PA 4KRYA 3WL8A 1XZFA 3HEAA 4Y2VA 4KR0A 4J3JA 3H1AA 1WM1A 4WDRA 2YYSA 1QIHA 1EK1A 4NVRA 2GBFA 2X5XA 3H0CA 3AZOA 4ZREA 3GZJA 3G0CA 1QGED 1UOPA 3IURA 2PBLA 4BZZA 1GKLA 5HCUA 1FJ2A 4Q05A 1OILA 3KDAA 3GROA 3A2NA 2O2HA 4UBLA 1LPAB 2RGUA 2AJBA 2B20A 4I4CA 4Z49A 5JAPA 5HF5A 3FSGD 3ZV7A 4MWTA 4A23A 3IVMA 1J2EA 3IBTA 2AJCA 3MVEA 4Y2UA 2JGJA 5AKKA 5AIBA 4OCZA 1CUEA 5CT5A 3U1TA 2YASA 1EI9A 3G0BA 2HU7A 4OUKX 3V1LA 4WFIA 3CXUA 4E14A 4L3WA 1O6FA 4DTCA 2WJ6A 3FOBA 3A70A 4OB8A 3OOSA 3JW8A 4QDUA 3FYUB 2XQKA 4H7FA 3I2GA 1CUZA 1MNAA 3H2HA 1UWCA 1G4HA 3AJAA 5FOQA 3OURA 3I6YA 2O7RA 1KEZA 3NOXA 4BE4A 1YB7A 2BGRA 2OXEA 1JT2A 3AUKA 3OTQA 3HRHA 2PVSA 5I7UA 3DL7A 3AILA 3M83A 4C6HA 5HF8A 3SK0A 2WIFA 4Y2YA 5HF9A 3G0IA 1XQVA 4Y2TA 4U2CA 1YS2X 2JF0A 2AXEA 1AGYA 3ZPXA 3CN9A 2XUHA 3WIOA 5CH8A 1QO7A 4AO8A 2IIVA 2R11A 5LYYA 3VJLA 4UHEA 4W1QA 3Q0TA 1L7QA 1UKAA 4BB0A 3WK9A 2HFKA 1ZGBA 3BDVA 4DLNA 4YASA 4U2BA 5LKRA 1E89A 3F97A 3ZLUA 3WYNA 5HQ3A 3PDCA 4Y7DA 1HL7A 5ALXA 3IDAA 4EY7A 1FFAA 2XLCA 4DNOA 2GBGA 4MXDA 4K5QA 1RP1A 4BVLA 3GELA 1H2XA 4E46A 1YB6A 1W4LA 5HKBA 1XRMA 3H2KA 4ZV7A 1Y7IA 2WTNA 2P8SA 4UBOA 1MTZA 1NU6A 2ONCA 4ZV9A 5ALMA 3CCCA 5ALGA 4EY5A 3ICVA 4FBLA 3IUQA 4DMFA 1CUHA 4INZA 4UHHA 2HA3A 3ZWQA 3O9VA 2R8BA 2VJCA 3L1IA 2WQZA 1QIFA 2JGEA 3DQZA 1XZIA 5ALHA 2WHPA 2OCGA 4DYHA 4Y2RA 5JD6A 4X90A 2VSQA 2VQ6A 4M0MA 1OCEA 4X6XA 5JALA 4RNCA 5T4BA 4P9NA 3U0VA 4B84A 1C7IA 2OAGA 2I3ZA 3QYJA 2HA5A 4CG3A 5JARA 2V98A 1J06A 4QWWA 3G9XA 5AM0A 1P0IA 3HSSA 4EB0A 4ARAA 2C5FA 3ESCA 4X85A 4X71A 3PFCA 5D6OA 4B9AA 5ALIA 2DR0A 4MEBA 1BROA 4U2DA 1J1IA 1U4NA 3EIOA 4G4JA 3H04A 4JYMA 3AIMA 4MJ3A 1VA4A 3VJKA 4DSZA 4H18A 3M3DA 1QE3A 1BEZA 1B41A 4NMWA 2C0PA 2I03A 3HYSA 3FWHA 3STVA 2AJDA 3G0DA 4CCYB 3STTA 1TCBA 1QIMA 1CUGA 5I8PA 4Q3OA 1CUWA 3WI7A 1LZLA 3C8HA 5JYCA 3DLTA 2OGSA 1TKRA 1LPNA 3HABA 2NW6A 2WU3A 1JJIA 5AK3A 1MNQA 2VT6A 4FWBA 2BKLA 1UOOA 4GEGA 4G4IA 3EQ8A 1DT5A 1VA5A 3FCYA 4FTWA 1ORVA 3C8DA 3QMVA 5FUMA 5E2IA 1F0PA 4KJXA 3R3ZA 2XMQA 5T4HA 5HFAA 1QJ4A 2ES4A 3WK4A 2YH2A 4BCDA 4HAIA 3BIWA 4FLMA 4G1FA 1OXMA 4LHEA 5I9IA 4KE9A 3JWEA 3HLKA 2XUPA 3SX4A 3FSGA 2JEZA 4FFWA 3BE8A 4NS4A 4QDTA 1HLGA 4N8DA 3KXPA 2ZVDA 4GW3A 3I1YA 4WY5A 3IUNA 4ZXFA 3WWOA 4BE9A 2RHWA 2PUHA 3FVRA 2UZ0A 4UBJA 4XWGA 1CEXA 4LXHA 3AFIA 4BZWA 3I2KA 2ORYA 3UUFA 5FPPA 2G63A 4UBMA 1ISPA 4H7IA 1HKHA 5EIHA 3ICWA 4BATA 2V96A 4WDQA 5AM2A 3N0TA 1Q83A 5FP0A 3QPCA 4OB6A 3PF9A 2G4LA 3FVTA 3A2LA 3PUIA 3T52A 5AKXA 4X91A 2OCLA 2G5TA 3WKEA 1DX6A 1JU3A 4X3CA 4ZGBA 2H9YA 3TRDA 1BCRA 1MPXA 3STYA 3G7NA 1XQYA 4J7AA 2XUOA 1DWPA 1PV1A 3WKCA 1VLQA 1ACLA 3H1BA 1AZWA 2VJBA 4RPCA 4BYMA 2V9ZA 3FYUC 3LLCA 2QS9A 4BBZA 1C7JA 4Y9SA 4E11A 2GZSA 4DMKA 5ALWA 2BUAA 2QXUA 4S0XA 1UXOA 5EHQA 1RWQA 3S8YA 4UFPA 5DWDA 4Y2PA 5J3JA 4EHBA 2J3QA 5FRDA 1U8EA 2XUFA 3CN7A 4C01A 3IUJA 2XMSA 3C5WP 3M81A 1KU0A 1ZI6A 4W9RA 4HVTA 2H7XA 1JMYA 5JZ9A 3O4GA 4ARBA 4L72A 2W22A 3OPMA 5A7FA 1W6RA 2DHDA 1DWOA 2DHCA 4DGQA 1YSCA 5C81A 4H7KA 2CBGA 3V9AA 2O7VA 1BEEA 4AMYA 2XDWA 4PSDA 4ETWA 1EXWA 4KE6A 4BCBA 5JADA 3NWOA 5T4EA 5EHXA 4KAJA 1XLUA 1IZ7A 1SCQA 1FFDA 4BP8A 4D9JA 2XMBA 3VKFA 1P0PA 4J0CA 4QA9A 2JBWA 2OCKA 5EIEA 3CCBA 1SC9A 1LPOA 4TPKA 2WG1A 5ALVA 4J0JA 3IULA 4HTAA 3VISA 2JGKA 1X2EA 4PQEA 4F60A 2CEKA 1WB5A 4KE7A 5KBYA 2OG1A 1MAHA 4PNZA 1XRPA 1FFBA 2WIKA 3R41A 4IQ4A 3YASA 1A7UA 2DCMA 4B9EA 4B0OA 5JD4A 3A2MA 4FKBA 1DX4A 1DQZA 5AKYA 2FJPA 4KAFA 1XZHA 3RM3A 1U2EA 5HQ3B 3QVMA 3PI6A 3I1IA 3R0VA 4QE3A 5AKHA 1CV2A 1UFOA 3DEAA 5HZGA 3DKRA 4Q1VA 3TEJA 3LIPA 1N1MA 4HXGA 4MYDA 4OD0A 2Z3ZA 4QDZA 3BWXA 1ZJ5A 2CUTA 3WKAA 1T4MA 2WIDA 4HXFB 2QJWA 2Y2UA 4ZWNA 5AP9A 2QR5A 4CIBA 5LP1A 5LIPA 3G02A 5LKAA 4G8BA 1YS1X 2XUKA 3JYHA 1UT6A 2WFZA 1G5FA 2BCEA 3I28A 1THTA 2B4KA 1ODCA 4NZZA 4P08A 3WZMA 1CUJA 2I3DA 1UK8A 1Z68A 5CW2A 1DWQA 5AOAA 3EQ9A 3D7RA 4A16A 2VA9A 4TVKA 4GWLA 1R4ZA 3SC2A 3FYUA 1XZMA 1EDEA 1ZI9A 4P93A 4KAAA 2HA4A 4Y2SA 4OPMA 5CT9A 1CRLA 4BVJA 1T2NA 3OC0A 1EVQA 3DL4A 5JZBA 2RIPA 5ALNA 5AI0A 5A6VA 2GBCA 5CH5A 1HPLA 2ZYSA 2QTBA 1XQXA 4FNMA 3S2ZA 4JUIA 2VAXA 1ODTC 1TK3A 1AUOA 4P92A 1G42A 3WKBA 5ALKA 1ZD4A 2QM0A 4FLEA 4JEIA 4AO7A 1E5TA 2WHRA 3KSRA 3AZPA 5JAHA 2XT0A 3RK4A 1X70A 2WIJA 3D5EA 2HRQA 2XQFA 1CIJA 1CQWA 5KREA 4Q3LA 3STXA 1R3DA 4ZI5A 2WFLA 4JNCA 3WLAA 2QRUA 2XUJA 2WIGA 1CUIA 1WHTA 2GYWA 4ITVA 4AMZA 1EA5A 2BUCA 2C5GA 4B82A 1FFCA 1ORWA 2PU5A 4UBIA 1CUSA 3QPDA 1HBJA 3WJ1A 4FLFA 1ETHA 3B3QA 3DOIA 4KRXA 5AIAA 4I3FA 1W76A 1KU6A 1N5RA 4C88A 2DHEA 1NX9A 3DYVA 5CXXA 3C70A 3WK5A 3ANSA 4HXEB 1XFDA 5AKIA 3OM8A 4W63A 4PV7A 5DLPA 1RYYA 4AB1A 2OQVA 3BJMA 4J03A 2H7YA 3SWWA 4XX1A 3C87A 4X6YA 3ZLVA 2CJPA 2VT7A 3W06A 4B80A 4EY6A 1K8QA 3V1NA 1B6GA 1NU8A 4H7HA 5FLKA 4DIUA 4EZIA 4G8DA 1R1DA 2RONA 2H7CA 4QLAA 1JU4A 2JEYA 4QDOA 4RE5A 2O2IA 1H23A 3C6XA 1BU8A 1CUBA 4BVKA 1JFRA 1ODSA 3WL5A 2PSJA 4BDSA 3HZOA 3BF8A 1FFEA 2DQYA 3QZUA 3ANTA 1YR2A 5BOVA 3WA6A 3AIKA 5DNVA 2JGIA 4X6UA 5IVKA 1XLVA 5JZSA 1LPMA 1QONA 1QZ3A 4UFOA 1LBTA 3RLIA 3ZI7A 4CI9A 2HA7A 5ESRA 1BS9A 2WSLA 3IIIA 1H2WA 3IB3A 5CT4A 2C4HA 4N8SA 2PU7A 5JASA 2J4FA 5KWIA 3H2GA 1IMJA 1BCSA 1XZKA 4BTLA 1JI3A 2WHQA 3F8SA 3C45A 1SCKA 7YASA 4OU5A 2IITA 1Q0ZA 3QITA 6YASA 4BAZA 2QZPA 1K4YA 5AI8A 5AM5A 2BUBA 5LLSA 2OCIA 4X94A 2BFNA 2ZJ6A 2HDWA 1M33A 3BJRA 4Y2XA 4FDMA 4DMHA 3LIIA 4WFKA 4PO3X 3BL8A 5LZ4A 1P0MA 2PSDA 5ALOA 5AM4A 3HI4A 3PF8A 4BRSA 2HM7A 3OG9A 1E66A 4FMPA 2PSHA 3WWEA 5CRIA 4GXNA 5C7YA 5H3HA 4OYYA 5HFNA 1LZKA 1QIGA 4PW0A 1GQSA 4BCCA 5D3ZA 4IO0A 1C4XA 5A7HA 2Y2VA 4AO6A 3PFBA 4MWSA 5IVHA 2WKWA 3W9UA 4TGLA 2OLEA 3BXPA 2XI4A 2WU4A 4MQMA 2ZYRA 2QVBA 5ALSA 1A8UA 1BN7A 3EQ7A 4Y2QA 3O9MA 4O08A 3WJ2A 5K3FA 3FBWA 5CTAA 2WUFA 3DCNA 1H2YA 5FKJA 2XQJA 1EB9A 2HHAA 2HU5A 1EX9A 5AI6A 2CKMA 4LXIA 4LYEA 3BIXA 1MJ5A 1TAHA 3STUA 4AN0A 1N8SA 2BAGA 1A8SA 5JATA 2ACEA 3HJUA 4U2GA 5AKGA 5A71A 2RHTA 2BJHA 1E8MA 3KWFA 2HA6A 2QOEA 4X97A 5K3BA 1XLWA 1YCDA 2XUAA 3VVLA 5ALYA 5CT6A 1Y37A 3ESDA 4GBGA 4H77A 3HXKA 1ZD5A 4G4GA 1XZBA 1K5PA 1QFSA 4HRXA 2CB9A 5ALUA 3I2JA 4AZ0A 4IH1A 3W05A 2HL6A 1WOMA 1EHYA 3GFFA 1GT6A 1AURA 4GI1A 5EHZA 5AI5A 1AMNA 4QWMA 4DNFA 2DSNA 1Q84A 2VTVA 4BAGA 3LCRA 3T4UA 1CUFA 1MO2A 1XZLA 3FAKA 5AI4A 1AQLA 5ALDA 3F9CA 3I2FA 1YA4A 1R88A 2K2QB 3TJMA 4AZ3A 2ROQA 2QT9A 1CFJA 1XZAA 3R3UA 1JMKC 5D3KA 4GDMA 4B81A 3MUNA 1EDDA 3VVMA 3WMRA 3A6ZA 5K3CA 5AKLA 2XLBA 2ACKA 3G9ZA 5A7GA 5AKEA 2DFPA 3C6ZA 3RKSA 2W6CX 4AQDA 3BF7A 1QO9A 1ZIXA 2XUQA 5CXUA 1QTRA 2GYUA 1SOMA 2PSFA 2V97A 3H17A 1L7AA 5EI5A 2C0QA 2EEPA 4BDTA 5HK9A 2AJLI 2WILA 3TGLA 5EIAA 5IVDA 4W1PA 1QIEA 1LPBB 5ISMA 1MX9A 1ZGCA 2PM8A 1YAJA 3WWDA 2HFJA 5CH3A 5K3EA 1TCAA 1UK9A 1JJFA 3D2BA 5CT8A 1I6WA 1AX9A 4HZGA 4X7BA 4DNPA 1YA8A 3MUOA 2B61A 3DOHA 3ESBA 5AI9A 3KWJA 3V1MA 3L1HA 3K2IA 3L1JA 3G8YA 4H7EA 3C6BA 2ZJ7A 1XRNA 1TIBA 1H2ZA 3UMJA 4H7DA 2WUEA 2VJDA 1VE6A 1WCYA 3D4LA 1XZEA 1XZGA 4BP9A 2WG0A 1EVEA 2EDAA 5DYTA 1QTIA 1USWA 2EDCA 5AOBA 4OYLA 4EUSA 2GBIA 1JKMA 2HRRA 1F0NA 2Y1KA 4FHZA 4U2FA 3N2ZB 2XUDA 1P0QA 5ALZA 3IUMA 2QUBA 2XMZA 4H35A 2WTMA 5YASA 1UK6A 1EH5A 2VATA 1A8QA 5LZ9A 1AC5A 3DYIA 4DSAA 3VXKA 3R40A 4LKOA 4UHBA 4AXBA 5ALJA 1K6EA 5JAOA 1CQZA 3M82A 1GPKA 4EY8A 1S8OA 4DMCA 3DD5A 3DS8A 5AOCA 3I2HA 5EHNA 1CUYA 1BN6A 5CURA 1CUDA 2XMCA 2JIDA 1W75A 3R3YA 1MU0A 1WPRA 1QIIA 1GXSA 1XRQA 5AHXA 1XRLA 3FLEA 4C4ZA 2QUAA 1MX5A 4G9EA 4Y2JA 5EGNA 1AKNA 4LYDA 1GPNA 1K63A 1YASA 2WJ4A 1R50A 1N5MA 3ESAA 5A2GA 5JAUA 1XQWA 5C8ZA 5AM3A 1ZIYA 5ALEA 2CMFA 2RI6A 3GUUA 4F0JA 3B12A 2LIPA 2RAUA 4J0HA 4EBBA 3D2AA 2OQIA 4ROTA 1BRTA 1IUPA 5ALLA 3PE6A 1THGA 2PKYX 1W52X 2FUKA 3R3WA 3W04A 2PL5A 4X92A 5D7BA 3H2JA 2CZQA 1UZAA 3PUHA 5ALTA 3FLBA 4QZVA 2VEOA 2IX9A 3WK6A 3DJYA 4XIIA 1EB8A 1MT3A 2WFMA 1E8NA 3FCXA 4K6HA 4BRZA 3NUZA 3K9BA 1XRRA 1R9NA 4B0PA 4DM7A 4B7ZA 3H19A 2X8BA 4JYPA 4MYSA 1QIJA 4QNNA 5ALFA 3QMMA
chains in the Genus database with same CATH superfamily
3G2IA 4O8CA 1PGNA 3AR9A 4JKIA 2P9HA 3BWEA 2CLFB 4KWTA 5FADA 1ZM3A 3P26A 1XKTA 2BFPA 4A91A 4I1UA 2ZRLA 3FYTA 2XGJA 4TQ9A 4XUGB 3C43A 3OZEA 1DJNA 2B37A 2PGLA 4Z0HO 1E9VA 5CTJA 3UJ6A 3VR6D 3UKOA 1NQOA 5K0TA 4MO9A 1C0LA 3FWYA 1TM7E 5E9WA 3AIOA 3WGQA 1XA4A 3NOVA 3OCJA 4C2AA 1APBA 5KJ1A 5C1BA 3KTOA 4FYWA 4QUGA 4IOMA 4XIGS 3RFVA 3AERB 3UGKA 5LYJF 4UBNA 4CUZA 3GD5A 3EVGA 1FUIA 5FI5A 3ZV5A 4GR9A 4QIHA 5P8WA 4EMUA 1IJBA 3OTOB 4D8YA 4II7A 2DLCX 3N39C 2WV7A 1OLSA 4OB7A 4DNQA 5D86A 5IH7A 1IOLA 4GPEA 1Y7HA 1B74A 3P94A 2L2QA 2GRJA 2HMVA 3D59A 4WKNA 5CEFA 1XA3A 2GEJA 3VAZA 2ZSIA 4FPXA 3TE6A 3FM9A 1Z3IX 1DTEA 4KVGA 4RC9A 2W2XA 1K97A 5ALRA 4C08A 3RC9A 5KWJA 3JASB 2RH9B 3KYDB 2JGLA 1RZ3A 3PHBE 1H0KA 4OAOA 2REXB 2C4WA 2YWGA 2E4VA 3K0CA 4J0DA 4RY0A 2P69A 4WXHA 4I4LA 4O2LA 1D6MA 5G40A 1SQ6A 1JDNA 3I64A 2QDXA 4UHCA 2H8KA 3WQHA 1BA3A 3CBGA 5BSMA 4D82A 2HNAA 2XCIA 2XQIA 5H59A 3NJ8A 1SHUX 3I6MA 2YXEA 4R3UC 4RKEA 2YZMA 3WKDA 2JIOA 2C03A 2H0RA 3B89A 1WVMA 3LWNA 3X1JA 1DADA 2BFFB 1JLRA 1Z2EA 2DULA 2GTHA 3OZ7A 1T4GA 4EUKA 4YV7A 2O2DA 5B1DA 5FTKA 3RS2A 1TEXA 4PC7A 4D8XA 4DUGD 4BXOA 3ZWDA 1DJLA 2W6NA 2ZIXB 2EATA 4XX0B 1NBAA 1O6GA 4LJ6A 1DEAA 4YR9A 1FTQA 1SCDA 2R7KA 1UM8A 3HDGA 1K8ZB 3GT3A 3SOZA 1NBMA 1KZYC 3LL7A 1AHHA 4MHOA 4EHJA 4CCWA 1Z6AA 3G0GA 2DB3A 5GGYA 4KQEA 1U1DA 1N57A 1P9NA 4G36A 4CJXA 3U4QB 1L5YA 2R5WA 5C8XA 2X76A 3LVQE 2R1UA 5JJBA 3IIMA 2XNHA 4DMMA 4JFAA 2D2XA 1RLTA 5H1YA 5DN6D 4XLZA 3WLEA 3KDPA 4U2EA 1N2IA 4F6RA 1U90A 2H51A 3F90A 3DLHA 2A0UA 2EKPA 2H5LA 4EFDA 3FFXA 2HF9A 2Q2WA 4NU0A 4RAQA 4TT3A 2Q7DA 3H11B 1GGFA 2F3QA 5KNCA 1M6EX 3USCS 3EY4A 1J9GA 1Z06A 2RHRA 2XVMA 1W2WB 4XGQA 3RR2A 2HCBA 3ZLTA 1NASA 2JGMA 4HWPA 1VYUA 4MP3A 5AJYA 3QFTA 3O4JA 1UJMA 3I6ZA 2DFTA 3JAKA 1CUCA 4WEQA 4X60A 3DNPA 2QUIA 1W34A 4PLYA 4D92A 2WP8J 3AZQA 2JH8A 2Y0PA 3RTGA 2H2DA 3VZDA 2YIJA 4FUTA 1AOXA 1P9RA 2C3MA 4NOJA 4H4EA 4QEZA 4TXLA 3JQGA 5BMVF 5BWCA 2HYDA 2CHFA 4JLJA 3M5PA 2QZ9A 1RDFA 5K7SA 2CLIB 5DNWA 1U7UA 1VHDA 1U28C 2HA2A 4RL4A 4S1OA 4C4YA 3A14A 3M6FA 2C58A 5U4QA 3VNRA 4B44A 1YZKA 1JDUA 5AW9A 4BN4A 3S68A 3PNOA 3GD7A 3O95A 3T99A 2ASEA 1H22A 3GFTA 1D8TA 2JFWA 3GRVA 4Z0NA 4CQMA 2QTWB 3TQHA 1CUUA 3COWA 2FZKA 3AFNA 5K20A 1VZ2A 1YONA 2HH9A 1CVRA 1J90A 1UZLA 1X19A 1YR8A 2DT5A 2R2AA 3EBLA 2PZKA 1IEWA 2QMUA 3HO1A 4K9OA 3ZVRA 1BWPA 1HT2E 2FHPA 5I7WA 3GO4A 4NU5A 4B71A 2FW0A 2FPPB 3OIYA 5FNVF 4L0CA 4MR8A 4WBNB 5BP7A 4EG3A 4JA2A 1DAGA 4OGFA 4N40A 2OC4A 4F21A 5LZ5A 4DXDA 3QBDA 2AQKA 4IICA 3UJAA 1ZEJA 3WLFA 3ZY2A 4AX4A 4DG9A 3V33A 5DNUA 5JXIA 2PWAA 2ZRKA 1FMLA 3OQ6A 2AEJA 1YFLA 1SG6A 4FE7A 4FBMA 1VPWA 2HA0A 1YZ3A 3BDIA 3BX1A 3VGJA 2D1TA 3VNQA 9ABPA 4K2AA 1CJSA 4I99A 2OPHA 1UOQA 3GUCA 1MAVA 3LL4A 1JHOA 2XMRA 4PZDA 4PIVA 1IN6A 1EBUA 4FFVA 3RADC 4JGGA 1WSAA 3F96A 2WP0A 3TX6A 2Q9BA 5K6RA 3TZCA 2ID9A 2Q5IA 4YEDA 1LD3A 3DNMA 3D1LA 4RD3A 3ER9A 4IMJB 1D3AA 3O8OB 3AW9A 4ZK6A 4V0LA 1BXZA 3K5WA 3I2IA 1JXQA 1U28A 1JQAA 2VXOA 3N87A 1BMQA 4EJSB 1W94A 5BVHA 4TKZA 1I13A 2PQ0A 3NUGA 3EJ6A 5DWVA 4LZPA 5JCOA 4ZCSA 4JX8A 2G0NA 4LQCA 1C9NA 1SVIA 2FX5A 5HIIA 5A1TA 1KR2A 4Q48A 2I4TA 4U0JA 1B76A 4BO4A 4A5SA 4FDLA 2IEAA 4Q3KA 2Q0XA 3OLWA 5K4AA 3AFOA 3TAUA 4PG7A 4ATNA 1L8XA 2R47A 4ZOLA 1IM8A 1ZI8A 5C1IA 2A7XA 4MVJA 3FLMA 1JFVA 3L9XA 2QLNA 2B9VA 4LIPD 3KV3O 3WGYA 3LX8A 5B30A 4P36A 3C6YA 3DMRA 4DBVO 2VJQA 2Z1DA 2G25A 3L8DA 3UJ9A 5I7RA 1TQDA 2AMJA 3E05A 3ADOA 1P1RA 2Q45A 3NEPX 4QM6A 4WCFB 1JZSA 4M21A 3PD0A 1AT1A 1HSZA 1I8TA 4FBGA 3T1NA 3VV2A 3C6QA 2HXGA 1CDDA 2GN2A 4FFNA 5B3JC 4QDXA 2G9UA 2XMGA 1I10A 4Q3CA 4U9UA 3N6VA 4X95A 4YUXA 2DJIA 1E8DA 3KPWA 3FPFA 5AQEA 5DTIA 1IN8A 1I1QB 3VR0A 3MWKA 4M8SA 4RSHA 2EQBA 4BXOB 1VXOA 3IVRA 5DJ5A 2O52A 4CM9D 1ECBA 4DPMA 2YWFA 3FNEA 2BFFA 3C8UA 1BH6A 1Z2DA 5E6UB 2C9CA 4DLVA 4YK7A 4URFA 4RLFA 1C80A 5AJXA 3EMKA 4UUAA 4YJ2A 2UXCB 4B85A 2OXTA 1SKYB 2PR7A 4CMHA 1VJ5A 4FCVA 1WDTA 2NO7A 2JIZA 2Z58A 4IYJA 3PQ3A 3U4QA 3RT9A 3BMCB 3R5TA 3CX8A 1IIBA 1IZ8A 3AP2A 1VL5A 4N65A 2FWMX 1LV8A 2J09A 4TSKA 4CU5A 2W4QA 1OBHA 2OFOA 1F4PA 2C7BA 1ZGJA 2QZ4A 1D2MA 4OKSA 4WLOA 3RBXA 3SJBA 4BBAA 5CCEA 4X6LA 2YZGA 1QQ7A 2QXTA 1XMXA 4KU4A 1PZEA 3S3TA 5C8YB 1FY2A 4DW8A 2B0CA 2AR9A 3O94A 5E3JA 4ZPJA 4QC2A 4HSEA 1CS0A 1NDQA 1UKBA 5KCMA 1QXSA 2VF2A 1KRXA 4U9IS 1I6KA 5ECYA 4PZ9A 4PC2A 1GGVA 1N3LA 3DAOA 4DJ5X 1FVXA 2Z5GA 1SIOA 5A4JA 3QX3A 4FDVA 5E4YA 3GP5A 4KK3A 1IUNA 1QHIA 4W7HA 4KXLA 5FBZA 2EZ4A 2WLSA 4WXPA 3R3VA 2B69A 1OWMA 2DBYA 3I6IA 3LXRA 1GAQA 2HBYA 1VHTA 4MR7A 2BELA 4IH4A 1AQYA 5DHAA 2WA1A 5ALQA 5CEJA 3GEGA 2EF0A 4ZODA 2N3ZA 1E2IA 4R2KA 3FFTA 5CDHA 5THKA 5IS2A 1SCIA 3FLAA 3R7AA 4WCVA 2X23A 4U3JA 2V8BA 1UPCA 3G68A 3I83A 3U3KA 1QGUB 1W87A 3MRTA 3GA5A 1C1YA 4H6PA 3H2YA 4YRQA 3WL7A 4MS1A 4NYJR 2B7BA 3EFOA 5K3AA 1QCDA 4UMFA 2CDRA 3DBLB 3VSDA 2IYFA 3G2PA 2GAJA 4G1EB 3QLJA 4Q9DA 4DIMA 4DLAA 1P2VA 2GEBA 3UBTA 5T5QA 2INGX 1VI2A 3RC8A 1X7YA 1ZN9A 2GWHA 2Z1NA 2CLHB 1FVHA 3SJZA 2R48A 3TLAA 3CKLA 3TOZA 1JG1A 2WG2A 4EJ6A 2MTBA 5B2EA 1JJBA 1TD1A 1DCFA 2QX9A 1NPDA 3RREA 1XI2A 3LS2A 1MHTA 1MAAA 1ND5A 3KHKA 5DPMA 4MJ7A 3ZY5A 1SG0A 3ZQKA 5JS1A 4ES6A 4M9QA 1YDHA 4AK9A 1KC1A 4AMVA 4TZ6A 4O3MA 1MB2A 3D9QX 3L9WA 2JGFA 2V7BA 4KUHA 1DQYA 3NGMA 4IRXA 4LXGA 1U11A 2D0DA 1L1FA 5A5DA 5FBVB 3M5CA 2OLJA 3EVZA 5K9ZA 4FINA 5EMKA 3BXZA 3QYFA 5DNYB 4DCPA 2VTBB 5KNCD 4ZI7F 4S0ZA 1EJ0A 4BNDA 2OKGA 4MWDA 1VKHA 3RPEA 3IXMA 1BDHA 3UPUA 2Z5FA 1ACJA 5A9SA 4RIIA 5CA0A 4B8YA 3ZYZA 2ZM6B 2IEYA 1N8NA 1Z0AA 2OBFA 2FB9A 4IS2A 1YWGO 1ZSVA 1PQ4A 3R0JA 1ZD2P 4FFRA 4IHJB 1TKBA 4YPOA 1K88A 4QG3A 1OYOA 5TARA 5FBKA 3I0ZA 1ZVVA 2H4JA 4LF4B 2VYVD 4D5EA 1Q21A 3BGIA 2X4DA 3IGFA 4MV4A 5E4JA 3KQPA 2AYYA 2GMWA 4K40A 4K9KA 4EAQA 1G2QA 2AZTA 3GCGA 3WLKX 4E94A 3D0OA 2B2CA 3WLSA 2H1VA 4N9WA 2OYSA 5K3FB 2J32A 4WIAA 4HVLA 3OQVA 3P9CA 2YKGA 4HN4B 1IY1A 1E63A 3RUHA 1UEIA 2OD7A 4X1IB 1GZVA 4RY9A 3PFHA 1N34B 4QGFA 3WB2A 1PNOA 3IUEA 5KDDA 2NUTA 4Q4HB 2J4DA 1L4UA 1J8VA 1DRUA 1HM5A 2W6JD 4QG7A 1U2TA 4UVDA 5FDFA 5CMLA 3T9FA 3E0XA 3H1EA 4UNNA 1EVYA 2XQVA 4G5XA 4XOIA 5ARCA 3BCUA 4DS3A 2Q6VA 3FDIA 2B34A 2ORED 3AESA 3IP8A 2IA5A 3KAQA 5AK5A 4U6QA 2AKYA 3CISA 2EFDB 2WHYA 1NUAA 2BOVA 2IYUA 4I8DA 5DCUA 1XZJA 3F7MA 1IYZA 4L4XA 3VBCA 4ZCIA 4FFDA 3IX7A 1YZHA 1QCZA 3R5KA 2WUGA 2AFHA 4ZQFA 4FT4A 5CXQA 2ID7A 3DOEA 1J2TA 3EDMA 4PLWA 1R9MA 3H99A 5IU6A 3AK4A 1F0YA 3NVMB 1W0KA 4MS4A 4WFQA 5BV8A 1DAHA 2NV0A 1V3VA 1LBSA 1CG6A 1ZMTA 2CF5A 3DE7X 4H1WA 1C1DB 5KWSA 1ARZA 1KP3A 1DQPA 2FUNB 5ABPA 1R74A 4RHTA 5EKUA 2BFWA 5K0ZA 1ML4A 3BM5A 3CNHA 4HAOA 4M0FA 4KPGA 4RD6A 5I5GA 3WL6A 3TTXA 1ODJA 1SHKA 4E2YA 4C4XA 3T3DA 3RDPA 1SC6A 3I92A 5JMOA 1TF2A 3VPGA 2WZDA 1H0HA 4P32A 1XVVA 4EPWA 2W6IA 2P9FA 2PX5A 4W1SA 5MN5A 4FGLA 4KR6A 3KS9A 3AM1A 1DBIA 1UBGA 3PTZA 4FEAA 4OQQA 4EGQA 3ZDFA 3PDIA 4GVXA 3B1FA 4FJ1A 4WCDA 4KYTA 2I2XB 1J1UA 3PHLA 1MH9A 2ZKIA 4JJZA 4RA9A 1N33B 1YJ5A 4TYPA 2O19A 3T0IA 2IYQA 3BD7A 2W11A 3NHMA 1O77A 4OL0A 1WAMA 2VTBA 2QMQA 2WSBA 4YV2A 3NDBB 2CL0X 4PU0A 1WZUA 1E4YA 1TW2A 3AUYA 3RQIA 3PNMA 3PCRB 3BHJA 3G3EA 4E33A 3BKWA 3E2PA 4ID3A 5EN4A 1ISJA 1CJVC 1Q0RA 3T7JA 1CXZA 3NJ4A 2H1WA 1IOWA 2G4VA 2XZDA 3MEQA 2EWWA 3GMDA 2CD9A 4G4SP 4XPIA 5LMZA 1F17A 5KX5B 1MX1A 3ENQA 5LMUB 3UA3A 1B0ZA 1IHYA 2W0MA 5EQFA 4YLGA 1UJBA 2H1LA 4GHWA 1POXA 5HHTA 4RGYA 1XPOA 4CEHA 2HWXA 5LJLA 4PC3A 1XTVA 1XZFA 2FX3A 2H63A 3LUCA 1GY8A 3RS3A 1GTZA 4KPFC 1GQFA 3I30X 3WGHA 4BGEA 2QJTA 4F8JA 4P4SB 5DCWA 3DBIA 3ZU6A 5JVDB 4UE6A 3ZGNA 1MAWA 5I48A 3TQRA 1HNWB 3K96A 5TJ9A 4YJ3B 4TKVB 4RVHA 4E08A 1J5EB 2OL4A 3BSFA 4KNYA 2OILA 3F9RA 4YRJA 2YYSA 2QU8A 4XM0A 2QSYA 4QYMA 3NFRA 4ZOLF 2GBFA 3GLIE 3RYHA 5IM5A 4ZHQA 4ZREA 1XAGA 4K2HA 3K71B 2EU8A 3V4SA 1RXCA 3T5PA 4YYEA 4KN9S 3KHUA 4WAUA 4OQMA 3U26A 2VPPA 5HCUA 4ZQCB 5A4KA 4UU0A 1IM5A 5H9WA 3DEKA 5JNUA 3KDAA 3GROA 5IAJA 3ZN2A 1EUQA 1JG7A 3A2NA 4IGIA 1KHHA 4KN6A 5JDIA 1YF3A 2AJBA 1KPGA 3W77A 3L7KA 4MR8B 1JTEA 3O93A 3AUAA 2YHAA 4MR9A 4N82A 4P83A 5I7AA 4Q93A 5A5FA 2J3EA 2I6XA 2PUWA 3T54A 2CVQA 3K0AB 2UYGA 5HF5A 3WSTA 1PTJA 3ZV7A 1E2KA 3R4VA 2JI4A 4MWTA 4AJ1A 2WB2A 1DGQA 3ZKWA 1M34E 1TUGA 2DGDA 2EBWA 2OD2A 1EM6A 2C77A 1YI0A 5L3RA 1M2FA 1LBIA 4AG5A 1HF3A 3GJ5A 3JZAA 4ND5A 1MQ8B 1TYCA 1YK1A 1N6PA 1PO7A 2AJCA 1GSIA 2YWBA 3JR3A 1GSAA 3W2GA 5CNMA 2J7PD 3CLUD 5AKKA 5HUJA 2AN4A 5BSKA 5KNDA 1UQRA 3E1SA 2V4MA 3IPLA 1T36A 3W5IA 5CT5A 2YASA 4GICA 2J1LA 1E2FA 4TRRA 1I94B 1ZRNA 3MOGA 4F3TA 3RK0A 1IN1A 2XVZA 2GZDA 1AGPA 1EFHA 2VH5R 3HL4A 5JSZB 1OXVA 3HVIA 3TDNA 1J99A 2QGFA 2XNCA 2QUKA 2I7TA 4JGIA 3M33A 4JLVA 2IEBA 5EQJB 3RS9A 2B2NA 1RJEA 5CNIA 5JO9A 2D13A 3USES 5A04A 3NTRA 1XKQA 4L4SA 1ICEA 3Q8XB 1C4KA 4ADSG 3E58A 1QQTA 5K05A 3FJYA 4L3WA 4BKQA 3D7NA 1P1CA 2H1SA 4WCFA 5DM2A 4OB8A 1II8B 5C1DA 3WRXC 1PLKA 2HJVA 3NWJA 3GPCA 3OQMA 1NUQA 1EXNA 2R2GA 3PDWA 4YIKA 2VWPA 1L7DA 1LBHA 3PC8C 5TF0A 4NQZA 1VQ1A 3D6MA 4JLAA 4ZT3A 2XPCA 4B31A 4ZHQF 3LDFA 3F6YA 5LR6A 3HO6A 3PDUA 3KTFA 3JRXA 4NJOA 1SXPA 1M0SA 1AA9A 4W9MC 1CRZA 3SX2A 1ZCAA 1Y8AA 2P2CA 2DZDA 3OE7D 2I87A 4P3NA 4O4IB 1RQGA 1YZNA 2A84A 1HE3A 3ZE2B 4CLOB 1OREA 5LOVA 1KH3A 1PTJC 4U1RA 4QUKA 2PZAA 3C39A 3R6TA 1T8SA 1RJ9B 1UWCA 4MS3B 3UAYA 5B7PA 5FPKA 2X0KA 3AETB 3G9QA 3X1WA 3OCZA 4AJEA 5FOQA 3ORRA 2FMHA 3I6YA 5SZKB 1KEZA 1GCUA 2HMAA 2HTEA 4ASUA 5I7SA 3NOXA 1BD3A 3FOWA 1EK0A 1VKZA 1AK2A 2BGRA 4C6SA 2OXEA 1H2EA 4X84A 3ZWOA 3SIWA 2CXSA 2VHZA 3SJAA 1SB8A 4S2UA 4UDOA 3Q2OA 3OTQA 5JSZA 3DL7A 1KIFA 5K6TA 3AR6A 2PL3A 4MV0A 1L0BA 3M83A 1VCNA 4FYJA 5T64A 2QE7D 1C4WA 1XEXB 5DIFA 5GV7A 1AO0A 4C6HA 1MOPA 5HF8A 2WIFA 4ZU1X 1NPTO 4FFSA 3E3MA 5HF9A 1YZQA 1SMKA 3G0IA 3UAOA 1ZM9A 2HDNB 3VPAA 3DOFA 3ZX5A 1E3IA 1WRBA 5G4LA 4U2CA 1G8MA 2KQUA 1YS2X 3CW2A 1PVDA 1I9CA 1JDVA 3B6ZA 3ZK9A 2XBUA 4BMNA 3V42A 5JFOA 4YIHA 3VR5A 2VCEA 3CN9A 5HDBB 2X9VA 3BTVA 1OGIA 3WIOA 4U7PB 2Z1MA 3R5JA 3LKBA 1Z25A 1I3LA 2ENUA 4Q39A 2VHCA 2G36A 3PD1A 2J9FB 4RD1A 1BMFA 1I33A 4TL9A 2AYXA 2Q4OA 4LY9A 3PC8A 1N2XA 1VG9B 5EVJA 2D59A 3VJLA 4W1QA 5HSGA 4AZ3B 1M75A 2B7CA 1Q7GA 2OXIA 4DIEA 1JDBC 2DLNA 2A1UA 1Y98A 2RHJA 1ZGGA 4YJGB 3WK9A 2E4UA 2HFKA 3F5SA 3BDVA 4R05A 5ECWA 4A0RA 4NXNB 2IS4A 1N1DA 3OLQA 4U2BA 1SVKA 3A6LA 5ANRB 4B6JA 1KNXA 4BO2A 1V8OA 1FS4A 1E89A 1AS3A 1USVA 3E1KA 3F2VA 1DPGA 4M37A 3HR7A 2C5AA 2XOKA 3WYNA 3HUEA 1TNDA 2UKDA 3ASVA 4DLKA 1QZZA 4P7GA 4Y6OA 3NORA 4EY7A 1XNHA 1MVOA 3GJ0A 3GOQA 4MXDA 3WADA 2V6FA 2RCNA 1L9XA 3F3KA 5LSAA 3NV7A 1DRVA 1JVBA 2EJBA 4U2KA 1NLFA 2QE6A 4YQYA 2NU9A 2Y71A 1L4GA 1A9TA 1FJHA 4I1OA 3HGTA 3OTWA 3IT0A 5BV2P 3HM2A 4AZ0B 2CN1A 1T24A 2VDNB 1TT7A 3CUTA 3K7EA 4HNTA 1XRMA 5K8VA 3CIOA 1WG8A 2YJNA 3GQBA 4TWZA 3DMYA 3K73O 1L5MA 2WTNA 2G6BA 4TUYF 3SQOA 5KC9A 5SY6A 1U7PA 1MTZA 1NU6A 3ZDEA 4RTSA 1N6OA 2ERXA 5KAPA 1AMOA 3JWIA 4QU9A 3G17A 2ONCA 3DQPA 4HYTA 1PLJA 3ZWWA 1JFTA 1W36B 1BOFA 1C7QA 1HK7A 4ZAZA 4YV1A 1T9GS 3T1OA 1NVXQ 3ICVA 4CDMA 4FBLA 4DUZB 4CKCA 3KOUA 3JQRA 2KI5A 1MTOA 3SIRA 2A0KA 3EZNA 2G17A 3H3FA 4DMFA 3UKJA 1QPZA 2KBFA 3EOAI 1I24A 3GAMA 2F43B 1P2GA 3WYAA 1P5FA 2XW6A 1AE1A 1RZUA 2OCAA 2R79A 3PDHA 4GBJA 4ZRNA 4NDNE 4EM6A 3R6LA 4FYVA 2EBUA 3M4XA 2RGGA 3ZIAD 1WTCA 3ZWQA 3OQHA 5DO9A 4LYGA 4B82A 1FTYA 5JCJD 2FPLA 4O2AB 5ILQA 3WXBA 3RE1A 4P31A 2Z2ZA 3H2BA 4ZO8A 5ALHA 3TLBA 2B5WA 2B8NA 2ZBPA 4DYHA 4CKCB 2X1MA 3W1VA 5JD6A 2UUAB 3QEJA 1CC1S 1LTKA 1PJQA 3EXIA 3LT5A 2Q7OE 1GPMA 4M0MA 2CVOA 1M2VA 1N2HA 3PQDA 3OX4A 1H5UA 3EFHA 5KWEA 3IE1A 1P19A 1KI2A 3FMVA 5BN5B 1DFHA 2I3ZA 1H2RS 3KYIB 1T9BA 3QYJA 4DRXA 1P9WA 2YFQA 1SU8A 4KYIB 1J06A 4QWWA 4DJTA 2BZSA 3PKZA 3HSSA 1E1CB 4JR0A 4R81A 3PHIA 4EGJA 2IYYA 4WOJA 5TMEA 2MDTA 4V02A 1XE3A 2PTGA 4A1FA 3QLUC 2WKSA 3FKSD 3RJMA 2MMGA 1ZUD1 2DBZA 1LDMA 3CLSC 1IY2A 2C9DA 2FZVA 3GG2A 1QKIA 3IR6A 2O06A 3OLZA 4EHDA 5BQ3A 3BC1A 1N7JA 1HTBA 1YVDA 3RVKA 2AOVA 2PANA 3V8NA 3GDWA 4OXXA 1W9HA 1NW5A 2JK1A 2FPXA 2VOJA 2JASA 3Q8LA 5A0TA 1I3CA 1KZGB 3AV0B 2OFWA 5ALIA 3F6EX 1SBCA 2COEA 2Y0DA 4D9MA 1C9MA 2DR0A 3KSAC 5ELXA 3I76A 3AX6A 1QR6A 5CFRA 4U2DA 1ZS9A 4IVRA 5FPYA 1U4NA 2PZMA 2VWGA 3AV3A 4F9EA 4BNUA 3ED5A 4O4HF 5CB6A 5K09A 1L1EA 4JYMA 3CLRD 4GSYA 1SZJG 4JLBA 2BMFA 1DHRA 2IEDA 4OQ4A 1XJCA 1RHJA 1UPTA 5J4VA 1UFKA 2CDAA 4H18A 4OA8A 3EB9A 3GLGA 1TECE 4JP1A 1C3OA 2X4IA 1ZKMA 4C03A 2OVBA 1FFWA 4NEQA 4NMWA 5I4KA 5LQNA 1ENZA 1T3SA 4NBKA 4QTYA 3R09A 1VB3A 2OB1A 3FKSA 1OT5A 1DL5A 2Y1LA 3UHFA 5KPJA 1IVSA 3QXXA 1T3GA 3STTA 1NP3A 5FL3A 2AJTA 4I9UA 4O63O 4RAOA 4X63A 1QIMA 3MJDA 2ZIZA 3H2ZA 4PYOA 5CB4F 2VP0A 4Q3OA 1RQNA 2HCJB 3B7GA 4RZSA 1NM5A 3OT4A 1ZMRA 1JZQA 3C8HA 5A9SB 1YA6A 1WP4A 2PKQO 1WIWA 2WMOB 3I9OA 3S1AB 5F7OA 2UYCA 1ULBA 3AR7A 3HYLA 1BXRB 1KJJA 2O0MA 5H80A 3RKRA 4CZ2A 2NVUA 2F90A 3TK1A 2VT2A 3P0FA 4D3ZA 3K1AA 2X8JB 1T9GR 1XEXA 4Q9HA 1D4OA 1NLZA 1JJIA 3CEJA 5AVKA 2VT6A 3RK1A 4K3VA 3KB2A 4ZANA 1XCMA 1Q16A 4GEGA 2O3UA 4MI9A 4G4IA 3EQ8A 1KDPA 4JP8A 4K81B 1EJ6A 2OWEA 2Q62A 4FTWA 1XTUA 5EWMA 1Y9JA 5KNBA 5A05A 4PYJA 2BZ1A 5KKNB 3ILXA 4JXJA 2KHZA 4WI1A 5D51S 1HQCA 4I3GA 3OZGA 4P3KA 2QQ0A 2DFKB 3EVNA 3ITDA 2QL6A 4G24A 3DH0A 3EGEA 4U6NA 5GONF 3PB3A 5E3HA 5FUMA 3V4LA 1KQFA 4BLTA 4D9NA 3IKJA 3RODA 2PTHA 2X41A 2EX1A 5E2IA 1X80B 5KTMA 3U19A 1Q7CA 3LPNA 4I5DA 4KJXA 4NZMA 4UEOA 4JLNA 4S1VA 1XR3A 2P9QA 2VNHA 4KQJA 1U8AA 4K28A 3LSTA 1WTAA 5H83A 4RF4A 1QJ4A 5TPWB 2NNLD 2O6LA 3VH4A 4Q66C 1FYWA 4CMJA 3H0EA 5B2ZA 2QWXA 3WK4A 4G1MB 1D0SA 1G21E 3ZE0B 4C29A 2JCBA 4BCDA 1XO1A 2WJJA 4ISBA 2WI8A 1RQPA 3EWSA 2BFEB 3REFA 3WDMA 3I3SR 4Z0PA 4G1FA 4LHEA 4X7MA 3USZA 4CYMA 1WCXA 5DNEA 2ZZKA 2XD9A 1N2BA 5JSYA 4KE9A 1FDTA 4OSPA 5E6RB 5D87A 3AONB 4PBTA 5EXXA 4OHYA 1VJGA 3FSGA 2G80A 1DKRA 5TMDA 2BFDA 3SZUA 5F2NA 4NCAA 3PA8A 1N2SA 2FVYA 2WHEA 3JQCA 3Q3VA 5TJHA 4B3MB 4OREX 4C07A 1NMXA 4N8DA 3R24A 5EJGA 1W47A 1GKIA 2ZVDA 1N3IA 2ARKA 4LOLA 1G63A 1NMQA 4Y9DA 1U99A 3NBUA 3PRKE 1XHLA 4FFPA 1U0GA 5DHUA 3A27A 4OYRA 3DZ8A 1VM6A 1RRMA 1P4JA 2I99A 6REQB 3LBYA 1AQ6A 5BMVB 3BGOS 1N2EA 1P61B 2IXGA 4Q03A 1A9XA 1PZNA 1U8UA 1Z9BA 2IEIA 1K0UA 3AFIA 4RS3A 1EX1A 1RACA 4TRJA 4WNAA 2V9PA 3E03A 4OQLA 2ZI6A 4KRGA 2DQ4A 3B85A 1N0UA 3CR3C 4B87A 5JFGA 4G0WA 1Z6XA 4MV8A 4C14A 1K6MA 1D1QA 2VYVA 4BWGA 2O0JA 2WD8A 1W19A 1Z0KA 3TQFA 2JFPA 3T3NA 5FPPA 3DZJA 2XH8A 2JAOA 4RW0A 1A9PA 1I2AA 3CH6A 4R7TA 4UBMA 3L05A 4KNVA 4B3IA 2VP4A 4X62B 4GR5A 4H7IA 4LS3A 3KR2A 2AXQA 1ZPDA 2VAPA 4BATA 2V96A 4EVRA 5A5EA 1IONA 3HPRA 1KDYA 1V1RB 3ZXXA 3FGPA 1QH8A 3K72B 1J8QA 1Q83A 1V48A 1Z4IA 2COUA 3SDZA 3OPYB 4CEJA 4EHHA 1P7ZA 3O9ZA 4BB9A 5AVWA 3CVUA 2UVDA 1EIWA 2WF6A 2Q50A 1YS7A 3C1OA 1GPH1 3BCSA 3PL5A 2G4LA 2FSFA 4OB6A 5IBQA 3FVTA 4KXFB 3HCDA 3JVEA 4ABYA 1O0CA 2CV1A 3A2LA 1GGJA 1A4XA 4HQNA 4ARVA 1ZAKA 4EKDA 2V7EA 1F14A 4DR4B 1U2RA 1A2BA 4WE3A 3D7KA 2B99A 3DZKA 1YR3A 3MWDB 5D8DA 5A06A 1R0RE 3ETDA 2C2GA 3N8HA 5LP6F 2O3JA 4ZOEA 3EWNA 1E3EA 2G5TA 3IXLA 4BO5A 5IT9A 1X74A 1YUBA 4TSFD 1QYWA 3NC1C 1UBMS 2JC3A 1R6BX 5HZKA 5TQJA 3V6LA 4M53A 4DVJA 1M8FA 2Z08A 3AB8A 3JQ8B 1VMEA 2O8FA 4PR0A 2GA8A 4JD5A 4EJFA 1IWPB 3KBOA 4J7CA 3OP1A 1BCRA 2Z4SA 3NC0C 3NVAA 4RH1A 2VIIA 1NW4A 4QXRA 1VHQA 3ZHSA 3SYLA 2XWJI 4Y6SA 4P34A 3LPLA 3FOAA 3NHAA 2FPGB 3EARA 5GIPE 3UYLA 2G40A 4CHTA 1RPJA 1DWPA 2XUOA 5EJ2A 3FYDA 1I4WA 2X2PA 5A3JA 3F6CA 2YZ2A 5TQ2B 3ESXA 3UG6A 3E4CA 4M60A 3BOSA 4ZO7A 3CT4A 1A97A 4Z8XA 2GLTA 2V9ZA 3QJYA 1DDGA 2PJUA 1PGJA 3H16A 3OKFA 3IT2A 2YV4A 1EBBA 3AH8A 3ICPA 3KC2A 5DLYA 4BBZA 1HNZB 1TQ4A 1WSWA 3RSCA 3ICQB 2YXNA 1AQJA 4BO9A 3C1UA 2I66A 2WK1A 4MUFA 4Y9SA 1XLTC 1R66A 1I4OA 3C24A 4J4BA 2QRVB 5HKLA 4TV9B 2CUZA 1Z4JA 2QMOA 2V55B 1E9FA 3D8UA 4W5NA 4TKMA 3GAFA 5BORA 5B6IA 3T4PA 4TM8A 1MP0A 4XGIA 1KFJB 1JQ5A 2Q6IA 3AEUA 3S2IA 2E7ZA 4DARA 1ZUHA 2BEVA 5CD1A 3AR3A 4C0XA 4BLPA 2BSAA 3DW1X 3FSEA 1YHZA 1ZK1A 3EXEB 2AR0A 3KZKA 2XKBA 4MLPA 4PQFA 1FQOA 3ZDDA 3Q3GE 1U0TA 4MQEA 4XQ9A 2M6SA 3OEYA 4A2WA 1R6UA 5C4GB 1SQ0A 3GIDA 5FRDA 3R3SA 1PW5A 1X7DA 2X0JA 3KKPA 4FGKA 4J7XA 2XUFA 4OEHA 2IHTA 1KE1A 4TLEA 3WBJA 2OZEA 1SVOA 4XYMA 2C5SA 4I08A 1X8JA 3C2QA 2ZRCA 5JNVA 3GCWA 6LDHA 1NBOA 4OJTA 1G9XA 1KZ4A 2B30A 1Q3KA 3L79A 2Z04A 2ONJA 3DP7A 2JLUA 4Z8YA 3HTXA 1CFZA 2XE6A 3PWKA 4W9RA 2NU7A 2V54A 3JQ7B 4O2BB 2QPLA 4UTVA 1YOVB 5BRAA 1OGYA 2QIPA 3CEHA 4QXPA 3AF0A 4AJ2A 1BGXT 1QCCA 2W6ZA 2YW9A 1JPVA 5K1ZA 1CWUA 2C2OA 3C41J 3LRTA 1RAHA 1R4MA 5FLXA 3GLIB 1Y8ZA 4BJ3A 1JFSA 3LZCA 1XSEA 2J0EA 5LYJB 5E7MA 4DV5B 2PYIA 1N2CA 4LJ4A 1V45E 1W6RA 4QGSA 1T26A 3D4OA 2TMKA 3RT1A 1L1QA 1YFZA 1ULTA 5SZHB 4QT4A 1JAIA 1Z75A 2Z30A 5AESA 1MEJA 2FK7A 2UYYA 3QUQA 3V8VA 3GRZA 8GPBA 2VUTA 3KB1A 5AVOA 2FQ1A 1DWOA 3LUKA 4GMFA 4KLAA 2X1HA 1VIMA 4MGYR 1SXIA 2B9EA 1PJRA 2OGUA 3IP3A 4NCXA 3BTSA 2HREA 3P2OA 4PIMA 4H7KA 4YRZA 4ZYXA 1RI3A 3KKLA 1B6SA 3K0EA 4YJHA 1NAHA 4NAUA 3B70A 3I72A 3T7CA 4TKUB 3PGLA 2ZZNA 5BN5A 2CK3D 4FYIA 4OQDA 1JA0A 1OAOA 1VC2A 4YXWD 4ZZ2A 5KI6A 4H17A 5CBPB 2FOXA 1EXWA 1TMOA 2NNWB 4KE6A 1YKFA 3UCEA 1RWPA 1I6MA 1X6VA 1U3TA 3EJWA 4M0LA 3VR4D 2HUNA 3LDUA 3E3OA 4MB0A 4DUYB 2FUCA 1XLUA 4MQFA 2CDCA 2F3RA 3T3GA 2VQ3A 4LA4A 1WDWB 3O73A 1XU7A 2CCGA 3ILHA 4LJRA 1GT91 4NBTA 1VI5A 1QR2A 4AUNA 1JJVA 1GP2A 1TTPB 5AR1A 2LDXA 3TN7A 5JUWA 3CZPA 1ZD8A 2CEAA 3OMWA 1P0PA 4U9HS 4BB6A 4C0LA 4GXRA 4C3VA 3OF3A 2J0QA 3SJUA 3TMAA 5F9HA 1JQ3A 2ZJ5A 1EK5A 1HV8A 1PYDA 3D02A 1NDUA 2BY4A 3MS4A 1SC9A 1O9HA 3RASA 2DKNA 5BY2A 1EM8A 4LJ5A 1ZU4A 2N46A 4QO7A 2YNMC 1KWGA 1V9LA 4MUJA 4J0JA 4R1TA 4D3DA 4C0BA 3UV7A 5EGSA 1YRWA 2I62A 4ER6A 2O59A 4C30A 2JGKA 3KZOA 4NI5A 1TDJA 1ZR2A 4TZ0A 1CRQA 1IQUA 3CCFA 4A27A 3RAPR 3FTEA 1PX2A 5I9MA 3DAGA 3PITA 2CEKA 1Y1PA 1XCGB 2KMLA 3T5AA 1QG6A 1MAHA 1SXJA 1UC5B 2OG1A 2PH1A 2F48A 3EMDA 3FHJA 4D0GA 1GM5A 3EPKA 1GSHA 2WJPA 3K16A 5JXGA 1ULZA 2QK4A 1Y6ZA 2O0LA 5KSZA 1WXWA 3YASA 4KR2A 1LS1A 2HDOA 3MZ0A 2ZIFA 4M55A 5H70A 4B0OA 4B9EA 2FWPA 2DVMA 1DX4A 1JT9A 2PBFA 4HQFA 2XRZA 3LQRA 1Y3DE 1JDPA 4BY9E 3M4NA 2J41A 2CFOA 4Z6KA 3TVYA 2BM0A 5DHFA 4ZEXA 1ABFA 3KQHA 2W83A 4OFXA 3VI3B 4YMLA 4CT0A 1U2EA 1H4TA 8LDHA 3PC2A 4YCBA 3T5MA 4NPCA 1Q50A 1PNRA 1JBEA 3KE9A 4B46A 4DR6B 2XRYA 3MRVA 5DNAA 5ICGA 3QOFA 5K8UA 2HMUA 1L4BA 5IJXA 1DS6A 5IZCA 1ZLYA 3DJFA 3PHCA 2ZT7A 3U16A 1FC0A 2FKNA 3TLJA 1B23P 1QH0A 2CHEA 5HBRA 1H2HA 2O1XA 3EF1A 2HNBA 3B60A 3HMQA 3KUDA 4HDRB 1FP6A 1J42A 2P3LA 2V3WA 3NIBA 1K6JA 2WHXA 3WQSB 4ESOA 1Y81A 1J39A 1PNQA 1ZMXA 3QU5A 1UC9A 4QBFA 4V0NA 4XOUA 2Y1XA 4D4MA 4JSTA 4RPJA 3FPSA 4TVSA 2ZYUX 2W6PA 1A8PA 2Z3ZA 2NU8A 5CD9A 1JX6A 1ORTA 1NVFA 1T2AA 2JFNA 2VCYA 2LDBA 3BULA 4YACA 5E8RA 1WP9A 3C74A 3WKAA 4CUKA 1A50B 1RE0A 5GY7A 1Z6PA 3THYB 1T4MA 2ECKA 4IIJA 3RS0A 2XBLA 1OW3B 4PG8A 1TJYA 2R1TA 4R2IA 4U02A 4CMAA 4BGDA 4KQ6A 1F2TA 3LY5A 2QJWA 3BBLA 3NOOA 3QG1A 3K8QA 5CDFE 3QA9A 2R8RA 1L4KA 4ZWNA 4BP1A 1KMMA 4DWJA 2CB0A 2DJ5A 1KTVA 1JEYB 2EFCB 1TT5B 4QQRA 2FEOA 4DA4A 3N8DA 2GVDC 3G02A 2HOQA 4O5AA 3U9TA 1C4OA 1YS1X 2VA8A 4DWVA 4MV3A 4BWVA 1UT6A 2REQB 2XYPA 3OAAA 4PZPA 5CR9A 1RYFA 2QNRA 4DUPA 4H1VA 2BZ0A 2WFZA 4FXOA 1WX1A 3PVCA 4HH0A 4PCVA 5EZYB 4OM7A 1CX9B 1Q3HA 2GD2A 3R3JA 2B4KA 4U7DA 1N7IA 2C4VA 3ROQA 3G5AA 4BQQA 1JN0A 4PRZA 3FOCA 2V4ZA 2LD4A 1E2NA 5D85A 1TL7C 1ZEMA 5TE9A 4KGXA 2E9SA 1E62A 1UK8A 1Z68A 3REOA 4KVAA 5AOAA 2FA9A 5H3CA 4HGQA 4M1YA 1TX4B 2WTXA 3LLMA 2CLMB 5IULC 2X19A 5DBFA 5JI2E 3DD1A 3K30A 3SC2A 2NP7A 2YTZA 3AYXB 2DM6A 2IDZA 3ETEA 2JBHA 1XZMA 3OOYA 4ESHA 1G6KA 2QPTA 5LCXA 4JYCA 4C4OA 3CF4A 4W9NA 4HQLA 2PMKA 1D2HA 1CJUC 4KAAA 3AJRA 1UWVA 3CEAA 3WQRA 3HVJA 4GYJA 4E4YA 2UZ1B 3H4MA 3DZHA 4NU6A 5L45A 4BNVA 3QTLA 1EQ2A 1TVCA 1Y6RA 4X8MA 2FMFA 4IW3B 3TNJA 1B0UA 3BK7A 1ZJJA 2C42A 2RI0A 3JQ7A 3W9YA 4E88A 4Z1MD 2Q3JA 1Z13A 1ENOA 2IEGA 3AHGA 3DL4A 1H6BA 4PICA 4DMUB 4R71A 2R1VA 2IY7A 2RIPA 4XB6B 2PRJA 3JQ9C 1QDEA 5ALNA 2NU9B 3VDQA 5A6VA 3RAFC 1B8PA 5IJWA 4EFMA 5CH5A 5K8IA 1Z5PA 1GQYA 1HPLA 2VRBA 5BRJA 1DO0A 1U1GA 1KQ3A 1UL1X 2W5UA 3QFFA 2KYRA 1IXSB 5J2TF 2PGJA 1G9SA 1T8TA 2VAXA 5DI3B 3S2ZA 4F4JA 3A9VA 1D4FA 4NFYA 2IZOA 2FV8A 2YRXA 1PZXA 3VPXA 1FNNA 5BYJA 3TCKA 5IWCA 3O47A 4BJHB 1UDAA 2OO3A 3N2LA 3H75A 1ZHFA 2PBRA 1ZD4A 3AGQA 3H9QA 4LPSA 3EUFA 4W5WA 3WRXA 4PG5A 5LQAA 4JEIA 1Y4UA 2PYDA 4RGQA 3TH5A 3B20A 2PX8A 1FE8A 3HN6A 1KKLA 2C8LA 3P9XA 2PMWB 2IW1A 3I0MA 3AVUA 3SSAA 2WHRA 4D25A 2GAIA 3LPCA 2AKEA 1RI5A 3OCVA 1AJEA 3OJOA 5CVVA 2XT0A 3JD1A 4DABA 5FO1A 1KEEB 3HWSA 2WIJA 1CE8B 4WA7A 4F5DA 3SDSA 3CVVA 4MB2A 4RX1A 1YO6A 3OO0A 4PX5A 3UXEA 3QWIA 1CIJA 1E2GA 1S1MA 2XAAA 2HZ7A 1OWNA 5KREA 1NJFA 2AZDA 2VHYA 4MW2A 3T4EA 2XKAA 3OTHA 1NXWA 2QMHA 3RRBA 1E77A 1LLQA 2A0YA 4JT4A 3ZYCA 1HFJA 1X77A 1MQSA 2VNSA 3NJRA 3QELA 3ZZTA 5IN4A 2FWRA 4P53A 4ZI5A 1V26A 3I5UA 3VNSA 3PFNA 5JOQA 2RD2A 1OI7A 3LGAA 4O2BF 2HPAA 1DAEA 1LW7A 3LTEA 3UMGA 2I6QA 4O2RA 5ICSA 4JI3B 3CZAA 2XVAA 3KL2A 1ID1A 4EG5A 1RMQA 2J6CA 3DLCA 4CM9A 4EH1A 5LZ2A 2G9VA 2O2EA 2D3WA 2ADMA 2ODPA 2BUCA 2I4RA 2C5GA 3FPEA 1JILA 3HUFA 4MUAA 3TG2A 1FFCA 3PGXA 3EZYA 1S2DA 3IDSA 2F2TA 1T15A 2GF0A 4B5LA 4NF2A 2C29D 1HBJA 3WMEA 4NBLA 1E2MA 1Z4KA 2ISCA 4NMXB 3SEFA 3TSWA 2A0FA 3N7AA 2QJOA 3FKJA 3B3QA 3J80A 1EE1A 4C0AC 4P38A 1J0CA 3ANLA 4G1CA 5DHPA 1QRTA 1HQKA 4PXSA 1GGKA 4ZVSA 5HRUA 4LMRA 1K7XB 1U0LA 1ZA1A 1W76A 5BN1A 4KVFA 1IY8A 3GHHA 4QOFA 2YDYA 2DHEA 4C88A 1PJSA 3G23A 1QYCA 3GFSA 1NX9A 2A9KA 4LF5B 5CXXA 1KF0A 3F7NA 4U7JA 3M34A 4M0CA 4KIGA 2CNNA 4ZOQI 3THWA 5IFLA 3WK5A 1IK6A 1N92A 1ETUA 4HXEB 3TIGA 2H4XA 1NVGA 3OM8A 2XOXA 3TKLA 4KRFA 1MKYA 1N25A 1QM5A 4DLZA 3X1DA 3KUKA 4XCXA 5C18A 2P6PA 5IUKC 4L8GA 4KSYA 2JGDA 2P62A 2Q0QA 3BJMA 3CGGA 2OQVA 4AM8A 1CZKA 4AY4A 5KTRA 3VOBA 3KKZA 3SWWA 1EZ1A 3EH2A 2JD2A 3JQFA 1A9YA 3SHWA 3C87A 4MWGA 4EFLA 5CCBA 3HNPA 4NBRA 4CKWA 4R0MA 3DO8A 4WADA 4K6OA 3VPCA 1JAHA 4W8GA 4XFJA 5GM2A 1K8QA 4LGYA 3KEMA 5DNCA 3UB3A 2IW3A 1LW6E 1Y1LA 3W5AA 1NVMB 4ZDJA 3FR7A 4DA7A 3L40A 2IYZA 2JHAA 1ZK0A 3NGXA 2FPRA 1Z4MA 2BHNA 4PTZA 1DQNA 4DIUA 3A1VA 3CWZA 3IELA 1Y6JA 1YZGA 4L27A 3SYMA 1R1DA 1XZQA 1OB2A 2AOWA 2RONA 3IB6A 3FSRA 3PWTA 1H94A 5A9RA 5JTTA 2F8SA 1K75A 2JEYA 4LJLA 4EOGA 4E5UA 3JWHA 4BIMA 3WGZA 1TCUA 1F4LA 3JQPA 4PPFA 3DP9A 2MOKA 4XYGA 4F86A 4E6EA 2WWYA 4PS0A 3WX0A 3ZGVA 2VHWA 3R7FA 2BEWB 1ST3A 4BV3A 1JFRA 3KNZA 2HPHA 1Q0HA 1SCBA 2O2XA 1ISFA 1ULAA 2PSJA 1MB4A 1DIRA 1ZKDA 3M2PA 4N7BA 4Q4LA 4JI8B 4X61A 1ID8A 4INJA 1OLSB 1ABEA 4KQHA 2EYQA 3JRWA 3LYAA 4LPKA 2VQSA 1FFYA 5HUHA 3QZUA 4MO2A 5EJFA 4HRVA 2ICAA 1JMVA 1VL8A 3KALA 1PVOA 4OHUA 1LLCA 4MAFA 4NE9A 4OM8A 5DNVA 4X6UA 4QYIB 3JSAA 5BPHA 3L6OO 1OZAA 3IUBA 3O1LA 1BC5A 4BPRA 1AF4A 5EERA 1LPMA 1QONA 4UFOA 3RLIA 3K35A 4ZHQB 4CI9A 2HW8A 2CLCX 1HTWA 4G5YA 1BS9A 2FQYA 1G1MA 3IIIA 4ZC1A 4BV9A 1VMIA 5CT4A 4YFYA 1WXIA 4AJJA 1VE9A 2WSSA 2BI7A 3JARB 2DH5A 5JASA 1KZ7B 2P9BA 4LRYA 3RG2A 2J4FA 5KWIA 3EHDA 4JI0B 1EAYA 3V7NA 4BGUA 2FMTA 4F06A 4QSHA 2C92A 1UP4A 3H2GA 4OAPA 1JA9A 1ZXLA 4WD3A 4AJHA 1LNQA 2BE7A 2BM8A 3CO5A 4NS1A 4QRDA 3AP1A 4R6XA 4Q47A 4YCDA 5K0LA 5AW4A 3O92A 4TLCA 4HNSA 2ESRA 4AF8A 1G9TA 2ERYA 7YASA 4JQYA 4MJLA 3VU9A 3A1UA 7ABPA 3PPIA 2FN4A 2IITA 1NVUQ 3DCYA 5IASA 4LI0A 3X1KA 1MO6A 3H5TA 3EEBA 2FQWA 4DM3A 3FY4A 3BWMA 4CLEA 4JVNA 2VK2A 3HBFA 1K4YA 5DN6A 4EAAA 2Z6VA 3JALB 4OATA 3GFQA 2TMGA 1X13A 1WW3A 4OG2A 1SO8A 2IYVA 1E1LA 3FHLA 3K6JA 4D5GA 1G19A 1QHHB 3R44A 4ZT6A 4WW0A 4RADA 4CVNA 1EFTA 1JIQA 4NZPA 3LIIA 3KB6A 2VHQA 5LD2B 3M9XA 4ZAWA 1N4DA 1AN0A 3PRHA 4LXTA 3VHRA 2VUSA 3B1KA 3U7QA 1T4CA 2PLAA 2PSDA 4ZOCA 2A67A 2AE1A 3KLOA 3BAFA 3HI4A 4I4TF 3PF8A 1NC1A 1Q7TA 1QHXA 3EVAA 5BN3A 3OG9A 3VI4B 2DU8A 2W42A 4IOKA 2H9IA 4JLUA 1WZNA 2ZS7A 1J7KA 4IY1A 1LDBA 1Q17A 4GXNA 2GM4A 1CNMA 4LN1A 4UHKA 4GX2A 4ZI7A 5IT4A 2E4ZA 1YJ8A 3CR7A 1L5FA 4OHVA 4RXUA 4XUEA 3ZNQA 3DEFA 4D6YA 4L0QA 1RSZA 4N1AA 5DOZA 5KOHB 4OYYA 1NM5C 1C1DA 5HFNA 3R5SA 5INTA 4JCOA 4ALJA 4H3HB 1JDJA 2GK3A 3GRUA 1QIGA 2BR5A 3NX4A 3QI7A 1BKDR 5AOVA 1WULS 4MHTA 4RH3A 3OKCA 4NMLA 4EA7A 1IAVA 4OQYA 1N4AA 4CGZA 2O4UX 1UDWA 4QU0A 3VPFA 5EP3A 4B4KA 3KDSE 4B33A 2NGRA 1JQBA 2JK0A 3L7JA 1DC8A 4WVLA 3SR3A 3HB4X 2CFRA 4WN9B 1QGDA 2QA5A 4WK4B 2P9JA 4CV1A 1NHGA 4UPEA 4YDSA 5IVHA 2C4UA 2ZTSA 2WKWA 4JWKA 3WGNA 4EELA 5EJ6A 4TGLA 4UOEA 1V11A 4ZEMA 1QYRA 4LYAA 5AT1A 3E7WA 3IT1A 3I5YA 1NZDA 3SBEA 2XGGA 2NTJA 4LBVA 1W29A 1PD0A 2ZYRA 4M76B 5ALSA 3HJRA 3MCTA 1P3DA 1W48A 1FA9A 1KC3A 2DY0A 3T1YB 1YACA 2V1XA 2W2OA 3L77A 1L8LA 3VQTA 5KTOA 2J46A 3RS4A 2YFYA 3BK1A 2CKDA 4F8EA 5FOVA 4F4DA 1Z6TA 2JZOA 3B7PA 4JR1A 3QSGA 4R9RA 3CUEF 4RD0A 3T3IA 2YYYA 5IW8A 1Q5PA 3WFZA 4F1KA 2O2SA 1QPGA 3S2GA 2AOXA 2G1UA 2Y27A 5CTAA 5K3FA 3K09A 4PRKA 2W2NA 4GMKA 621PA 4IDHA 4PX2A 2JLXA 2QUJA 3FIJA 3CX3A 4LE0A 4O4IF 2P2DA 4YJ2B 1RIIA 1VIYA 2O0HA 4R84A 1YUNA 3UJBA 3F73A 5FKJA 3C7KA 4JI5B 2XQJA 1C9KA 2C8KA 4B73A 1M76A 3AU9A 1CIVA 2HHAA 3FZQA 3KPUA 2A5LA 1T6ZA 1TAQA 1U6JA 3EDOA 5AI6A 4BFVA 1ATIA 2CKMA 2RGBA 3FRHA 4JSYA 2E18A 2B6HA 4PTYA 1N6RA 1LC0A 2DUJA 3OJCA 4H31A 4KQ1A 1JG4A 3E61A 4LYEA 2XGSA 1MJ5A 1TM4E 4RVCA 1TQ6A 2E2WA 1N8SA 2BAGA 3T06B 3ETNA 1YC5A 4U5QA 4DKJA 3ICOA 5AW6A 4QJ4A 3N8IA 1JHZA 4YCAA 4G26A 2IQ5A 2RHTA 4MVJP 1LCIA 2BBSA 3MMXA 4IGAA 3NDJA 3D6AA 4HDMB 5AXAA 2BJHA 3PEVA 2C2MA 2HA6A 2AFRA 2ZU0C 3FNGA 1HA3A 4KQCA 4E3ZA 3TRIA 2NU8B 4DB4A 1E2BA 3OECA 4DDWA 2JIZD 1XLWA 4QDJA 1YCDA 3MJSA 3WBBA 3NVKI 2IVZA 3GFOA 1Q7EA 2HWUA 2XZTA 5CT6A 2IY8A 1BXKA 1ZXXA 3HCFA 1EFVA 4GBGA 1MG5A 1U6KA 2H08A 4H77A 1LFAA 2VQFB 1KDTA 3QBVA 3NAQA 5JZMA 2GYYA 2Y4NA 2X3UA 5B1EA 1X3LA 3L0CA 4PR3A 4IH1A 4JQSA 3W4IA 2FLWA 1N75A 1OVMA 4BGIA 3CW8X 1XNJA 3P9RA 5C5CA 1IDN1 1SKYE 3AVTA 3NAZA 1WOMA 3QUAA 1EHYA 1XBTA 3ZK8A 1ADFA 1XALA 3GUYA 2FMXA 2JFOA 5PGMA 4Z53A 5JCPA 1G1AA 2D2VA 3IJPA 4Q1EA 4UW9A 2ZOSA 1SXJC 1XDDA 5BW8A 1JR2A 3H5IA 2APJA 4CMEC 3S40A 2ZBVA 1ZM7A 2ZFUA 4QWMA 1G2OA 3IE0A 3VHXA 3VU0A 5FQOA 1TMYA 4DNFA 3DDNA 1Q84A 3I9KA 2B1GA 2ZRJA 3NHYA 3OETA 4HUJA 3NU1A 3RROA 2RHBA 3LCRA 2ZPTX 4L9SA 3AT1A 5DMHA 4WX2B 3HKEB 4LX8A 5BN3B 3TI7A 3LGXA 1XZLA 1XTQA 3FAKA 4URYR 2GPJA 3V55A 2AB0A 1FP7A 4XSGA 3PUWA 1UKZA 4I50B 1RYDA 2D1FA 2GZHA 3I2FA 1Y3BE 1QORA 2CD7A 4IIVA 2NV6A 1GRVA 3D4BA 5JCOC 5KJFA 2QT9A 3V8QA 4CEIB 3I53A 4H4DA 3IVGA 1FRZA 4RFSB 2YWXA 2J87A 1WKVA 2BFOA 5D3KA 4DQUA 1OGJA 1U5AA 4N18A 1E59A 1JNXX 3NYQA 2XTZA 1TGVA 1DKLA 1KJYA 1U3CA 2GBPA 3MD0A 1T0PA 1M54A 2PY6A 5H4HA 1EDDA 1LB1B 1Z36A 3VR3D 2G70A 5BWLA 5F2KA 3KXDA 3IQWA 4JBGA 1AUXA 1XV5A 5G53C 1I0LA 3VOSA 1CNEA 5CDUA 2XLBA 1NUUA 1QV7A 1XZPA 3CVJA 4RPIA 4Y6GB 1MG0A 2GDJA 3FGNA 3JTEA 4D96A 2K87A 1NW8A 3IPYA 4JJ7A 4OL9A 4Q3NA 3HDHA 4XD7D 3SZLA 1BVUA 3UCFA 5IANA 3DTYA 2WYVA 1P31A 2DFPA 4N47A 4HEA1 3G2NA 3ZW9A 5AUQA 1AKMA 2IQIA 3C8MA 2C8VA 2H6EA 2RDMA 4S35A 4FWIB 1HDGO 4D80A 2CMDA 4MVJD 1KOJA 2Q2QA 2R25B 3O3MB 4TN5A 1GN8A 1XAIA 2I2CA 4AY6A 3HUDA 1FDWA 4X41A 5AUPB 2ID4A 4EG7A 3D81A 3GZTB 2XUQA 3OEHA 3S27A 4D4JA 5CXUA 4ETMA 1WHSB 3IVAA 2TECE 4X8OA 3AKDA 4XLLA 4PCAA 3HBNA 2OZKA 3JQEA 2SKCA 3KZMA 1AK1A 2IPAB 2PSFA 3CQ9A 3DXZA 1C0EA 2PKQP 4GOKA 4HDQB 2LKDA 5EI5A 2EEZA 3FHCB 5K45A 2C0QA 4L2IA 4BDTA 3ZU3A 2AJLI 2BGKA 2P8JA 3F3MA 3S8EA 2Y1EA 2XXJA 1JDZA 3UK0A 4INPA 5IVDA 4W1PA 4LYJA 2HSDA 2X14A 5KVSA 3T3MB 2PXXA 4RK7A 1SXGA 3SM3A 5ISMA 5D6NA 3GN1A 5LYJA 1B6RA 4XA8A 2PM8A 5EY5B 4CFYA 4ARCA 1W5TA 2VDKB 4B79A 3IPAA 1PT5A 1YE8A 1JHYA 3K8YA 1NXPA 3N0VA 3KT8A 1UK9A 1JJFA 2WTEA 3LQ2A 3NH9A 4R51A 3K3PA 2CFIA 3EBOA 4DNPA 5JJKA 1A4IA 1YA8A 3OZAA 5I7VA 1Q92A 1E9BA 3DOHA 1GJRA 4G37A 4L16A 1G7RA 5AI9A 3U3MA 1XD2B 2PJDA 3A05A 4CTMA 3E9QA 3A4VA 4W9NC 3HSKA 3WLRA 3MGKA 3KX2A 3PNLA 5HW0A 1CRWG 3MT7A 1C8BA 2B36A 2DPGA 3R5XA 1NDHA 1V3QE 2ETXA 2QQEA 4G9BA 4H7EA 4TT3D 1KKMA 4FD3A 4LDAA 4YAOA 4Z4FA 1NR7A 1H69A 4N4AA 3WGGA 3TX2A 2CCKA 3ZU4A 1H2ZA 3UMJA 3RTCA 2VUHB 1LJ8A 4H7DA 4MQEB 1EWKA 3GR6A 2I71A 4ZU3A 4PHFA 4CQLA 4OHOA 2X3YA 2XSZA 1DWUA 3PC4A 2B94A 2X8LA 3C3CA 1NFFA 4LWPA 3P9QA 1H9AA 1PQPA 2B4AA 4XXHA 1UPUA 1H1TA 2A8YA 2XB9A 3N3AC 3IBGA 2PVCA 3R7NA 1VPDA 2HEGA 4MQ6A 3L6EA 3FUVA 1N36B 1PR6A 1XA0A 4IX1A 2PMDA 2W70A 4GUAA 3FDFA 2CV2A 1C29B 1FRQA 2H31A 2V5AA 3PZRA 4JLWA 4AMBA 1OC4A 4K6MA 3H5WA 4RHEA 1NVDA 3OF5A 4XLTA 1P5RA 4KQFA 2Y1KA 1YS9A 2H9AA 4EVIA 2ONYA 4JLKA 2CFTA 5G0VA 5JDIC 1MA3A 2DR3A 1GPWB 2GK6A 2ZM5A 4F5WA 1I51A 4YYZA 2RHMA 2WTMA 4W8OA 4Z7NB 4C5BA 3DFKA 3EULA 1K7YA 1DKUA 1O87A 2RB5A 3W2IA 1AD2A 3C98A 4Q0MA 2NTVA 1S02A 3BBPA 1A8QA 4XGNA 5JG7A 1Z63A 3EQZA 1G291 2MJLA 1BCRB 2QLFA 3HGQA 4ZKEA 4B3SB 4RF3A 1KDVA 5F78A 4DSAA 1W2GA 3UAVA 2D2FA 5L3ZA 2VFAA 3M3PA 3ROPA 4LKOA 4Y18A 5JVDA 4TS1A 2OB2A 1CETA 4WZAE 1C9DB 1M9NA 2YQ4A 4MV5A 1GU1A 1B43A 4JLOA 3WSVA 5JJLA 4CEHB 2ZRAA 4P4NA 2W2LD 4KN5A 3II6X 2A58A 3E7FA 4YC7A 3M82A 5CVDA 5HTOA 3QU7A 3N8NA 2DX7A 1QDUA 4D3YA 3IEMA 4IWYA 1CVIA 1AZLA 1YZFA 3NASA 4KLNA 4B5KA 4AVYA 4F4UA 2FPOA 1QLHA 2YXLA 5E3IA 1G8PA 3RNLA 3UUWA 5EHNA 4CF5A 1CUYA 2O8BA 1RWBA 3E5RA 1FBNA 2R8EA 2C7PA 5JZVA 1IULA 4QT0A 5DB4A 4XEUA 2DKFA 1BSVA 3PV0A 4OVKA 5LM3A 1R8SA 1MU0A 1GNRA 2C84A 5HS6A 4RMGA 4IDFA 3OVMA 2HXYA 1UBTS 3FPGA 3TUJC 1NVWQ 4C2BA 4TYWA 1VPLA 1YHNA 3NETA 4HAWA 4ND2A 2FE1A 1ADCA 2WOJA 3LK6A 1U0EA 3OM0A 4HGYA 3VPBA 5CFPA 4C7VA 2QUAA 1KGDA 2CNDA 2H2AA 2B8WA 4I1RA 5LNK1 5EGNA 2V3VA 4OQPA 1YASA 4IUCS 4LYDA 4UE3S 5I8ZA 4EW2A 3RYFB 2C4TA 4F2PA 5KYKA 3SDBA 1TLTA 5A2GA 3UOAB 2NO5A 1JLSA 2WDZA 1PT8A 1XQWA 3HCPA 3R6WA 4UCQA 1TJ3A 5C8ZA 4B8WA 4EJ0A 2JAHA 4JUCA 4XDHA 5F9MA 4CN9A 5KOJB 1NTOA 1Y80A 2WM8A 1ONSA 2V0NA 3PE3A 4MWOA 1DIHA 2NSYA 4XH9B 1JALA 3B53X 5NULA 2IDJA 3W7AA 2Z9DA 2IV3A 5EMJA 1U1FA 1C1HA 1KZ6A 3QVUA 5ES3A 5F2OA 1FXWA 2AOUB 1D1SA 4EBBA 3O91A 4YONB 2OQIA 3CSSA 1MABB 2ZYWX 1Y1SA 1PJZA 3CZ4A 4O0MA 4ROTA 1MMFB 2OO7A 2AI1A 1PUIA 4RWZA 5EJIA 4P82A 3VHQA 3PT9A 3F4BA 3ZY3A 1IFXA 4RU1A 1UPAA 1IBSA 1W52X 1BDJA 3LQKA 5EQTA 3VZSA 1SK9A 3VSAA 4NENA 5EP2A 1CY8A 4L4RA 5EUCA