4MWSA

Crystal structure of human ppca (trigonal crystal form 1)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Lysosomal protective protein
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwsA00
1TKRA 3UMJA 3FNBA 1LPSA 3DCNA 1E8NA 2RGUA 3H2GA 4U2DA 4ARBA 3C45A 4KAAA 5K3AA 1WPRA 2HM7A 4AQDA 4CCYB 1QGED 1VJ5A 1SFRA 2HRRA 5CURA 3WIBA 2DR0A 5ALWA 4QDOA 3IUMA 4XX1A 1LZLA 1XZKA 4EUSA 2WUGA 2WFZA 1W52X 5CBKA 3OOSA 1ISPA 1G66A 1F0NA 3LIPA 5ALFA 2P8SA 4Y2PA 5F4ZA 3BJMA 3WK8A 4EHBA 5A7HA 3WWOA 3BIWA 3QZUA 4FLMA 2BAGA 1EINA 3BL8A 1CUAA 3C6XA 5JD6A 4PSUA 4H18A 4UHHA 3QH4A 1XZGA 3WK9A 4HTAA 4B0OA 3ED1A 4C6HA 1NU8A 5JASA 5AP9A 3I2JA 3G02A 3PF9A 3ZLTA 3A6ZA 5AKHA 1EX9A 5HQ3B 5AKIA 2OAEA 1AC5A 3BJRA 2YASA 1BEZA 1Y7HA 5ALSA 1EI9A 4FFWA 3WJ2A 4UBNA 3G0CA 3D2AA 5DJ5A 2HU7A 5FPQA 4CG3A 2HU8A 1OILA 3WWCA 5JD5A 4C4XA 2C5GA 3K2IA 2B61A 2O7RA 1EB9A 5FLKA 1XRRA 3D5EA 1CIJA 5LZ2A 5JD4A 4ARAA 1G5FA 1XQXA 4QLAA 2EDAA 2XMSA 2FJPA 2O2HA 3DJYA 4GI1A 1T2NA 4I3FA 1UKCA 2QRUA 3E3AA 1RYYA 4J0DA 2J4CA 5JYCA 3GELA 1YSCA 4CIBA 2HADA 2CKMA 2WU4A 2HA3A 2H1IA 1ACLA 1XRPA 2C58A 1E8DA 3D2BA 4DMKA 4CG1A 1LNSA 5FXMA 4AX4A 1WHSA 2HFJA 2QR5A 1UOQA 3KD2A 3DOHA 1K4YA 3T4UA 3UUFA 1YB6A 1CUWA 1MT3A 2B4KA 2ECFA 3FWHA 1G4HA 3HYSA 1Q0RA 2VEOA 4C4ZA 4JYPA 1QIDA 3JWEA 4FBLA 2D0DA 1ZI9A 4BZZA 4B80A 3DNMA 3WL6A 4DMHA 2WIDA 1TCBA 3GA7A 1ODTC 5ALIA 3V1MA 2OCIA 3S2ZA 2ZYSA 2OCLA 1CR6A 3STVA 2QXUA 1J1IA 3LP5A 4PSCA 3MUNA 4G5XA 2J3DA 4OD0A 4Q34A 4X95A 1TCCA 4FWBA 1MX5A 1QIEA 2WTNA 2G63A 2O2IA 2VJDA 5LZ9A 3B3QA 1K63A 3O9MA 2OCGA 2GBCA 3C8DA 3STUA 5ALRA 4NZZA 2HA7A 1U65A 4ZV9A 5JZ9A 3D3NA 3KOOA 4NVRA 1DT5A 2VAVA 5AOCA 1EB8A 2ZJFA 4KR0A 3GFFA 1ZD3A 4RNCA 1EA5A 2XUJA 5LZ7A 5LIPA 3W9BA 1W1IA 5AOBA 2WU3A 4OB8A 2WHPA 1N1MA 4X6UA 3FSGD 3D2CA 1XRLA 5C8XA 2ACKA 3FSGA 4UBOA 4U2FA 5ALHA 1JT2A 3WMRA 5A2GA 3C5WP 3WA6A 2XQJA 3CCBA 3JYHA 1ODSA 1DWQA 5E4TA 5EHQA 3QMWA 2PSJA 3G8YA 5CRIA 2QT9A 2XMBA 4XIIA 1VZ3A 1CUSA 4H7IA 3IVMA 3R3VA 1JMKC 4J0CA 1Z68A 2JEZA 2ORYA 1QTRA 1F8UA 3V48A 3ICWA 4WFKA 3KXPA 4DYHA 2HRQA 2XE4A 3Q8WA 3W04A 4MQLA 2CJPA 1IUOA 4AMYA 3YASA 2Z8ZA 5EIEA 1S8OA 2I78A 2QUBA 4X91A 1YA4A 4IQ4A 3ICVA 1UOPA 4DTCA 2YXPX 4Y2XA 3S8YA 4C4YA 3A2LA 1E3QA 4W1RA 1XQYA 4KE9A 4QDZA 4H77A 4Y2TA 1MNQA 1J07A 1ZIYA 4CFSA 3CXUA 3MUOA 5C81A 1JU4A 3EQ9A 3C87A 5D6OA 3QPAA 2WFLB 3O4JA 1K6EA 3ESAA 1UKBA 1M33A 4HZGA 3D59A 2ZYHA 1DQYA 3SX4A 1VE6A 4S0XA 4B83A 2I03A 1XRMA 3DLTA 5E4JA 2HA0A 5AK4A 1AUOA 1XZFA 4EB0A 4GDMA 1XQWA 4BVLA 5ALDA 4X97A 2WIFA 3W9UA 4KJXA 1FFCA 1UWCA 2VJAA 4JYMA 1BCSA 5ALNA 1VZ2A 2AJLI 4DNPA 1QO7A 4G4GA 5IVKA 1JKMA 5AI5A 3FYUB 4OUKX 2OCKA 1XLVA 4FKBA 1ZD4A 3L1HA 4XWGA 3D0KA 2JGFA 4EY8A 3O9VA 1SCQA 1XKLA 2X76A 3ANTA 2DHCA 3SK0A 3AZOA 4Z49A 4NMWA 3B5EA 2V9ZA 1EK2A 4BCBA 1CFJA 2Y6VA 1FFAA 5FKJA 3O4HA 1DWOA 5I8PA 2PX6A 2HA5A 3HABA 4QE3A 4DM7A 3QPDA 1R4ZA 3WJ1A 4OYYA 1K5PA 4X7BA 5DNVA 1P0IA 1R50A 1Y37A 2WLSA 1XZHA 2RHWA 5ALQA 4X90A 1PJAA 2VTVA 4PW0A 5HKBA 1VA5A 2YH2A 1UOOA 1XQVA 3IDAA 2D5LA 1NX9A 5HF6A 2OQVA 1GZ7A 5LLSA 5C8VA 1XZBA 4HAIA 3I2GA 3ZLVA 1EXWA 1YCDA 2ACEA 4X92A 5CT8A 4QWMA 5DYTA 4GHWA 4X93A 3IUNA 4HXEB 1CUVA 1DQZA 2HA2A 3F8SA 1D07A 5LZ5A 3MGAA 1EDBA 1FFDA 4KAFA 3OTQA 4MEBA 1QIKA 4N8EA 2BCEA 4OYLA 3RK4A 1JJIA 3FVTA 3ESDA 2V97A 2AXEA 2WIGA 1MNAA 2XUIA 3FBWA 1ZI8A 3PI6A 2Z3WA 2QXTA 3M3DA 3UUEA 2WIKA 3C6YA 3RLIA 4MJ3A 5AOAA 1LPNA 2FUKA 4U2GA 4CIAA 1HL7A 3H04A 1MTZA 5FOQA 3H19A 1PV1A 5FV4A 4B82A 1IUNA 2W22A 3I1YA 2PUJA 5AM0A 5HF9A 5EI5A 4J03A 4A23A 3AUKA 4B85A 4H7FA 3STXA 2OGSA 1A8UA 1CLEA 3I2IA 4UBMA 4LIPD 1EH5A 4MWTA 3QITA 5ALYA 1QIIA 4WY8A 1P0PA 5K3FB 1OXMA 3WKDA 5IKXA 3AINA 1IVYA 1XFDA 3IURA 1GT6A 3F98A 3H1AA 4FLFA 5ALXA 1B41A 5AKLA 3HC7A 3PFCA 1O6FA 5AM1A 1WPXA 4IO0A 3KWFA 4N8DA 3VISA 1N5MA 1AGYA 3G9TA 2AJ8A 5KWIA 4QNNA 1MPXA 2ZJ6A 5JAOA 2BJHA 4YK7A 4QLOA 4MWSA 5HCUA 5LKAA 3WK6A 5JATA 2WKWA 3L1IA 4YX9A 2Y2VA 2WFLA 4GBGA 1AKNA 3OURA 3WA7A 3OM8A 4ZREA 1DTEA 2ZVDA 4P9NA 4U2BA 1FFBA 1LBTA 1CVLA 1ACJA 4J0GA 4Q3KA 4PO3X 4PQEA 2W6CX 1ZD2P 2XUGA 3EF3A 1LZKA 2JGIA 3BDIA 5AI6A 3FLBA 5AKJA 3ANSA 1H23A 5CH3A 3PDCA 6YASA 2XUAA 5K3FA 4DIUA 3H2IA 1I6WA 4BBZA 4YASA 4G1FA 1FSSA 4DMCA 4UHBA 1ZJ4A 1J06A 4RE6A 3AZQA 4Q3OA 3I2FA 1A8QA 2C0QA 2WSLA 4AMZA 2CUTA 2Z5GA 5DYWA 5C8ZA 1VXRA 5FP0A 3IA2A 4BATA 3BE8A 1R1DA 2ONCA 2J3QA 1X2BA 4KE7A 4B81A 4ZI5A 4UHDA 2H7CA 3G7NA 5AIAA 4ZXFA 1XZCA 3ZI7A 1UK8A 3I6ZA 1QIJA 4FOLA 4KEAA 2DQYA 3A2NA 2PSHA 1R3DA 3G9XA 1IUPA 3BDVA 1QIGA 1QLWA 1SOMA 5ALUA 3QBJA 4WFIA 3VVLA 5HZGA 3KSRA 5JZBA 4AO7A 4QEKA 5A6VA 5AKZA 1HKHA 4C01A 1LPMA 3D7RA 4WCVA 1QIMA 4B6GA 1DU4A 2B9VA 4A16A 2VT6A 4QWWA 2WQZA 1SC9A 3BIXA 4UBKA 1KU6A 4PV7A 3P2MA 2C7BA 2WG0A 2WUDA 3D4LA 3F96A 5FPPA 1CQWA 3QMMA 4LHEA 4AXBA 1FFEA 5HFNA 1THGA 2DSNA 5IVDA 2OGZA 4OU5A 1JU3A 4YPVA 2RAUA 2QTBA 4A5SA 4X94A 2PBLA 4OSEA 5JAUA 1TRHA 1L7QA 2XUFA 4K6KA 2PUHA 5AI8A 3BF8A 3O4GA 4X6XA 3STWA 4UFPA 1YAJA 4KYVA 5AJHA 4BP8A 1L7AA 1GKLA 5A71A 3M81A 4G8CA 2WJ4A 2YYSA 3WL5A 3F9CA 1KEZA 4X6YA 1Q0ZA 3C43A 3I1IA 3V1KA 1MX9A 4QDUA 4LYEA 5LYYA 2B20A 4BAUA 1CPYA 4AZ3A 5JZSA 5ALJA 5ALPA 2RONA 3MVEA 4L72A 5A7GA 3STYA 4EA6A 4AO8A 4ZV7A 5DNWA 2Z3ZA 3O0DA 2GZRA 2GYVA 2GZSA 4TVKA 2UZ0A 1C7JA 2DHDA 4AN0A 2WJ6A 1CEXA 2HIHA 4QZVA 5ALMA 2XQKA 1GKKA 1XZLA 5BV7A 3HZOA 1EDEA 1QTIA 3FYUC 3V9AA 5ALTA 1CV2A 1N5RA 4H7KA 4BCCA 2PSFA 3IB3A 4BP9A 3IUJA 2OG1A 3H2JA 1CUYA 3H18A 5ALEA 1ZD5A 1QJ4A 3M82A 1BROA 3EQ7A 4X3CA 3H2HA 2QOEA 4UHEA 1DX6A 4WDRA 1CQZA 4WJLA 4X85A 1DX4A 1H22A 4W1PA 3FAKA 3NGMA 5JAPA 4ETWA 5CXXA 3FLEA 3W05A 2XMZA 5FRDA 1ZGCA 2OLEA 3CN7A 1ORVA 3HSSA 4AZ0A 2PU7A 5AM4A 2VT7A 1BCRA 1XZDA 3U0VA 3GZJA 4HXFB 1R9NA 4J0KA 4B84A 4Q82A 4GW3A 3WL7A 4IH4A 3ZPXA 2C4HA 3FCXA 5D3ZA 4OB7A 1DT3A 3PE6A 1CUIA 3SC2A 4MEAA 4EY6A 4U2CA 1BN7A 4L0CA 1ZOIA 4G4IA 3VDXA 3WKAA 1X70A 5ALGA 5AK5A 3ESCA 3FYUA 4E11A 4Y9SA 5JALA 1UK7A 5JADA 1UZAA 1GPKA 5FUMA 4Q1VA 4X00A 1E66A 4QDTA 3AIOA 4E15A 2BFNA 4OCZA 3HXKA 2PPLA 2Q0XA 4G9GA 3IULA 2PKYX 4Y2RA 3RM3A 2JGJA 3I6MA 3AJAA 3N0TA 4TGLA 4QDXA 4LXGA 3WQHA 1EVQA 3DYVA 3NUZA 1XRNA 1ZGBA 1G42A 3C6ZA 1GQRA 3K9BA 1WCYA 5DTIA 3U1TA 2I3DA 1A7UA 5KWJA 1C7IA 4ZRDA 4BCDA 3DYIA 3G0GA 3GROA 4DNFA 4BC1A 1XZEA 2WG2A 5A62A 4M0EA 2WFMA 5D7BA 1MO2A 2CBGA 5K3BA 1LPAB 2QUAA 4EY5A 3M83A 1ZICA 2VF2A 4TPKA 4ROTA 2QJRA 2XUOA 4B9EA 4K6GA 1GPNA 2CEKA 2G5PA 1WB4A 5E4YA 3LIIA 4N5IX 1BRTA 3G9UA 1U8EA 3ZV7A 2O7VA 2IX9A 4UHFA 3KDAA 4QA9A 3WK4A 2H9YA 4EY7A 5BWCA 3C5VA 4F60A 2XUQA 3G9ZA 4KE6A 4FBMA 3O4IA 2XUDA 3LS2A 4Y2UA 4E14A 5AKKA 3VKFA 5EHZA 3CN9A 4FHZA 4UBJA 2HU5A 2BUBA 3ILSA 1TAHA 4N5HX 2PSDA 4JH0A 1VE7A 5CW2A 1QO9A 2JEYA 5HKAA 2ZYRA 1USWA 3NOXA 2OPHA 2QMQA 1GQSA 4JEIA 3QMVA 2VA9A 4BDSA 5CH5A 3WIOA 3QPCA 5JARA 1U2EA 2ZSHA 4ZGBA 1E8MA 4KACA 4AB1A 1AX9A 3WWEA 1VLQA 1W76A 2XMCA 2XMQA 4XJVA 1WOMA 2GBFA 5AI9A 3I6YA 1IZ8A 1CUEA 3FLAA 2XQFA 4WFJA 2XMDA 2R11A 4NS4A 2ZJ7A 3V1NA 1UFOA 5ALOA 1TIBA 4OB6A 4E46A 1F0PA 2DQZA 2RHTA 2WHQA 1CUBA 4WY5A 4G8DA 3BF7A 1CUXA 3TRDA 2IITA 3F67A 2BUAA 2WJ3A 3HRHA 1Q84A 3PUHA 3STTA 4PSDA 4BVKA 3WKBA 1B6GA 4ZWNA 3PUIA 3G0BA 3BWXA 5AM3A 2BKLA 4FNGA 5JAHA 1YR2A 4MXDA 1KU0A 1BS9A 4H7HA 2JGKA 5YASA 2XI4A 3GBSA 2JIDA 3K6KA 3WWDA 2XMRA 4J7AA 4V2IA 4DNQA 1PFQA 2HFKA 1T4MA 4FLEA 3WLAA 4JUIA 5HF5A 2C0PA 4Q05A 4KAJA 4GEGA 3NWOA 1MAHA 4P93A 1UK6A 1W75A 3IBTA 1SCIA 3WL8A 5AHXA 2QVBA 2GBIA 1X2EA 4BYMA 2WTMA 3N2ZB 4F5ZA 3HLKA 3R3WA 1AURA 2JGLA 3QYJA 1LPOA 2WG1A 3I2KA 1UKAA 5CT5A 3WKCA 4BAZA 2ES4A 4G8BA 5A7FA 5FDFA 2V96A 1H2XA 5CH8A 3HJUA 4AN1A 3PF8A 3WI7A 3AIMA 2JGEA 2LIPA 1MJ5A 3VJLA 2VSQA 2NW6A 4BRZA 1FJ2A 4J3JA 5LZ8A 2C5FA 3WK5A 3R41A 1WB5A 3KWJA 4CCWA 4DNOA 4HS9A 4CI9A 2O2GA 1CRLA 1AZWA 2QKYA 5HK9A 2VJCA 1O6GA 4IH9A 3E4DA 3H1BA 4P08A 2GBGA 4C87A 1OCEA 3G0IA 3HEAA 2OQIA 1XZAA 3CCCA 4HVTA 1ZIXA 1P0QA 3WYNA 2WUFA 1QE3A 3QVMA 1ORWA 3R0VA 4B0PA 1JMYA 2XQGA 4OU4A 1L7RA 4K6HA 1XLWA 4W1QA 1RWQA 2AJBA 2BGRA 3AFIA 1W6RA 3E0XA 1EDDA 2CZQA 5T4EA 2BUCA 4BVJA 4DMFA 5AKXA 1MN6A 1CUHA 1YAHA 4EY4A 5BOVA 5AKYA 3DS8A 3TJMA 2XUKA 2XT0A 5I9IA 5AO9A 3LLCA 2ZSIA 1N8SA 1WB6A 4PNZA 1BE0A 3TGLA 2OGTA 1Y7IA 2VJBA 1ODCA 5J3JA 5AK3A 2ROQA 5EGNA 1UK9A 4PF1A 2J4FA 3R3ZA 2OAGA 3DL7A 2PM8A 2DHEA 1XZMA 4ITVA 4X71A 4GLBA 4BAGA 1R9MA 2Z8XA 1SCKA 5E2IA 2EEPA 1QIFA 3R3UA 4HRXA 5LKRA 4JNCA 1YA8A 1XZIA 2JBWA 4BTLA 3I28A 4G9EA 3FCYA 5IVIA 3DL4A 5T4BA 4BE4A 1NU6A 2QZPA 4FFVA 5CT4A 4CG2A 4H0CA 4DLNA 4EZIA 3GUUA 2WUEA 4UHCA 2VATA 4LKOA 1EHYA 1QFMA 1K8QA 3C70A 1J2EA 2JGMA 3VXKA 4MQMA 1E5TA 1CUCA 1F6WA 4DGQA 1YASA 5D3KA 3IUQA 7YASA 4BZWA 2XLBA 5JANA 1H2WA 4C88A 1WHTA 5CT9A 5ESRA 1VOTA 4B7ZA 2XLCA 4KRYA 2XUHA 2VQ6A 3SWWA 5AH0A 1GXSA 4M0MA 5DTJA 4LXIA 5AIBA 1QOZA 5DLPA 2WHRA 4FDMA 1BU8A 4J0IA 1QZ3A 2OXEA 3DQZA 5CMLA 4UBIA 3OG9A 4L9AA 3EQ8A 5K5EA 3EIOA 1CUDA 4HRYA 3RARA 3O95A 5KBYA 5JIBA 2DFPA 2AJCA 1IMJA 1WM1A 3VJMA 4BC0A 4N8SA 4H7DA 4J0HA 2JF0A 3B12A 2RIPA 5K3EA 3AILA 1XRQA 3WZLA 2AJDA 3DKRA 3HACA 1H2ZA 3PFBA 4XVCA 2XMGA 3FYTA 4BDTA 5SYMA 5SYNA 1LPPA 1RP1A 2X5XA 4WDQA 2H7XA 3G0DA 2GYUA 5CTAA 5IH7A 1YS2X 1VA4A 3R3XA 4Y2VA 2WM2A 1W4LA 3ZWQA 3BXPA 3DEAA 3A70A 4IH1A 1CUJA 1LLFA 3H2KA 4G4JA 4GXNA 2HL6A 3I2HA 2XB6A 2CMFA 1QFSA 1VKHA 4RGYA 1P0MA 4HXGA 3VJKA 3WZMA 4UFNA 5DYYA 5HFAA 4BB0A 5ALLA 1CUFA 1MAAA 1TK3A 4IHAA 2XQIA 4CCYA 3DKKA 1HBJA 2HDWA 1E89A 2RI6A 5EHNA 5ALKA 1GGVA 1LBSA 3WKEA 5KREA 2WILA 5CT6A 1TQHA 4UBLA 1HLGA 4K5QA 3AZPA 1TCAA 4Y2YA 2WHPB 3JW8A 5AM2A 2VAXA 3R40A 2Y2UA 4OPMA 5DNUA 1EK1A 3H17A 1YB7A 4P92A 4W1SA 4MYSA 4GECA 2E3JA 2HA4A 5ALVA 1AMNA 3PICA 3QM1A 3WYDA 4UUQA 2FJ0A 3EBLA 5HQ3A 3R3YA 4LXHA 3RKSA 2QS9A 2ZYIA 3VVMA 3Q0TA 4KE8A 4FMPA 5H3HA 3AIKA 4BRSA 2WIJA 2CB9A 3FVRA 3W06A 1GPLA 1AQLA 5AI4A 1Q83A 1A88A 4M0FA 3C8HA 3IIIA 1H2YA 4UPDA 1QONA 4B9AA 1JI3A 1THTA 5AKEA 4H7EA 1CUUA 2G4LA 4DSZA 4Y2SA 3HI4A 5HK8A 5ALZA 4W63A 4D9JA 1MX1A 3OC0A 5DWDA 4RPCA 2QJWA 4J0JA 2HHAA 2R8BA 2GYWA 4I4CA 4F0JA 4FTWA 3W2TA 1BN6A 2V98A 1LPBB 5CXUA 3L1JA 4EBBA 2IIVA 1HQDA 5EIHA 5AK6A 3F97A 1XKTA 5AKGA 3T52A 4KRXA 1HDEA 2X8BA 3E1GA 2BGNA 4W9RA 3DD5A 2QM0A 3FOBA 1A8SA 3LCRA 5EIAA 4GWLA 4AO6A 2DCMA 5C7YA 1HPLA 5K3CA 1LGYA 5IVHA 1CUZA 4DSAA 5AM5A 1ZI6A 3DOIA 1JJFA 4C89A 4Y7DA 4F21A 2H7YA 1XLUA 3TEJA 5T4FA 3C6BA 1C4XA 5T4HA 5AICA 4UFOA 3H0CA 4INZA 2Y6UA 1CUGA 3ESBA 1R88A 2FX5A 1YS1X 3A2MA 1U4NA 4L3WA 1UT6A 1DINA 1XROA 1JFRA 4K2AA 2XUPA 1MU0A 3V1LA 4MYDA 2PSEA 5ISMA 4H7JA 5LZ4A 4I19A 2PL5A 1IZ7A 5AI0A 2PU5A 3ZLUA 4LYDA 1JJBA 4FNMA 2HA6A 3WWPA 2Y1KA 4BTVA 4Y2QA 3DDUA 1ETHA 4H35A 5I7UA 2G5TA 5EHXA 1VXOA 3X3HA 1XZJA 1EVEA 1ZJ5A 1DWPA 4RE5A 2PVSA 4BE9A 2EDCA 4U2EA 2XDWA 2I3ZA 1QIHA 5EFZA 5BWBA 1UXOA 5K3DA 2K2QB 1BEEA 3OPMA 5LP1A 4Q3LA 4Y2JA 4O08A 3WK7A 5HF8A
chains in the Genus database with same CATH superfamily
4AJOA 3UV3A 1ULUA 2I22A 2NU7B 4OGLA 5LA6B 1XCLA 4C14A 5HW0A 4YNBA 3DCNA 3EAQA 2X3UA 3H2GA 3ORYA 3NJ4A 3TLJA 4E5YA 1QZTA 2C83A 3U3OA 4AY3A 1L6IA 1IHPA 2GKOA 3K16A 3Q72A 4YGYA 5K3AA 3W5VA 2FG5A 4QHTA 3VMFA 1RLIA 4RZ2A 2Q3MA 1QG6A 5ELLA 1P33A 2WMYA 1VJ5A 5F9FA 2HRRA 1Z08A 5CURA 1NVVR 1Y6ZA 1YB2A 2A7XA 1XDSA 4GR5A 4LV5B 5GINE 1L8AA 2ILVA 1J8VA 4RANA 4QDOA 4BNIA 3E58A 1IQRA 5FH9A 4CPDA 4Y6LA 2XDQB 3OQMA 6LDHA 2AV6A 2WSSA 1V3TA 3A05A 3RSGA 4DAOA 4MI3A 3FGZA 1LZLA 2FWAA 5EWMB 4L9RA 3V97A 4DA6A 1W4BA 4DHEA 1E5VA 1SZJG 1W52X 4GQAA 3BRWA 1X86B 2VYCA 2QN6A 4L8GA 4YRTA 3THXA 3VH3A 3AIIA 2H2FA 4EG5A 4S05A 2HNBA 1UAGA 2VAPA 3LIPA 2AX3A 4OMUA 1N9GA 1U81A 4KPGA 5ALFA 5F4ZA 4CBVA 5C4MA 3QXJA 3EB9A 3B9BA 4HLUC 2DB3A 4HY3A 1GZ5A 1YT5A 2MMCA 4N3BA 4QYIB 3KLNA 3DULA 5T41A 4EHBA 5IUJC 2GVDC 1CXZA 4LRWA 3T7TA 1XF9A 5IAJA 1VKJA 1DAFA 4ZODA 3SF8A 1CQIB 2OBFA 4D3FA 3W3AH 1B42A 2F2TA 2QRLA 3PX2A 3EC2A 4LGMA 3VPHA 1E1CB 1EFCA 3QZUA 2WYUA 4URYR 4EZBA 4F3YA 3N6XA 2GA8A 2ZREA 3EWAA 4FLMA 4AZSA 4KC0A 1AKEA 1Y6JA 2BAGA 4LN1A 1Z2OX 5EE1A 2FHSA 4ZOQI 5FWNA 4B71A 2P3LA 1W35A 3DBRB 4MDYA 4RD2A 3VKVA 4COOA 3EEFA 4PSUA 4R3UC 3MWDA 4JASB 4XA8A 1HG1A 5G41A 5J4KA 2Q6TA 2CLKB 1QORA 4M22A 3T0FA 1XZGA 1P81A 2DPGA 3L3BA 1K66A 2XOKA 2ASVA 1FBNA 1AG9A 2AB0A 2C2WA 2HWXA 5FADA 1JDSA 1NU8A 3DTVB 2NX2A 2OFPA 5AP9A 1JW9B 3IJPA 3KZKA 2Z57A 3I2JA 4CTMA 3G02A 4AJJA 4OGGA 3JQGB 4QUGA 3L7LA 2GB4A 5TGZA 2M6KA 4QGHA 1M6WA 2JFWA 3QTBA 5F7ZA 1KARA 2DKFA 5U4QA 2R96A 3LMKA 3TPFA 1FTNA 4R68A 2OAEA 1HC7A 2VWGA 3SVTA 1MVOA 2BFMA 4DLPA 4UVHA 3T12A 8LDHA 2YASA 3GRYA 1FZQA 1GGKA 3BHMA 2P8JA 2V7QA 1SQ0A 4MVWA 5ALSA 3W7VA 1GG2A 1T6NA 3KEQA 1KBZA 4UBNA 5DCLA 4ZA2A 3AUJB 1G9TA 3MF4A 1BRMA 3NHJA 4BN0A 3RC8A 5ECGC 3ITNA 1Q7GA 4IYJA 4LC9A 1KJWA 4QQKA 4A6XA 3JQAD 5EJGA 2HU7A 3RD5A 4R1PA 1OILA 1W0CA 1RRFA 4LUCA 4KUHA 1GL9B 4JP3A 3WFJA 5JD5A 3JARB 2R1VA 4LBYA 5D5PA 5BSUA 3W1EA 1YCFA 1Z06A 4I1UA 1CF4A 4ITRC 1FRVA 2EKLA 3HL4A 4JU8A 2Z2JA 3N5CA 4Q4AB 4QYIA 3PDHA 2C5GA 3K2IA 5JZOA 2C5AA 2O7RA 5AJYA 1I80A 3VH1A 1EB9A 1YQQA 5FLKA 2XVMA 3KXKA 3FPEA 2FEPA 4QULA 1GDTA 1XRRA 1L5NA 3UWMA 2B21A 3PTAA 4U0KA 1T5IA 4Y2HA 4ARAA 1JYEA 3DP7A 1PJ2A 5ETJA 1DX9A 1E6CA 1XQXA 1NQVA 1WUKS 4ZYZA 4CV2A 5TEVA 1XWIA 1EWKA 1MQSA 1F2TA 3WDLA 3UPTA 4E5DA 2IDKA 5LDGA 5DI3B 4J16A 3TQCA 1CQPA 2A0KA 2WU0A 1AF7A 1Q12A 1T10A 3N5KA 1JDUA 1Y9JA 1VLLA 3GELA 2RJOA 3D6AA 2QLFA 3F7TA 1YUBA 3W9YA 4QD3A 1PK8A 2BGIA 2IIQA 5CG1A 5BWOA 1K6XA 4HDMB 3TS1A 2CKMA 5HSGA 5MFZA 2YZ2A 2EFJA 1XTSA 2Q29A 2WU4A 4BLPA 3B89A 3TTXA 1ACLA 3DL2A 1EUQA 1ZMRA 2HV9A 1B6RA 2ZJ2A 3WNQA 1PAUA 3NRBA 3NT2A 3KDSE 4POOA 1G60A 4ZMRA 4RK0A 4M9QA 4I46A 1E7RA 1MCZA 5DYGA 1PG0A 1V47A 4CG1A 3OZ7A 1IOZA 1LNSA 2XD4A 2P6MA 1XSEA 1Z0JA 1WHTB 1WHSA 3DLAA 3KQKA 2QM3A 3QKSB 1QS0B 2XCOA 3ZQJA 3J7AC 3CLUD 5E7IA 2WTAA 3ACBA 3KD2A 3B3AA 1A9XA 3T4UA 3UUFA 4IVRA 3DPIA 3L7AA 2AX4A 3T06B 1JFFB 1WVGA 1MT3A 1X87A 1YR6A 2B4KA 2WHXA 4GM4A 4L2IA 3FWHA 1Y5NA 3UK7A 3IP1A 2RGAA 5DNEA 4RJTA 3KSBC 3U2QA 4D2IA 6REQB 1HMPA 3HYSA 2VEOA 3K15A 3F6RA 3Q10A 1FDOA 4XQCA 5FOWA 2CE7A 4HQNA 2CVFA 3ZXYA 5CLHA 5C7LO 1J22A 3E9CA 5KDOA 2ZWIA 1E0SA 3J7TA 2FFHA 4UM9B 5L7YA 2X86A 2ZB8A 2HK6A 3CX3A 3VPAA 4UCFA 4BZZA 3IYLW 4MWGA 5BR1A 1JR6A 1GU1A 2BZSA 3URKA 3ZDDA 1N2JA 3PGA1 3RG8A 4ZI2A 1XYGA 1P3JA 3HWRA 3LOQA 3DVAB 2WIDA 3O2JA 4CTJA 1ODTC 1L6RA 2PTHA 1Z88A 4W82A 2LVBA 1DKNA 2GM5A 4DDHA 5HZMA 3CPHA 1V8FA 3OD1A 5CLLA 4OF4A 5DI3A 2OCIA 2NU8A 3VC3A 2PKCA 4N01A 4E5VA 5BN4A 5FBKA 1J00A 3SYRA 4JB8A 3EG5A 5CFLA 4ZOAA 2Q3EA 3MUNA 4PSCA 5JU6A 2OK7A 3IDFA 4EJSA 4ZK6A 2YHAA 1EFAA 1BKSB 2ZRAA 5ER6A 1ZHFA 2AJTA 1LC3A 2QVZX 2AG8A 3C3AA 4Q34A 4TKVB 3FGOA 2FSVC 1GO2A 1MX5A 2QRVB 1CY1A 3P2JA 5BOSB 4J8PA 2R2GA 1RXWA 1NQTA 1C14A 1SCUA 1N7GA 3TMYA 2C94A 5NULA 4PE5B 2C92A 3B3QA 1J8FA 4OJNA 3RYIB 4WJKB 1ZRNA 4OL9A 3O9MA 3QENA 4MYCA 1X1CA 3C8DA 4G4SO 3STUA 2IZ0A 3ENVA 3PD1A 1M8PA 5IZCA 3TD6A 1JDVA 1CE8A 3NRJA 4D92A 1S02A 2DTXA 2WA2A 2YV3A 2FZLA 2JIRA 3L07A 1QP4A 2M32A 4R51A 4WZAE 3ZX5A 5H9WA 3QEKA 1DT5A 1L5ZA 4Y1EA 2IEYA 2I6TA 1G1AA 3L18A 4XGIA 4YPOA 5K0BA 3DZFA 2OLKA 3GFFA 4WN9A 3I0NA 1PSDA 2YN2A 2RKWA 1QVZA 4L9WA 4V0QA 1U9IC 1WSAA 1EP1B 4PN7A 5LD2B 4LX0A 3TRFA 2UUAB 4MMYB 2J5KA 1T0JB 4DANA 1SOWA 2ZJAA 3MCZA 2JAWA 5AWFC 3WV5A 1XQ1A 3DLHA 4KN5A 1RHRA 4YRDA 4X8MA 4X44A 3P2OA 1KPHA 1G8SA 1RRCA 1GTSA 1LI4A 3G7SA 4Q03A 2OCXA 1GADO 2VUSA 3OJEA 4HZUB 4AZTA 1MT0A 1N1MA 2JLBA 1GFWA 5BN3A 2GA9A 5IBRA 2Z04A 3FSGD 2B2NA 4HNUA 1XRLA 4J16C 4Z4GA 2UYQA 3ROZA 4UVDA 4YIKA 3SQWA 1EFPA 5CLIA 1GVNB 1JT2A 2Q5OA 4ZHSA 1KZYC 2PSSA 2XQJA 1PGOA 1RBZA 3QYAA 4NBNA 5D2CA 1ODSA 1Y5MA 1JLKA 1E64A 5DM1A 3WLHA 1U7XA 2PGNA 2O9JA 1MDFA 3IH5A 1A4UA 4NV3A 4DBLE 4AUEA 1DWQA 1OFUX 3HS3A 1SVKA 1T6XA 2HDNB 1AO3A 2G1PA 3HO1A 2XMBA 4XIIA 1VZ3A 1NI4A 3VZQA 3CNOA 5KI6A 3IVMA 5K6RA 1JMKC 1FF9A 3FMVA 3LRTA 2JEZA 1GUBA 1U2DA 3F8TA 3JZAA 1ZRMA 2D5CA 3VI3B 3C74A 3UVEA 4EF5A 1P2SA 1JHZA 2B35A 3V48A 4PICA 3ICWA 4V38A 1TZCA 2YWGA 3L6RA 2D1RA 2G77B 3OX4A 2O3RA 4KG7A 2LCQA 2HT1A 2H65A 4RLSA 2H92A 3K1AB 3KXPA 3SFTA 1L5SA 4G0WA 2P9CA 1RPJA 5P21A 2ZUBA 1DAMA 1Q3TA 3RS7A 1MAUA 3IV9A 3HZZA 3CURA 3L6UA 3BN3A 2Q4RA 4MQLA 2OHJA 2JLRA 1WX1A 3AEKA 3ZTYA 4AMYA 1RAIA 3K2EA 1W9MA 1XNGA 2YBDA 3B6IA 4IIXA 3SZLA 3WTBA 2R751 4LCJA 5AOVA 3KPVA 1S8OA 3TE7A 5ANRB 1ESEA 5FBVB 2W6IA 2GZMA 4IQ4A 1PR1A 2ZU0C 1MQ9A 4I1RA 3TR5A 1JAXA 3A0RB 1J0DA 1MIOB 2GFHA 2GSWA 1OI2A 4X1YB 1UM8A 5FR1A 3EXIB 5EJ4A 3I3OA 4C4YA 1E7QA 2GDZA 4U63A 3FPAA 1IM5A 1JUDA 1OVGA 4ND6A 4REQB 1OW3B 3K9GA 1FNBA 1WWKA 3L8YA 2DBYA 3RROA 2ZKIA 3KCQA 3LC1O 1MNQA 2OCAA 4PTZA 3R3SA 4QDZA 2JD0A 3PJRA 1ZIYA 2PMFA 1X1QA 1BC5A 2BEVA 3JR7A 1DLJA 3Q5DA 3H7IA 4ABYA 3QK7A 2VP3A 3MUOA 2ZSDA 3AP3A 4Y6GB 4YRPA 2AWOA 2HBYA 1BGXT 2HLHA 2K87A 2X4DA 3OZFA 4QGBA 1JU4A 4P7GA 1A27A 4LC1A 4KXYA 2FCRA 3QPAA 5JS2A 3BT7A 4RVHA 3O03A 2WFLB 3N05A 5FV7A 4JA2A 4I3HA 4WUVA 3CRW1 1IM8A 2FSPA 2BBWA 1XEWX 1OFGA 2G09A 4PGFA 5CFQA 1UBFA 5ICSA 5A0VA 2OZLB 5EPEA 2V5UA 1R15A 4GYWA 1XQ9A 2BL4A 4RIGA 3NO4A 4D8XA 3KR1A 1VE6A 4H4CA 3K0CA 5F51A 3S81A 4OA5A 3ZGVA 2GTHA 2CVZA 4K3VA 3DLTA 1Q0LA 1Z37A 2HA0A 3LT0A 4RHEA 3VU0A 1Q1BA 5GWXA 3NHKA 3W2FA 3WRXC 2JFUA 4WL0A 4XD2A 3V2HA 4GDMA 4QGGA 1XQWA 1CE8B 1U3GA 3NTUA 3W6ZA 4BVLA 2FN4A 4CTOA 3W9UA 3OFJA 4PANA 2IY9A 2FW9A 2WW8A 3GDHA 1D0IA 4GC9A 1RCTE 1JDBC 2RGEA 3AVQA 3LSYA 4EKEA 1J7KA 1XU7A 4JYMA 4YDSA 3VNQA 1Z5ZA 4DNPA 4ZYUA 3A36A 1RI1A 3ZVRA 4BNGA 2VDNB 5CW1A 3WLTA 1OLSB 2H16A 3MSCA 1Z6AA 3DZKA 4G4GA 3TPCA 4HI0E 3RV3A 4XB1A 3SHOA 4DQDA 4E5NA 2FDXA 5DHAA 4BQNA 1NSTA 2GM9A 4HAXA 3UHJA 1H42A 1LTHR 2DUJA 3MJVA 1NVWQ 3NWPA 3O74A 1Z6QA 1YMQA 2GFQA 3U17A 4BNXA 3G88A 4OUKX 4I1SA 4XZ3A 4LOIA 4EAQA 4KBFA 2D54A 3QELA 3KFLA 4DARA 1V8PA 2ZRBA 3KOYA 1JVSA 4R2XA 3B53X 4IJ5A 1ZR4A 1UOEA 1D8AA 2R6GA 2B1RA 4HDRB 3JD0A 5B7PA 4GXRA 4BGVA 3RRXA 3GCGA 3IBCA 721PA 3WS7A 2VDWA 3O9VA 1XKLA 2X76A 2I7DA 2XCQA 3ANTA 2ZBDA 2DHCA 4M7RA 3TOSA 5IJ9A 1FL9A 4IDEA 3BQMB 1XZPA 1XTBA 3GT7A 4ZD6A 3IP3A 2O8CB 2QRVA 1C50A 2X1MA 4NMWA 4R98A 1L3CA 2GBLA 2SICE 5HF8A 1R8XA 2QRHA 3KKQA 5TJHA 3FCUB 3SS8A 2B6NA 4FCCA 4DXHA 2K5UA 4PBTA 5B1IA 4F3CA 4KZKA 1TF5A 4C03A 4G36A 3PD0A 3O4HA 3WBJA 4M9ZA 3TKYA 3HR7A 4DB2A 1F9EA 2HA5A 4MGKR 1XUOA 1NXPA 3CT6A 3REFA 1JQEA 1JYSA 1EUCB 4UATA 3WJ1A 4AVYA 5AVXA 1MOSA 4LF4B 3L8FA 3DZDA 1NG1A 1IYZA 2RGNC 5TPZA 4AJLA 4TYYA 1J1ZA 4UXIA 1NSFA 3O38A 2NZ2A 2BF7A 2WLSA 3D7LA 3V2UA 3DO8A 3GUHA 4NEQA 3BFKA 4V0MA 3DQQA 4M54A 1N0IA 1JJ7A 4EJ2A 2WA1A 1XEXB 1J5EB 2VTVA 5HKBA 1VA5A 2OKCA 3KXLA 4EL0A 2YH2A 1XPJA 1R12A 3KQVA 2F8TA 1HY3A 1TAGA 1TW2A 2QP9X 3DC2A 3MOIA 3U7EB 4ROSA 4ZVVA 4CMCA 2QBYB 1RR6A 1JYFA 3GNTA 4HAIA 5JH7A 3ZLVA 4B2PA 2GGSA 4F2DA 2Q4BA 1EXWA 3CWQA 3L8ZA 4V1CA 2JD1A 3NVMB 1F06A 2QSJA 2ACEA 3T5MA 3WLNA 1CT9A 4D9KA 2WMOB 4HVCA 4YAIA 1VL1A 2W11A 4MPRA 5CT8A 2GUGA 1NI3A 1PL8A 4QWMA 2O2ZA 3FWYA 3O0TA 4J1NA 4P0TA 1F6BA 3BMOB 4X93A 2V0GA 4O2RA 2O5EA 2E4ZA 2O52A 4F1KA 3IUNA 5BT9A 4HXEB 3WHLA 1ENPA 1SWWA 1V9CA 4J07A 4UC0A 1C30B 4EWLA 2ZE8A 4ZAWA 3FH0A 2P6UA 2IYPA 1E3MA 3EC7A 3GLVA 4QYXA 2OHFA 5H4HA 4Y1FA 3TRHA 3ZE0B 4F4UA 1V16B 3QLJA 2P5YA 2YWXA 2DGDA 2A5LA 4C4TA 2HKIA 4KSYA 4JHXA 1FP1D 3ORRA 4NJEB 4F97A 3AM1A 2AEFA 3OH8A 5ESXA 2D8MA 1VPEA 3HSYA 5FOXA 3GRRA 4R0MA 1A98A 4LQLA 4MS3A 1GQYA 4MR7A 2XNDA 4O5OA 3E1KA 1Q20A 4G07A 1ZNYA 2OMKA 4N8EA 1T1SA 1NI5A 2C7GA 3ASVA 4JGGA 3T7RA 3I01A 4Q9IA 5CFRA 4UNPA 2LV8A 2VN8A 1IBLB 3EXHB 2FR8A 2PPVA 2XZOA 4QU9A 4G6ZA 4PR0A 1CKEA 3RK4A 3CF6R 1VIDA 3A9TA 4RV4A 3FVTA 5DM70 1FMTA 4TLDA 3QBEA 1L4MA 4GI7A 2C2OA 2EP7A 4EO4A 1XPUA 4A6PA 2B92A 2WIGA 4ZJZA 3S2UA 3L0BA 3GRVA 4B6EA 5JUWA 1ENZA 4NNOA 3H42B 1J7JA 1ZI8A 3HV2A 2ZSJA 3PI6A 1OU4A 3EZLA 3WNVA 2H3HA 1SBZA 3M3DA 3PNBA 3NH9A 2JAXA 3EZYA 3UUEA 1ILEA 3T5CA 5DTQA 2VK1A 2VUTA 3RLIA 2WKSA 2Y99A 3ICPA 3B8EA 4MJ3A 4UU1A 3NC1C 2FUKA 4KFCA 4MRPA 2A5JA 2E4YA 2OUIA 4BBAA 1S4QA 4M8SA 1QR6A 4IIEA 2C7PA 4BVEA 1NVUQ 4PNEA 2YQ5A 5C5DA 5FUWA 4BY9E 2NXJA 2BHNA 1X9IA 4DHWA 5T5QA 5FV4A 7GPBA 2ZWMA 3TXAA 1Q5PA 1VPVA 5HQJA 3CKLA 3G8AA 3MTDA 4C6SA 3LKZA 3N76A 1E2NA 3I1YA 3UK1A 4QAQA 1NE2A 5AM0A 4CGZA 4B44A 1M6VA 3L77A 2X8JA 4OQMA 1KMHB 4D02A 5FYQA 1K0UA 2JCSA 3ZUPA 4XWYA 5EKDA 4JL5A 3GRKA 1MW8X 1E7WA 1PEYA 2D4AA 4JR2A 4ACBA 5B7QA 4AJ2A 4G1MB 4OUDB 4YFVA 2IGTA 3GLTA 3QBTA 4E6PA 4GWKA 2NSHA 1EH5A 2PZGA 2PWAA 3EBOA 1QIIA 4TVSA 5HRUA 2ZM5A 3VNSA 1SBHA 4DUPA 2WWTA 2BI7A 2HMSA 2QX7A 3C1TA 3R3JA 3F71A 4KWHA 4B34A 1PZEA 1BW9A 2V1XA 4WY8A 3DHWC 3GPDG 3SGLA 5IH3A 3J81k 3ER8A 1Y1LA 5K3FB 3EOAI 3WKDA 2PQMA 2IPOA 2OV3A 1W36B 3AINA 3DT9A 1BXZA 4W6QA 1TYEB 3R1IA 4WA8A 2OKGA 4TXMA 5CIQA 3F98A 2JIZA 4DT1B 2FZ5A 4GP7A 4XX0B 1N7IA 5BMVF 1W5SA 3DOJA 2PRSA 3PFCA 4KREA 5I9LA 4UVGA 4Z8XA 2FFRA 1N3YA 5JFGA 3UK0A 5E8RA 3KUKA 2X8AA 3KWFA 1HTTA 4FOTA 1SUEA 4NBRA 3U37A 5CB8A 1N5MA 4PYNA 3G9TA 4J2OA 5DNCA 1I30A 4NU0A 1Z63A 3NS7A 1FTWA 2B4TO 1M8KA 1ZUIA 4M9SA 2QMZA 3GZNB 1N1DA 4WTOA 2X0JA 2FPGB 2BJHA 1W0JD 4UMVA 4QLOA 4ZU1X 2A0UA 1XEWY 2A88A 1WEHA 4GMDA 2OZEA 4EDFA 2WKWA 4U02A 3IOEA 1CG6A 4KRFA 1WA5A 1U1DA 6AT1A 3WJAA 4GBGA 4ZQBA 1AKWA 2HPAA 5JW6A 1X39A 3IMEA 4DRZA 5E1OA 3OURA 1JG3A 4N9QA 3NU1A 3PNKA 1RBYA 2ZVDA 2VPTA 1KY5A 2P41A 1GPDG 1Y4ZA 2R85A 5FOTA 4OATA 1FFBA 1QCDA 1LFDB 3IQXA 2IPNA 3MB8A 3PNVA 4MVXA 1T9HA 4BKRA 4WN3A 3OZSA 4X20A 4B3CA 4F3NA 3TF5A 4CM1A 3P2YA 4Q3KA 4PQEA 1VSVA 2W6CX 2QGNA 3V4SA 2WJAA 1KAQA 3DZGA 3P9XA 4BASA 2V7PA 3T8YA 2BMDA 1JSZA 2WP8J 2Z4RA 3MT8A 3WE7A 1NBIA 1EGAA 5DM2A 3CVWA 4RAQA 5B6PA 2PLWA 3GN1A 1PJBA 3FLBA 3ANSA 4ILKA 2BFOA 3EUWA 3GLRA 8AT1A 2WYWA 2Z9DA 4DSOA 3MJRA 4RZ3A 2W2KA 5LP6A 2P1RA 4IDAA 4PAQA 1SVLA 4O6VA 2F9FA 2NLOA 3IKTA 3ESYA 3BWEA 2WMNB 5L3QB 2H5LA 2HJ9A 3MBIA 2XTNA 5K3FA 5T67A 4RVDA 5IK2D 1IVSA 3B78A 4AG5A 3RANA 2COEA 4FGLA 1RPAA 1V1RB 2XYRA 1U0BB 4MW9A 1JS1X 3BD8A 1FSSA 1S1MA 4NOMA 2EJBA 2YR0A 3RWOA 3RGWS 4LRQA 1H4TA 1B15A 3LUFA 1V39A 5JOQA 1SVOA 3I83A 3TTUA 3RC3A 1CZLA 1HZJA 1XVAA 2CBZA 1A8QA 5TQJA 3HL0A 2WE8A 4D9BA 1R4MB 2F3RA 2GVNA 3CYFA 4G37A 4GF5A 5IANA 2Z5GA 3I8XA 1Z0SA 4PLTA 5DYWA 2VWQA 1EHCA 2HJWA 3ELYA 4S1PA 4GXQA 4E51A 5K0TA 3IAAA 1PQUA 2CN1A 3C41J 3ZNQA 2XKBA 5KYXB 1C80A 3SSAA 3K2BA 2H4JA 5DPMA 3HR8A 1S3FA 2GAIA 3BE8A 3IIJA 1W25A 5L51A 3TZQA 3WGQA 1BAPA 2WD9A 1D04A 2ZYWX 2J3QA 2PH5A 4X64B 4J3FA 3FFAA 1SWVA 3QLVC 2JGDB 4EY3A 1E2MA 3PNLA 2PRJA 4PZ9A 2VUIB 1HDGO 2YV2A 1Y4DE 3EDCA 4G1EB 4P33A 3ZK7A 3SI7A 3G7NA 1P60A 1E2UA 3W8NA 4LWPA 2ZBEA 2AI2A 3B82A 2J87A 1Z3CA 3OEHA 2VPQA 4OHWA 3ZI7A 1UEIA 3KKMA 3MC1A 3S6JA 4Q5IA 3AEZA 3CE6A 2J0VA 3IE0A 4S24A 4JYCA 3SXJA 1EXNA 1N92A 1CLUA 2EBUA 2E18A 3G9XA 5ITZA 1N33B 1ZXLA 2VJOA 1JA1A 2IOFK 3BDVA 3QXCA 4JB0A 5F2OA 5JS7A 1QLWA 3HUEA 3ME5A 1X13A 3U4HA 4DIFA 2ZROA 4RD1A 5LP6C 5CDHA 1FBTA 3QBJA 4PPYA 4R84A 4YCDA 5DTRA 4RTRA 4J6FA 4MQEA 5EXEA 5B55A 2C4MA 3N6VA 3QW2A 4LISA 4NCJA 4UM8B 4KKXB 1BQEA 2ZAIA 4WAUA 3KSRA 5JZBA 2XCRB 3K8YA 4QEKA 4BO5A 3ERCA 1IN4A 2W2OA 3S99A 1M7BA 4HWPA 4QJ4A 2O23A 2A9PA 1P7ZA 2IE8A 3U4IA 1D4ZA 3OO1A 4IW3B 2AC7A 5IX8A 4B2IA 3DMGA 5DP2A 2DP4E 5KX5F 1H4VB 2BKXA 3ND5A 1E0DA 4UBKA 3LD9A 2OV2A 4WUTA 1GQ2A 2WBLC 3F96A 4PV7A 4TMVA 4EO9A 2OE2A 3H6GA 1GZUA 1V7CA 5FPPA 3QWAA 3BXFA 3QLUC 4BJ6A 5K7SA 1YU6A 2OM2A 1F8GA 3F0TA 2B9EA 1ZHOA 2XSZA 1TEZA 1WOYA 5A03A 5IVDA 1KHHA 2QVCA 1WUJS 1EM8B 1JWBB 3HLTA 4L3OA 4LJSA 1GU0A 5E9QA 4D6XA 5EE9A 2JA2A 5ARCA 3HCEA 4IMIB 4D0NA 3UXHA 4ZVUA 4YPVA 2OQRA 5JECA 2BBOA 4GH5A 3G2PA 4ND1A 4C4RA 3L6DA 4OIMA 2PV0A 3CJRA 2F8LA 4V02A 4DA8A 1YXMA 4GSLA 2XV1A 4URHA 4TTVA 1H2FA 1NBME 1L7QA 3EJ6A 4K6KA 2PUHA 5GAJA 2PMCA 1SC3A 1VMEA 4WFQA 1EHIA 4Y6OA 3ZDFA 4R7ZA 1VFPA 3BF8A 5DX1A 4M38A 4ZT6A 5BV1A 4JBXA 2HGZA 1HFWA 3O4GA 3TD2A 4UFPA 3GNLA 2VF8A 4ZYLA 2P9JA 1SK9A 2XOEA 3AETB 4TOIA 4G0OA 4WOKA 4ZTUB 1N34B 1E5DA 4TMWA 1DFHA 2GPWA 2Z30A 3DDWA 5AJHA 1XHEA 2VVTA 5GP1A 4BP8A 3EAFA 1V4VA 1C1DA 2PQ6A 1G6Q1 1P7CA 3MILA 4HJXA 1GKLA 2L19A 3VKHA 2HCRA 2HB6A 3BCRA 4JJEA 1C0PA 3A06A 2ID4A 1VI5A 2PRZA 3TWOA 1XTKA 3C3EA 4GBED 1VCIA 1KC3A 2Q9UA 4L8LA 2FW6A 1DEXA 5TPWA 2ZJBA 4MVCA 1Q0ZA 4K05A 1BX1A 1UWLA 2H52A 2ZI3A 3ENQA 3U9LA 1JXMA 1O8BA 3PNPA 1WSDA 1TE2A 3I1IA 4FS3A 5FYDA 3V1KA 2OORC 4RZXA 1UFKA 5DNDA 5REQA 1U3FA 3RJ9A 2HHLA 2O20A 4BAUA 1KEEA 3HVIA 1AIPA 2WRZA 3M70A 4Z1MD 4NNJA 1UXIA 4LF5B 1QRDA 2QHXA 2VG8A 5HJ5A 3L0SA 2G83A 1KNXA 3OJFA 3RQIA 2KX7A 1XHLA 3BC1A 3TW0A 2EZ9A 4YYZA 1SQ5A 2A0XA 2FSGA 2NSLA 1RM4A 4X3PA 2UZ4A 2W6OA 4U00A 1WDLA 5ALPA 3KUUA 1KMNA 4Q47A 3QXXA 2BONA 1YQTA 3MS2A 4RHCA 4EA6A 5I8WA 1G9XA 2Q41A 3ET5A 4N6NA 3UTCA 2Z3ZA 1UDWA 3M4YA 3RO7A 2PY6A 1OZHA 5SV2A 1QG2A 3GCZA 3O0DA 1PWYE 4H27A 1Y8ZA 1B00A 2GZRA 1BE1A 1RQ7A 2VQSA 4TXLA 4LDNA 2WV9A 1WXIA 3B6EA 2UZ0A 2QSUA 3BREA 1H4QA 4JBIA 2EGHA 2WJ6A 1M1NA 3ZYCA 1RLMA 1BU5A 2GH1A 4KLNA 2IYUA 3GO4A 4OGWA 4G25A 1HURA 3TZEA 4DLBA 4QZVA 1NP3A 4FCTA 3IV7A 1XZLA 2YZGA 1R5BA 4TV8F 1AXEA 4DLKA 2EZ4A 1CIPA 3IXLA 1KI3A 4M1MA 2ZWOA 3WISA 3MTEA 5DNYB 1Q74A 2EZTA 4AM8A 2ARKA 4ABTA 3BPSA 4YRQA 2WABA 2JHFA 3GDFA 3WGNA 1G18A 2VZEA 3FLMA 1GCOA 3KPUA 4HUQB 4RMIA 3T94A 4BN5A 3IB3A 1C9DB 5D87A 1IHUA 5TARA 3WGVA 3EEIA 5JJIA 1Q7RA 2QPTA 3IUJA 4IIGA 4ND8A 4A82A 2RI0A 2PJZA 3H18A 2JC3A 4C20A 1BDHA 2W6PA 1NV9A 2AD1A 1KK1A 3NCTA 1P3Y1 5CNJA 2CDNA 4KLRA 1E61A 1ZU5A 3H13A 4ME6A 1XKXA 1RKXA 2ETXA 1U02A 2G0NA 4OXXA 5KYVA 5KC9A 3KEMA 5BW5A 4RZUA 3O7WA 1DBRA 3JAKB 1QF6A 5BSTA 3AP2A 4IJVA 1QP0A 4WBNF 4UHEA 1DC4A 4ZOBA 1N2CB 1JHVA 2YS6A 4I1VA 2EBWA 4WDRA 3KR0A 4YJHA 3TJZA 3PQEA 3REQB 3W3AA 1U7WA 1A9TA 3IO5A 5FPSA 3FAKA 1GUYA 1UMDA 4A8JA 5IC4A 3QX3A 3ZDAA 3OWHA 3G2IA 1EGMB 4UNNA 3LXRA 1ND5A 2BRUC 4TQAA 2GXAA 1CEEA 4M21A 5K3SA 2A30A 2EKPA 2VO1A 3FLEA 4L4XA 2VXCA 2VYNA 4E94A 4ETWA 2ADMA 1YQXA 2NZJA 1N7JA 1SG0A 2DY1A 3JQ9C 2QTTA 4WI1A 1ZGCA 2JVKA 5H16A 1ORVA 4D9FA 5CFZA 1EG7A 3HJGA 1AKQA 1T24A 2YC2C 3LF1A 1LLCA 3DE2X 5AM4A 3I5XA 1HA3A 4HFRA 2DQKA 1XLTC 4URVR 1HE3A 4K8OA 4ER3A 3ZJYA 1X7WB 2EG9A 3I9V6 3KV1A 2JD2A 4QRHA 4EJ6A 5AW8A 2WZQA 1K6JA 2PNFA 2ZB3A 5KYWB 1V6CA 4HXFB 3VR2A 4RMGA 3KHTA 2GJKA 1SD5A 1AKYA 2VDWB 4LWQA 4TKUA 3SDSA 3SNHA 3ZC3A 4C0JA 1K27A 4Q82A 2VLIA 4GW3A 4OHRA 4D25A 3C1AA 3WP1B 4I50A 3ZPXA 3FCXA 5JJKA 1Y9AA 4OB7A 2N1BA 1E2FA 2JJ1D 5IDWA 2PCJA 5GVSA 4JLPA 2I0FA 5JFOA 5EXDA 3SC2A 4IO1A 4ALKA 4EFMA 4EHKA 4UZFA 4DDVA 5J2UA 1YC5A 3LX6A 3ZDYB 2A1TR 3RVMA 2I7TA 2G5CA 3Q4GA 2QQFA 4JXXA 3OT4A 1SKYE 5JNRA 4CCSA 4RACA 1ZOIA 3PZRA 4YUWA 3KL4A 1XDBA 4XB6B 4B7AA 5B6JA 4Q9HA 3ZLJA 2JA1A 5CFNA 2GD0A 4ZARA 5ERYA 4K88A 1Z74A 3N53A 1SB8A 1RWBA 4MWZA 4XH9B 3EH1A 3DAOA 4JLKA 5IDXA 4ARZA 3ESCA 4REMA 4Y9SA 4HEQA 2Y76A 3DBIA 4Q1DA 4NOKA 2C82A 1XGKA 2P6OA 1HRDA 3DFKA 4R0VA 3KPWA 3NHYA 2XECA 4HQLA 4KXQA 4ZOLF 2PR2A 3A1DA 1D0SA 4M46A 4XCQA 4EFDA 4BNLA 2FH5B 2BFDA 4OCZA 2JKYA 3HXKA 1MXFA 2V4MA 1W34A 4I3GA 3W8RA 1K6MA 1XTZA 3AERB 2J5BA 3CUWA 3NAGA 3GZ4A 2NO4A 3IULA 3K05A 3PGVA 4JC8A 4WLUA 4EKGA 4YRSA 2FA9A 3NEYA 1M2EA 4KL8S 3WJ7A 2CXUA 3COVA 1N5KA 2P67A 4KHPB 4JLUA 5B3KA 2GPBA 3FBGA 4ZVQA 4CUJA 3PC2A 2YJ3A 3BWYA 3RYTC 4TGLA 5EPOA 3OPNA 2JEOA 3UY4A 2WVAA 1KFBB 1ONOA 1WXHA 1GZDA 2CFSA 3M6VA 4NJMA 4QGAA 1UZLA 4BMZA 4DLYA 1IDN1 1VE5A 2GESA 1PQYA 2D1FA 2EG5A 3C3PA 1KQOA 4NP6A 1GNVA 1VECA 3NUZA 4H59A 5IUKC 3RWBA 1KO8A 4BMOB 2WF5A 1YZLA 1TJ4A 2AXQA 1ZGBA 5DW0A 5FI1B 2Y93A 4NR0A 5I6DA 4WLNA 3ROMA 3PC8C 3K9BA 3RSHA 4YLGA 4QASA 1D6MA 3PUXA 4D3XA 1KRXA 3DAYA 4UUMA 1A7UA 2LKCA 5DNAA 5KWJA 1GCUA 2Z2XA 4ZRDA 5BRNA 3OBIA 4M0PA 4MCIA 3KZ1E 4NMMA 7REQA 3QEMA 1YRQA 5DT2A 3GROA 5AHOA 1CP2A 2J6HA 4C78A 5H82A 4DNFA 1I7SB 1HH4A 4CEIB 1ESDA 2Q9BA 4BC1A 5FO0A 1LI7A 1YI1A 4NU6A 2JDID 3SS9X 1T8SA 3DFUA 3TLMA 2YVAA 4Y0VA 4MUEA 2DUUA 2IOYA 3NBUA 4QOGA 4E88A 4X1IB 5D7BA 2WT8A 4PFSA 2GJ4A 4HH3C 4KTTE 2Q6LA 3TKAA 2C5EA 2VNJA 1LPAB 3RE1A 2QUAA 4ZQCB 2DTDA 4R9SA 3D8SA 1ZICA 4LJ6A 3BG5A 4RESA 1Q0UA 3E4CA 4ROTA 5EKSA 5IAKA 5I01A 5LWQA 2QBYA 4O1HA 3TSYA 4JOSA 5G1PA 1G38A 1FS6A 4ARSA 5I7HA 3JAMA 2E85A 4OMDA 3P20A 2YWRA 1SCAA 4XGKA 3CXRA 3A1WA 2P1ZA 3G9UA 4B3HA 2QX8A 1U8EA 2C54A 4RYLA 1D2AA 3IBSA 4B2YA 4HNHA 3HU5A 4O25A 1DC3A 4RW0A 4A6DA 4GRDA 3AESA 4F4HA 2V58A 4M9CA 3CR7A 4MGHA 3T4XA 1NDQA 3ZE7A 4DDKA 3E61A 3HXMA 1MQAA 4M8IA 4YI3A 4P5PA 4ZEVA 2I1QA 4LGVA 1QOQB 4BQRA 2A4MA 3PEUA 2QUIA 1G2IA 1SXJE 4C7JA 1YQ9A 2J5XA 4WNCA 2H31A 3KDAA 4P7KA 2AYXA 2QTVB 3T5BA 3BM5A 1WU7A 1J9EA 3WK4A 2H9YA 3F90A 1EJBA 2ZANA 3KOUA 4M37A 4U7TB 1POWA 4OP2A 5CVVA 5IHXA 1PT9A 1BHO1 2FF5A 3S27A 4EY7A 2IP4A 4F8EA 3KJHA 3KSDO 3OU6A 1YVDA 2PUGA 2X23A 2I99A 1OASA 1PV4A 3O4IA 3L7KA 4R1OA 2P4QA 1F2VA 3BWCA 3G2NA 4NYJR 4D98A 3JYQA 4PLYA 5KQRA 4Y2UA 4GQBA 5AKKA 4E14A 1R6UA 5LU9A 5EHZA 4LJ4A 2EXXA 4QKQA 2HF7A 5EHIA 1Z6GA 1ISGA 3QTTA 4MR9A 1T8RA 2FUNB 3I8SA 4FHZA 1NF3A 2HU5A 2VPZA 2BUBA 3CONA 3THSA 2SKDA 4IJMA 1GHTA 4E6EA 3UK2A 3H16A 3ZHYA 3C14C 2TMYA 4US0R 3WB2A 1QO9A 2RAPA 5CW2A 2RGRA 3D4OA 3E9RA 2WWYA 1KDPA 1FMJA 1PKEA 2L82A 4Q7QA 4Z7NB 4Y6RA 1QGAA 2K2WA 4LJKA 4DLLA 3QTLA 2ZG6A 5D3MB 3INTA 2BBTA 2NU8B 1QGYA 1VHQA 1IFXA 4HN9A 2R0QC 2H9AA 2V4UA 4Y6QA 1MF7A 5I45A 1T13A 3AHJA 2PUEA 1Q11A 3SJUA 1N6NA 1MEJA 3KPYA 4M7PA 1V5EA 2YOFA 1JHRA 2V4ZA 1ZM4A 4LTMA 5ILOA 4ZGBA 2EBHX 1C1YA 4ZJUA 4KACA 1AX9A 1DCFA 4P82A 3K5PA 5THXA 3KJGA 3L5KA 4Z4HA 3TCKA 3W2EA 2FYTA 5AI9A 5EXPA 5FBQB 2MMGA 4FYPA 4MKGA 1E0AA 3QVTA 3NBAA 3NT5A 3OIYA 3U56A 3EG9A 1X0XA 5LXTA 2XCTB 1JEEA 1KY4A 3R7BA 2CLOB 3FLAA 2P9HA 3UT0A 3CRNA 4G65A 4AP9A 3EDYA 4N82A 4E31A 2QN7A 4F5EA 3ABRB 2QJOA 2FQWA 3LHSA 2ET6A 3NDJA 4O1MA 4PLHA 4TS1A 4GKKB 4UTZA 1TIBA 5ALOA 4I9NA 1E5XA 2UVQA 3OUZA 4I9FA 3ANYB 2WJZB 2FCAA 4RIHA 1T1JA 4XDZA 1GFZA 4JOBA 3DMRA 5CXQA 1E7SA 2ZI6A 3ETDA 3JSXA 2WHQA 4HH1A 2V6GA 1CUBA 2CC2A 4WY5A 5FNVF 2ISSD 3H5AA 3QWHA 1G17A 1MJNA 1Q1GA 1QCYA 2WTXA 2XBLA 2INGX 4TWJA 3TRDA 4QODA 3TSAA 4QT4A 3E0QA 1O94A 3TR6A 1B0AA 1O9HA 3L7CA 3RPEA 1OWOA 2FUEA 4HAVA 3OE7A 2ZE6A 3RUAA 3CZCA 2EP5A 1U99A 2IY7A 3NONA 3U13A 2Q2WA 4FZRA 4D3ZA 1HO3A 5F2NA 2QG9A 4FFBB 3HRHA 4P2BA 3WGKA 4MP3A 2D3TA 4YT8A 2H1SA 1CU1A 2XBUA 3C2QA 3IILA 3ZV5A 1HORA 3RADC 3X1KA 2VHEA 2BI4A 3K94A 1T4DA 3C1UA 4FZ3A 3BXZA 3T38A 4BVKA 4R8VA 4TMTA 3UB3A 2F67A 1E1QA 4NPCA 2JFVA 3SNKA 3B9QA 1KZ7B 4P80A 4Z7OB 5IZCC 3FTEA 5TMEA 2Y1WA 2JI9A 4PCLA 1H5UA 3DVAA 3FDZA 4HWRA 1SY7A 3K4QA 3G0BA 3AU9A 3BWXA 4NDAA 2WTBA 3AFHA 1DDGA 4FR2A 1Z4PX 4TRMA 3RSQA 4B45A 1N25A 1Y81A 2OYSA 1WF3A 4RL4A 5YASA 4AY6A 2AKYA 2EEZA 4DA9A 3KAJA 2FOXA 4JX8A 3WRYC 1XVIA 3K9LA 4D3DA 3WWDA 4ZQHA 2MCFA 3SF0A 1ZEMA 1HNXB 1X92A 2W6JA 3WRVA 4EHFA 3QVXA 2X15A 3X1ZA 1JGTA 5FX2A 1RLUA 3T7AA 4N6OA 1QYIA 5DISB 3WMWA 4CIWA 2PXAA 4KAJA 4TN5A 4YVFA 4ZVRA 1DEOA 3REOA 2DOKA 2FWRA 2RHRA 3QVWA 5E6SB 3RS0A 5A3RA 3SVZA 2RKBA 2ZS9A 3LQFA 4XYGA 3MBOA 5J2UB 1KI2A 4MCAA 1MAHA 3SLRA 3QX8A 1GPUA 1GM5A 1UK6A 2P68A 1B1AA 1ZBQA 2Z6VA 3DFMA 3IBTA 2B34A 1GQFA 5K4AA 5AHXA 2AE1A 4PZAA 5K0CA 4J4TA 1HSZA 1DJOA 4YMVA 2GBIA 1X2EA 4MR8A 4N0QA 4YHBA 2IPLA 2AVDA 2DJ5A 4PYKA 2NO0A 4GYJA 4GE0A 3LVBA 2V7BA 1XA4A 2PLFA 2VCHA 3KKOA 3PXDA 4RF3A 3W6OA 3CNLA 5CX1A 3S7ZA 1V9LA 3CNQS 2WG1A 3AKYA 1WW3A 3GFQA 5CT5A 3NXSA 4LWOA 3TUJC 4L5CA 2TRSB 5IT0A 2BY4A 3M5PA 4PG6A 5DM60 1P73A 4R7GA 5FUVA 2OHGA 4PXAA 4P0PB 2QAIA 1H93A 3GNQA 3HJUA 4AN1A 3QY0A 3WI7A 3ZWCA 2C03A 1H05A 2CHFA 3E9NA 1TL7C 3DZIA 2JGEA 4NCNA 3C8ZA 1I9CA 2IUYA 3QHPA 4F6CA 2LIPA 1CR2A 4O4LB 2X8LA 5A5EA 3BKWA 1GZVA 2QK4A 3R7FA 3T15A 1C7ZA 3VJLA 4B3GA 4PPNA 2X13A 2X7HA 1YFZA 2YUIA 3B52X 4M87A 2CXNA 4NPHA 3NDRA 3IMGA 3LDAA 4YTEA 3ZWWA 1R8SA 5TF4A 5IC6A 5JS8A 4K1LA 3QJGA 1TJPB 2V6MA 1YS7A 1GTMA 3CEMA 4J3JA 1SIBE 3TSZA 4DVJA 2O3JA 3JYNA 1Z83A 2RMKA 5INTA 2FP4B 3I6QA 4GUAA 4Y3UA 3S3TA 3SFZA 4D79A 1N2XA 2QENA 4DA7A 4RJKA 5HBGA 3PNMA 1TMOA 5F5LA 4CCWA 3TUZC 1GSHA 1IIRA 2JCGA 4C1BA 4CI9A 2HUPA 2PZBA 1SHLA 2QTVA 1YV9A 2XZPA 2G1JA 2O2GA 2OA0A 4CU5A 2E1PA 3GA0A 1GKIA 1Q16A 1GV1A 5EC8A 3P7MA 4H0NA 4YAKA 3TGPA 3F9RA 1I7NA 2AZMA 3OC6A 1U8TA 3HKEA 5DBOA 2XTZA 4QOIA 3NBFA 1UMBA 1DPGA 4M1EA 4EPRA 1SU6A 5HK9A 4PG8A 5G4KA 5BORA 5DCYA 1KDTA 2AZ4A 4BLVA 5D8DA 1OI4A 1FQOA 1NVBA 3TAHA 4Q4JA 2DETA 3ONVA 1VQ1A 3UYKA 2I2AA 4LPKA 3E4DA 3AB7A 4FP9A 3H1BA 3L06A 3PFIA 3I9KA 4UU0A 4XUCA 4EABA 1W5EA 1Y82A 2YMLA 3WSTA 4A9AA 1OZ0A 2P2NA 2PT6A 1MG0A 1U0GA 3CZ9A 5AR1A 3VO1A 2DULA 1SCDA 3QSGA 1JHYA 3I01M 5IWCA 3W5JA 1CJTC 2VSFA 1QTNA 5G2OA 5JXGA 3UMMA 2H4XA 1I6MA 3OMXA 1RFLA 4DZRA 3BB4A 2VH1A 3S2YA 2FWNA 4HVTA 1K3TA 4LMPA 5JC1A 3E53A 1VIYA 1OLOA 3BK2A 3EW9A 1K0FA 2B4YA 4B4WA 5BN5B 2AEJA 2PUVA 3E81A 1KVRA 3SDZA 3ZZ0A 4WXEA 1D4FA 1T1IA 4ZN6A 4CNBA 1A95A 3THRA 5DK4A 4G5GA 1ORWA 2ZRNA 4TTJA 4B0PA 5KQPA 1LUAA 1YOBA 4EPTA 2ZYVX 4OU4A 4L5JA 1R27A 4K6HA 3A2KA 3II6X 2VC2B 4OQDA 3R6DA 3GD5A 3D4PA 4GRAA 5DK6A 4B3XA 1L4NA 2JDIA 3BXOA 2JHAA 3FRHA 4RKEA 3KTAB 3JQDA 1U28C 2QQ0A 1S4MA 2R4UA 5E7JA 4C3UA 1ZJWA 3QVGB 4F3TA 2WY2D 3JR3A 5T4EA 3VNBA 2BUCA 2BMVA 4CFYA 3CUEF 4IDPA 1G8MA 3G9QA 4HOYA 1Q3HA 5LLDA 1A2OA 1MN6A 3EDOA 3OJWA 4M49A 1YAHA 4QUBA 4C0QC 4YMHA 2GQ0A 2CVQA 3QRWA 4C7OB 2KPOA 4ONEA 5BOVA 2XUKA 3W7BA 5JDIC 5LOVA 3GLIA 1DUSA 1JDTA 3NDPA 5AO9A 2HCJB 2C3MA 3VZBA 2YXEA 4EGQA 1VYHA 1TRKA 2RI1A 4R71A 1R18A 3ETGA 4J0EA 4M4SA 2ZRCA 3JVDA 1RLOA 4I5DA 4X45A 4EMBA 4ZCRA 2QNRA 1MABB 3HUTA 4YGXB 3U48A 1P17A 2OGTA 4HLUA 3GCXA 4C6TA 4IJUA 1HNNA 4KN8A 4PO8A 5FNVB 3ZDEA 5LMCA 3R0JA 2RG7A 3TIFA 4YJ2F 4H31A 2ROQA 1IG3A 1KP3A 1Y33E 3QHQA 5K8UA 1E3TA 3LDGA 2Z8YA 3OU7A 4J94A 3ZD9A 3TQSA 1GN8A 2GASA 5B3JC 1JDNA 2AFIA 4ZT4A 2CUZA 3ORQA 2I6UA 1GQQA 4JZYA 2VJKA 4XM2A 2C1EA 4LOJA 4BAGA 1COWD 3G79A 1LNQA 2C84A 2VPWA 4YRZA 1Z0FA 4ZI7F 1SUBA 4IQ8A 1P3DA 1JFVA 5EERA 2Y0EA 2EEPA 4CTKA 5J1SB 2QD5A 1QHXA 1EBFA 4R9UC 3IAEA 1IMOA 3R3UA 4G85A 2G8NA 1DIRA 1K7CA 2Z5VA 3HHPA 4J9UE 4JNCA 4EM6A 1YA8A 2BD0A 4KO8A 3L4JA 5ADHA 1KO1A 2XKAA 5CA0A 3RSCA 1WZUA 3M7IA 4OY3A 4PZPA 2H2WA 3O2SB 3TLAA 5JEDA 5T4BA 1NBWB 2CFRA 4KO4S 4ZZ2A 4LI3X 3DVQX 4PIVA 4UM5A 1PZFA 3DE5X 5CT4A 1CS4C 1UMKA 3F6PA 2F1HA 1YRWA 2WUEA 3JPWA 3OJOA 3T9EA 4D5EA 1Y3FE 2VPXA 3LW7A 1EHYA 4CQMA 3HDTA 2W7TA 5TPZD 2Q62A 4MRMA 4BMYA 3BS4A 4TUYB 4B46A 3OA0A 1QHIA 1JQLB 4FDVA 1CHDA 2A3NA 1KYIA 4L07A 4ZVMA 2V7EA 4MQMA 4K1XA 5C3UA 5FTKA 2GOYA 3RR2A 2V3WA 5CCBA 4OHXA 2J9XB 2PKWA 3GBPA 3LX4A 4P4NA 1D1SA 1JBEA 3C6MA 3WQRA 5CDUA 3IUQA 4QFMA 7YASA 1KSFX 3EVBA 3GUZA 5KHOC 2DWPA 4KDRA 4F4FA 4FYIA 3BSSA 1U1IA 2LW7A 4O59O 3WLJA 1OWPA 4B6OA 4EH1A 1WHSB 1WHTA 4AY2A 2FXVA 2H07A 2W6NA 5CT9A 4F96A 4ND8B 2CSUA 4TROA 5JWRA 1N5JA 4FWIB 1TVKB 2YUTA 4B7ZA 5A9RA 4GP9A 5K2OA 3B60A 3ZY3A 3R2JA 1B8OA 4QDKA 3NUQA 1CB0A 1TQ2A 3U80A 1ZIOA 5G4KB 3SWWA 4YYEA 2C99A 5DBFA 5DOZA 4YV7A 5IM4F 3D3EA 3RTDA 3OLCX 3A9VA 5JYDA 2BGGA 4BO0A 1BHQ1 1GTJ1 1W4AA 4LXIA 1QOZA 2X4IA 1NJ5A 2R8XA 3L04A 4Q1FA 2GLXA 2B78A 2A9OA 2FOIA 3FNEA 3LKVA 1D2MA 1U2QA 2ZDQA 3BFPA 3FCCA 3GFRA 3QOYA 4J0IA 2OXEA 4L7VA 1WV0A 2ORED 2W9XA 5CMLA 3S68A 4OYHA 2C2XA 1U9CA 3TSOA 3WGLA 3CZMA 4UBIA 4NG5A 1WXQA 3EQ8A 3EIOA 3WGMA 3HCAA 3D3JA 3RARA 3N9IA 3LQ2A 4PG5A 3TZCA 3WMEA 2OOSA 1E9VA 4NNPA 3UGKA 1RI5A 1E2QA 1XP8A 4G1CA 3NAZA 3SD7A 5JIBA 3T1QA 4AWXA 2FDCA 1AUQA 1NBMD 3GQVA 4HRAA 3H3XA 3HU1A 1IN5A 3MJTA 4OI1A 2IA5A 1JQBA 3GUYA 1IMJA 1K08A 3EXEA 3EZ6A 1V5GA 4I5FA 3ZWKA 3PFFA 3W5DA 1WM1A 3VJMA 1HETA 3WAGA 4H7DA 3VPSA 1A7KA 4I4LA 4MW5A 1M1ZA 2JF0A 3B12A 1A5ZA 3AV3A 1XYYA 1TJ5A 3RF6A 4HMPA 5K3EA 1DXOA 3MCTA 1TKCA 3R7NA 2Z58A 2CFOA 4CU2A 9GPBA 1P1IA 4XQ0A 3CINA 4MKIA 4QBGB 1OH5A 3V7UA 2HRZA 2WSIA 3LY8A 4FQ7A 3PFBA 4JVMA 1I14A 3CUUA 3KNZA 4MIKA 3GUVA 3AKCA 1PD0A 3GT4A 3OT1A 1OKKD 4G5QA 4IS2A 2AZXA 3LHIA 3RUPA 3FTNA 2RHBA 4YJGB 3MWEB 5JG7A 1JQ5A 3FYTA 4M7OA 1KJ8A 4C05A 3VDRA 1TUBA 3WLPA 4CKBB 2BGMA 3M2PA 1YBMA 3HUFA 4G86A 4PTLA 4LBVA 1UDXA 3ILXA 1SBTA 2IZ7A 3TOXA 3UATA 1ANKA 3ZWYA 2BP7B 1R4AA 2DFVA 3P1JA 4B35A 2VJPA 5J1TB 1NASA 1WDWB 3G0DA 3D6NB 3GK3A 5BWMA 3VOBA 3EVFA 2WNHA 1YS2X 2W8ZA 2FPLA 1P72A 1SUSA 2AMJA 1Z4IA 4XAQA 3IKVA 2YNMA 4PLGA 1HE1C 1DAGA 5I7AA 3ZWQA 1H0HA 4AF8A 2H00A 1EWRA 1JSRA 4CNQA 1EGVB 4BNWA 5IARA 4G4JA 5JI2E 4GXNA 2QG6A 2OHOA 3KHSA 4M9RA 2CVOA 2XB6A 5EXSA 3QEAZ 3GGPA 2CMFA 3T3MB 4CM9D 1R0RE 4XI9A 1NYQA 3UKOA 1WD7A 2FN9A 3T3DA 1DRVA 1ULSA 4HLDA 1P0MA 3SXUB 2RGXA 1D2EA 3IBFA 1PEKE 5DIZA 3BXXA 2CNWD 5DYYA 2Q6OA 5IMSA 3UGQA 4BB0A 5GY7A 5HIJA 3KWLA 3BL6A 3MCWA 1VGVA 5IM5A 1B8PA 2H5IA 1GIAA 3E84A 3ZDXB 1MP0A 4O2BF 4YH1A 4U7DA 4R9VA 4HSEA 1GNPA 1L4FA 3MG9A 4JN6B 3ZHQA 1JG6A 1MAAA 4IHAA 2I3AA 2R84A 1DC7A 1RP7A 2SNIE 3P9IA 3P0HA 3QVLA 4LCEA 2XA9A 1EX1A 1GT91 4MV9A 3ZKAA 1LBSA 3ZS9A 2F62A 3GD7A 3RS3A 2YV1A 4GI5A 3VUFA 4UDOA 5KUTA 4DR4B 2DQ4A 4WGGA 4ZQIA 5TNXA 4CKYA 2H1RA 1FYXA 3DT8A 5G40A 4HAYA 3ZU4A 4WVLA 5AESA 4EG0A 1SA0A 1QPZA 1FCJA 3WKEA 1Z45A 1KVQA 1DB3A 5HGXA 2WILA 2HZ7A 5CT6A 3FPFA 5LNK1 1BMDA 4NOJA 1OREA 1S9DA 3CY6A 3D0RA 3LGSA 2QE6A 2PS3A 2V9CA 3QX9A 4JXKA 1B43A 4PONA 4ZPJA 4B1FA 3MYRA 3AOGA 3AZPA 3L46A 4Y2YA 5ABPA 3HMKA 3K53A 4XWAA 5GMOA 5LFAA 3C3DA 5CYFA 4GOJA 4IY1A 4BO6A 2Y2UA 2O48X 1DAPA 4R4JA 3O47A 1L4EA 1EXMA 1QX3A 4W1SA 4EJSB 1ZMBA 4TMXA 1TYBE 4FINA 5DN6A 1PSWA 4B6SA 4I55F 4ZDIA 5C18A 1PV2A 4MYSA 1FUIA 1ZQ9A 4RFSB 4KSCA 3UWPA 1NJFA 3B9RA 4J2TA 3PTLA 1XMXA 3U3ZA 3AWIA 2H29A 2VFAA 2YRXA 3VU9B 3PNYA 4I6EA 5ERXA 4YPFA 3CTPA 2H59A 2GO7A 2VNHA 4PWYA 4RZSA 3RC1A 1Z8FA 4JLOA 3PEFA 1QFJA 5IJAA 2AG5A 1L7OA 3KHUA 3QM1A 4MV4A 4N03A 1QU2A 1U0NA 3OQJA 2O50A 5LDHA 3G2LA 1GD1O 5ES3A 4AJPA 4DE5A 3KKKA 4HB2A 1M73E 3WNBA 4DL9A 3R3YA 5G02A 4R2WA 2AFHE 4EFLA 3RKSA 2H7VA 2OGUA 4URZR 1RPTA 1BVHA 3KOWA 4WCFB 1I01A 4KQ1A 3E5HA 3FVVA 1QHHB 1YULA 3EMBA 1A9SA 3RKRA 4LJ8A 4A73A 3LCMA 4C30A 3BEDA 4Q1CA 3G3EA 4LK2A 1R5OA 2OFOA 1NBAA 2CB9A 4MINA 3B38A 4RETA 3PXCX 3W06A 4F45A 5I7WA 2PYZA 1IRXA 3HDYA 4QUJA 1T91A 2P2GA 5J4LA 1L4BA 2RGNA 3C8HA 1UODA 3ER6A 1W5AA 3FJYA 4H6XA 2YWFA 4REOA 4ANFA 2AFIB 1QONA 4FPXA 1QGUA 1ZK2A 4WIAA 1FQJA 2REQB 4PAOA 4IOJA 1JI3A 3RT7A 1VE1A 4LXYA 4IJWA 3GF4A 3MFYA 5JISA 1ZUD1 2WT9A 4JBYA 4D5GA 2HTFA 3ZWAA 1U8AA 5IYZF 5IJ0B 3DKPA 2XZTA 1OJ7A 4M89A 3C24A 5BQ3A 1H0SA 1YI0A 2QAJA 3FYSA 4IIJA 5A4FS 3QYPA 4N7BA 3FROA 4AY5A 3QFHA 3F5SA 2PKQO 2RH4A 1CJKC 3G7UA 3DBHB 1T8UA 3R3HA 4WMLA 3DWGA 1MX1A 1Q7EA 5G0WA 4RPCA 3ZQ6A 5EJMA 1DMSA 2BJVA 1JKXA 2JASA 2R8BA 2HMAA 2PGIA 4FTWA 3LF2A 1YL7A 2DPLA 3BIOA 1F1JA 3CNEA 3DVLA 3HBLA 4GGOA 4B87A 2OHIA 3CNHA 4KQFA 5DEIA 3EGXA 3R0XA 5IK2A 1CK4A 4MP6A 4CETA 2ZUDA 1J8DA 4R1LA 4HRVA 1Z0ZA 3L1JA 5LXTB 3F73A 4EBBA 3TLZA 2Z2IA 3JD1A 3MLEA 1URPA 2BZ1A 4ENVA 1ZINA 3CNNA 2W6JD 3DV9A 3F97A 3EDQA 4ZIRA 4AI6A 4MWEA 1KYTA 2W2NA 5F1OA 1BOFA 1E1LA 4DSUA 2A9RA 4LGCA 4RPIA 5DXFA 4FKMA 2P77A 4RK4A 3GXBA 1MW9X 3ASYA 5DULA 1ZUHA 4A0FA 1JSXA 1SURA 2QM0A 3JQBA 2IHVA 1SNYA 3QKTA 4CM8A 3CLTD 4EUEA 4B8WA 5ITZB 3P94A 5E95A 1FYFA 3ZU6A 1PX0A 3TCXB 2O8BA 1TTPB 5L4SA 2BMJA 3UG6A 4ZJYA 2GN2A 1C0IA 4Y67A 4PRZA 1Z0KA 3AEUA 4AO6A 2NTNA 3AJ8A 1M72A 3GGOA 3UANA 3AONB 2VQEB 1SUDA 1RWPA 2M2IA 3SMQA 1R16A 2O0JA 3O1HB 3KQLA 2Y1CA 1YVPA 4DSAA 1ZI6A 2HLNA 2W37A 4B7XA 2XXJA 1B14A 1MHPA 3E2IA 4NENB 3WQBA 5CVUA 3S70A 1FSZA 3U7FB 4AS1A 1SJ9A 1VM6A 3H6HA 1E2DA 2ERXA 3LNCA 4HFNA 2FFJA 3NBMA 4EENA 1VMKA 2FMKA 3EQ2A 5DVZA 4Z53A 2PV7A 3WLLA 2QPAA 5K8IA 5B2EA 4BNKA 2LDBA 1V37A 5A3SA 3W5UA 2XYVA 4M0CA 1VLHA 5JBQA 2HY7A 1GOTA 1G5HA 1PWHA 1QVVA 3NRCA 5T4HA 1AN9A 3WSWA 3VDQA 1P1FA 1M8GA 5CVJA 1JXAA 1I4WA 2WJPA 1KQPA 5G1NA 4FWTA 1VP3A 4BVBA 1C2YA 2G1UA 4KNVA 1KKLA 1AOXA 4QTXA 3QU7A 4X8LA 4KODA 4RLFA 1I3NA 1ZO8A 2XZDA 4QPNA 4D44A 3OPYI 6NULA 2ZZNA 2FX5A 5IMBA 5BN4B 1U4NA 4XIJA 1MG5A 3Q9UA 4L3WA 2J3KA 1IDOA 3OQVA 5A04A 2UXBB 3IKJA 3FKJA 4IDFA 1VBNA 4YUXA 1JFRA 1FC0A 4YLYA 4K2AA 5CDFA 1W5BA 1Y6QA 4KQCA 5F3WB 5MN6A 4BNTA 3RIXA 2ZQ5A 2VKQA 1OE0A 5TF0A 2O6HA 5ISMA 4JJ4A 4LOLA 1V3VA 4YJFA 2BFFA 2FP3A 1GAWA 1RJ9B 2HSJA 4AMGA 1P7VA 2V7VA 4GAEA 1N57A 1WJGA 3IUSA 1WY7A 3KUDA 3EFOB 3DHEA 4PHFA 3JSAA 3QU5A 2NXCA 1M6VB 3DOUA 1ZU4A 3UA3A 1U7PA 1KVSA 1HTBA 2HA6A 2Q6IA 3NAQA 2FEAA 1NXTA 4IGIA 2B3DA 2FUCA 5FQNA 3WWPA 3K4PA 5JJBA 2CZCA 4INOA 1NFQA 5J58A 1WSWA 4Q4LA 3A6KA 2I66A 1ONPA 3PHCA 5I7UA 5HNKA 3C0KA 3E8MA 3FJOA 3UMYA 2YL2A 2GEBA 2VYFA 1T2VA 1EJ6A 4TS4A 2KBFA 1TQ8A 4OXRA 3MS4A 1TZMA 1HEUA 1VXOA 2FW7A 1NVFA 2H4HA 2DFNA 3DEJA 3K0HA 4HX9A 3VZPA 4NFHA 3OCXA 4GBMA 1XZJA 3MM4A 4Q48A 1ZJ5A 1UBRS 2BI8A 2W0MA 5AJUA 5HDBB 3HUDA 5JO9A 1KJNA 1REQB 2I3ZA 4BWVA 1TZBA 2EHDA 3JQAA 5BWBA 5F7JA 1I9GA 5K3DA 3R6TA 3ZD6A 1PZGA 1WL8A 4IAOA 4WKPA 1GTRA 1BEEA 4XARA 4Q3LA 3A1CA 4GZ5A 4W7HA 5A2QA 3WK7A 1E9SA 4G2NA 3WNDA 1Q14A 4DWJA 1SCJA 3UMJA 1YR7A 4MHTA 3FNBA 2QY6A 3UKDA 4JXZA 1KJQA 1SB9A 1FE8A 2XB9A