4MWTA

Crystal structure of human ppca (trigonal crystal form 2)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
b'APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal protective protein
molecule tags Hydrolase
source organism Homo sapiens
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwtA00
3C8HA 2XLCA 1XQYA 4H7JA 1AZWA 2WFLB 3IURA 2Y6VA 4WJLA 4X3CA 2I78A 1J1IA 2Y2UA 3O9MA 1ORWA 2BAGA 2WUEA 4C4XA 4H77A 1HL7A 2QVBA 3M81A 3H2HA 3WKCA 1AX9A 1WM1A 1EA5A 4HAIA 1FJ2A 3R3YA 4J0JA 5AKIA 5CH5A 1T4MA 2HM7A 3FLBA 4TPKA 5AKGA 1DINA 3EQ9A 4IH4A 1IVYA 1IMJA 2O2GA 1JJIA 3JWEA 3JW8A 5AI8A 2GYUA 2OAGA 5JADA 5EIHA 1CUSA 2HU7A 1DQZA 3G0BA 1W76A 2QRUA 3IUJA 3TJMA 2W22A 4UBOA 3B12A 4PSDA 2WG0A 3K6KA 5EGNA 5AO9A 3WKAA 5DYTA 1UKAA 2AJDA 3BDVA 5CT6A 1CQZA 1G42A 4Y7DA 4BP8A 3PDCA 3WL6A 5CH8A 1Y7IA 4DMFA 2DR0A 1SCKA 3AIMA 5AOBA 3BE8A 2HDWA 2HHAA 4Z49A 4DGQA 3BL8A 3ESCA 5FUMA 1ODSA 5AKHA 1Q83A 1YS2X 3LCRA 2XUDA 4UPDA 3SK0A 2ZSIA 1DU4A 5KBYA 1ISPA 4QWWA 4DSAA 5F4ZA 1K5PA 4BDSA 4H18A 2ZYSA 1O6FA 1X70A 2R11A 4J0IA 1CUEA 2WIDA 5AI6A 4PNZA 2O2HA 4LHEA 2ZJ7A 5C8VA 4UBNA 5DLPA 2XDWA 4JYMA 3H0CA 1SOMA 2XLBA 2XQGA 3ZI7A 4X92A 3H1AA 5IKXA 3DYIA 4BRZA 2J3QA 3I6ZA 4MEBA 1CVLA 5AP9A 3CCCA 1B6GA 3IUMA 4BVKA 5EHNA 5AKJA 4QEKA 1N5MA 1VXOA 2OLEA 5CT8A 1TCAA 2LIPA 3WK8A 3AFIA 1HQDA 5T4BA 5EIEA 4XWGA 4PSUA 1W6RA 3ILSA 5CRIA 5ALQA 1GPNA 4HS9A 4DNPA 3GA7A 4MYSA 4X85A 3FSGA 1DTEA 3BIWA 1LLFA 1AURA 1VLQA 2WG2A 2V9ZA 1WPRA 3VVLA 4BZWA 3I2JA 2XMBA 2Y1KA 3M82A 2VT7A 1QIFA 4LYEA 1CQWA 1G4HA 4Y2RA 1AUOA 3K2IA 4OUKX 4PQEA 4JYPA 4Y9SA 3CN7A 4EUSA 4E14A 2OCGA 5K5EA 4YK7A 3PUIA 4X7BA 1Z68A 5CXXA 3HXKA 2HA7A 3IBTA 5ALZA 3W2TA 3FLAA 4J03A 3WA6A 3C87A 3RLIA 1CUAA 1SC9A 2XMSA 2ZVDA 4X6XA 2QT9A 4Y2QA 5ALDA 5HCUA 3HC7A 5ALHA 2YASA 3M83A 4KAFA 4C6HA 3HABA 3MVEA 4N8SA 3GELA 4Q3KA 5A7FA 4H7DA 1L7AA 1TIBA 1IZ8A 5ALTA 5IVIA 1HLGA 3DKKA 3FYTA 3CN9A 4QWMA 1THGA 4K2AA 1DT3A 4OU4A 3E3AA 4DLNA 3WYNA 3TRDA 1MPXA 5FLKA 3WL7A 3DOIA 4B84A 1MT3A 3FYUC 5AI5A 3YASA 5FV4A 3NWOA 1IUPA 3OURA 2WU4A 4MYDA 2PSHA 2XQKA 2QMQA 4KAAA 4Y2YA 2HA6A 5FPPA 1UKCA 1QIMA 1WOMA 3PF9A 4X94A 1CUIA 4AMZA 2HA3A 1Y7HA 3ZLTA 1QFMA 3WZLA 3WL8A 2PPLA 4I19A 1A88A 3EIOA 1MAHA 3D3NA 1YB7A 1XFDA 3ICWA 1BCRA 2WHQA 4DNOA 5HF9A 2XT0A 1LPMA 2IX9A 4ZI5A 2BUBA 2VA9A 4A16A 1BS9A 2UZ0A 1VXRA 3I2IA 3T4UA 2XMZA 1CIJA 2BUAA 2JIDA 1I6WA 4AMYA 3RK4A 5LZ5A 1BN6A 1RYYA 5CH3A 5IVDA 1YCDA 3C6ZA 4DSZA 4HXGA 1XQXA 3NUZA 3HLKA 2FX5A 1HDEA 1CUXA 1EHYA 1XRNA 2GBGA 4A5SA 2AXEA 4UHHA 1J2EA 4EY8A 1W75A 5LYYA 4HRXA 1W52X 3I2KA 1QJ4A 4DMKA 4KRYA 5LKRA 4W1SA 4RE6A 2ZSHA 5ALLA 5T4EA 2GBCA 2WFLA 2GYVA 5ALWA 2WFMA 3VVMA 4UHCA 1VKHA 2GZSA 3AZPA 2VJBA 4Y2PA 5JD5A 5ALEA 4C87A 4BZZA 1VE6A 2VF2A 5ALRA 2HFKA 4M0MA 2C0QA 5HK9A 3WMRA 3ESAA 4QDZA 2ONCA 1QIEA 4ETWA 1YR2A 4BC0A 3WWOA 3HJUA 3WKEA 5ALKA 3S2ZA 4K5QA 1CUFA 1CUZA 3QPAA 2CZQA 2OCIA 2D5LA 2HL6A 3HRHA 1QE3A 3AJAA 5CBKA 2YYSA 1VZ2A 4PW0A 2Y2VA 3BIXA 4G9GA 4CCWA 1LNSA 4U2CA 2HA4A 5A62A 3BXPA 1QTIA 4FTWA 1C7IA 1DWOA 1AKNA 1O6GA 5BWBA 1OILA 4FHZA 1XZFA 2XUPA 2HADA 4KACA 5AI0A 4UFPA 3D0KA 1VZ3A 4NS4A 4UUQA 2PUJA 4BAZA 5A2GA 2QZPA 2PX6A 2ACEA 1TCCA 4G8BA 4OPMA 5DYYA 4UBLA 4FLFA 5AOAA 1YAHA 3C5WP 1P0IA 3F98A 5AKXA 1CUUA 4FFVA 2HA2A 1NU6A 1PV1A 1R50A 4UBMA 4MQMA 1CUGA 4HZGA 4GDMA 5A71A 3ANTA 2XMQA 2FJPA 1Q84A 3LIIA 3STWA 1XKLA 4XJVA 2X5XA 3G02A 1X2BA 4BVLA 4L3WA 3E1GA 4H7KA 3I6MA 1XZJA 4QDXA 1GKLA 1WHSA 3GROA 3QITA 5D3KA 4Y2UA 1CUWA 3SC2A 4QDOA 4JH0A 1XRRA 3FVTA 5T4FA 1LPBB 3STTA 2O7VA 1U4NA 3R3WA 2WU3A 1K8QA 1J06A 2CKMA 4EY4A 5ALXA 2PSDA 1WPXA 4KAJA 1TAHA 3O4JA 4P93A 1XQVA 5ALSA 4XIIA 1FFEA 2HIHA 1OXMA 4FNGA 3UMJA 3OM8A 4C89A 4Q82A 1EB9A 3LIPA 4ZXFA 5CT4A 1A8SA 1JI3A 4FLEA 3UUFA 4AQDA 2WILA 2O2IA 5H3HA 2XI4A 4BB0A 1AQLA 4FMPA 4BAGA 5HKAA 5HKBA 3H18A 4W1QA 3AINA 2CB9A 3LLCA 1CLEA 3QH4A 5AK6A 5I8PA 3BJMA 2WUDA 1LPOA 5E2IA 3BJRA 2XMCA 5DNUA 2XUGA 5JATA 5JAPA 1XZAA 3ZLVA 3G0DA 1E89A 4OB8A 1WB5A 1UT6A 3BF7A 3U1TA 4KEAA 2ZJFA 2G63A 3FSGD 2Z8XA 1QIKA 3G9ZA 1ZJ4A 3FOBA 4M0FA 4BCDA 3W9UA 4B0PA 5BV7A 1H22A 4K6KA 3L1IA 3VJMA 5E4JA 3C70A 4B7ZA 5JD4A 1RP1A 3S8YA 3KWFA 3WJ1A 4J0HA 4LXIA 5AM4A 5E4YA 3WKDA 5LP1A 1GZ7A 4GI1A 4Q3OA 4ARBA 3QMWA 4LXHA 1ZICA 1JJFA 1UOOA 1QLWA 3WK6A 5AKYA 4H7HA 1BEZA 1M33A 3FYUB 1DWQA 4RPCA 2Z5GA 3FYUA 4G4GA 1JU3A 2JEZA 2GYWA 1JMYA 4TGLA 4LYDA 4FNMA 4ZRDA 1XLUA 2VAXA 4ZWNA 2VAVA 2XUIA 5KWIA 3SWWA 1XZIA 4DM7A 3PICA 4J0GA 3IUQA 3HACA 1DT5A 1H2WA 3OG9A 1QIJA 4KRXA 1LBTA 3G0CA 3IVMA 5EIAA 5DYWA 5D6OA 1LBSA 4Y2JA 2WG1A 1FFAA 4J3JA 2OQVA 3C43A 1ODCA 4BTVA 4IH1A 1XZMA 1YAJA 3WJ2A 5DNVA 1E3QA 2GZRA 5K3DA 3HSSA 3NGMA 3F8SA 3C6XA 3G8YA 2CBGA 2IITA 2E3JA 3HI4A 2G5TA 3H2GA 3AZQA 1R3DA 4BYMA 2X8BA 3VJLA 3WYDA 4CCYB 4EBBA 3D7RA 1Q0ZA 4J0CA 2ZYIA 3QVMA 2GBIA 2DHDA 4KE9A 5AI9A 1EI9A 2ACKA 2H7XA 3A2LA 1BU8A 1W1IA 3L1HA 1Q0RA 1RWQA 2HA0A 3F9CA 3PI6A 4X6YA 5CW2A 4BAUA 1CFJA 1ACJA 3RM3A 5BWCA 3AIKA 1IZ7A 2I03A 1XLVA 3IB3A 1EDBA 3BF8A 5A7HA 2CMFA 2XE4A 4EHBA 4E46A 3PF8A 2C58A 2ZYRA 2DFPA 1DQYA 3ESDA 2PL5A 2ZJ6A 2WHRA 2X76A 3E4DA 5ALFA 4NMWA 4E15A 2BFNA 3DQZA 1TK3A 3FBWA 3EQ8A 1FFCA 5JASA 1D07A 3LP5A 2HRRA 1WB4A 4EB0A 4UFNA 3D2CA 3D2BA 3C45A 1MJ5A 2PSJA 3DL4A 1UK6A 5D3ZA 1E8MA 1S8OA 4GWLA 3I1YA 1FSSA 2JGMA 2DSNA 2J3DA 3JYHA 2H1IA 7YASA 2AJLI 5ALVA 5LZ7A 1R1DA 4BCCA 2VTVA 2VJAA 4KYVA 4BC1A 2FUKA 5AK4A 3GBSA 4F0JA 3HZOA 5CT5A 4DTCA 3LS2A 4X93A 1EVEA 1R9NA 3C6YA 1MTZA 4G8DA 5HFNA 4C88A 2XUHA 1XRQA 4HTAA 5ALNA 2JGKA 3WKBA 1MX9A 1Y37A 4C01A 2RONA 1EDEA 2OCKA 5K3FB 1K6EA 3DKRA 1VE7A 1QO7A 3GFFA 1CR6A 4BDTA 4AO6A 5AM5A 5LZ2A 4OD0A 2XQJA 4EA6A 2I3DA 1XRMA 3DLTA 4N8EA 5CTAA 4B85A 3HEAA 4RE5A 3FCXA 4J7AA 3IA2A 4ZV7A 3UUEA 2VT6A 3V48A 1CUVA 3FLEA 5HK8A 1LZKA 2VSQA 3I2FA 3A2MA 1SCIA 2XQIA 4GLBA 4AB1A 1HPLA 2WFZA 1LPAB 4X97A 3ESBA 1K63A 4Q3LA 1EK1A 3W05A 1PJAA 1HKHA 3PFCA 3V9AA 1UXOA 3DL7A 4ITVA 4B83A 2IIVA 3DJYA 3WWCA 4IHAA 3C5VA 2QXTA 4N5HX 3WL5A 4QZVA 3AIOA 5JIBA 4WFIA 4FLMA 4AO8A 4AZ0A 3A6ZA 1DX6A 1YA4A 2ORYA 3DD5A 3WLAA 4NZZA 5JZBA 2BJHA 4LIPD 3STVA 2HU8A 4L0CA 2OGZA 4B6GA 1U8EA 4Y2VA 4KE6A 3QMVA 1R88A 1XZLA 1N1MA 3O4HA 4MJ3A 2HRQA 4UHEA 1ZIYA 4C4YA 3F97A 3VKFA 1WCYA 4X6UA 3ZPXA 3G0GA 3QMMA 2QS9A 1XKTA 3AZOA 4AZ3A 4AX4A 1L7RA 3R3XA 2WUGA 5CXUA 2DHEA 4QA9A 3V1NA 4Q1VA 2C0PA 3C8DA 2BGRA 4LXGA 1QOZA 1ODTC 2XMRA 2QJRA 1TCBA 1N5RA 3I28A 2WLSA 5DTJA 1LZLA 5C8XA 3WA7A 2NW6A 4DMHA 4QLAA 4QE3A 5AJHA 2OG1A 5KWJA 5AIBA 3WWEA 5FRDA 1W4LA 2OQIA 3O9VA 3ED1A 5E4TA 3WK4A 4PO3X 5BOVA 2WSLA 1GGVA 4FFWA 5EHQA 3WIBA 3H1BA 4GHWA 1TQHA 3DNMA 2WJ6A 3RARA 1ZD4A 5ALMA 5JANA 3VISA 3QZUA 1UK8A 4BCBA 4MWSA 3V1KA 3WZMA 5IVKA 3VXKA 2QXUA 4MEAA 1XZCA 3CXUA 5AM0A 3WK7A 5AOCA 4M0EA 3R3VA 1JJBA 1DWPA 4RNCA 1ZGBA 3STXA 5ESRA 3ZWQA 3SX4A 5HF8A 2VATA 1EINA 4G1FA 1F0PA 3DCNA 1TRHA 2Q0XA 2C5GA 5HQ3A 1ZD3A 4GXNA 4QDUA 4AN0A 4KJXA 1EXWA 1UOPA 3OOSA 2C5FA 3H2IA 1UK9A 3STUA 2PSFA 5DNWA 5JD6A 1FFBA 3H04A 4BE4A 2XUAA 1F0NA 3KDAA 4AXBA 4EZIA 4JUIA 5EFZA 1JMKC 5ALYA 1VJ5A 3A2NA 4G4IA 2OAEA 1EVQA 2YXPX 3O4IA 2V96A 1JFRA 1U65A 4IQ4A 4X91A 3AUKA 1P0PA 1ZI9A 4KE7A 4UHBA 4FBMA 4BATA 2G5PA 1CUCA 5HF6A 3STYA 4A23A 4Q34A 3IUNA 4BRSA 4FKBA 4S0XA 1GPKA 3VDXA 4CFSA 1XROA 4XVCA 3WWDA 4TVKA 1H2ZA 2WM2A 5AIAA 5FP0A 4U2DA 4WCVA 4DNFA 4UBIA 1BE0A 1BRTA 2QM0A 2AJBA 1G66A 2Z3ZA 3G9XA 5JZ9A 1CEXA 1H23A 5ISMA 1C4XA 5AM1A 4HXFB 4HXEB 1YB6A 2WUFA 3I6YA 1NU8A 4G4JA 1ZD2P 1UOQA 1VA4A 2JBWA 1R9MA 1L7QA 2ZYHA 2RAUA 4YPVA 3R3ZA 4IH9A 1CUDA 4DMCA 1EH5A 1VA5A 3G9UA 2R8BA 1JT2A 3WQHA 2RIPA 4BP9A 3FWHA 4UHFA 3KD2A 5T4HA 1MX5A 4ZGBA 4KR0A 4OSEA 1MNQA 2RHTA 1XZGA 3PE6A 4N5IX 2GBFA 1LPSA 3TGLA 5IVHA 2WIGA 4ZV9A 2XMDA 5EHXA 5J3JA 6YASA 3R3UA 1EB8A 1ZJ5A 3B3QA 1HBJA 3BWXA 5ALPA 1GKKA 1LPPA 4G5XA 1QTRA 5AHXA 5ALIA 3N0TA 4GECA 5JALA 3PUHA 5A7GA 4CI9A 4D9JA 2P8SA 4B9EA 4Y2TA 3I2GA 4W9RA 5AKLA 4QNNA 5D7BA 4X71A 4UHDA 3MUNA 5ALUA 3C6BA 2XUOA 4DYHA 3QPDA 3X3HA 1EDDA 2DCMA 5KREA 3GZJA 3O0DA 4DNQA 2JGFA 3U0VA 2PM8A 5JAUA 5SYNA 4ROTA 2V98A 4CCYA 4RGYA 3MUOA 1QZ3A 1PFQA 2XMGA 5JZSA 1TKRA 4INZA 1XZKA 4GBGA 1GPLA 1QIDA 1ZGCA 3D5EA 3H2KA 3W04A 1H2YA 4WY8A 3FVRA 1SCQA 1CUBA 1A8UA 4U2FA 4GW3A 2I3ZA 4F5ZA 4IO0A 1SFRA 1QO9A 3KSRA 3W06A 1MN6A 4FWBA 5ALOA 1CPYA 5IH7A 1JKMA 3WIOA 5HQ3B 2FJ0A 5AK5A 1ZD5A 2PSEA 2JEYA 3I2HA 3QM1A 4H0CA 2RGUA 3DDUA 1AMNA 2PUHA 4EY6A 4UBKA 1MAAA 1H2XA 3D2AA 2WHPB 1F8UA 5FDFA 5LZ9A 1YS1X 2WTNA 3DYVA 2HU5A 1WB6A 2VQ6A 3QPCA 5JYCA 3V1MA 3QBJA 1XZBA 1OCEA 1KU0A 2QUBA 3OPMA 3CCBA 5YASA 1AGYA 4YX9A 1C7JA 4L72A 4CIBA 1FFDA 4X95A 5FPQA 3GUUA 5LIPA 3FAKA 1P0QA 3O95A 3K9BA 5EI5A 2DQZA 3O4GA 3A70A 5I7UA 1IUNA 3ANSA 1A8QA 5AKZA 2O7RA 1ZIXA 1VOTA 4DIUA 4OB7A 1USWA 2ECFA 1MO2A 4EY7A 3V1LA 3IIIA 5CMLA 3G9TA 3IDAA 1UZAA 1BROA 3W9BA 3B5EA 4MQLA 1E5TA 5AM3A 4OB6A 2CEKA 4U2GA 1QIHA 4B80A 1N8SA 3FNBA 4OU5A 3DEAA 4UFOA 4BTLA 1ZI8A 4YASA 3ZLUA 5DJ5A 4OCZA 1THTA 4B9AA 4PV7A 3QYJA 3D59A 1CRLA 4F60A 4QLOA 1XRLA 2DQYA 2BCEA 1X2EA 4K6GA 3VJKA 4UBJA 4WFKA 5C8ZA 4CG1A 3WI7A 2WIJA 3WK5A 5HF5A 2JGEA 4Q05A 3AILA 3M3DA 4P08A 4FDMA 3EBLA 1BEEA 5FOQA 4WFJA 2JGLA 2Y6UA 3Q8WA 4JNCA 3BDIA 1ZOIA 2CUTA 1XZEA 1MU0A 4P92A 4I4CA 5ALJA 2EDCA 3R0VA 1UFOA 4GEGA 5AICA 4W1RA 3EF3A 2WJ3A 1XRPA 1QGED 1UKBA 2PU7A 4N8DA 2JF0A 1G5FA 5AK3A 1ETHA 1YASA 4B0OA 1XQWA 2XUJA 5C7YA 3WK9A 2OCLA 4V2IA 3R40A 4HRYA 1A7UA 5CT9A 1EX9A 4PF1A 4WY5A 1KEZA 4I3FA 2WQZA 1YA8A 2Z3WA 4AO7A 1GQSA 4B81A 2K2QB 1NX9A 4MXDA 4K6HA 1F6WA 2QUAA 2V97A 4U2BA 4C4ZA 3F96A 2HFJA 2ES4A 4Y2SA 2XUQA 4L9AA 1U2EA 4H7FA 2QOEA 5JAOA 1ACLA 5HZGA 2WHPA 4NVRA 2AJCA 4O08A 1E8NA 5HFAA 5C81A 2C7BA 4J0KA 5AKEA 4KE8A 2D0DA 4J0DA 4P9NA 2B61A 2G4LA 1XZDA 2HA5A 2VJDA 2XB6A 1YSCA 5DWDA 3F67A 1E66A 1WHTA 5AM2A 3FCYA 4X90A 4CG2A 2QR5A 1E8DA 1P0MA 2W6CX 3G0IA 5ALGA 2OPHA 1ZI6A 1EK2A 3TEJA 3H17A 4OYLA 4BVJA 3KWJA 5K3EA 4W1PA 2VJCA 2RHWA 3L1JA 1CUHA 1T2NA 3DOHA 1AC5A 2J4CA 5LZ8A 1XZHA 4FBLA 4OYYA 2VEOA 5A6VA 2WJ4A 5JARA 5LZ4A 4CG3A 2QKYA 5K3BA 4F21A 5K3CA 2C4HA 2WIFA 4H7IA 2WTMA 1BCSA 4HVTA 5AI4A 2JGJA 4G9EA 5FKJA 2PBLA 1GT6A 4QDTA 2PKYX 4CIAA 2OXEA 3OC0A 1DX4A 3R41A 4WDRA 2YH2A 2RI6A 5LLSA 1LPNA 2B9VA 1JU4A 1MNAA 2PVSA 3PFBA 1QIIA 4E11A 3IULA 3P2MA 1BN7A 2QTBA 1IUOA 4FOLA 2Z8ZA 5CURA 3ZV7A 1ORVA 1K4YA 4G8CA 4JEIA 3DS8A 3KXPA 4X00A 5FXMA 1CUJA 1CV2A 2BKLA 5I9IA 1LGYA 4EY5A 4ZREA 4LKOA 4AN1A 2DHCA 2XUFA 3EQ7A 1MX1A 5EHZA 2EDAA 1R4ZA 2EEPA 3G7NA 4B82A 1GXSA 4U2EA 2ROQA 1UWCA 5AKKA 2QJWA 3MGAA 1GQRA 1KU6A 2H7YA 5AH0A 3H19A 1XLWA 2XUKA 5K3FA 1CUYA 2WIKA 2XQFA 3ICVA 3KOOA 5SYMA 3T52A 4W63A 1QIGA 2AJ8A 1B41A 2B4KA 3Q0TA 3D4LA 4MWTA 2BUCA 4BE9A 2JGIA 3OTQA 3WWPA 2J4FA 4H35A 4ARAA 3E0XA 1J07A 2B20A 5JAHA 2H9YA 2OGTA 2PU5A 1UK7A 4BBZA 4XX1A 3I1IA 5LKAA 3HYSA 4H7EA 4Y2XA 2WKWA 2CJPA 2H7CA 5K3AA 2BGNA 5DTIA 3H2JA 3NOXA 3N2ZB 1QONA 2OGSA 4WDQA 1QFSA 3RKSA 4PSCA
chains in the Genus database with same CATH superfamily
2H18A 4I3GA 1Y42X 1Z08A 2JD2A 3C8HA 3ORQA 3GNTA 3L05A 4O1IA 1G2OA 4DABA 1C3EA 1DOAA 3ZQ4A 4F9FA 3L92A 3F6EX 3OLVA 3P7MA 4PXSA 5THXA 4NENB 1NNSA 2RG7A 2C5EA 1J1IA 1BRMA 1YOBA 3LDAA 2KQUA 3TRJA 4EF4A 4F4DA 3HJAA 4B46A 1WDLA 2Y99A 4EGFA 2GFQA 4ER3A 2PE5A 2D5AA 3IDFA 1X38A 5H4GA 4C4XA 3QWBA 3A1VA 4HMPA 2G04A 3NBUA 3PX3A 2TSYB 1HL7A 3LTNC 2E4VA 2JJ2D 1RAFA 2W0SA 2W0MA 1VIDA 3LWDA 3O1IC 3P2IA 4ZKDA 2NO9A 4DRYA 2OCYC 1X86B 4WESB 1WM1A 3BK2A 2JIZD 1V9SA 3ORYA 1FJ2A 1Y3HA 2CNLA 5C3MA 4O1MA 3COZA 1KH3A 1TL7C 4RVGA 5AKIA 3PDIB 4JI4B 1ZLYA 5B53A 1UP7A 3D6NB 3DPSA 5A5DA 3ZD6A 2C4MA 4MEJA 2YC2C 2H11A 2NXNA 2QBYA 4RYLA 1EVKA 1G55A 1PBTA 4G0NA 5LBTA 1KHHA 2F1KA 1O57A 1G38A 2X0NA 3MWDB 3OOHA 4QTZA 1NVBA 7MHTA 1CZOA 1O8BA 3TNDA 1JJIA 4ZIRA 1T2FA 4GOJA 5BV1A 3QWFA 1ZINA 2ESRA 5HX7A 2VAWA 2O2ZA 4LGMA 3JWEA 3EZ6A 4ND5A 1PZMA 5AI8A 2GYUA 4QICA 5JADA 3D8NA 4LJAA 5EE9A 4MKZA 5EIHA 5HGXA 4B7XA 1ILWA 4DR2B 2UUCB 4O8CA 1DQZA 5I48A 4OVKA 3W8EA 1W85A 5LLTA 2JHFA 3IKLA 4OFZA 1JZTA 3R5TA 3R0ZA 4R41A 4UBOA 1F2DA 4LZLA 4DANA 1L6IA 1RE1A 3UF0A 2N3ZA 5E1DA 5DGHA 4Q7QA 3K6KA 1J5XA 3Q12A 1VQ1A 5EGNA 1P19A 3K0SA 3BCUA 2OFOA 4YLEA 2V7PA 1GG8A 3HWSA 2AR0A 5A3VA 2O8DB 2EZTA 4AFNA 1G42A 1U0NA 1J00A 2FE1A 2FUG1 3O6VA 4KDEA 1EA7A 4NEQA 3KV1A 3TUJC 4DJFC 5AW8A 1EFPA 1RAGA 1S2NA 3RI3A 3BXHA 3PDCA 2GETA 2N1BA 2WTEA 4R51A 3E22B 4RO0A 1R8JA 5CH8A 1TYAE 3IKTA 1ST3A 3ETLA 2DR0A 4D0RA 2VRWA 4YLYA 2J0SA 1L5VA 3A1TA 3ZHXA 1OI3A 4EMSA 1JMVA 3GFGA 4DGQA 4BFVA 1Q1ZA 5I7AA 5FUMA 3JQ9A 3ZC3A 3LOUA 2QGFA 1LSOA 1ODSA 1Q83A 3JQRA 4WCDA 1VPTA 3WYAA 3ZTYA 4BB9A 5K8JB 1ECPA 3LCRA 3ND7A 3NWEA 4XB1A 1OAOC 2CXPA 1BGWA 4KXVA 3WWZA 4ALMA 1PT6A 4UPDA 1QCZA 3SK0A 2V3CC 4E5DA 1LBEA 1APBA 1L4YA 4HLQB 1DU4A 1NKTA 1NQOA 5KBYA 4QWWA 2WZDA 1HC7A 4DSAA 5F4ZA 2PBFA 3LCUA 4GLJA 1GU7A 2QDKA 4Z9BA 1JV2B 2QD5A 3OICA 4FYXA 2W4IA 1K0UA 1D6SA 2ZT7A 3HADA 3RUAA 4XSVA 3LUKA 1T43A 4B4KA 2R11A 4EWLA 1IZZA 2OV6A 5JO9A 3PR2B 4NYIR 2BGIA 2RK4A 1IQRA 4Q3NA 4LHEA 2G4VA 3VO9A 1OROA 1ZHOA 3PJFA 2XDWA 4GT1A 3U4QA 2UZAA 3GGCA 4FM9A 5BWMA 3R5SA 3KTAB 1WD7A 4R8SA 5EJ2A 2VCEA 1L9XA 1ISIA 2V7WA 3H1AA 5G1OA 4NXNB 4REQA 3K32A 2H2DA 3G8CA 2J3QA 3GJ3A 3B7GA 4AKSA 4EUEA 5LC1A 5B4UA 1HFKA 4AY6A 3I0NA 2D62A 3K1JA 3D6MA 1T4GA 3IUMA 1B6GA 2I4RA 4BVKA 3E9MA 4P7KA 1J5PA 5EHNA 3Q6IA 4NU6A 5AKJA 3QA3E 2Z1NA 2P9CA 4IIJA 4GYJA 4QEKA 4TTPA 3S2GA 5KNCH 1VXOA 1RYNA 4FEEA 3HCBA 3Q41A 4GI2A 2IV2X 4I1IA 4PGAA 5K01A 1LC0A 2LIPA 3H9CA 1AMOA 1YL6A 1BCRB 1Z73A 3BGDA 3WK8A 4KREA 3FZGA 2B78A 4JELA 4V03A 3TZKA 5JQGF 5SZIA 1QYVA 3BMCB 3FE2A 5T4BA 2X5NA 3K09C 5FUXA 4MAAA 1MRZA 3UKJA 5AHWA 2F4NA 5BR1A 1W6RA 2ZJOA 5CRIA 1GPNA 5K4GA 4BQIA 5F7XA 2PZGA 3NBAA 3C98A 1ABEA 2QTNA 2VUUA 4FEGA 4PLWA 1LLFA 1JYFA 3DBVO 3LO5A 2KLHA 2P6PA 3W3AH 5BN5A 3W3AA 3DEZA 4MHOA 2BHNA 1G3IA 4HEQA 4OI4A 4QYXA 1FTWA 3PNQA 4I1UA 2V9ZA 4OHBA 4A6PA 4WXRA 1D4AA 4YS6A 1NZJA 2QJFA 4EUKA 3BICA 3O8OB 1OU0A 3B2NA 3P9KA 4W5JA 4LMAA 1CVIA 1AK9A 3T5TA 2MHCA 4Q7LA 5JO0A 5SV2A 2BMWA 3AJRA 3F74A 3B36A 4MVJI 3VR5H 4AY3A 1O03A 1RAHA 2BJVA 4MWGA 3TOCA 3OZFA 2MOKA 4E4RA 4F06A 4RSMA 3ITKA 3KB1A 1SHKA 2XMBA 3C85A 4DHEA 1CY4A 4MVJA 1VYVA 4HVLA 1IXYA 2ZIFA 2FI1A 4G0YA 1GZSA 4N5LA 1UKZA 3B1XA 3LUPA 1AGPA 4LYEA 1QV7A 1XD2B 2PZ8A 1CQWA 4NMMA 4GL2A 1BC5A 3ZGNA 4ETMA 4XD7A 1I30A 2BFBA 1K8ZB 2OT3B 3KJZA 4FFBA 4BMXA 3UAVA 5KCZA 5CA1B 5D6NA 1NMYA 1SG6A 5JLAA 3ZLBA 4PQEA 4Y1GA 5A1TA 5JWOA 1U3WA 2EKDA 4EUSA 3ZWPA 4E14A 2Z08A 2OCGA 4JN6B 4XVHA 3TKAA 4AL4A 1U6KA 4YK7A 2D6FA 5BQ3A 4QC2A 4Z0PA 1I2BA 1XK6A 3LP6A 5G02A 4B3FX 1VL1A 3W5BA 4NCBA 2WKSA 2PH1A 5CNJA 5K0LA 2QU8A 5CXXA 3EPHA 1ZJZA 5ABPA 2PT9A 1N5LA 4L0QA 3M5CA 4CN8A 3MS7A 4ZJYA 2HA7A 4KQ1A 1T8RA 3IBTA 1EWRA 3FLAA 4ALIA 1WY7A 3JQCA 2P4SA 1VM6A 3HH8A 1RCUA 3KYDA 2W6ZA 1CY6A 4P5EA 4ZC8A 1Y1LA 4DR1B 3C87A 1QH1A 5F1YA 1T2VA 4AY5A 1CU1A 3MGBA 2CKDA 3AO0B 2F9MA 4IX1A 1JKFA 3HSKA 4AZTA 1M0SA 4C22A 4X6XA 2H1SA 3MAAC 2HCRA 2DFLA 2O52A 5IAJA 1CZLA 1AUQA 2Y1CA 5HCUA 3R7NA 1D2CA 3IVRA 1ISFA 4MR9A 2FN4A 3DLPX 1QQBA 1YK1A 4NHOA 4YAOA 5ALHA 4KAFA 3IOEA 4HSEA 4N8SA 3SEAA 1UC4B 2VEDA 4RPLA 2X5JO 5KWSA 1B14A 3C3JA 1XLTA 1P33A 2QMYA 5A9RA 1OX4B 4OX9Y 4V0NA 1U81A 1IY1A 3E7WA 2Q49A 2X2EA 4YYEA 4AW9A 2AN5A 4WEOA 1Z7EA 2C54A 3BH7A 4D80A 3RJ5A 4D45A 1IZ8A 5ALTA 3EGDB 1F8GA 1VL8A 1W49A 2NSHA 2EKQA 2YWJA 2ZYGA 3D7KA 13PKA 4FONA 3EWNA 3FYTA 3CUYA 5JYEA 2X8JB 4UREA 3HXMA 1E2QA 1E3SA 2FMKA 3NHKA 3QVUA 1DT3A 2XEDA 5LNK1 4EHJA 4DLNA 3TLXA 3K6SB 4F8JA 1FDTA 3MGCA 2FF5A 4HFMA 4G36A 3AFOA 3JQ7A 4ZT4A 2H3EA 5FEMA 4JCCA 4ARSA 5BW4A 3O8QA 1ZCAA 2EVWX 3TQIA 2PMFA 1IUPA 2ZITA 3EVGA 3KAKA 3OURA 4FGKA 3PHJA 4HNRA 1KDYA 1RZUA 4B7CA 4YCCA 1QC5A 3GN1A 3CRNA 3L8YA 3D6VA 3T99A 1X7DA 1H1LB 1VKJA 4D81A 1AHNA 4BQNA 5JXIA 4NH0A 4CNBA 4B6EA 2FUCA 2N42A 2H1RA 4P4TA 1KWGA 3ZXYA 1LQUA 4KAAA 3KXLA 4IUCS 5EUBA 5LP6B 2RGXA 1K9VF 1VGQA 1T4BA 1WXWA 2CVPA 5IW8A 4MW2A 4ISBA 2Q50A 4KWIA 1I9CA 1V3TA 5FPPA 5KX5A 3OLQA 4V3BA 1UKCA 1L5HB 5H16A 2IZ6A 3R9XB 5G53C 1U8XX 2AFHE 4B5LA 4JOCA 1E2LA 1LC3A 4MH0R 2QE7A 3ILHA 4AKIA 2PS3A 1SKMA 2QMUA 1GY8A 5AW0A 4OBXA 2HC9A 1W581 1MOSA 1K98A 1T4DA 4UNIA 2O1EA 4RTLA 2PA3A 4X94A 1RNLA 2KPOA 2GD1O 1S2MA 5DHQA 1T36B 1V1JA 2ZB4A 1A9SA 4B7AA 1SXJB 4NLLA 2UAGA 3ENKA 4ERNA 1FMLA 1VHJA 2G7MC 1MB3A 2JJ1A 4D5GA 2RC6A 5MDHA 4WOPA 3A4IA 2EP7A 2DH5A 2FPRA 4O2AA 3RRYA 2P7IA 3OBIA 1XFDA 3QVGB 3OF5A 2JKVA 1BCRA 4WNIA 2WHQA 4DNOA 5BSEA 1SM4A 3EF0A 2XT0A 3LPMA 2ZRHA 4WKOA 1M73E 3A1DA 2OBNA 4O1HA 3ZWNA 4GX1A 1YR9A 3P9RA 4CMHA 4RJIA 2P5YA 3GPBA 4A16A 3WTBA 1JIUA 3GL9A 4FI3F 4W5OA 4D4MA 2RI0A 2X0FA 1SBYA 2O0KA 2VDJA 5THQA 3FTPA 4QECA 3GEEA 2WMYA 3QQPA 2W71A 2XKJE 4Q93A 3UY4A 1T29A 4N0DA 3L8GA 2W2MA 2V6BA 3I30X 1IB0A 1C0IA 2C4UA 2IF0A 3T4UA 4Q9NA 1CIVA 3SXJA 4PHFA 3PZRA 1JLLA 5JEEA 4Z99A 1JBEA 3G85A 2BUAA 2RAFA 3UJHA 2HSZA 4NESA 1MQ8B 1JVSA 2HCTA 4D9CA 4M7PA 3VU9B 1P29A 4PN7A 4OAPA 1ISMA 1NA5A 3GLSA 1RJWA 4JI5B 2RHOA 4BN5A 2NV0A 3S1SA 1O58A 1RYYA 5CH3A 4AWXA 1NW5A 4WCFC 2W5UA 3DA8A 3NIGB 3OZIA 1B4DA 1WUYA 1AKMA 1YCDA 3C6ZA 1M8JA 4B33A 4DSZA 1GTG1 2QRJA 3VR3A 4EW6A 3QUSA 4WX2B 3AEZA 4UZFA 2GDZA 1VCNA 2J7KA 3NUZA 3P0EA 3DH0A 3HLKA 2ZRFA 3ONDA 1KI1A 2ZYUX 3M6WA 4K28A 4TQUS 1J2RA 1EHYA 2FWBA 2QVXX 3U9SA 3A6GA 3BMCA 3PXEA 5KNBA 1DWUA 1A9XA 4IYJA 3BX1A 4RHTA 4UHHA 2PT7A 3LT5A 1Z4KA 2NYVA 4UTOA 3G2LA 2BFBB 1KY2A 4FFBB 4HS4A 4JLNA 3WR5A 4Q37A 5K09A 1J2EA 1UBCA 3EAGA 4CXMA 1YNOA 1XF9A 1SHZA 4G09A 5HCNA 5LYYA 1GGJA 3VPDA 1NVFA 1N8NA 2BL4A 3HWRA 3M4YA 4Q3CA 5TPWB 3VYUB 4D3DA 3ONEA 2BE9A 3R6TA 2PZFA 4FPXA 2O05A 5CAEA 1P2FA 3DOOA 3GDHA 4MUBA 2BGMA 1OXXK 5EZYF 4AJLA 2FMTA 1VL5A 3F6BX 3AL0C 4PRLA 3DBHB 3DUFB 3PNKA 1E5XA 2ZRIA 2WUWE 2WAMA 3QLVA 4RE6A 1U1DA 5EIWA 3FF1A 2G9QA 2J0EA 4IG4A 4M49A 4EHLA 1BFDA 4BKRA 3PD1A 5FEUA 2PD4A 1R0BA 3VVMA 4C21A 3EODA 2O8DA 1OJ7A 3RJ9A 1AO0A 3Q1LA 1VKHA 4CQNA 5EL0A 1A98A 2AUMA 3JYLA 4MRRA 3X1MA 3DMPA 4AVYA 5TMPA 2WB2A 3AR9A 2ERCA 1O95A 5DM0A 4WI1A 3OMLA 5DZSA 1J56A 5CYFA 3UT5B 5CD1A 2PQ0A 3PJEA 3MLEA 1NDHA 4RS4A 4RA9A 5A3QA 3FBTA 2G8NA 1FB5A 3QY0A 2CVFA 2XQVA 3IBCA 1E0SA 3LK6A 3WYGA 3DOFA 5TQ0A 3U80A 4G0OA 1HDRA 1I3CA 1P17A 2IHUA 3UAXA 3ZS9A 5LP6C 4F2DA 1P0FA 4WEQA 3PQ7A 3OFKA 2IGBA 2H2AA 1WKVA 4ZZ0A 5HIJA 2BM1A 1DPFA 1DBIA 1RS0A 3L01A 3PLNA 3W8NA 4CM9D 4FHFA 4OQPA 1TKBA 4KX5A 5JD3A 4DLXA 3TG2A 1M6HA 1YKSA 2ONCA 1WVGA 1YDEA 3TR0A 4ETWA 2NUTB 2GDJA 1XNHA 2OILA 3NM4A 4ZO8A 1GRRA 2Q6LA 4H6XA 5GM2A 1BQ3A 1RTTA 3TW6A 3ZZ0A 4A8HA 4RKYA 5FNVF 3S2SA 1E64A 1EGVB 3FNEA 2VHCA 1ZM4A 4F3YA 1SWWA 4Q4LA 2V74B 2HWUA 2D5LA 3MLBA 4HDAA 3CX6A 2R7LA 4MIOA 3T9AA 2ZBQA 3OQ6A 4Y6PA 4RJKA 5B7NA 4O2RA 2LRHA 3P2JA 4MWCA 3OKFA 5K7SA 5C8YB 2WJYA 3ZKAA 5EJ9A 1RWMA 1YK0A 4L0DA 4PW0A 2Y2VA 4CM3A 2O2CA 2E87A 1FE8A 3QOWA 4X63A 1S2OA 2XTMA 1EXMA 1RRKA 4CCWA 4REQB 4K9RA 1PJ8A 2RGDA 4MWDA 4NH4A 3N8HA 3PK0A 2O8CA 1DRJA 2XCUA 2YZKA 3KJIA 3VX3A 2YVKA 3Q98A 4IS3A 1LEHA 3AVQA 3SQOA 1ISRA 3OO0A 1PR4A 2PS0A 3ZK7A 4ZOLB 4AP9A 1NR5A 3ESYA 1Z0DA 2REOA 1QTIA 1W88B 3UAZA 3ZCVA 1NM5C 1C7IA 4KBGA 1BE8A 3DQQA 2W4QA 3S1LA 1F3OA 3CT6A 2WWGA 2I1VB 1L0BA 1D5CA 3G68A 4H9GA 3DBRA 1NQWA 1OILA 4QG3A 1XZFA 3C41J 2P9GA 5KSYA 2ZI5A 3MELA 4HAWA 4DA8A 5JS8A 1BNCA 3NYRA 4J07A 5I3CA 1KETA 3KPWA 4LSZA 5FAXA 3PQ5A 2BT4A 3ZV6A 1VZ3A 1C8KA 2QTFA 2QY6A 2PUJA 1WXDA 4MMZB 3B5IA 3F6SA 1QG0A 2QZPA 4U9UA 3BC1A 2R66A 3VZBA 4B4WA 2ACEA 5CDYA 5UKDA 1TRKA 2O8FA 2P6NA 5ESDA 2FHPA 2YQ4A 4CDMA 1NBEA 4FYMA 4UBLA 2XDQB 1XB2A 4DDTA 5T6BA 3T1QA 1F7UA 4HH3C 4NOKA 3W4KA 4FLFA 1YAHA 2DF8A 4Y98A 4LOAA 1DTWA 4TQGA 4D44A 4OXIA 4ZVMA 4AF8A 3ZU2A 4GLOA 5FOSA 3RIYA 4O2AB 5EQTA 3WX0A 1Z6AA 5KKAA 4WINA 5EWJB 3CWCA 1C8LA 4TMXA 4EYKA 3A3OA 2PL9A 1NPDA 1NU6A 2QPLA 1KYYA 4F8EA 3VH3A 4XCXA 4J75A 4QIHA 1QHEA 1T2UA 3EF1A 3EVDA 3GLKA 3R0QA 4XFKA 5H3CA 3P45A 3R7FA 3AVXA 4TX1A 2NYUA 1ECJA 4JGBA 2MR6A 2A9VA 3ZHZA 2NMVA 5DGTA 4EGQA 2HT1A 2XMQA 2FJPA 3KOUA 4EJSC 2YWGA 2IYUA 5JSQA 3EPRA 1NM5A 1AS2A 1EWTA 4QOFA 3STWA 1V9LA 4BO8A 3G02A 3JAWA 3PYXA 1FZQA 4AJJA 1CZNA 4L3WA 4WA8A 1KEEA 3KM0A 1LSSA 4UHJA 3V8RA 4E31A 1WHSA 3A1WA 5FL7D 3ZU4A 3QITA 2ZCUA 5JE8A 1OREA 1QF9A 1CUWA 1RIFA 3NNDA 2XA9A 4NBTA 2ZT6A 2P0AA 3OQOA 4RESA 1DMRA 3UCXA 1TK9A 3MTQA 2WA2A 1A9RA 1CS0B 3T9FA 4JC4A 2JZNA 4MUKA 3LT2A 2ZBRA 2V3WA 1U9IC 1UWLA 2REQA 2FN8A 2DFNA 1U9JA 3RWBA 2C1ZA 3QF7A 1KPHA 2QPOA 2PLFA 1G8FA 1NG9A 1QU3A 4ZVRA 3PEYA 3KYDB 3SHWA 2R25B 1UEXC 3A06A 4Y9UA 3ELUA 2JH3A 3K1AA 4FC6A 2C5HA 4WNAB 3KT6A 2H65A 1YKFA 3QJGA 3LWNA 1ZXBA 3DE6X 3PX2A 4P3OA 1DKMA 4PHTA 2WU3A 4ZOQI 4TMZA 4CKWA 3QSGA 1Y3FE 4NAUA 1FU8A 5ALXA 4DTIA 4NBUA 5KKNB 1WPXA 2IJGX 4UM9B 3WDKA 3O4JA 2FVYA 2HRDA 2R1VA 1RBYA 4P93A 1IMOA 4R9RA 4X41A 1XQVA 2XOKA 1I14A 3JAKA 1DIGA 4TLAA 4YRNA 4DV5B 1YB2A 1CEEA 1R8SA 1AHPA 5EC8A 2LWIA 4FUTA 3RVRA 2XVMA 1J09A 2OO3A 3OZTA 3VO2A 3OM8A 4C89A 2BEVA 5HUQA 2QW1A 4Q82A 4KWTA 3LIPA 2FK7A 4ZHQF 3HE3A 4DCNA 4GWGA 3L7KA 3M4JA 5FUYA 5GVRA 3IT2A 3EC7A 1NI5A 5KSPA 2FZCA 1JI3A 1FDVA 1QH9A 3EIXA 1VSQA 4YACA 1UPXA 2QENA 4JLSA 3I58A 7REQB 5ERYA 1EKXA 4OKIA 4RA9B 3RS7A 1EK5A 1I51A 4KWCA 2NUBA 2I8CA 2ALJA 4IRXA 2ZSEA 4F3NA 2VF8A 3V55A 4X84A 1DAKA 1M7HA 1XDZA 4D42A 1JPNA 3KAPA 1UJMA 1Z4NA 2GPAA 1CDZA 5JR3A 2ZQ5A 3KSBC 5HKAA 1FFXA 1DJLA 5CFRA 5BOSB 2BGJA 1U4SA 2AEMA 2PRJA 3C7KA 3N87A 1JAZA 1P61B 2X41A 3H18A 1IK4A 1ZSNA 3L4SO 4IDGA 4KITB 5AVWA 2YYZA 3T95A 1H1LA 3T8YA 2AMVA 1P5JA 2X3YA 3AINA 1IPFA 1OBCA 5ES3A 1ZWLA 2NU9B 1QKKA 1L4LA 3A27A 1CLEA 2GKGA 2VWQA 2WJGA 1QSGA 1H8HA 2DFTA 2ZRDA 2Q4OA 3KEQA 3PHIA 3WLLA 4W9MC 4R9UC 5BW5A 1VHTA 2W2LD 1H66A 1M2KA 5I01A 3BJMA 3KU4A 1X3SA 4CT5A 4DDHA 1LPOA 1S3GA 3OCXA 5GMOA 4RYDA 5SICE 1JHVA 3WXMA 2XMCA 1LJUA 1NFQA 1JT9A 2I6GA 5DNUA 1EP3B 1HZZA 4NU8X 2HK7A 5H1YA 3ZLVA 5B7GA 5IULC 1PX0A 3U1TA 4PXYA 3ANXA 4BO0A 1KI3A 4IDQA 5FB3A 2FEPA 3FYHA 5EJEA 1QQTA 4L28A 4Q6BA 4RK1A 1YVUA 2F67A 2PG3A 4DIFA 1JYEA 2YS7A 4AF7A 1LDYA 1ZGAA 3AP3A 4FYWA 1P7ZA 1QIKA 1GM5A 3UHOA 2F1JA 3T3HA 4OI1A 2YNMC 3FPEA 3HCCA 5PNTA 3VHXB 4E5NA 2CK3A 1NF2A 2NTNA 3VYVA 5SY6A 4ZO6A 1XA3A 3DVSX 1PK9A 3JARA 2FSSA 3SE7A 5JCOC 4AQYB 3MPUA 2PMWB 2B5WA 4PGMA 2P6RA 5C32A 2MSWA 1KYQA 4XYLA 5B4TA 2FMHA 4D2IA 4B7ZA 1RC0A 5JD4A 1YR6A 2F90A 1BCSB 4PTLA 1P9OA 5ESWA 5TQ2B 1RP1A 2WM9B 2VDPB 3WJ1A 2C7GA 3GIDA 3I12A 4LXIA 4Z4IA 3WKDA 4EJSB 1D2NA 4F9EA 1DRVA 5LBIA 4LF8B 3PCRB 2PX5A 1PWYE 3PQCA 4D97A 1LI7A 1V45E 5DLYA 3NDIA 5E6RB 1YS6A 3HUDA 1YGPA 3IV7A 1GOTA 4F4HA 3I04A 3GGOA 4QJ5A 1NZDA 3TM5A 2MWMA 1JJFA 4LF6B 1NDUA 1XGKA 3A10A 5F5NA 4PC1A 5J5CA 5BSUA 3J81k 2IUUA 3ZW9A 1UOOA 5DF1A 3N2LA 1T2EA 3RS5A 3UO8B 3BQMB 4OQQA 5CBPB 2EX4A 3FYUB 3K0FB 1DWQA 4RFVA 4YRBA 1QYCA 1D1SA 5IAAA 2Z5GA 1SVLA 4H3SA 4UD2A 3D8RA 1YRQA 3IAHA 3M2TA 3SWWA 3W4IA 2FEWB 5TEVA 1W5AA 4FDTA 4XWYA 5BVGB 1IN1A 5ILOA 2QD1A 3KSZO 2I5PO 3O2QB 3KP1A 4A27A 1RM0A 3BORA 3K4HA 4W9NC 4ZWNA 3W2EA 2VAVA 2ZAYA 1AHIA 3WIUA 2J9XB 1SUEA 4E7PA 4JUCA 4IIBA 1BQEA 2A5GA 2G67A 4IVNA 4ZRNA 3UOAB 4I81A 4JQZA 4L4UA 3W6ZA 4C20A 4ZTUB 3HDGA 3MJTA 2AKYA 2IUSA 5K2MA 3GP3A 4UVIA 1HNWB 4GFDA 1QX3A 3CH4B 3IUQA 2BR5A 4MINA 4YJHB 4QM7A 4B3SB 4KYUA 2Q9CA 3Q87B 1NKVA 2RHGB 1PQUA 2JIOA 2XYVA 5CGQB 4GE0A 1OFIA 1WDMA 2WJVA 2WYOA 1N7JA 3NB0A 2UZ3A 4AWAA 3G0CA 5I7FA 1TMOA 1MW8X 4XYEA 3RPEA 4RVCA 1CETA 1CY0A 3GRCA 4B4VA 4QFDA 4P82A 4Q21A 3C7AA 4EITA 3CW2A 2H00A 3B7WA 5KVSA 1LBSA 4K6MA 3I73A 3AJEA 3F4LA 5H83A 3MZ0A 4Y2JA 1E3DA 1FFAA 2FSIA 2WG1A 4MVCA 4U39A 2OQVA 4EA7A 4B3GA 4BTVA 4IH1A 3A4MA 1V0JA 3TOXA 1VSBA 2VXYA 3OZ7A 4CKWB 1YAJA 5CM9C 3WJ2A 5DULA 3TAXA 4WAUA 2YW2A 4JQYA 3UK2A 1JFLA 4C7XA 4J3NA 5DNVA 5BN4A 1E3QA 2GZRA 2VHUA 3E2PA 4NR0A 5K3DA 1W30A 1H9AA 3BILA 2ODWA 3E70C 4JC8A 5IBPA 3FPKA 4I5IA 3GXBA 2O7QA 3KKNA 5KU7A 3ZS8A 2ZIUB 5G0TA 1VG9B 2VPPA 2HCBA 4B3TB 4FGWA 3BL5A 1LA2A 2Y1FA 1W96A 3HI4A 2WWWA 2CN1A 3ETNA 3FXAA 4XIJA 2FFRA 2Z5FA 1RI1A 2PKCA 3A6EA 2R2GA 1QV6A 4ZP1A 3CG4A 1QYRA 2NUTA 4PX2A 5KI6A 1PR3A 4PYOA 4MA4A 1UDRA 4DDUA 1MO3A 4FMCB 4NAVA 5LQCA 4KIGA 1PD1A 1UINA 3HFGA 2JLBA 4NNOA 1J0XO 4UEWA 4EB3A 4GMKA 4B2PA 1WNTA 2DQKA 3SBOA 3QQ5A 2LDXA 5I7EA 4J0CA 2BJWA 1WB9A 3ESXA 4QPPA 1E0AA 4IRMA 4MVJF 3QVMA 2R8OA 3AUTA 2FZWA 1U80A 2Q5FA 4KPUA 5EZSA 1USIA 4Q1CA 2G17A 2BKUA 4BGUA 4CU5A 4LSGA 2IZ0A 1EI9A 1AKQA 2YICA 3CZAA 2H7XA 3A2LA 3NKFA 3DFUA 3F5QA 1RWKA 3W5UA 4HV4A 3EGWA 1DZ3A 5A4IS 4YWHA 1W1IA 3AR8A 2DTXA 5IZCC 1K3TA 1HT0A 3AHFA 1U2ZA 3JD1A 2R7MA 1MH1A 1RWQA 2VKQA 2Z56A 3W6PA 5KX5B 1XVIA 3S8EA 1X7XA 4PG6A 3WJ7A 4BKMA 5T8KC 3VNSA 1SPXA 4C04A 2F59A 5BWCA 4M8SA 1Q3KA 5JMOA 1R15A 1IZ7A 4LHZA 3TSWA 3Q8KA 2I03A 2R96A 3IB3A 5LYJA 1OYWA 1K68A 1YUNA 1ZK0A 1N5DA 1W0JD 2OZPA 3B60A 3CWQA 3KVRA 3QEOA 4RSHA 4D9KA 4DILA 9GPBA 5DNYB 3GJ4A 3SYLA 5FH9A 2XE4A 3D3WB 4V0OA 4E46A 2C58A 3VZSA 4ODIA 1GPUA 4AP6A 2VXBA 1T9DA 3NW9A 2AW5A 4ZAVA 4GPEA 5K99A 1T5IA 4K87A 3R6WA 3T7DA 3TD6A 3C4VA 1QO0D 2WB4A 4M36A 3ESDA 1T9ZA 1KJYA 1PJSA 1MC8A 5J59A 1OY1A 3OF2A 5DSTA 1P80A 4XQGA 4IBOA 5JVDB 2OBFA 1CJCA 3HKCB 4XA8A 3HKEA 3NV9A 4LGCA 5ALFA 2OYCA 2YXLA 3AH8A 2I2DA 3DWGA 5GZ3A 4D4KA 2BFNA 1TK3A 1YR1A 3RTGA 4CF7A 5TGZA 3GUZA 2X3FA 4A8JA 4KXLA 4H1WA 3EQ8A 4N82A 4TLCA 1FFCA 3T5PA 2OAQ1 1AVTA 2FHSA 1XWIA 2ZB2A 3CB2A 2H1WA 3HUTA 3O74A 1KMQA 3HSYA 1FP4B 1G3UA 3DDHA 4LWOA 3KVOA 4Z54A 3N75A 4O6VA 3ITEA 4BLRA 2NZUG 4EB0A 1WULS 3DXFA 1XRSB 3AF4A 3UWKA 3LF2A 4HX9A 2PUBA 4ROSA 3UHJA 3LLSA 3CBGA 2XE6A 4WBSA 3AKDA 4B8YA 4RFSB 3D2BA 3BWYA 1WXFA 4QPNA 3H9UA 5ICFA 1K66A 1UK6A 3B1WA 4GXQA 4LE0A 1XR3A 3BJEA 1KI8A 2JHPA 4DUYB 1JBQA 2JARA 1MIHA 2PBZA 5DXJA 3N3AC 1X80A 1A97A 2GVZC 4DLKA 5AUNB 3EPLA 4XOUA 5IAGA 3TZBA 3U3JA 2HOQA 4Z8XA 1NATA 2HI0A 1GZ6A 2BFEB 3CRW1 3Q4GA 1FSSA 2W2TA 2X15A 4HQOA 5I4IA 4AJPA 3T5AA 4O0LA 2DSNA 4FXOA 2EBHX 1VJGA 4JYCA 4HYEA 5G0SA 1KOFA 3GJ6A 5ITWA 2AJLI 4AK9A 1Q92A 1N2ZA 4EJ6A 3A4VA 4L07A 3R0IA 1CS0A 2EARA 1YFZA 3E9DA 2J6IA 3FPHA 5B4VA 4TLBA 2GLXA 2IIQA 1TT5A 2ODEA 3ENVA 4R8MA 3UHAA 4CF4A 4DREA 4JXJA 5I7WA 3GFSA 4R5MA 3EEBA 3PQFA 4F1JA 2R86A 1CJKC 5SZKB 1NJFA 2NXCA 3G7UA 4GE3A 1GAEO 1KP3A 2OM2A 2YIJA 2ZTUA 4MPJA 4AUMA 4DDKA 5ADUS 5A02A 4DTCA 4U7DA 1XQ1A 1VB3A 1H8ED 2I91A 1EK0A 1NP3A 2E89A 1ESNA 5L40A 2BLLA 4DADA 3ED5A 5FUVA 5DBIA 3C6YA 2ZIAA 4KNWA 3H4IA 3EFHA 4QYSA 2CFOA 4U7HA 1H3EA 3GRRA 2DFDA 2V3VA 3GRKA 1Z6XA 3QW2A 4R0VA 4HPWA 2FQWA 1I0ZA 4ABTA 3A4YA 3I8XA 2H4ZA 4ZQIA 5FD8A 1L1EA 3WBJA 4IWNA 3WKBA 2D2EA 2H6EA 2W7TA 3K0AB 4OQ4A 1MX9A 5LU8A 4UXIA 1H6CA 3SFTA 1M2HA 1RKQA 1AQIA 2Z1MA 3GMTA 4US0R 3ZHVA 2FV8A 4QQNA 2C7RA 1CJTC 1EDEA 1R8QA 3WQQA 5FBZA 5KWVA 4PQGA 2PYIA 1RRCA 5HR5A 3RS2A 2ZIEA 2FQQA 3MNFA 1RXUA 2X0IA 2HF2A 4LJRA 4BV3A 2XSZA 2FWJA 4P84A 4WFQA 3AUSA 1FLNA 3BFKA 3P71T 2GQ0A 3PEFA 3UB2A 3E7DA 3QFHA 3W6NA 4LDZA 1CB0A 2R6HA 1CR6A 2OBXA 4Q9AA 4OQMA 3Q8LA 3PRHA 4GKAA 5LZ2A 2CFIA 4LN1A 1ID1A 4G0ZA 4O4JA 2XQJA 3WBKA 1QHYA 2GF2A 4YDSA 2I3DA 5M5BA 4NE7A 4X1YB 3THXB 1C2TA 3QWAA 5FQOA 1HURA 2C78A 1Z06A 4C0BA 4YV7A 2IYLD 2HCJB 4HNAB 4N8EA 5HNKA 1U94A 2HHJA 1G20B 1RZRA 1CQIB 4DYDA 2MSLA 4QGGA 2QD3A 2VLBA 4ZAXA 2IHZA 4ON9A 2VWHA 3Q2KA 1E3WB 5CLJA 1XP5A 2YHIA 3BSFA 2QL6A 1U7XA 3IA2A 2WJWA 2D2XA 3T7RA 1L7MA 4PC7A 3QUCA 4OHUA 2QW0X 4AKTA 2AI1A 1WMDA 3UUEA 2ZQZA 1A76A 1X7HA 3SDSA 3V48A 4ENQA 3E8MA 1NBMD 3TTSA 1PNOA 3LK7A 3I9V6 5EIXA 1SVSA 3R5HA 3I5YA 2YZ7A 1N8KA 4N65A 5SY9A 2VSQA 5TR9A 2ZE7A 3F2VA 1RWXA 3W2IA 3A2MA 3F8WA 3FCEA 4PRKA 4MCHA 2QTRA 1JZQA 1UKYA 1UJ4A 3JR7A 3Q7EA 5B57C 5J2UA 1V96A 2XXAA 2X4DA 2G09A 5KDOA 4X97A 1VPWA 4G5SA 1KMMA 4NG4A 3W2FA 2IXTA 3O3NB 3SKYA 1K63A 1RRMA 2QAGC 3L9WA 4HGNA 2XNCA 3MJFA 4HRAA 4Q3LA 3GB9A 2W00A 1EK1A 5J47A 2AOXA 3H9QA 1PEAA 2D7DA 4HQ6A 4RKWA 5TV2A 4TYYA 1AIPA 1I4DD 1LK5A 3OCCA 1XD8A 3NHMA 4JWTA 3PCXA 4MV1A 5TC4A 5IAKA 1ZUNA 3TR5A 1GDTA 4C78A 1E1KA 5AD1A 4YMSA 2FZ4A 3RIXA 4HGPA 2ZR7A 4GMFA 4EAAA 5J4KA 5L3QB 1N0VC 3QVWA 5FWYA 1DI0A 3C3YA 1EG7A 1MR3F 3EZ2A 1I4LD 1ZM3A 5KTRA 1FLAA 2NZVG 3DJYA 2C4KA 1E2MA 4IHAA 1OBFO 1YDFA 4LVUA 2YXNA 5BUZA 4MR9B 1RM5A 4BFTA 5F5LA 4PWYA 3A32A 5GONF 1V26A 1QFZA 1XAGA 1YCFA 2PKQO 4GMGA 5EFOA 4OXXA 2PGNA 3BXFA 3AIOA 5DV9A 2DJIA 3NYQA 3EDCA 1F2UA 3DMTC 3EGOA 2QAIA 3CISA 1ATIA 3BD9A 4K9SA 3IV9A 4BUZA 5JECA 4M1KA 5IM4A 3F5MA 5DSXA 5KYYA 1PEKE 2VJMA 1XMOB 3QE0A 3OPYA 4TTVA 3WLAA 1THMA 2GX6A 4BKPA 4C0KA 1XPUA 1VE3A 4MS1A 1ZK2A 3W1WA 2ZEJA 1CNMA 2F8MA 1E2NA 1Y3CE 2ZFUA 4IIVA 5DGDA 5DU2A 5JT1A 1U8EA 3GJ8A 2HSEA 4X8OA 1PZEA 2CMGA 1DBWA 2PH7A 3VTKA 4XCVA 1HLPA 1R88A 4WXPA 1N1MA 3A4LA 3CH5A 2O2EA 3SF0A 1QC5B 5I5EA 3RNLA 3EHEA 1G7SA 1GNPA 5ADHA 5JSFA 1KFEB 2QG4A 4LOKA 5IC5A 3HDJA 5IJ0A 2PRSA 1C0PA 1P44A 2RKWA 4DCPA 3ZPXA 2FA9A 4GQIA 3PLAE 4MV6A 5EIFA 4IIHA 1E3MA 4IICA 5FNVA 2BMDA 2I2BA 3AZOA 3G9QA 3O4RA 3OCUA 1Z6YA 1UBOS 4Q9JA 5DBEX 5D51S 3PHBE 3ETJA 5EP1A 3RRZA 5E9QA 1PGJA 2WUGA 2ZIZA 3HBNA 4L5BA 4RAOA 4HAUA 4GR9A 2DWPA 2I2CA 2YDXA 3PUVA 2O0JA 1G1AA 1IN7A 1ZZGA 2P4QA 1MGPA 4Q1VA 4Z1MA 4UQPA 4CUKA 2BGUA 1RPJA 3AYXB 5KOYA 1IM8A 1R4AA 3OZCA 1YTUA 3RU7A 2IXEA 3KEOA 1IXZA 4BV8A 4TTQA 4MAFA 3QLTA 2X42A 2XMRA 4QDJA 2F1IA 3G6WA 1MB2A 2QJRA 5DTEA 1A27A 1QGDA 3LCCA 4JJZA 5E6UB 1IXKA 3UJNA 3R9XA 4NZNA 4D3FA 1OJLA 2C2HA 2GN8A 2INGX 4HFJA 5C31A 4OQNA 3I28A 1MZVA 1NXPA 1GIAA 2WLSA 2JIZA 5DH9A 5LR6A 3TSAA 4LXUA 4ZICA 3DKVA 1WLSA 2X9NA 3DWFA 2ZUTA 1YZGA 5TQJA 4AULA 2C77A 4TYPA 2ZM6B 1Z8HA 1U9YA 4QLAA 2GERA 2G1UA 4M37A 2GRAA 4A1OA 3ICPA 2WIBA 3CZCA 3HKCA 3UYKA 5A9SB 3OPXA 4BE7B 1QFXA 3KZVA 3DWIA 4P53A 4LG1A 4Z7OB 2BFCB 3IPYA 5B30A 3BXEA 3ZWYA 3B89A 4RCVA 3KL2A 4EVQA 4D9IA 3T5MA 1FS5A 1M2EA 3GVXA 4UASA 3ER8A 3GEPA 3O8QB 2GZMA 3JQEA 3IAUA 5JLJA 2A5YB 2IWRA 2C2WA 3PD0A 4LC1A 5ITSA 2JFQA 2M1ZA 3N0VA 2C2XA 3W1EA 4D0SA 3OFNA 1K08A 5H5JA 3WS7A 4PO3X 5FTMA 3RG2A 3DTYA 3PQ4A 5H3LA 1DARA 4C3ZA 3OCZA 4KXMA 4LF9B 2WSLA 3QSYA 4F4UA 2AC4A 3FUUA 4LY0A 2GJ8A 4D7AA 3DNMA 4IS2A 4LV8B 1H93A 2F3QA 2WJ6A 4E03A 4EYQA 5A4DA 1ZG3A 1ZD4A 3TI9A 3O90A 1DKUA 1U8YA 1E2KA 3F3MA 2CMKA 5ALMA 5JANA 1NNEA 1UK8A 3ACCA 2O57A 3DONA 4M1MA 4U3JA 1G0OA 2JAHA 1N9ZA 1OBOA 3U5TA 2Y1EA 2VP9A 3AESB 3BPSA 3SLRA 1I3LA 2OXCA 2QXUA 3D8BA 1V35A 1HE8B 1HETA 5AXAA 9LDBA 1JHOA 2XD4A 2X86A 3R3VA 2NPIA 3PL1A 3HB9A 2ENUA 2AK2A 4D0LB 4XLZA 4YUAA 1A96A 1MO6A 3LXMA 1VHWA 2DTDA 1LF5A 3NT5A 5BSTA 5BSKA 2IKQA 5I6DA 2R4UA 1DG9A 4YAFA 4POOA 4CLHA 2RJOA 2VPIA 1PVDA 4MAMA 1LI4A 5ESRA 2SNIE 1S02A 4NABA 4P86A 3EYWA 1FQOA 1MVOA 5H80A 5HF8A 1WL8A 2RBEA 3LECA 3I39X 3RF6A 5LDHA 1QP7A 4GMDA 1N0HA 4OHWA 2YWRA 1Q17A 2PS9A 2IODA 3QUAA 1LY1A 2OK8A 5E3JA 1E1MA 1M2JA 1XX6A 1X15A 2QN7A 3DCNA 4C1BA 5HQ3A 1ZD3A 1XU4A 1N6NA 3HB7A 4GXNA 5D7NA 5BQOA 1B2RA 1NQVA 3LBYA 3ZWKA 1Z33A 3VR4A 2J31A 3IDSA 4DWWA 1GDHA 1TYEB 1EZ4A 1RPNA 1SU7A 3EC2A 4B3CA 1U3GA 1BVUA 1DUSA 1KMIY 2BKVA 2KX7A 3H5TA 3NYIA 3OOSA 5CX1A 4ZPXA 3F3YA 5DPMA 3E9RA 2JCBA 4NCJA 5F73A 4YRAA 3PT5A 3VX4A 1VGRA 1JR3D 1U0EA 1Y5LA 4RHFA 2E7ZA 3WGOA 3N2GA 4NULA 1SKUA 4BE4A 1UMCA 1C3XA 4PM4A 2CVOA 5F33A 4EZIA 1L7NA 5K05A 4YP0A 1DP4A 1FFSA 1U31A 5EY5B 5IT4A 5B6JA 3K0EA 4OLFA 4IUYA 4OFWA 4GIBA 4QT4A 2TS1A 1M5TA 3A2NA 5DTRA 3KZMA 1GPBA 1EVQA 2O2JA 1E6KA 2EEZA 1ICIA 1P3JA 4LOLA 1OIXA 4TXLA 3SYKA 4MDFA 4CM8A 1SWVA 4IVPA 2C42A 2UV8A 4JSRA 3CF4G 4MPDA 4WZBA 2R2AA 4JLPA 4LF5B 4EJ2A 3L18A 1BGVA 1JFRA 1Q2UA 4MGZR 3I9JA 4D4JA 4DSNA 1C1XB 2WD7A 4K9QA 3ZXSA 4YMIA 1GAWA 3I9OA 4P2BA 3A58B 1YXMA 1T6NA 1U1FA 3SC3A 2WWIA 3A1SA 2Z9CA 5A03A 1WJGA 3KC2A 1IZ0A 2D7JA 1VMIA 4KI0A 2Z57A 3ZKWA 2HB6A 2YYAA 4KIJA 1TECE 3QELA 2QTLA 1OGIA 4KLAA 1EIZA 2XDQA 4MQBA 5DHPA 1WD5A 5HF6A 3STYA 4IOJA 1K8XB 4YJ2F 4BRSA 5CA0F 5JMTA 2J6BA 3IVCA 4FKBA 2ZOSA 4QARA 3VDXA 4LF4B 3WYFA 4XVCA 3VPHA 3JYOA 4RL4A 4RK5A 3DBLB 3TLAA 4BQSA 4TVKA 1H2AS 3MEQA 4DW8A 3PS9A 4NZYA 2RCYA 2ZCVA 3EARA 4PO9A 5F77A 2LCIA 5FP0A 2AXPA 3FA2A 1LV8A 4WCVA 4DNFA 1UMBA 2HBRA 4IFEA 4UBIA 7AT1A 5C52B 2CJWA 4I4NA 2IYQA 2YWDA 2HTFA 4KGZA 4LS3A 3PPIA 5F4BA 1XVLA 3VTZA 2AJBA 1W47A 1G8AA 2Z3ZA 3JQPA 2O8CB 2K7FA 4ZFNA 3SXUA 1GAXA 4YJ2A 5A0FA 4BPRA 2I2XB 5KJCA 5B37A 4EBFA 3L0IB 5AM1A 4R1MA 5JW6A 4P54A 1RQ2A 1WW3A 4HF7A 4XVQA 3VOAA 3EPJA 5FI3A 5C1DA 4IJKA 3OJ0A 2X1VA 4C14A 2PWZA 1N75A 2ZJYA 2ZRAA 2WUFA 3I6YA 1ONNA 1NU8A 3ORHA 2V1XA 4LRWA 5LA6F 3GH1A 5REQA 3V80A 3HVRA 4IEEA 3MT8A 1L5KA 1FMCA 3IMCA 4UHKA 4E13A 2MYTA 2JBWA 2XE8A 3AF3A 1XL1A 2WOOA 3T6KA 3N39C 4NNPA 1RPAA 3RR2A 3JWGA 1Y4DE 2WJJA 2NZ8A 1PFWA 1F20A 1B8OA 1KZ4A 1RXEA 2GZ1A 5C0OE 4C4AA 3FSRA 4WLVA 4FU0A 4C6TB 1EH5A 1G19A 1BYUA 2DECA 3ANLA 1U9ZA 1WXIA 3WOHA 2GM3A 1HNZB 3Q0IA 2OQRA 4KN8A 2XAAA 1IJKA 2P1ZA 3O7WA 1NT2A 5F1OA 5FULA 3JQGB 4WVFA 3HA2A 1NMSA 1UZUA 3R7WA 2XNDD 3LHSA 1N1GA 4IYRA 1USGA 2R7NA 4ZYXA 1YL7A 2IHNA 3OIGA 3RTAA 4BP9A 3OIUA 4PRZA 4DKJA 1VYUA 3S1AB 3VH1A 4F4FA 2PL3A 4FFPA 2ENWA 3I6IA 3D31A 2QIOA 1KDPA 1LK7A 3AOEA 2ASEA 3FDZB 1O89A 4O4JB 3ZVRA 3ETCA 4KR0A 4YAGA 1EDZA 1YB5A 4J2OA 4JOQA 2OHHA 1V8PA 2EG5A 1V48A 1NX6A 3A8TA 1RVV1 4ZK2A 1AA6A 1IN8A 2OFPA 3WRYA 1CQIA 3PRKE 4U2KA 1GGFA 2P2SA 1EQ2A 4CM1A 4LRSB 4YBZA 3KTOA 4N5IX 5JI3E 2VR1A 4MQEA 3G6KA 3G2IA 4EKYA 2P9HA 1U11A 1G8GA 4JJ4A 3TGLA 3CO0S 2OLKA 4CPDA 4P81A 5IVHA 4S1WA 2FSHA 2WIGA 1OXBB 1EUDB 3F9RA 4R7ZA 3WVNA 3ZW7A 4ZV9A 4Z1OA 3ZHOA 3IHTA 5EHXA 2CUZA 2DUNA 3ENZA 5EE1A 5CHEA 1UEIA 1YZTA 2GAIA 3L7YA 3F1LA 3PUZA 2HIGA 2EQBA 1Y8QB 2FOLA 3BGOS 1N2IA 4FZ5A 3SHOA 3T3PB 1TAUA 1JTEA 3PHLA 1HGXA 3HV0A 5ALPA 3WGTA 3OLZA 3JWJA 4IZIA 4EQ6B 5CHYA 2GBLA 4NK4A 1RMQA 3BA1A 1GTSA 3NUQA 4G5XA 1WMSA 1SQ5A 4R1PA 3F7TA 2C31A 2V6IA 3IAAA 3KEMA 3IHKA 1OT5A 4PYKA 3C5EA 2ZB3A 4PYMA 2JIRA 1EBFA 5INTA 4A0RA 1HK7A 5BOSA 3ER9A 3PXUA 5KJ6A 1SIWA 5JALA 1TTPB 4C43A 3KLBA 4KBYA 2XXBA 3DNFA 1U0RA 3FOCA 4Y2TA 1X1RA 1T8TA 3LYAA 2ZRGA 4POAA 3EJWA 1JHZA 1E2DA 3D2LA 1NXVA 1Z3IX 1PWZA 2WABA 4QNNA 2J7PD 4UHDA 2QTZA 1XVUA 3RVSA 3FR7A 1VJ1A 5ALUA 1I8TA 3TW8B 1ID8A 4PQRA 2AWNA 1L5RA 1KGSA 2D06A 2L2QA 3CLUD 3FSEA 4B6RA 5KHLB 5I9LA 3EVBA 2O7NA 1T24A 4IMPA 5HKKD 3WRYC 1AZTA 4KO1S 5CW1A 4M6WA 2QTCA 3GWZA 3KYIB 1H2EA 1O87A 3R5XA 5KREA 2CNDA 3RBXA 1UM8A 3AR3A 3O0DA 2XIQA 5CLFA 1ZIOA 3NAMA 4DNQA 2JGFA 3W5CA 4TV9B 4YJ3B 3TIXB 3U0VA 2PM8A 5COBA 4H27A 4DC9A 1VKRA 3SQXA 5JAUA 2O8BA 5JDIC 4WKPA 3GARA 3GMSA 1D09A 4RGYA 3D6JA 2GJKA 1AOXA 3H7IA 4LGVA 1EP2B 3DBOB 4NXMB 1MLDA 1PFQA 4G1VA 2R3SA 3ID6C 3LVFO 2OD7A 1P62B 2R79A 1J8YF 1E2EA 5KNCD 5LB2A 1A8HA 1ZDMA 1NVUQ 5AWFC 4RZ2A 2IY9A 5KCMA 1PIWA 1XTTA 2YJGA 4UJ3A 4LYJA 5C1IA 4LA4A 4DIOA 4ETIA 1PWXA 1QOPB 2MYUA 4DRXB 5IFKA 2IDJA 4LZJA 5K0EA 4WY8A 2JCXA 3M1AA 1KQPA 2MT9A 1Q3HA 1XDSA 4N3BA 4QT0A 4GLLA 4J1SA 5I9MA 5AVKA 1CDOA 5KU1A 1F17A 3ROMA 3WRXC 4O59O 4X20B 2GAFA 2I3ZA 1JQ3A 2XTJA 1SFRA 5J2TF 1GU1A 1Y5IA 3LY8A 2I9KA 1C3OB 1MN6A 3V4ZA 3IT3A 4O63O 5ALOA 4A2PA 1MFZA 3JALA 5HQ3B 4IFIA 2FJ0A 1EK6A 3C16C 3RTBA 1UBUS 5EJ5A 3A9CA 5CFPA 2O48X 3U3XA 2FPPB 3M6XA 4AXXA 1XTIA 2QN8A 3I2HA 3QM1A 2W58A 5BVHA 1AUPA 3ND6A 5CGZA 3WBFA 3IO3A 2H4XA 1AMNA 5IN5A 2PZLA 4WOJA 1JZSA 2IXGA 4NMHA 4QELA 1XPRA 2VWGA 2P4HX 2HJRA 4RZIA 4TS9A 3O03A 5HRUA 1MAAA 1U2SA 2WT9A 4OJNA 4CM7A 3IP6A 2AMLA 4J8PA 3I3SR 3PBKA 1P2UA 1F8UA 2GASA 4M0DA 3RYHA 4B75A 5FDFA 5LZ9A 5GGXA 2EFHB 2EJUA 3BRQA 3QJYA 4QVIA 1D0VA 2P6OA 2V6FA 4WESA 2VQ6A 2QQEA 1M2VB 3QXSA 4M3NA 2A58A 4WBNF 5HILA 1GA6A 1FQKA 2ZBDA 1GGMA 2OCAA 1KU0A 1QVZA 2CFTA 3CNOA 3V97A 5CYOA 1G6KA 3EK2A 4L78A 3OM0A 4L72A 3DDSA 4Q3DA 4X95A 3I01M 3GUUA 4DMLA 1M8FA 2WMDA 3B85A 3FAKA 1LU9A 1QHSA 3R44A 1PN3A 1VIAA 3FNHA 4KQWA 4B43A 5I51A 2VRBA 3O95A 3PT9A 4JLJA 1KF0A 2QLBA 3K9BA 3PPWA 3HKDB 5EI5A 4O4JF 2OGUA 3P26A 4C4TA 1NSFA 1EFDN 4FCTA 1MP0A 1ZGZA 3DWEX 4U7FA 5JPDA 3EW7A 3K6SA 4DA4A 3FDXA 3ANSA 4IWXA 2P4EA 4P1ZA 2O7RA 4N7MA 4MVWA 1ULBA 2H5JA 3DB2A 5FO0A 4ML3A 5BN5B 3B9PA 3NWPA 3ZE2B 4HQLA 1OAKA 4MUHA 1USWA 2ECFA 2ZRJA 3T7AA 5BUSA 2VOJA 5FWNA 5BSWA 2NNLD 4MO2A 5G4KB 4H59A 3VPSA 3KSAC 4I1PA 3IEVA 3QBVA 1I01A 1HZJA 3EGIA 4QEZA 1ADCA 2KWIA 2RH5A 5HZMA 1NYRA 3K5WA 1NV9A 3A3KA 4AQ7A 4Q39A 4GKKB 4J4HA 1P4GA 1YZHA 1E2UA 1M1ZA 3UJ6A 3AGPA 1JHUA 2ZS7A 3MAJA 1TA9A 4AS1A 2CLIB 1J0DA 1UZAA 3Q15C 4OXKA 4KIWA 3WWYA 4HB3A 3GO4A 1RKVA 4CTKA 3B6JA 1C1DB 4E0BA 3B5EA 4OL9A 4W5RA 1YI8A 3KUXA 5G3ZA 4RMHA 2COUA 4ZODA 2ACVA 1UBGA 5AM3A 1VL0A 2CEKA 3NATA 2VZ0A 2P2YA 1EFTA 1RQ7A 1GZVA 3IJ5A 1F14A 5IC6A 2NM0A 4Q7EA 5KTMA 2NZXA 1SBQA 3E9EA 4FEYA 4G5YA 4UFOA 4BTLA 1L7DA 3DD1A 3FETA 3F78A 4HEHA 4L6IA 4Q6WA 5D86A 3U3ZA 4UULA 1DKNA 1XCLA 3NRCA 4J94A 4H6PA 1L4GA 3GLIA 4DLRA 2D1RA 1JFSA 1SB8A 1ZI8A 4U9IS 5F2EA 5FWXA 3T7TA 3UT6A 1K86A 5J2UF 4QUIA 4YJHA 1F4LA 4DCJA 3RRJA 3PZBA 3DE5X 5EOVA 3LFUA 4OCZA 4PX3A 2H92A 4F72A 2IH5A 5C18A 1THTA 4P34A 3T0IA 4LYAA 3LLVA 3VC3A 5C37A 3QYJA 4F2PA 1KS2A 4FQ8A 3IXMA 1KA9H 1TUBB 1XXHA 4F60A 4MV8A 4ZARA 3JD3A 1PI3A 2FZEA 4B09A 4QLOA 1UDAA 1XRLA 2DQYA 1XBTA 1T13A 2LKDA 4TLLB 4MO9A 3JVDA 5AUPB 4FDUA 3MA0A 1E6EA 3EPPA 1W1WA 4UMEA 4UBJA 3KQYA 1JB1A 4H1TA 4WFKA 3AERB 3VJKA 3ZN2A 4UOQA 1XAIA 3V4OA 3GCDA 3EVZA 3FDZA 3WI7A 1S4QA 3WK5A 5GZ1A 4DGSA 1M0TA 1I3NA 3UKDA 3SR3A 4NEHB 5D3MB 1P5FA 5LP6A 4N54A 4KN9S 2WM8A 4R8VA 2XZDA 3M3DA 3R8XA 3JAWB 3PCTA 3EFBA 3QU5A 2H63A 2WTAA 3GN2A 4QOSA 4ZDJA 1EXNA 3F6YA 3QFFA 2NO4A 4UU0A 2WSSD 4JI7B 2ZUDA 1BEEA 4TZTA 2QVCA 4YHHB 3U44A 5FOQA 2XADA 2OV8A 2ZSKA 2JGLA 1G8PA 2BY4A 1L4EA 1B73A 3LL7A 4F5DA 2GFIA 4O4HB 4WKBA 1V43A 2C20A 4M98A 1FY2A 5EWMA 5ALJA 5JWHA 1H6DA 5KTSA 1KJNA 3FKSD 4KIFA 3MWLA 2QR2A 5REQB 2FP4A 1Q91A 4RL6A 2I54A 1XMSA 5AICA 4U6QA 1OWLA 4MVJM 4P3NA 4KR9A 5HRCA 1ADBA 1FTGA 3MRTA 4OSPA 2WY2D 3R7SA 3ZVNA 1QGED 2PU7A 3AX6A 1ZK4A 2TMGA 2VTKA 2W2NA 1FRFS 1U3UA 3N2KB 1E3LA 4GGPA 4I4LA 5FJIA 3OE1A 4Y0VA 5EG5A 1E1LA 2WSYB 3K1AB 5KYXB 3SKVA 5HKKA 2QIPA 2WWRA 2YJ6A 4B0OA 4Z4QA 2NO5A 1Z2AA 3H05A 5L3ZA 3FWZA 2QGNA 1DAGA 2P11A 4HHEA 2ZZKA 4PX9A 3WK9A 2B99A 2OCLA 3WLOA 4V2IA 1DCMA 4YR9A 1XMVA 4IDPA 2I2FA 1EUQA 1V11A 2CDBA 3HVIA 5CT9A 3AHDA 2VCHA 2J85A 1H9CA 4GD3Q 4JC0A 4PF1A 1O0CA 1L4NA 2R1VB 4WY5A 3TD2A 3TMKA 3SS7X 2GEUA 5DBGA 3Q2OA 2HQOA 3F47A 4LDNA 1L1RA 1AN9A 1R6TA 2EJCA 1Z4MA 1THZA 2ZIXB 4MJXA 3M1IA 2ID7A 4TQ9A 1JDVA 1ZXLA 1JAHA 2K2QB 1D9XA 1NX9A 1JEQB 1P5RA 2BFPA 1WXQA 2O3JA 3GR6A 3IAM1 2GCEA 1GZHB 2OEPA 4GOOD 4PZ9A 2R8EA 4MXDA 2O3TA 1XCMA 1UXKA 4MS4B 2CHQA 4IDBA 1L5GB 4AJ9A 1M74A 2JI4A 5JJLA 4WBNB 2V97A 4C4ZA 5JVDA 4X65B 2CXTA 1OA1A 2HFJA 4ZMSA 4Y2SA 2XUQA 3U4QB 3K4PA 3SLKA 3K9CA 4PPYA 3QW4B 4ABYA 2PFSA 1JQEA 3I53A 4L6CA 3HY4A 4XFDA 4BKUA 1CR4A 4OXNA 2A88A 4GM0A 5LP6F 5IK2A 4LQDA 4D8VA 3TVYA 5K3OA 4JL8A 3GV0A 4PLYA 3OPYI 1T0UA 2NO7A 3EAFA 3J80A 1FPMA 1U2DA 2C3OA 3I92A 3GHYA 3UGJA 2ZM5A 4J0DA 1YRBA 2C07A 3GLGB 1ZUWA 3HBMA 1KC1A 3PFNA 1I7DA 3NXKA 4P7BA 2I87A 2QYSA 1X80B 4TS1A 2BVNA 1N6RA 1TJ5A 4D9EA 5EP2A 1L4MA 1YMUA 4OHKA 4TMYA 2A3RA 3TAHA 1WHTA 1A7AA 4CODB 2W2QA 1A1SA 2YWHA 1Z2DA 2P0YA 4R5HA 2FZVA 1JH8A 3BWMA 3D81A 3DFMA 2PS1A 2QRVA 4HX5A 3JWIA 1RC1A 1SUSA 2ZATA 1S2LA 3GPDG 3FNRA 3N07A 2AN3A 1B0ZA 4TZKA 4QDKA 2FEMA 3HDHA 4QYTA 1FEZA 4WKNA 3RVMA 4JZYA 3SYMA 3AKZA 4BFSA 3O3OB 4BLSA 4BVJA 4G1MB 2AWOA 5C53B 3LXUX 5LOVF 1UBFA 5EVJA 4W1PA 2ISSD 4G07A 4UE6A 5I7SA 2AFIB 1EBBA 2HF7A 3B6MA 4MHSA 2NU8B 4HNAA 3IKVA 2NTEA 2IS4A 2RHWA 4L5CA 1T2NA 2HMVA 3DOHA 1AC5A 2VQDA 3AR4A 4XPIA 4UCXA 4OYYA 3EVEA 3RSCA 3G2NA 3FWPA 3VNRA 1NAHA 4PZYA 5K3BA 1TYDE 3ZH2A 5JARA 2CNOA 2GPJA 1E0JA 1JDJA 4F21A 2WIFA 4Q47A 3QV2A 1KZ9A 3IPCA 3Q6MA 4K7JA 1UBTS 4KN6A 3UANA 1JXQA 3MTDA 2HHLA 4BUCA 4LV6A 3OO1A 1NOIA 1DRKA 1UAYA 1WF3A 2A5LA 2H1CA 2YJ4A 1E20A 3FMIA 1V8FA 3JS5A 3TCXB 3HL4A 2PZMA 3TRKA 3TZCA 2H51A 3DLIA 3ORSA 2OC9A 2MYNA 3HCRA 4R1OA 1IHXA 1YQGA 5DISB 1S2GA 5BNZA 5F98A 4Y30A 4I5GA 2VK1A 3N0WA 4MB6A 1UFQA 5F64A 1EVZA 3B3JA 2OYSA 2H29A 1LRJA 4OO3A 3O8LA 3WLQA 2BEJA 1GN8A 3EW9A 4REOA 4NU0A 4YBRA 4CJXA 4OHVA 3O38A 1V6AA 5T3UA 4BY9E 5HOQA 2VPWA 1GTZA 2GA8A 2AX3A 1Q50A 2YH2A 3WIVA 2IXAA 4DLAA 1Z4OA 5BMVB 4CV0A 5FLEX 5DM4A 4CE6A 3WGJA 1DDIA 1MVNA 1SVOA 2NG1A 3PFBA 4JQOA 4ZT6A 4WKCA 3IULA 4K8RB 1ZCZA 4Q3EA 4RORA 3J81A 3QBEA 4DQDA 3P2MA 1BN7A 4WWHA 4J29A 5TVGA 5KC8A 4O4HF 4IM7A 2Z8ZA 4K0RA 4L4SA 2DWUA 4C29A 1F0KA 2YZ2A 1N9GB 2BEWB 1K4YA 4FFOA 4Q4AA 3ZV7A 4YCSA 5AW1A 1HSOA 2IU4A 1JSXA 4AMVA 1NVGA 3C1UA 2YV3A 4HZIA 1NW6A 4NDZA 5B1IA 2PT5A 1ZOSA 3Q9SA 3L0ZA 1NPYA 2FW1A 4FEAA 4DL9A 4FQ5A 4PAMA 5B3JC 1FS4A 3GLIB 2GTIA 2JAPA 4BWVA 3GLGE 3DF7A 2DWCA 5LJIA 2PH5A 1BWSA 2ID4A 3DXZA 1G2IA 1WKBA 3FMFA 1QDLB 3B8HA 1G5TA 1NKSA 4KL8S 1KIFA 5HQJA 1LGYA 5KAPA 4QKQA 1Q7CA 1X9HA 3LQYA 3ZY5A 3DOEA 1Z4QA 2OK7A 4EY5A 1IXSB 5E7IA 2O1SA 4WNCA 5T64A 1WQ3A 3OI7A 3RTDA 3UCEA 2G80A 1NRWA 1PJ3A 5LWQA 1MABB 2DHCA 2XR1A 3BBLA 4WMLA 4AD8A 5IDWA 1MX1A 2PKEA 1TYZA 1U28A 1XEAA 1IOZA 1Y8RB 4G1UC