4MWTA

Crystal structure of human ppca (trigonal crystal form 2)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Lysosomal protective protein
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwtA00
5HFAA 3VKFA 3BWXA 4BC1A 5LP1A 3GFFA 4ZXFA 4E46A 2HU8A 5CT4A 1FSSA 2XUAA 2CB9A 3HI4A 5DYWA 4C01A 3WWOA 3C43A 5K3FA 3RM3A 1Q0ZA 5AKLA 5LYYA 4B6GA 4A5SA 2AJDA 2ACKA 2WHPA 3W05A 4N8SA 4TPKA 2XQIA 1JU3A 3G0CA 5K3CA 3WL5A 1OILA 4KYVA 4AZ0A 2JGEA 3DYVA 5J3JA 3WK6A 1ODTC 3I1IA 3EIOA 3FSGA 2IIVA 3HZOA 3OURA 3T4UA 4J0CA 1VA4A 3FCXA 3C87A 2HFJA 4KE6A 1XZGA 1G4HA 4Q3OA 4FBLA 1P0MA 5E4JA 1EDBA 1ORWA 1FFEA 1P0IA 1XZCA 1CV2A 1YAHA 5EI5A 1CUZA 2CMFA 1B6GA 4ZV7A 1MPXA 4FTWA 1SCKA 4BTVA 1K63A 2B20A 4E11A 4UBNA 3G9TA 4W63A 3L1JA 1L7RA 5AKZA 4OU5A 5JZ9A 4UPDA 1TK3A 5LZ8A 1DX6A 2OAEA 4UFOA 3WKDA 5JD4A 1CFJA 3O4IA 3PUIA 4UHFA 3BDVA 1VZ3A 1Q0RA 3WZMA 1GQSA 4AN1A 1BS9A 4FOLA 4BVKA 1HBJA 1XZIA 2BJHA 1ISPA 4BVLA 3ZV7A 1UZAA 4Y2QA 5EIAA 1GKLA 1ZGBA 3I6MA 4GLBA 4KR0A 4BZWA 4H7DA 5AI9A 1EK2A 2XUJA 5CH8A 2PVSA 5JAUA 4BCCA 4TGLA 1XZJA 1YB7A 5JANA 1AMNA 2QJRA 3I6ZA 4QDXA 5E4TA 1AKNA 2BUCA 4CG3A 5AO9A 1QO9A 1VE6A 1BN7A 2WSLA 5ALHA 2H7YA 5CH3A 1E5TA 1LPAB 1T4MA 5E2IA 4DMFA 2OGZA 4MWTA 3I2KA 2WIGA 3E1GA 5IVHA 2QUBA 1YS2X 1QOZA 1LBSA 1ACJA 3V9AA 4FFVA 2E3JA 5FP0A 1LNSA 3ZLTA 1WOMA 2J3DA 1XLVA 1FJ2A 4FFWA 3I2IA 1UK7A 1R3DA 2PSEA 1TIBA 4FLMA 4J0GA 3MGAA 2WU3A 2XUGA 1LPPA 3C5WP 3R40A 5E4YA 5ALKA 3WJ2A 1QIHA 1MNAA 3D0KA 2OLEA 4CCYB 2XI4A 3R3ZA 2W22A 4GECA 3STYA 1UXOA 2GBCA 3FOBA 4G9GA 1CUCA 2Z8ZA 3FYTA 3HLKA 4W1QA 3F96A 3HACA 1U4NA 4J03A 4UHEA 5LZ9A 3G8YA 4CG2A 2EDCA 4AXBA 1K4YA 1YCDA 3IBTA 5HF6A 3WK7A 5KWIA 5ALJA 1E8DA 3H2HA 1QTIA 1JFRA 2WHRA 4H0CA 4X85A 3QMWA 3RLIA 4E15A 1ZD2P 1U2EA 1ZI8A 2ZJ6A 1XQWA 5C81A 2VATA 1A8SA 1F8UA 4IQ4A 1QJ4A 2AJBA 4NZZA 4G1FA 1JJFA 4Q05A 1J06A 1Q84A 5CT9A 1HLGA 2QOEA 4O08A 2PPLA 2YASA 1VZ2A 2V9ZA 4UBIA 2HHAA 2XMGA 5HK8A 2HA6A 1J1IA 1ZJ4A 1PJAA 4BYMA 2C4HA 5FDFA 4DMCA 2Z5GA 3O95A 3F98A 1BCRA 4H35A 2PSDA 1MNQA 2JEZA 4WFIA 4X90A 1HQDA 1VLQA 5AOBA 1VKHA 2ZYHA 5CT8A 3LP5A 2XB6A 5AIAA 1SFRA 3C6XA 1XZLA 1H2WA 4J7AA 1ZIXA 1TCAA 1DTEA 3D4LA 2WU4A 2QUAA 1CUBA 3WLAA 3AZOA 2I3ZA 2DHCA 4WDRA 4EY4A 1P0QA 3IUQA 3DJYA 3FYUC 2XUOA 3C6BA 3KD2A 3GUUA 4PW0A 1ZD5A 4QNNA 4S0XA 4GHWA 1A88A 1SC9A 4XIIA 5CH5A 2OCGA 3EQ7A 1Z68A 1QFSA 3BXPA 1CUVA 2WFLA 4AB1A 3ESBA 4XJVA 3WKEA 4BATA 1GKKA 5EGNA 2WKWA 4KAJA 1QIIA 1GZ7A 1NU6A 2BGRA 3B3QA 5JALA 4Y2VA 1CUUA 1CUJA 1MU0A 3DOHA 1DQZA 5FUMA 3D3NA 2WFLB 4H18A 3M82A 1AQLA 1ETHA 5JZBA 2B61A 1XZMA 4LXHA 4DIUA 2QVBA 2WG0A 2VT6A 4LIPD 3WA7A 1CLEA 1XRNA 3PDCA 5AKKA 1XZKA 4UBMA 1OXMA 5K3AA 2R8BA 3HRHA 2VSQA 5A7FA 2FUKA 4XX1A 1N5MA 3WKAA 2RONA 2EEPA 3WI7A 5JAOA 3Q0TA 1WCYA 5AK3A 3C5VA 5D7BA 1HDEA 5C7YA 1HL7A 5EHNA 3ESAA 4ZREA 4MQLA 3OG9A 2C5GA 2ZJ7A 4BZZA 3H2IA 4JNCA 2PSHA 5T4BA 5ALVA 4B7ZA 4IO0A 4BBZA 3D7RA 1Y37A 4FKBA 3G0BA 1IUOA 2QXTA 1G5FA 3QMVA 1TCCA 1YS1X 1MJ5A 5DNWA 3ILSA 1VJ5A 1R1DA 2Z3WA 1QIMA 1CIJA 5K3BA 1XKTA 4LHEA 1FFBA 1QO7A 4J0KA 4KE7A 5AKIA 4BB0A 2RGUA 1XZAA 4B0PA 4Q3LA 4OYLA 1YASA 3L1IA 5ALZA 1KEZA 3HJUA 1AZWA 1LPSA 3V1KA 4OUKX 3DEAA 3A2LA 1CUGA 2PBLA 5ALNA 2WILA 1EK1A 2WUDA 1ORVA 2VF2A 2PSFA 3DLTA 3M81A 4YPVA 4BCBA 5AKYA 4MJ3A 1GQRA 2CUTA 4HRXA 2ZVDA 3C6ZA 3WK4A 1CUFA 1UK8A 2WIDA 1RYYA 1ZD4A 4AO8A 5AICA 1XRQA 3HXKA 5CMLA 4K6KA 3A70A 4X91A 4B84A 2WFZA 4Y2XA 5JIBA 2CKMA 1TQHA 1FFCA 3IVMA 4RE6A 3K9BA 5FPPA 3EF3A 3U1TA 2XQFA 5DWDA 3STTA 1CEXA 4J0IA 4L9AA 3GA7A 4PQEA 2VEOA 4MWSA 5AKGA 1MO2A 1UK9A 4DMKA 1W75A 4BE9A 5LZ5A 1XQXA 4WFKA 4NS4A 4X7BA 4RNCA 5ALSA 3WZLA 1Y7HA 4AMZA 5A2GA 3AUKA 2XQJA 3R3VA 4LKOA 4PSDA 5JAPA 2HA3A 3VJKA 2PSJA 1MX9A 2OCIA 3V1NA 1MAAA 4LXGA 1EINA 1BE0A 3I2GA 1DINA 3V48A 4H7KA 3QVMA 5C8ZA 5CXXA 3VJLA 4UHCA 3ZI7A 1JKMA 3H1BA 4EB0A 4JEIA 1J2EA 2QTBA 4LXIA 3PE6A 1DQYA 1LPMA 3W06A 3FLAA 2WLSA 1RWQA 5AKHA 3PF8A 2PUJA 2BAGA 3G0IA 4G5XA 5DJ5A 5ESRA 1ZOIA 1JMKC 4HXEB 2WTNA 5DYYA 4DNOA 2OGSA 4B9AA 4C89A 4Y2YA 2HA0A 4CIAA 1TCBA 2WHQA 4ROTA 3DKRA 1ZICA 2OG1A 4HVTA 4V2IA 4NVRA 3KDAA 5CBKA 3I2JA 3STUA 3PFCA 4UUQA 5SYMA 2WFMA 3ZLVA 3LLCA 3R0VA 1LPBB 4Y2PA 3H04A 3G7NA 4P9NA 4JUIA 1PV1A 4WFJA 1CQWA 4ARAA 5D3ZA 5FOQA 3UUEA 5ALQA 4Y7DA 3EQ8A 3BJRA 5AKXA 1MX1A 2JIDA 5AM1A 4C87A 3O4HA 1ODCA 4X97A 1X2BA 4IH4A 3X3HA 4AO6A 1P0PA 4B85A 5T4FA 2I78A 1W76A 2WHPB 1K8QA 5ALMA 3OM8A 4G4JA 4BC0A 4ETWA 2V98A 3DNMA 1GPNA 3NUZA 2XUIA 1H22A 2VT7A 2VAXA 5K3DA 1WB5A 2GBIA 3QYJA 1U8EA 4DTCA 2GYUA 1UFOA 2BFNA 5T4HA 1CUDA 3WKCA 4EY6A 1OCEA 4AX4A 1CUXA 3C45A 3G0DA 4Q82A 4HTAA 3STVA 1QGED 3ZWQA 2DCMA 4PF1A 2OPHA 2WUFA 1CUWA 3W2TA 2GYVA 5ALRA 4RGYA 1W4LA 4PO3X 4BP8A 3FAKA 5AM4A 1RP1A 4KJXA 3A6ZA 1DU4A 2J3QA 3MVEA 2QJWA 4UBLA 1TRHA 3HABA 3LIIA 4RE5A 4FWBA 2P8SA 3ICWA 5ALIA 2XUKA 1PFQA 2PU5A 3STWA 3NWOA 3PUHA 4H7JA 1LPOA 2C58A 4DSAA 1BU8A 1I6WA 1QIGA 2ROQA 3WWEA 1EDEA 1XFDA 5I7UA 1N1MA 1E66A 4PNZA 5AI0A 3FCYA 1JI3A 5HQ3B 4GXNA 4G8DA 4Y2JA 3ICVA 1CPYA 3ANTA 2O7RA 4JYMA 1AC5A 1GGVA 1WB4A 5AK6A 1VA5A 4MQMA 2C0PA 5AM0A 2J4FA 2QKYA 1KU0A 4CG1A 6YASA 4EY5A 2ONCA 4H77A 2JGFA 1C7JA 1CUYA 1ZJ5A 2XMQA 2AJLI 1N8SA 4EBBA 2XMSA 3H17A 1F6WA 5JD6A 3FYUA 4G8BA 4QLAA 3WL8A 1JJBA 4PV7A 3WK9A 3WK5A 5LZ4A 2OCKA 3KWFA 2DHDA 1C7IA 1W1IA 4DNFA 3AIOA 3QM1A 2PX6A 3AINA 2D0DA 4HS9A 1QZ3A 1BRTA 5IVIA 3U0VA 3BIWA 5FRDA 4EY7A 1CUHA 2JF0A 2JGLA 5A6VA 4YASA 1E8NA 1G66A 3BL8A 3KSRA 3JYHA 2Y2UA 4M0MA 5JAHA 2PL5A 2HDWA 2PU7A 1SCQA 4BCDA 4I3FA 5I8PA 3N0TA 3TGLA 4B80A 5ALPA 3E0XA 4BP9A 2XQGA 4W1SA 3WWCA 3L1HA 2OXEA 3D5EA 1A7UA 4EZIA 2JBWA 1AUOA 3C70A 1UOQA 1ZGCA 1QE3A 5HCUA 1R9NA 2GBGA 2ES4A 2CZQA 4WY8A 3WK8A 1WPRA 1CQZA 5AI5A 3DS8A 2O2GA 2GBFA 5HZGA 4K6GA 4G8CA 2XMCA 3DDUA 2I03A 2G63A 5K3EA 5AJHA 3IIIA 2DHEA 4EA6A 3WKBA 3ANSA 4GEGA 2RHTA 5ALWA 1UKAA 4QEKA 1SCIA 4OU4A 5EFZA 2QXUA 3NGMA 4BRSA 3M3DA 4X6XA 4W1PA 4ZGBA 4WDQA 1C4XA 3ED1A 3AIKA 5EHZA 1XZBA 3I2FA 1LBTA 3I28A 4OB7A 3WYNA 4K5QA 4H7EA 1BEEA 3K6KA 3I6YA 2ZSHA 4HXGA 3FLEA 4BAUA 3MUNA 1FFAA 3WA6A 1QONA 3DYIA 3PICA 3ZLUA 4GWLA 5ALLA 1EDDA 1MAHA 5AOAA 5IH7A 2QT9A 1ZI9A 4ARBA 2XDWA 3G9XA 5BOVA 1XZDA 1EH5A 4B82A 4HAIA 3G02A 1XQYA 1THGA 1ZD3A 5A7GA 2O7VA 2VJDA 3O4GA 3K2IA 2XUPA 2WQZA 1AX9A 2K2QB 3LS2A 2I3DA 4AZ3A 3V1MA 4FLEA 2DR0A 2DSNA 3GBSA 4M0EA 5BWBA 2GZSA 2WG1A 1WPXA 2HA4A 1ZIYA 4BDSA 1S8OA 4MYSA 3E4DA 3GZJA 1EB9A 4UBJA 1FFDA 5AK5A 3QPAA 3G0GA 2WJ4A 3SX4A 4X6UA 2D5LA 4P93A 3D2BA 1EVQA 4B81A 2DFPA 3FSGD 5ALEA 3BIXA 1EX9A 4QDUA 4DYHA 4QWMA 5AM5A 4H7HA 2FX5A 4B9EA 5AK4A 5CT5A 4LYDA 2BCEA 4B83A 3EQ9A 5FLKA 2RHWA 2O2HA 5LIPA 4HZGA 2CBGA 3WWDA 2V96A 3FVRA 3CN7A 4Q1VA 1U65A 1DWQA 5AI4A 4FNMA 3MUOA 2BGNA 3FYUB 2HA2A 5FPQA 4RPCA 1GXSA 2DQZA 1DWPA 2Z8XA 3R3XA 4DNPA 2Q0XA 5ALXA 2QM0A 1WM1A 1EB8A 3S8YA 4UFNA 3JWEA 4X94A 4ZWNA 1DX4A 4P08A 1LZKA 2QMQA 2RI6A 4L0CA 3FBWA 3WMRA 1UT6A 2B9VA 4W9RA 2HU7A 3VXKA 2HU5A 5D6OA 4OD0A 4QZVA 2AJCA 4DLNA 4Z49A 2YH2A 3C8DA 5DNUA 1USWA 5BV7A 1XLWA 4WY5A 2H1IA 3DQZA 5IKXA 1AGYA 2QS9A 3LCRA 3OTQA 3RK4A 2G4LA 5AM3A 1R50A 1W52X 4AO7A 4Y2RA 4KACA 2AJ8A 4F60A 5DLPA 4Q34A 1J07A 1H23A 3D2CA 5LKAA 1GPLA 4LYEA 4FHZA 3UUFA 1IUNA 4ZI5A 2FJ0A 4OSEA 2WUEA 2XT0A 1XRRA 3I2HA 4KAFA 2IITA 4UHBA 1O6GA 1YB6A 3F67A 5I9IA 3KXPA 4FLFA 4BAGA 4KE8A 4C6HA 4CI9A 5HQ3A 1GT6A 5FXMA 2WUGA 3WL7A 3AJAA 4JYPA 4F5ZA 4L72A 2UZ0A 5DTIA 5AHXA 2XE4A 4WJLA 2XUHA 1ACLA 4PSCA 3ESDA 3CCBA 4YX9A 4Y2UA 4KRYA 5C8VA 4X3CA 5BWCA 3QMMA 3PFBA 1MTZA 3QITA 1QIKA 3VISA 2JGJA 3VVLA 2WJ6A 3IA2A 4B0OA 3YASA 2ZYIA 3IULA 5H3HA 1O6FA 5LZ2A 1E8MA 4I19A 2PKYX 1UOOA 2RAUA 5ALGA 5JASA 1YSCA 4G4GA 1NX9A 4J0DA 1HKHA 3DOIA 1X2EA 1DWOA 2IX9A 2ZSIA 1HPLA 2XLBA 1WB6A 1X70A 4L3WA 3O4JA 1K5PA 1LLFA 4GBGA 3RKSA 3B5EA 2OCLA 3AIMA 1JU4A 3A2NA 3H2KA 3A2MA 2EDAA 1WHTA 3DD5A 1IMJA 4A16A 1F0NA 1QFMA 1K6EA 4EUSA 3H2GA 3SK0A 4QWWA 4C88A 4ZRDA 1AURA 4DM7A 3BJMA 1XLUA 3O0DA 1A8UA 3IUMA 5KREA 5A71A 3H2JA 3HSSA 3IUJA 3WL6A 3AZPA 2LIPA 2WJ3A 3BE8A 2WG2A 2WM2A 1QIFA 3IURA 5K3FB 5D3KA 2GYWA 1QLWA 2G5PA 2ZYRA 4X93A 4E14A 4BDTA 3D2AA 3BF7A 5AOCA 5T4EA 1XROA 2ACEA 1IVYA 1R4ZA 3QBJA 1MX5A 4FMPA 4UBOA 2YYSA 2ORYA 1QIEA 5ALUA 3IDAA 3DCNA 3OC0A 3AILA 3I1YA 5JATA 1IUPA 3NOXA 4OB6A 1H2XA 3C8HA 3R41A 2ECFA 3KOOA 1LGYA 3H19A 5AI8A 4I4CA 1XKLA 5ALFA 4MEAA 2Y1KA 3G9UA 4C4XA 4BVJA 4CIBA 3HEAA 1CR6A 3W9BA 1JMYA 4K6HA 2ZYSA 5CURA 4D9JA 4JH0A 2X76A 1KU6A 3EBLA 3S2ZA 4KEAA 2R11A 4M0FA 4HRYA 2PM8A 1E89A 3GROA 1YR2A 5SYNA 4QDOA 1YAJA 2JEYA 3T52A 3TJMA 5A7HA 1DT3A 5EIHA 3UMJA 3DL7A 2HA5A 1CUSA 4UFPA 1R9MA 3CCCA 1NU8A 2HFKA 5CT6A 5LLSA 5FV4A 1UOPA 1JJIA 2Y6VA 1Q83A 1CUAA 4U2BA 4QDTA 4ZV9A 1BROA 1UWCA 1F0PA 2XLCA 3AZQA 1WHSA 3IUNA 1L7QA 2Y6UA 5JYCA 2B4KA 3O9MA 4MXDA 1IZ7A 3OPMA 5JADA 2O2IA 5F4ZA 4OYYA 3FWHA 5CW2A 3D59A 1XRPA 4YK7A 2NW6A 4AQDA 3HC7A 1YA4A 2XMBA 3WYDA 3VJMA 3O9VA 5ALOA 4KAAA 3W9UA 3WIBA 1UKCA 1Y7IA 2Z3ZA 4Y2SA 4AMYA 3F9CA 2VJBA 7YASA 2XMRA 2JGIA 5JD5A 5C8XA 2XUFA 3R3UA 1BCSA 5DYTA 3IB3A 1EHYA 3V1LA 4OCZA 3G9ZA 2H9YA 4U2CA 4FDMA 2VTVA 2W6CX 2VA9A 4BRZA 2C5FA 4KRXA 2G5TA 1ZI6A 1XZHA 2V97A 1QIJA 3W04A 3Q8WA 1TAHA 3FVTA 4FNGA 3WQHA 1D07A 1THTA 4H7FA 5HF8A 2XMZA 4DSZA 1VXOA 2JGKA 3SWWA 2QZPA 5EHXA 1EA5A 5JARA 2QRUA 5ALDA 4U2EA 1EVEA 4KE9A 1MN6A 2X8BA 2QR5A 1CRLA 1B41A 5HFNA 3FLBA 3DKKA 3WWPA 5JZSA 3ZPXA 4DGQA 3AFIA 3BDIA 4XVCA 3JW8A 4N5IX 1CUEA 4QDZA 1DT5A 4CCWA 4IH1A 5KBYA 2JGMA 3DL4A 3WIOA 5ALTA 1SOMA 4Y9SA 5FKJA 4INZA 4XWGA 4UHDA 5AIBA 4ITVA 4NMWA 5AKJA 2PUHA 3STXA 1VXRA 1XRLA 4J3JA 4WCVA 4X92A 3ESCA 1BEZA 2H7CA 4QE3A 3QPDA 3R3YA 1JT2A 5IVDA 4OB8A 4X6YA 2HM7A 5DTJA 5HF9A 2OQIA 5CXUA 3R3WA 3KWJA 4IHAA 3VVMA 2ZJFA 5YASA 4EHBA 2BKLA 1UK6A 1CUIA 4TVKA 3E3AA 2HRQA 5ALYA 2DQYA 3QH4A 2WIFA 3TEJA 3TRDA 3N2ZB 4OPMA 1XZFA 2CJPA 1GPKA 2WIJA 4QA9A 1CVLA 5IVKA 4FBMA 2C7BA 1L7AA 1R88A 4IH9A 2XUQA 5EHQA 4F0JA 5AM2A 1W6RA 3C6YA 5CRIA 2VJAA 3CN9A 5HKAA 4H7IA 5AP9A 2XQKA 5HKBA 2FJPA 3B12A 4J0HA 4DNQA 4J0JA 2CEKA 1T2NA 4U2FA 4X71A 2XMDA 4F21A 4U2DA 1EI9A 1VE7A 1MT3A 1ODSA 3PI6A 4Q3KA 5HF5A 1XRMA 2HIHA 2WIKA 5KWJA 1VOTA 5CTAA 4MYDA 1EXWA 2H7XA 4CCYA 1N5RA 3RARA 3H18A 2OAGA 4QLOA 4P92A 4GI1A 1QIDA 2C0QA 4EY8A 4X95A 3BF8A 4UHHA 2BUBA 2VJCA 2HA7A 3SC2A 3F97A 2OQVA 4C4YA 2VAVA 1IZ8A 4DMHA 4CFSA 2RIPA 2Y2VA 3VDXA 1M33A 1H2YA 3H1AA 3WJ1A 2HL6A 1QTRA 5K5EA 5AI6A 3CXUA 3PF9A 1YA8A 2X5XA 5EIEA 3F8SA 3HYSA 5HK9A 2GZRA 4G9EA 3M83A 4PSUA 3FNBA 4N5HX 4BE4A 4BTLA 1A8QA 1H2ZA 4G4IA 2HADA 4GW3A 4A23A 4K2AA 1TKRA 5A62A 2BUAA 1G42A 4UBKA 4X00A 3LIPA 2OGTA 3OOSA 3H0CA 1LPNA 5DNVA 4U2GA 4AN0A 5AH0A 3QPCA 4N8DA 2AXEA 4C4ZA 2HRRA 1UKBA 1XZEA 3P2MA 4W1RA 3QZUA 4HXFB 4Y2TA 5LKRA 1E3QA 5LZ7A 4BAZA 5AKEA 3GELA 4GDMA 2VQ6A 4MEBA 2WTMA 1XQVA 2YXPX 2J4CA 1LZLA 5ISMA 1BN6A 2XUDA 4N8EA
chains in the Genus database with same CATH superfamily
1KDRA 4Q3CA 4LOJA 4P35A 1ADJA 1PG2A 4ZAGA 5P8WA 3HLTA 1OH7A 2ZAIA 1SXIA 3DZBA 4QYIA 2DEUA 2O5RA 2RARA 1C9MA 3OCJA 4ZQBA 2VCEA 1BOFA 5LD2C 2G7ZA 1QZUA 1GPMA 2IHJA 2QL5A 1LU9A 5FNVB 5C34B 1X15A 4BC1A 4GX1A 4DMMA 3W5SA 5TQ0B 1KERA 3KSUA 4TVSA 4GZ6A 3PHJA 1KJQA 4MWGA 4Q7MB 1E6KA 2HU8A 1FSSA 3DW3X 2XUAA 3IILA 4ZC1A 3RFVA 1TTPB 2IU6A 1NN5A 1JBEA 2JDID 2FR1A 3KQSA 4IEFB 4MUAA 1I2BA 4BRWA 2Y1LA 3P20A 1L4EA 4BASA 4XWKA 4IDFA 2I80A 2ZIWB 4QT4A 4F38A 1P1IA 1Z63A 1LXCA 3Q0EA 4B3MB 1KIFA 3RM3A 5G4LA 221PA 2IE0A 3SQLA 3EOBI 4MO2A 1XEFA 4JKIA 3RJZA 5C80A 4REQB 3AWIA 1JFSA 4BKOA 3AESA 3KUKA 5EJMA 1N7JA 1QXSA 1F06A 1G9XA 1H5NA 1XMQB 4L95C 1VYHA 4HMQA 4Q4LA 2A0FA 3EXAA 3OT4A 4MDYA 3GD5A 4Z86A 5C8DA 1JR6A 4QXRA 2WHPA 4K9RA 4YGYA 5F23A 3G6KA 1A8PA 5DP1A 3RU7A 5GZ1A 3DE4X 5LXTA 1HYHA 1P74A 2FCAA 3Q4GA 3ZTTA 1FBNA 4BB5A 3PRHA 4PS1A 4PRZA 4TPKA 2C4TA 2JI8A 2V7WA 2XQIA 1JU3A 1PFWA 4TQAA 1M7HA 3G0CA 4IPTA 5K3CA 4BLRA 4CTKA 4MB2A 3NPAA 1WJGA 2JJYA 1HE4A 3L18A 4H4CA 3T3EA 2FE1A 4PEVA 4KYVA 1E0KA 3ZD8A 1TKAA 2HN9A 2I34A 2Q99A 1T26A 1TW2A 3QW4B 1RR6A 4P7JA 3MERA 1NRIA 2ILVA 2ZYUX 4ZHQB 3K96A 5EKTA 4J2HA 1YZFA 1ICEA 2RCYA 3HZOA 1Z34A 2CWDA 3L7IA 1KSHA 4LDRA 1QGUB 2YKGA 3UKDA 3A7EA 3FCXA 5FADA 4ZYTA 2HFJA 1JA0A 2H52A 3SHVA 3IXMA 3H5VA 1UMBA 1XZGA 4KE6A 5DIZA 3ROTA 1RM3A 4AULA 5E4JA 1FMLA 4LGVA 3GJ4A 1ECBA 1Z5GA 3OX2A 1MQSA 3FZYA 3HCFA 4JLMA 3PPVA 1FFEA 3LHDA 4DBZA 1C9NA 4K8RB 2EFGA 3GRCA 3D1VA 1T5IA 1V3UA 4G2NA 4KMMA 4WXRA 4A10A 3U1BA 4A0FA 4IQFA 3JZAA 2HXSA 1L7XA 2OVFA 1IJKA 1HF3A 1HGXA 1NBMA 3DV2A 3PRKE 1GCUA 1ODIA 2LVBA 3IE2A 3Q85A 2NMVA 1K2VN 3D3KA 2AMVA 1B6GA 4GVPA 3CGWA 1CDDA 4BPRA 3K4QA 5IZCA 4BXOA 3OJ0A 3RUFA 1E79D 4BTVA 1M1YA 4U5QA 3RFTA 1J2TA 2OTCA 1Z2PX 2FW0A 4TMZA 1OGJA 3H6GA 4OA5A 4Q9NA 5FLYA 2J0VA 4XX0A 3LTEA 3WTCA 2VHQA 4GNRA 4I4TF 3WVNA 1KEPA 1YQDA 3TGWA 3R1IA 4IICA 5ECWA 3WNCA 5FI0B 3AW8A 4OU5A 5E7JA 5JZ9A 2ZM5A 3NBQA 1YDEA 5L3SA 3WLPA 2V1UA 4U6SA 1EK0A 3EMBA 1K6JA 4RKQA 4BNIA 1TK3A 1PX2A 1SH7A 3JASA 1O0SA 1PP4A 1QKIA 2XKJE 3QKRA 3QXJA 4E5MA 3GRPA 1N6IA 2GESA 5A1TA 4PIPA 2BGGA 4PYLA 1JQEA 1WCIA 2ZBRA 5BWOA 3LKVA 1XHLA 3L8EA 1WCV1 3BWCA 4Q9KA 1L5FA 1CFJA 1V4VA 1Z6AA 4MUNA 1R6TA 3FPHA 3O4IA 4PQFA 4UHFA 2MYTA 4D97A 1JG2A 5H70A 1LWNA 3VH1A 3WZMA 1T2AA 4FCVA 1G3MA 4DEXA 1VBFA 3TLKA 1SB9A 4FSXA 4H1VA 4INOA 2MSDB 4XH9B 2ECPA 4RK6A 2PA0A 5FBLB 3A32A 4JC4A 3KV1A 3ZV7A 5C7LO 6LDHA 5F3RA 5I3ZA 2XCOA 3GMDA 5GMOA 2OK8A 3G2JA 4I4TA 1RM0A 2W6QA 1U3FA 1ZGBA 3R9XB 1Q5PA 3ERCA 4MLZA 2HLHA 2PKWA 5FOXA 1T2FA 1ZL0A 3DP7A 2UKDA 4H7DA 3W1EA 1W36C 5CBPB 1YBMA 5J2UA 1HYGA 3EODA 2BEVA 2GRUA 4OP1A 5KYVA 3LOQA 3NYQA 4A8PA 1PS0A 4BCCA 3H2ZA 1JR3D 1C5KA 1ZXBA 2X0JA 3AHHA 4RK0A 4TGLA 2DKNA 2IYXA 2JCGA 4EMSA 3RASA 3I6ZA 1GTSA 3WMEA 4AYXA 4TV8B 2W6NA 4UTZA 1QYDA 1R0CA 4R7TA 1T36A 2BUCA 3IDZA 4DB2A 3GNTA 1IB6A 2H5JA 1HM5A 4GM0A 3ROGA 3ZVLA 2YWXA 4CG3A 2I5PO 4F3TA 1QO9A 3CJQA 2HNKA 3GJZA 5ALHA 5FV7A 2GF2A 3K73O 1XTIA 1T4GA 1WZNA 2BJWA 3OUTA 3V7UA 1PU2A 1C0IA 1TO1E 3C39A 3GWGA 2CLCX 5E2IA 5ESWA 4N18A 2OGZA 5EEGA 4UC0A 3HVJA 3Q3VA 3RSCA 3WLLA 2WE8A 1KYQA 1W5BA 2VHXA 1CY2A 3AIIA 1KXJA 4UTRA 2F8SA 4WTOA 3BUSA 2A0UA 2WAYA 1AV6A 1P18A 1PT8A 1S01A 2G5CA 3B2NA 3MWJA 4MS3A 4R69A 2AYZA 2VDUE 1A95A 3CWQA 3Q3CA 1ACJA 3VU8A 4RVHA 3V9AA 3LLVA 3WL4A 5BN4A 4Z4GA 3VZDA 5LQDA 4AFNA 1P2GA 1QG2A 1TVKB 1W87A 2YDXA 1CZLA 3CNNA 5FP0A 3DCIA 3HR7A 1N6KA 1WOMA 1XJCA 3FPCA 2QE6A 1Z22A 3ZX5A 3U37A 3IIKA 4CNBA 1U8ZA 1WDMA 3AB8A 4JROA 1FRFS 4NMMA 4ZU1X 3PCXA 5JJBA 4H4EA 1W5EA 3I2IA 4ICIA 1G3RA 1NVMB 2OSBA 3IQHX 2WPDD 4FYWA 4TTVA 2OD2A 3QG5A 3L6UA 3M4YA 4J0GA 4HWRA 3T0FA 4IIJA 2WU3A 1RXEA 3M6FA 1B2RA 1KYVA 3F6BX 2XUGA 4RM2A 1EHCA 3C5WP 1GQYA 4R9NA 4ZAYA 1VMDA 1KMIY 1L5OA 1Q2XA 1QO0A 5E4YA 5ALKA 5I01A 2YMMA 1ONOA 4JIMA 4NH4A 1XSEA 3E53A 2PBRA 3NHMA 1V1JA 3NT2A 4RDHA 4EF4A 1V3QE 1YR3A 2J0EA 5GZ6A 2CLDX 3D3QA 1FNNA 2BFCB 2XTAA 3R2JA 5LQCA 1PJBA 2REQB 3ONFA 2W22A 3GDOA 4XGNA 4PG5A 4BLSA 1C50A 5CA0B 2J7KA 2Z8ZA 1UDRA 3QLUC 3DEIA 3ESQA 2FMUA 5EFOA 2R8EA 4KSCA 3IRVA 3DMFA 4BNUA 2H4YA 2PT7A 4UHEA 3CX4A 1ZBDA 2RGGA 4OQPA 3G8YA 2V4UA 2AF4C 3AGQA 3RYTC 3ZWWA 4RY8A 3VR5A 2PH5A 4JXKA 4B31A 3A1NA 4A6XA 4CDGA 4NG5A 4PC1A 1HE1C 3WK7A 1PO7A 4YJ2A 5KWIA 4ECEA 2HK9A 3FPEA 3QVLA 4EHNA 4XYLA 3H2HA 1QTIA 2DYKA 3DXFA 3RV4A 4JXZA 1IOZA 2EHJA 3RLIA 3QMWA 4D42A 4DL9A 5JMOA 1ZH0A 1EX1A 2P2SA 1OX4B 1U2EA 3RIEA 4JL6A 4GG1A 4QUIA 5EP3A 4KPYA 3OQPA 1OBFO 2ZWOA 4R5HA 1CJBA 1HDGO 1XQWA 2JCXA 5EWJA 3HFJA 3T4PA 2COKA 2VATA 3P9ZA 3PFWO 4A92A 4O2AB 4FJ0A 1A8SA 3L43A 5M3BA 2WW8A 2EZ9A 4O0LA 1DRKA 1TUEA 1HE5A 1H9CA 4TKUB 5I3CA 4LJAA 3PHBE 3T0GA 4DM3A 1JJFA 1MENA 1J06A 1Q84A 5AHRA 4D96A 4LXUA 4ER0A 4LMBA 2H4FA 2QOEA 5EJ8A 4O08A 4QU8A 2OWDA 3UB3A 1GZ3A 4LVUA 4I4IA 1XIVA 2YASA 1DG9A 4OQMA 3N7AA 4UBIA 4RTOA 1XNHA 3ZVMA 2TRSB 4N6NA 2XMGA 2YWGA 5C1BA 4Q4AA 4KWEA 3I0ZA 1YS7A 2NTEA 4LBZA 3BK2A 4EENA 2YY7A 5EN4A 2C4HA 3K8ZA 3JQPA 2Z5GA 3HLYA 4AY2A 3P19A 3VO1A 1BDBA 3CLTD 3VSBA 3E2MA 3WRYC 3FOCA 4TWZA 1LF0A 4JJZA 4ODIA 1G6KA 4FDVA 4CKEB 1NQTA 2UAGA 4ZI7B 3CNBA 1BCRA 4Q3NA 2P62A 3F8TA 3P45A 3TLXA 1F0YA 2PSDA 1MNQA 1U8XX 1KQPA 3GEDA 2QRJA 3G59A 3KOWA 1Q91A 4HLQB 4C7JA 4L9WA 4P5PA 4J90A 4JOCA 5AOBA 2YOHA 5EPUA 1VLVA 2ZYHA 3KB8A 4FOPA 5C31A 2XVXA 3IR7A 2H2AA 3ZWOA 3LP5A 4F8YA 5BR1A 2OD9A 3LNTA 3OFSA 4KI0A 4DHEA 4RIEA 1XZLA 3FUTA 1E2HA 1XQ6A 2GERA 2QW0X 3KLBA 4LYHA 3CF4G 2R4TA 4PHHA 3CWZA 1IJEA 2PZMA 3CZRA 5J1SB 5CCXA 4IIBA 3GMIA 1EG7A 3NHPA 4IIJB 2FFJA 5FO1A 3WLAA 3ASVA 1KO5A 3SIRA 1O4VA 4LE2A 3H0KA 4DV6B 3D4IA 4TYNA 2DHCA 2IY7A 2G80A 4S1OA 2J32A 1J33A 3U81A 3E9DA 4EY4A 5JYBA 2VXCA 2X9NA 3ANNA 2C3PA 4JBNA 4L5IA 2GF9A 3IUQA 4YIHA 1M8GA 3FYUC 1C0KA 4NMHA 5KHOC 4NU5A 5A5EA 4QJBA 4DBLC 2GCEA 3E5MA 3MUFA 2FFAA 2VP3A 3PX2A 3OIDA 4ND4A 2J87A 3ORFA 3TD9A 2ET6A 2Y99A 1CZHA 3HTXA 1X1CA 4M7PA 4QNNA 4HNAA 1B23P 5HIMA 2IUEA 5DV9A 4OUDB 2DXIA 1JDPA 2NZUG 3N2EA 4AYWA 2C07A 4GHWA 2YDYA 4HUTA 3GLFB 1H1LB 3JQ8A 2QTAA 3OQIB 1RPAA 2AUNA 1MIOA 2H2GA 2X4LA 1RRMA 2A30A 3DDZX 1YQQA 4RW0A 1CNFA 3HU1A 4BO8A 1XVIA 5KINB 3KQTA 4I55A 4XIIA 5BW6B 3ICCA 3BILA 2OCGA 3EQ7A 3O4FA 3ZD6A 1NUHA 2QTTA 4C0QC 3BXPA 4RSMA 4A1FA 1SPBS 3HNPA 3RSGA 3FZGA 3L4EA 3NDRA 4AB1A 2HMWA 3ESBA 2Q4RA 4JUCA 3WLTA 4I1SA 1QH0A 1GKKA 2OO5A 3WKEA 3TZHA 5CPBA 1QIIA 4X8LA 4UAUA 3SSAA 3RS9A 1GZ7A 4J76A 3B3QA 3QEMA 4BNGA 4ZOEA 3WYGA 1EFKA 1KO8A 2X13A 3E48A 3L77A 4E5PA 5JALA 4JJ8A 1C9KA 4NH0A 2O1WA 4EB3A 3R0ZA 1QB8A 4WE3A 1V35A 2ZYGA 721PA 2C54A 3FJOA 2HJWA 3GQBB 2DAPA 1JWLA 1DV1A 1P1CA 2GJKA 4G01B 4PPGA 1PL6A 4EFDA 1KKUA 2QGZA 4FI3F 4BX0A 2H5EA 4B43A 2R8OA 2X2EA 3T4XA 5JZBA 1QORA 3MJSA 2B61A 4V0ME 4P2GA 4ZCMA 4TZKA 4MV6A 4FFSA 3U7JA 1YDMA 1YT5A 4J0FA 4QXQA 4XFDA 2BP7B 1V1MA 4INJA 4EW1A 1G2QA 2QVBA 4CKCB 2C7PA 4A36A 1FTQA 2VT6A 2W8BA 3PHIA 4LIPD 4ZCLA 4KFUA 2NO1A 2DPHA 1XRNA 2IJGX 4NCAA 5AKKA 2ZWAA 4UM5A 1YKFA 1O96B 2GM5A 1BHSA 1V45E 2I2XB 1Q19A 1U0EA 4IV5A 3SHFA 1H0KA 5A7FA 2FUKA 1YL6A 3JASB 3ROMA 4JXXA 2RONA 3WI7A 3RTAA 3T06B 3TNDA 4RNDB 3Q0TA 2IBSA 4BRUA 1P72A 3C1UA 4FILA 4EF6A 5C7YA 2HIMA 2Y0PA 5TNXA 3Q7TA 4EKIA 2BDEA 3TKAA 2QW1A 2BEWA 2OM2A 3MM4A 2V0CA 1SO8A 4OSPA 2NPIA 5BSFA 1TI7A 1CJUC 3PIRA 1I6KA 2O2DA 2VJLA 1P0FA 3K5WA 4KIFA 5LLTA 2ORWA 3V1TC 2F9LA 3FPKA 1G1AA 4EUFA 3LO5A 1H3EA 2XNJA 2R5NA 2DTDA 3NVDA 3RTDA 4DABA 3GZNA 1NFQA 3I5YA 2QXTA 4Z4FA 1J25A 1BVUA 3AFMA 5SZJA 3TBKA 2HK6A 2WU0A 1M6EX 3I12A 1N92A 3H9CA 2NO6A 3PNPA 4KWCA 3FNRA 4ENRA 3THXB 4BO3A 2J46A 2CXQA 3L1UA 4QUBA 1OY1A 3ILSA 4PX9A 5DNWA 5KVVA 1KL7A 1LVGA 1YRBA 2LDXA 4H2DA 3A1VA 4FDUA 1JZQA 1QDLB 1CRZA 5GGXA 1YDWA 5IMBA 1PNVA 4JIGA 5M04A 1JHAA 1UANA 1SKYE 1UFRA 3N7UA 2HR1A 1M8FA 3OFJA 1FFBA 2MU1A 4I1OA 1Z5UA 2E82A 1QO7A 2OFWA 5K7SA 3D0OA 3PNYA 4Q4AB 4B4KA 3P2JA 3QF7A 2BFDA 1CY8A 1MBZA 4LK2A 2PJRA 1TA9A 3HGMA 1XZAA 2D4AA 3X1KA 1PG0A 3SQNA 5BVHA 4YAEA 3B1JA 2WTXA 4KH1A 5I8WA 3KSZO 1CHDA 1GG5A 1HC7A 2JA2A 4NSNA 1OMOA 1VB5A 4BN0A 3NHBA 1W93A 4AAYA 4URXR 3WYAA 5HWSA 1U04A 3QSYA 3U44B 1AZWA 3ETNA 1G291 1ESDA 3ETJA 2Y0EA 4JMLA 4KB5A 3M6AA 3UV7A 4OUKX 4UJ5A 1G20A 1R8JA 4HPJB 4QUAA 4CHTA 1G1MA 2JJ1A 3N87A 1CUGA 3MCAA 3NS7A 2EP8A 3FNQA 3VV3A 2QORA 2WILA 2R68A 5L4NA 1I2CA 1K8RA 1ZEJA 5JRZA 1A9SA 5TGDA 3WLEA 1EQAA 4IUDS 2Q2NA 4HN2A 5CGZA 1A8IA 2JIOA 3IR5A 2PZAA 2DHQA 4FUTA 4HDKB 4N6GA 3DLTA 2EATA 1XNRB 5A9SB 3ACBA 5H9VA 1E2GA 2GN2A 3LY7A 2OV2A 4R1NA 4RVSA 2X7HA 2NUBA 2ZIXB 3DEKA 2JDIA 4JLWA 1AHIA 1GQRA 4KQEA 4O4LB 1YB5A 1CY0A 4LGMA 2ZCUA 2E5FA 4MO9A 2QPOA 4OTZA 3CPHA 4R6XA 5BVGA 3FTFA 4MYHA 2VQDA 3L7LA 1RZVA 3SX0A 2AIRA 3C4QA 5CMLA 1YGPA 1CZNA 1R64A 1VFPA 2IPNA 2JBAB 2VYVD 5ANRB 4BLOA 5ES4B 2VXBA 4QIHA 2F7SA 4FSDA 3B6KA 3W7BA 4KSBA 4QFDA 1MO6A 3AONB 4TLMB 5HHTA 4DA4A 4JYAB 5JDCC 3VKHA 3OKCA 1AKTA 3LUCA 3PDWA 4B4OA 3NYWA 2PGXA 4ABTA 1Z07A 2X9VA 4RE6A 2J07A 5K4GA 1M83A 2A2ZA 3K9BA 5FPPA 1Z0ZA 1HOXA 3DAPA 1I24A 2XQFA 3Q3JB 3QXGA 5HUQA 1LH0A 4TVBA 3VPDA 5KPJA 1EBFA 4GRIA 2VHCA 3PNOA 2PWPA 3ESZA 4PQEA 3PK0A 1WXGA 4ILEA 2IHVA 1L5ZA 3T6KA 1K3TA 2FYTA 1ZW6A 2R6AA 1JLLA 2V03A 4MWSA 3TBFA 3NTOA 4FFRA 4PLTA 1WS6A 1K06A 2BW0A 2FFQA 4EFLA 1Y7TA 4K6CA 4LRQA 3QBVA 3EGDB 4MGZR 2QR3A 3OIYA 3PT5A 2XWBF 3RUHA 1KMHB 3EVGA 4P5EA 4CPDA 2Z2KA 4K05A 1I4WA 2V7QD 1E79A 3AP2A 3GY0A 3ODGA 3R6TA 4NS4A 2ZB4A 1XP5A 4QPPA 4R01A 4B33A 2PHZA 4GP9A 1VKNA 3OVMA 1J4AA 1RHKA 4FHEA 4HEQA 1VSVA 4M38A 5T67A 1Y7HA 5LD2B 4C1NA 1A8HA 5A2GA 1AQYA 2Y71A 1KP9A 1VYUA 3OZTA 3N86A 2XQJA 3R3VA 3SBEA 2LD4A 3PC4A 1V3VA 4PLFA 5JAPA 1UBEA 3BA1A 4M8SA 2C5LA 4BEVA 4UEQA 3W5CA 4OH7A 3TE6A 4DV2B 1CIVA 1ZO8A 2GEVA 2O50A 2UVDA 3REOA 2F3QA 2ZRNA 4MVJI 2HGSA 3VX4A 4M0PA 5KDDA 1AGRA 4OBWA 3S4YA 4UASA 4I9HA 3QFCA 4WK4B 4I9FA 4KBYA 3V1NA 3NHLA 3OMWA 5H3CA 1P33A 1XN1A 2LR0A 2X2FA 1BE0A 3ROXA 3ULKA 3V2GA 4ASUA 5AVZA 5L95A 1DINA 1O6ZA 3BZUA 4DNXA 3QQPA 3ED5A 4OSOA 5J63A 4HAUA 3IO3A 4BX2A 2J0UA 4YAKA 2X1MA 2K7FA 2QU8A 3MMZA 1KK1A 5HRAA 2GPWA 1P1KA 4BWGA 4WSOA 4GS5A 4QOGA 2V7GA 2REBA 2WMDA 2D3TA 4EB0A 2FMIA 2I6UA 1J2EA 4CEIA 3EIEA 2Q5LA 3II6X 2QT0A 2ZULA 2E6UX 1P73A 1GM5A 1LPMA 3DBOB 4GBED 1HDIA 3H16A 4PICA 3I8OA 3RRFA 2A9RA 2VPQA 2X15A 2G6BA 4P3OA 4JZKA 1NIJA 1OAKA 1X7XA 5AKHA 3SE7A 2OFXA 2Q7XA 1JSZA 3RSHA 3DPIA 1ZINA 3OSUA 1OA0A 1V8ZA 4JR0A 3DZIA 3SSNA 4OYRA 3KJQA 3T7RA 3FTNA 2W42A 1M2GA 3G0IA 2QVZX 4LAFA 1T9HA 2BGJA 5K0BA 2NT4A 1BH2A 3IRUA 1SNYA 2PS9A 3W8EA 1QVVA 3QHQA 4HXEB 3COVA 4PANA 1XZPA 2UU9B 4ZQGA 1PK9A 2WU8A 4ZO9A 1N5JA 1MLDA 3ZIAD 2CV1A 4YAGA 3G2HA 1GHTA 1PNRA 1Z62A 4G0UA 3FCUB 4K9KA 4K46A 1M8JA 4XYMA 4YRCA 3PQEA 3UIEA 3M1IA 4HP8A 4CIAA 5IG2A 3SBXA 4BECA 3HY6A 3CUUA 1ENZA 3IUPA 4FJ1A 1M1ZA 2QRPA 4HLDA 1GCOA 4Q3DA 1B0UA 1S3GA 1J2JA 1YDGA 2XVZA 4GQBA 4WNIA 4Z8XA 1VKOA 4YI3A 2PANA 1NRWA 2I91A 2DBRA 4PYIA 4HDNB 3I58A 3C2QA 4AKTA 1E77A 2OG1A 3KXKA 2Z9CA 4EG7A 4ON9A 4E2YA 3FSJX 4V2IA 4DJEC 2ZAOA 3B2QA 4WY2A 5DRTA 1XTPA 1F8YA 3DE2X 4P4SA 4DCOA 1ABBA 3KXDA 5DNCA 3ETDA 1U8TA 1QG0A 3MLBA 2BGWA 1BX0A 4RAOA 2WFMA 4JB3A 2WWGA 5FLEX 5JC1A 3O8OA 4IOJA 4ZQHA 2Q1YA 2CHQA 5A06A 1DB3A 4II2A 2PO5A 3UQZA 1FMTA 2IY9A 2GTHA 3OLVA 1H1DA 3GVCA 3SBDA 1XZQA 4LJRA 1ONBA 2Z30A 1PV1A 1A4XA 5IDXA 2ZE7A 2B4YA 3ZWCA 4JV5B 4C2BA 2J9FA 4FHFA 4V1CI 5D3ZA 5FQNA 2VH1A 4Y7DA 1QF9A 3HO8A 3EQ8A 1GKUB 1ZESA 3L7CA 1TX4B 4RTPA 2NU8B 3BJRA 1TAUA 5DULA 1MX1A 2ZSAA 3RU3A 4YP5A 1NLZA 3K8QA 1JTFA 4J8PA 4D4GA 2PL9A 3L5KA 3HDQA 3K20A 4UQOA 2B21A 5GAJA 3HXQA 2PV0A 4BB9A 4IH4A 3H65A 3VKGA 2CLOB 4UDOA 4DMGA 2FWIA 1J9GA 2XXBA 2AUTA 5T4FA 1KORA 1YVEI 3CEHA 3NDJA 2NZVG 4CNQA 2WHPB 2MR6A 3CZAA 2NSYA 3QOFA 4GLFA 5ALMA 5EZYF 5DO9A 4WBSA 3D6VA 1D2NA 4F93B 3NUZA 4XRGA 3QW2A 2VAXA 2FUG6 1KBZA 2WD8A 2BELA 4Q5IA 7MDHA 1ZHFA 3KAJA 1WB5A 1GPBA 5K3DA 3AF6A 3H8WA 4A5OA 3A37A 3JQQA 1TJPB 4FFNA 4TXNA 4RACA 1SQ0A 2EYUA 1N5LA 1EESA 3GYBA 1KVRA 2PY6A 3NBMA 2VHJA 2RHLA 4GOKA 5T4HA 3ZV6A 4OGWA 2WR8A 3IAAA 4C0KA 4EY6A 1ILWA 5B1YA 5CK5A 3KHSA 4HQNA 5ESXA 2HQRA 3LM8A 1TA0A 1RPTA 2W93A 3MW8A 1F2UB 1VTKA 2X0FA 4B6EA 3SSMA 2P27A 2VJOA 3NIGB 3AYXB 3C45A 5TQ0A 3S99A 3AF5A 7ADHA 1GA1A 1YBAA 2CBXA 3IS3A 4WXEA 5E95A 4HTAA 3STVA 4A8JA 1T13A 2L2QA 4RFSB 2VFAA 4PN7A 1NG9A 3CW8X 1QGED 2XBMA 3D1LA 3DFFA 5LMUB 1GD1O 4QYIB 2VJPA 1KYYA 2ZW9A 4KIWA 1OC2A 2DCMA 4PF1A 1GL9B 1KZ1A 3TLYA 2QDKA 1HH4A 3QI2A 3UTDA 3ZZUA 1EEXB 3HBMA 3JD0A 4V03A 1CUWA 3B20A 5MN6A 1ES9A 4AY6A 2QM7A 4JA2A 1NI5A 1SKBA 1E7RA 5ALRA 5JAIA 2P2GA 3H3FA 2WIAA 3BH0A 1RHJA 4JLPA 1YR1A 4RGYA 5JJLA 2FZKA 5J5VA 3WLMA 2I1QA 5FWAA 3ZJYA 4A15A 4Q19A 1W0CA 1QC5A 1VCOA 4QUGA 3UJAA 1PQUA 4D3ZA 2DR3A 3GJ6A 4ZAXA 4KJXA 3A6ZA 1YGYA 4RTKA 5FBKA 3NOQA 3OFND 4B2PA 1HX7A 4UBLA 3BMXA 4JI6B 1SU6A 3FR7A 3HU5A 4YJKA 4XTCS 3ENKA 4RE5A 5CPFA 1MJNA 3I34X 3ZIUA 4FWBA 1CJKC 4WL0A 4OKIA 5FWXA 3VOBA 2RGRA 2JJ2A 3RROA 1I3LA 2C20A 3N70A 2JB9A 5F35A 4KO3S 5AXAA 2OCPA 1WQ3A 5MGBA 1PJCA 4BLQA 2A9QA 1ESCA 3RF6A 4BO6A 1N2JA 1WMFA 1OOEA 4B40A 4F92B 2W6OA 3D6MA 3O4VA 5EJ9A 2IFTA 1E32A 1QDEA 1NYQA 2PH1A 1CERA 4J07A 2ROQA 5IM4A 3QUTA 4RDXA 1WPQA 1WPGA 1BGWA 3HVHA 2BD0A 5HJ7A 1XFDA 3HY4A 3E70C 3PXUA 1YQ9A 2JGAA 1SXHA 4M0KA 1B0PA 4JJ6A 4PNZA 2FMTA 3TEMA 3U6BA 1JI3A 3PA6A 2AKAB 3JQFC 4GC5A 4O4JA 4RADA 4EZEA 4GXNA 2P40A 4I7EA 3Q7PA 4OAOA 4P34A 2PD4A 3JARB 5EMNA 3SICE 4B74A 3DHNA 1VCMA 3ICVA 4N9WA 6Q21A 3DM9B 3W2HA 3TOSA 1C1HA 1SVOA 4ZO6A 4PBTA 2II6A 2W2TA 4O4HB 1VIDA 4LMAA 4IZ6A 2P35A 3LCVB 2B4TO 2QN6A 5EUCA 4EI2A 4JJEA 5F77A 5LQKA 2OORA 4ZODA 3B6ZA 3FPLA 4IUYA 4UXHA 4BGIA 1GN9A 3MINA 2E9SA 3CPJB 8ABPA 5E0OA 4RV4A 5DHRA 3K0HA 3QVGB 1XJQA 3DUWA 4BNWA 1V48A 4MVJD 5AHWA 2HH9A 1YXMA 4RZSA 1Y1KE 1UODA 3SJCA 1TPZA 5HRCA 3CRW1 1B74A 4BMSA 3T5DA 3FI9A 3NHUA 1ZJ5A 2XMQA 5C51B 1E2PA 2Z58A 3AEUB 2E6KA 3PR2B 2VNIA 5E3JA 3R7WB 3UT0A 3OX1A 4EBBA 5BMVB 2XMSA 1K6IA 3I2YX 3KUDA 4C43A 3I4CA 3AWDA 2CNLA 3PD7A 2J6HA 2BPOA 3BOSA 3CBGA 4HMOA 4XGQA 3SR0A 4DLPA 2O0KA 4G8BA 4Q48A 4G41A 3CNHA 2O52A 2FFBA 3EDYA 2I8LA 4QGFA 5PGMA 1JJBA 4ETNA 2K4MA 1P5RA 4NEHB 2X6TA 3SMQA 5LQUA 4TZ6A 4C7VA 1D2CA 4BKUA 5FBRB 4YMUA 1N33B 2C9BA 1GR1A 1KOFA 1P62B 3FMVA 4J1NA 1C7IA 1W1IA 3GEBA 5T6MA 5JS2A 1IIBA 2PX6A 4NAVA 2CC2A 5E0KB 4ZAWA 2CB0A 4WBNA 1RWVA 4I36A 4QFBA 4R2IA 4YRZA 3HA3A 1FBTA 1E0SA 4N1AA 2WF5A 3RF7A 1Z7WA 4I5EA 2EOAA 3BIWA 4MUKA 4KRFA 5SZKB 2CXUA 5JE8A 2VO1A 4WXPA 5TPWB 4WK6A 3TNFA 3PJGA 1IPFA 3EHEA 3IODA 4JODA 4IJUA 5LM3A 5FA6A 4KFCA 1VBMA 5J3JA 2R84A 4M0MA 3M5WA 4PO1A 4Q7LA 4LV8B 2PL5A 3TXAA 3VC2A 1Q0SA 2H8GA 1SCQA 3MTGA 1NVTA 1OFGA 4RF4A 3N6VA 3CGGA 1WV0A 4I3FA 1E9DA 1Z4KA 4ES6A 5KYUB 1Q77A 3TGLA 3E5HA 1HNXB 2VQFB 5K0NA 1UM8A 3TPCA 1Y9EA 5KIAA 3B8EA 4I8IA 4FR2A 3ZBPA 5CR9A 3M34A 1DRWA 1YNSA 2CFCA 1YU9A 3B7WA 3GT0A 4J9VA 3KB1A 3ZUGA 2YJGA 4BP9A 4XEUA 3KXLA 3E05A 1WD5A 2B5VA 4W1SA 4P8RA 2CVOA 3GLVA 4DCGA 3EDRA 5HCNA 4S1TA 3WWCA 3JCZA 4EHKA 2P3LA 2EFYA 5CDGA 2CSXA 2OXEA 1BJRE 3D5EA 4DM4A 4UEKA 1HNZB 4P81A 2VJNA 3MMNA 4IMJB 3ID6C 4IJ6A 3AHCA 3U44A 3CH4B 4R2JA 5DSZA 2VDLB 3H13A 4BMOB 5F12A 3M1AA 3CRRA 2PQMA 3FYSA 1I2AA 5HCUA 1M6HA 1R9NA 1MH9A 2KM1A 5CLGA 3BORA 3RJ5A 1UDCA 4IRMA 3T1NA 2IV7A 4FFBB 2QZJA 1NBOA 3QPVA 5H83A 1NX6A 1T25A 5JSQA 4Q0MA 2IT1A 3DS8A 1RCTE 2O2GA 2WWVD 3H7AA 4HH3C 1CKEA 1E2LA 2DMRA 3W77A 2YN0A 1EPUA 3I9LA 4NV3A 5HZGA 4KO2S 1WTCA 1N6LA 4AIIA 3A0RB 1Y6ZA 5HDQA 3U7QA 5EAIA 2J5QA 1SKUA 2ZI9A 4OIFA 3K5HA 5H81A 1FDRA 3VSCA 5J47A 4RL6A 5K3EA 2QAJA 1E6MA 2QN2A 4LSGA 1Z29A 2I8AA 4EO9A 3WKBA 3NDBB 2J85A 3R5XA 4JN6B 2ZS9A 3FTPA 4GEGA 4RL4A 4UVEA 2J0QA 4RSHA 1H3NA 1Z06A 5ALWA 3ZK7A 3AVTA 1H5UA 1LKZA 1N2ZA 1R37A 3CG4A 1IM8A 5SICE 1N3YA 3WIUA 3WY9A 4B3HA 4EMTA 4FMCF 5I9NA 1O0CA 2BMFA 2NUPB 3NGMA 3DF9A 4G5RA 4LNUA 4N40A 1SXQA 4EDFA 4Q6WA 2Z56A 3DAGA 2D4HA 2IXAA 2JJMA 1ABEA 3EZ9A 3OBIA 3CE9A 4JSRA 3KUCA 2IX3A 4W9MC 3FW1A 1DKUA 4ZGBA 4OA8A 4Y2GA 3NZEA 2RCNA 1MEOA 2C2XA 5FBQB 4YUYA 1RBQA 4R51A 4JLSA 2VSOA 1L9XA 2E5LB 3AIKA 1JKIA 1RRVA 1GZ4A 3TDNA 5EYPA 5AESA 1G8MA 4NJMB 5JW6A 1J9ZA 1XZBA 1U1IA 5BN5B 3I2FA 2ZZMA 1DIGA 1ZK3A 1WMAA 3ANLA 4PZEA 1SKAA 1AQIA 1V1RB 1SMKA 4CM9A 3UA3A 1RADA 1V7ZA 3I28A 3U4HA 1ZCFA 1LSUA 1U0NA 3LGAA 4X63A 3THWA 2EF1A 1DC6A 3VM6A 4ARIA 3L82B 1BEEA 2JFOA 5DEOA 4WINA 5KVSA 2E4VA 4R1MA 5HS6A 3WGTA 3K6KA 4KR3A 2NSHA 1TYCA 2XJ9A 1YV9A 3AG5A 3GFVA 4HXGA 4BAUA 2YW9A 4NEGA 3RVQA 2WTAA 1KEKA 2JVJA 2IYOA 3LVQE 3S3TA 2DCUA 3W2IA 5DCUA 3WA6A 7GPBA 2OFPA 4N03A 2DZDA 2LKDA 3F47A 4KFTA 3ZVKA 2EXXA 3CONA 2AI2A 3HJNA 5IJZA 1BD3A 1KBQA 1ZSNA 3RYFA 1BWSA 1N2SA 3RYIA 2CF6A 1GNSA 2GQ0A 4GWLA 3UGQA 2TS1A 1B6SA 1UH5A 4LV6A 5D51S 1V95A 4RJLA 5ALLA 1EDDA 3IOEA 6ABPA 5IH7A 4UOQA 1FNSA 5ERGB 1W5FA 1ZI9A 1RXCA 2GZ2A 1G8HA 1N0IA 4XM0A 4NNOA 2UUBB 5BOVA 5GGYA 1L1QA 4ID3A 3CIFA 2YIVX 1QM5A 2BZ1A 1EH5A 3PPIA 1NVVR 4YNBA 4B82A 5MHTA 1Y81A 4ATNA 3VO9A 3G02A 4Q1FA 1IAVA 2EL9A 1ZD3A 2W4MA 4ZTBA 3ZXYA 4DBVO 2ZBDA 5E1OA 4N0EA 2FPSA 4MW9A 5A7GA 2HMTA 3O4GA 1CEQA 3ZGNA 4RTMA 2C3MA 2HMVA 3K2IA 3V46A 1JKXA 2XUPA 3DJFA 4DLWA 4Z4IA 1DLIA 1PAUA 4HFRA 1FL9A 4OH1A 2JAQA 2XADA 1BVYF 2H5LA 2QMHA 1LLDA 3ECAA 5BN3A 1XRJA 1CY7A 2GWHA 3S55A 5K0TA 1W46A 2Q8NA 4NFSA 1UBJS 1GV1A 1K6XA 3HZRA 3VBCA 3CPEA 3ZLJA 1GU7A 3PG5A 4EUNA 1RNLA 5JQGF 2WG1A 4TKVA 2QRMA 2IU4A 2IZ7A 3JTEA 3VPSA 4F6RB 2X9GA 4FYVA 4L74A 4KO8A 3WLNA 3LO8A 4EHDA 3ZHVA 3MAJA 5E1MA 3MMSA 4FYPA 3W6NA 3STHA 1M2OA 4BDSA 3L0SA 1SVIA 1S8OA 2PYZA 2QBYA 3FNGA 2LIVA 3LXRA 4D4JA 2PTHA 4RAQA 2ESRA 2VRCA 4KDEA 1KY2A 2D6FA 3QBTA 4UU0A 1TZ2A 1G9SA 4UBJA 3WMGA 3NBXX 4FYMA 3MS2A 1IHPA 1SUCA 2JFZA 1WZCA 3QPAA 3G0GA 4M89A 2ZR0A 3KJXA 1DPGA 3I9OA 3SX4A 1B8NA 3I1JA 4CMEA 2ZS7A 5IMSA 3J7TA 4GPIB 4X6UA 3TAXA 3SNHA 1GLNA 1HQCA 4P93A 3PT9A 1VMKA 1Y1PA 1WUIS 2YWDA 3CYFA 4TXHA 5F33A 4Q3BA 4XGRA 5DI9A 1V37A 4DV0B 1PSDA 2DFPA 4J16A 5ALEA 5DLYA 3WGZA 5K6RA 2P9FA 4Q16A 1TZBA 3NDIA 4OL9A 3KDSE 2W98A 2Q7DA 2R6R1 2RAPA 1RQNA 1ULHA 1E3WB 3A3PA 1KQFA 1MJGA 1Y42X 4LF8B 4LWOA 3RVMA 3BWVA 4H7HA 4JUFA 2FX5A 4LJ6A 4TM7A 2GPNA 5CVVA 4HNHA 1DCMA 3OLQA 3WICA 1PCXA 2WP0A 5JCJA 5K0CA 1JAZA 3JD2A 4B83A 3MB8A 5K1ZA 3USES 1VIMA 4PZ0A 2NM0A 4YAWA 3L6CA 5EMJA 3G2MA 4Q02A 4YRFA 2BEUA 2RHWA 3IMCA 5A9RA 5IJ0B 1K92A 2D1QA 3P5BA 4EMBA 3HB0A 3E8SA 1Q1QA 4D9NA 4RF3A 4O3FA 3WWDA 3N3AC 3GAMA 1UBMS 2V96A 1ZD1A 2KX7A 2VP6A 5D85A 3PKIA 3OQNA 2QP3A 1U65A 4DCJA 5L40A 2R5FA 3MUOA 3GP8A 2GEKA 2XUZA 2YQZA 1AE1A 4PZPA 5EP4A 4ZQCB 2JEOA 4FGLA 2QTLA 1RYZA 4IIUA 3REQB 1JE0A 3H99A 4IJ5A 4ANFA 1OFHA 3LYLA 5CJJA 3PYXA 2DF8A 4B3RB 1CS4C 1DLJA 2XBUA 4FT4A 3A4YA 2DQZA 4IHQA 4DCPA 4RIIA 1C1XB 1JFLA 3HB9A 4JFRA 3R3XA 3DL0A 2OYSA 2Q0XA 4TL7A 2R47A 2JIMA 4URUR 5ALXA 4OKNA 2LXNA 1XMIA 2VZEA 2ID4A 3OCXA 1EB8A 4B5KA 3O38A 5JS1A 5HE8A 1KK2A 1T6BY 2FSGA 1XR3A 2P41A 1IPHA 1XBTA 3D8SA 3K0AB 1Z4IA 3ET5A 4Y6QA 1QFZA 2HEGA 2C7RA 1N0WA 4XSGA 1DDOA 4M0DA 4MDEA 1DX4A 4JEUA 4R1UA 2YZNA 4E21A 2Q3DA 3CJTA 4AP5A 1B3RA 2OO3A 1W2GA 2CLHB 2BMAA 3P8ZA 1Y89A 1G4AE 1LZKA 4V38A 1MO5A 3QQ5A 1UBGA 4NAUA 1ESNA 4XLTA 1U8CB 4E70A 4GLJA 4TS1A 2BONA 3NOVA 3FBWA 4I8DA 2P65A 2CLEB 1UC4B 4X1YA 4YHBA 1A3CA 4KN5A 3TK1A 2B9VA 2ZWMA 5KNBD 3VNQA 3V5NA 3JRNA 3A1TA 3ZHSA 1DCKA 1ZG3A 4MLCA 4HMPA 2ATCA 2GN1A 2AJCA 3FTCA 4MARA 4E5YA 4RA6A 2UVPA 1ZD9A 3UKOA 1KQOA 5AVRA 4KYUA 3MOIA 2M98A 2FDRA 1LI7A 4BNYA 4CL0A 5KNCA 2CE2X 3AVXA 3ISTA 2OCXA 4MA5A 2DFTA 2PKCA 5JQGB 4UZEA 4CF7A 4TKZA 1KP2A 1XPUA 2MCFA 4TZTA 3DQZA 3AB7A 5IKXA 2V6FA 4FC7A 2Y4NA 3ZU6A 1CC1S 2W2KB 4ZCQA 1XDGA 4WN3A 1MRSA 3RK4A 1TZKA 3BEOA 3WGLA 1RLIA 4OQYA 5AM3A 4GM4A 2NYRA 1FJHA 4AO7A 1JJAA 3EEIA 4EF5A 1S8NA 2D8MA 4F60A 4IJKA 1P60A 4E31A 5KQMA 2BBSA 1YUBA 1FX0A 2QSUA 4DFDA 2FSVA 5BXQC 2ICAA 2NXWA 1MH1A 1TLTA 1Z2DA 5DE3A 3HJGA 5I7VA 4Q34A 5CDFA 4FGKA 2DUJA 4XWAA 3SYMA 2WJGA 2BMDA 1PQ4A 1WDLA 1X8KA 3LPLA 4PLWA 4D45A 1C8LA 2RBGA 2C82A 5B53A 1K8YB 1GPLA 4I3GA 3CG0A 3EPRA 4LYEA 1W88A 4R05A 2Q6KA 3UUFA 1P4GA 1XAGA 4A27A 2FJ0A 2REOA 4PPFA 2XT0A 4KAFA 4GOND 4YMLA 2UZ1A 4E88A 2H4HA 4I50F 4UHBA 3NLLA 4NAHA 1M1YE 1TUGA 2B34A 2X77A 4PXYA 5FJJA 5I9IA 3QF4A 4JNKA 4M9SA 4JAVC 4FLFA 3PJDA 4OXRA 4Q4HB 1FFGA 5CLHA 4C6HA 1JBQA 4L73A 2VLIA 4MW0A 5L7WA 5KX5B 2A0YA 2ZRJA 2A4MA 1GPUA 3HYRA 3ZDAA 2J30A 1I7PA 2P9YA 2WUGA 3MJ4A 3DMTA 4QU9A 4YCLA 2AYYA 2XY4A 3IDSA 3S81A 2PXXA 1X9HA 2HDOA 3K7EA 1RW4A 3LX5A 2GMWA 2XB8A 2O8EA 4C4OA 3QFRA 3CEPB 3VOTA 4F5ZA 2Q3JA 3L8GA 5CJPA 4L72A 2HT1A 1ZD8A 5DNAA 3ITNA 3K0CA 1ACLA 1Y8AA 4YVFA 1LX6A 1R0ZA 3CX6A 1P1JA 3I3SR 4NBLA 3DMNA 4C4RA 4F4UA 4Y2UA 4TL6A 1P91A 3DMDA 5FULA 4KRYA 1JPVA 3VHQA 1H4SA 4CEHB 2C5EA 2XNCA 3AI3A 4YLEA 3TIVA 4RJIA 1EFTA 4QARA 1KOJA 1X19A 2VUSA 3QMMA 1TM2A 1VDZA 3QITA 2OZLA 3ZZMA 4YWJA 1BHQ1 3F1LA 1GZ5A 5KJ1A 4A82A 2WYHA 2JGJA 3AETB 2C2HA 4HX2A 1CQJA 4UCWA 2DLCX 1EAMA 3CH7A 3ZXXA 1PTKA 3BRQA 1XU4A 1K9VF 2QTVB 2VCHA 3DC2A 3IHWA 4HDQB 1GPWB 1M6NA 1V25A 1WXIA 1BDMA 1HZZA 1TF5A 1X80B 2I8CA 2OBMA 4N49A 3TTYA 4MEJA 3GUVA 3KOUA 1QOQB 3AKDA 3I73A 2UYQA 3QXXA 4RHTA 1O6FA 5IARA 5LZ2A 1JQLB 2DTEA 3O93A 4XUCA 2PGOA 2A1UB 4F7DA 1O89A 5JASA 1M2FA 4G4GA 1NX9A 2IW3A 3NXKA 4ZT5A 3V3TA 2QAGB 2X42A 5AUOB 2WTBA 4OQXA 3DE7X 5E6RA 4EUKA 5AW4A 5JTUA 1D6SA 4H59A 3DOIA 3MLAA 4UQLA 1DWOA 2EKBA 2XCUA 4FD3A 2MOKA 3IQFA 4ZKEA 1UPTA 1AU9A 1ZDMA 1PX0A 3VHXA 5KKCA 1V9CA 3V42A 1WVIA 1PLJA 1DIBA 1F2TA 3JRWA 1ZMOA 2XLBA 3EASA 2CYCA 4DV4B 1X8LA 1FMFA 1C7ZA 1NTOA 4UULA 3PXXA 2OP0A 2V9CA 4OHXA 2ZI6A 1PL0A 2AZ4A 3G1TA 5DN9A 4KO4S 1JQDA 4HGZA 3PGJA 4W6ZA 1WLSA 3H11A 4BV8A 4QHTA 1Z16A 4FS3A 1NGSA 2VP4A 2XA1A 3L7KA 4LDJA 1YDHA 1X1RA 3CUKA 5KYNA 1FB5A 3E3LA 4UDYX 4V39A 3CQ9A 4POAA 2VTDA 5AW2A 3A1SA 1IMJA 3EVDA 5K8TA 1NOKA 3FVQA 1SBQA 4A16A 3TO5A 1MV8A 2IWRA 4E09A 4IWXA 3NBUA 3VYWA 4CR8A 1N9ZA 3QVKA 2PX4A 3GDHA 4A2WA 4ER7A 3CVWA 4KVZA 3H6HA 3NMUF 1RLUA 1TQ4A 4RCYA 5GVRA 1IUKA 1JLKA 1XLUA 2RHRA 3KLMX 3RS8A 1AKWA 2Z8YM 3O0DA 5P21A 4HNTA 1S2GA 5JLAA 1DADA 1A8UA 2AW5A 2YWFA 5JNVA 2CHGA 3NTLA 3TKYA 5TSDA 2CLKB 4FX5A 4QXPA 1D1QA 3PI7A 3W5HA 5ARCA 1FS6A 1JHRA 1PZNA 3CF6R 2MJLA 1Y8ZA 4TWRA 3OIWA 3B1FA 3JYOA 4FCWA 4UZFA 2FPKA 5IU6A 4XB1A 4M1EA 4TMVA 3C7DB 1U0BB 5G1PA 4IIVA 1B0ZA 5EERA 3AZPA 3WL6A 2LIPA 3EIXA 3B13B 4N9QA 1PJRA 1I7SB 1ZMXA 2WM2A 4M49A 4NZPA 3UW1A 3H11B 3VNRA 2XE8A 2C5AA 5HKOA 3TQRA 2A9PA 3GGCA 4LF5B 4BJ5A 4R0NA 4OVKA 4L08A 4U2KA 5JJIA 1KZ9A 2YUIA 3QIVA 1I3OA 3QTTA 4UAVA 3T3IA 4NENB 2W2QA 2XOXA 3FBTA 2G09A 3O91A 4US0R 5LOVA 1JEQB 2ZUSA 3CX3A 2XYHA 5BYJA 3BE5A 3UMGA 5IPFA 5EJ7A 1CDZA 5FO0A 1U0FA 4FE7A 5JSZB 3D2AA 2QZ4A 3QPBA 1DG1G 2INGX 3UY4A 3VYRB 4DLAA 2ATEA 3IT0A 5GM1A 4EJFA 4OHVA 3GEMA 1XFAA 2GPSA 4ISBA 3GGOA 4KFSA 4OKSA 4QBHA 3FTDA 5JSKA 1U31A 2AS0A 1IVYA 5KC8A 1R4ZA 2VH5R 3W3AA 3ZYZA 1MX5A 3ZI4A 2DRIA 4CF5A 2HCJB 1E4OA 4FCTA 5AOVA 2VA8A 4DJTA 2ORYA 3KZ1E 3JD3A 3KTFA 4GXTA 3E9ZA 4XOIA 1P9RA 3OC0A 1FUIA 4M7WA 2Z5FA 2NADA 3UWKA 4E4YA 3V2UA 1NYTA 2BDUA 1PGJA 4WK0B 1O03A 4B8WA 1BKSB 3RYHA 3C7TA 5DK6A 2PS1A 2QG9A 4CRWB 1XTKA 1R0WA 5ECDA 3WLIA 4KBFA 1RHQA 3OF5A 3DXXA 4UD6A 3WDMA 4DQLA 1OBOA 5BW4A 3X1DA 1CX9B 2D59A 2BY4A 1SBTA 2VC2B 3DMRA 4HV4A 4NARA 1GSHA 1OFUX 3C3JA 4Y1RA 3GWZA 4GZ3A 3A31A 3OE7A 3R76A 3IJRA 3KL4A 3GRAA 4DZTA 1E63A 1CP2A 1UM9A 1Z26A 2AXNA 3EFBA 5LQMA 3GBVA 1XKLA 2NP7A 3F46A 2X6QA 3EZ7A 4S2EA 5E38A 5H5JA 2F2TA 4P83A 2J09A 4GVXA 2EFEB 1J22A 3JZIA 2Y1KA 4BVJA 4YMGA 1G3IA 1H8ED 4UDNA 5FOVA 2JFQA 1UZUA 2REXB 3HU3A 3ZNNA 2CL6X 4GX0A 3MELA 1PBTA 1MX3A 1U8AA 3GOHA 3T9EA 3U4QA 3HCRA 3QK7A 4ZOLF 2JL1A 3ITEA 4LDZA 3S68A 3TN7A 3LDGA 1KU6A 1QWSA 3EBLA 4HH4A 5LP6C 3WP1B 3COJA 5JAZA 5EOVA 4H08A 4R1QA 3ZW8A 4DPMA 4M0FA 1SQSA 3JQ9A 4A1OA 2VTBA 2D1FA 4MRPA 2JHGA 2PT9A 4MGYR 4JKOA 1SK9A 5CUQA 2GCOB 3T5CA 4D7AA 3CY6A 2PRZA 1FLAA 1SIWA 4Y7CA 2NOAA 4D6PA 3GROA 1D7AA 4B17A 1F2VA 1HA3A 4D3SA 5AVVA 3VC7A 1OGYA 1W9HA 4CDRA 2ISQA 1QYVA 4YCDA 5B6IA 3WYCA 1HXHA 2COEA 5JR3A 2UVQA 3PNSA 1EP1B 1CEEA 1LK7A 4KR6A 2QVCA 4QXOA 1Z38A 4RVFA 4N3NA 2G1JA 1DT3A 4G5SA 3IEKA 2EFCB 2JI4A 1Y6QA 3W79A 4R8SA 1YJQA 1CUSA 4UFPA 4JJFA 4LXTA 2OHVA 4B73A 3V4FA 2WKRA 1IY1A 1Z8HA 2GNOA 1NU8A 3CCCA 1BJKA 4E5SA 1DXOA 4O2BB 3U4MA 1JECA 2O2EA 3PR3A 1OZAA 3KPYA 3GIWA 2WK1A 4MPRA 4E32A 1ORDA 2P30A 2XKAA 1E7YA 3CKLA 4MGHA 1R12A 4NNJA 5GJWC 3U3DA 1I01A 2HD4A 2O8NA 3IOYA 3PQ8A 1U1DA 1M2HA 1RIIA 1T9DA 2YW2A 1E1NA 3BULA 2H54A 2I76A 4E5NA 3CA8A 3AV3A 2HEIA 4NTZA 1ZHHA 3UCXA 1NP6A 1QV7A 1UWCA 3NGXA 3VPHA 4D8UA 5A5GA 2R1VA 3LW7A 2HJ9A 4I9UA 3P0EA 2RGNC 2F67A 3T12A 3X1ZA 1L7QA 4AUEA 2JHCA 3BRSA 3TW8A 2EJCA 3ZV3A 1PQWA 3K9NA 2XDQA 5BR7A 1JR3E 3CH6A 5JZMA 1YQXA 5JADA 3L79A 1IN7A 2O2IA 3G23A 2Z1DA 5DGDA 2Q7OE 3UFBA 4DCVA 3FWHA 4GLOA 5CW2A 1Y6JA 1D2AA 4FYYA 5C52B 4YCMA 4YK7A 1CRWG 3KKZA 2NW6A 2RK4A 4AQDA 2XB2A 2R7KA 1H85A 4RTSA 1T6NA 4URWR 1U9IA 3O9VA 1E69A 4X8OA 2A9VA 2BGTA 5ALOA 1CXZA 3G8DA 3V00A 3OZIA 4W5TA 5K4HA 5GVSA 3QKWA 2Z04A 1Z2OX 3QX7A 3JV7A 3RWMB 4TROA 3V8PA 3OZFA 4RPHA 1V47A 4L8YA 4D4IA 1Y7IA 3PTAA 4ZJZA 1RKUA 1JKFA 1C1XA 2IUYA 1YCGA 3DO8A 3SVLA 5IUNC 4QBFA 1U4SA 1NBMD 4DTIA 1KSGA 4MPTA 1Z6ZA 1C2TA 1S2OA 1ZGZA 3KKMA 4M9ZA 2VJBA 3DKPA 4TTTS 3NBYC 3UC9A 1KI6B 2GD2A 3VU3A 4BNHA 4F7WA 1GNLA 3FE2A 5TX7A 2Y0BA 3AEKA 3OM0A 4RVCA 2HKIA 1IBLB 5MFZA 1KJWA 2X41A 2YZ2A 3VMMA 2JGIA 3EUAA 4L2IB 3VZSA 1RRCA 2BT4A 3B6JA 4KPGA 3EE6A 4Y9UA 4Y3UA 1TYAE 2XPCA 4Q9AA 2C1ZA 5DCLA 4DIOA 4EEZA 2WUVA 1A9OA 5G0UA 5I9LA 3JAKA 3JR7A 5FIUA 1OF1A 1Q15A 3L0OA 2M6LA 3OZEA 5HX7A 4J94A 4ZVPA 3V1LA 4OCZA 1KJ9A 1MV5A 4U2CA 3GMTA 1JPUA 3GRUA 1FUEA 2EERA 3MJCA 4RXMA 4MV3A 1Q12A 3CFYA 4M0UA 5TE9A 2VA9A 2H1RA 2LV8A 1O8CA 4IEIA 1IQRA 4AZ3B 3O0TA 4BRZA 2J0SA 1HV8A 4KRXA 3RBAA 4QXMA 3CEAA 3C3MA 1NE7A 1BIFA 4RF5A 2F4VB 2VRWA 3W04A 2OHIA 1XP8A 3MJFA 4KN6A 3H4IA 5JBNA 2HHJA 4LVCA 2HMYB 1NNSA 4V0NA 3FHOA 1ULUA 1NW3A 4I5GA 5TEVA 5LSAA 3IT1A 4H3HB 4KWTA 4YJ3B 4DSZA 1SGWA 2EKLA 3OY7A 3ZLBA 1WVGA 4ZN6A 3SWWA 1D0VA 1A9PA 2LW7A 1FDSA 4OHZA 5EHXA 1Z3CA 3GB9A 4I81A 3SYTA 1KAQA 3SZ3A 1O9BA 1XNJA 2X8WA 5FUVA 3IUEA 1PJ2A 5ALDA 2AFVA 3D1JA 3A9CA 4M1ZA 2LP4Y 3LSYA 2I33A 2ODAA 2PLNA 5IM4F 2QD1A 1X3SA 3HMQA 1DEXA 1SK8A 4LRYA 3OU7A 3W2GA 1BKYA 2X8BA 2WJPA 2O5VA 3QA9A 2NV2B 4L15A 4TL8A 3ZU5A 5AVTA 2BSXA 3WAJA 1PW7A 1G3QA 4JX9A 3EIHA 4QDKA 3L9XA 2DUNA 2X8LA 4EG0A 5K8IA 1PYOA 5GPBA 1ADGA 2FN7A 4JENA 4ZT4A 4OJNA 3WBKA 3BDIA 4M21A 4LWZA 3LQKA 2YXNA 1EBUA 3RRYA 3FB4A 1DT5A 4CCWA 4S0ZA 1EGVB 3OT1B 1JHOA 1MAWA 1Y3BE 2WWXA 3K2BA 2H1WA 2JGMA 3RJMA 1DJQA 1UMCB 1C3EA 5JFGA 1MZPA 2ZKIA 4D0SA 4G5FA 3U39A 2AEFA 2GJSA 2WP8J 2MYPA 1SOMA 4O2RA 4Y9SA 1SBCA 3R5KA 3COYA 3LSTA 8ATCA 1KZYC 2J9FB 5U4QA 3IMFA 2V58A 3WYFA 1XXHB 4YMWA 4W8GA 1CYEA 3D4BA 2H1OA 3T54A 3HCWA 5ITWA 5CFOA 4UW9A 4NMWA 3UJHA 5KMGA 3LVBA 4FS8A 3V8RA 1KDZA 2CDCA 1XTTA 3PLNA 1D9XA 4ZYZA 3HADA 2AOUB 1V11A 4J3JA 3UB2A 2CXTA 3K72B 1U11A 1UP4A 2YRXA 2ZB2A 3ESCA 3EZYA 3I64A 4PAMA 4K3VA 3UWMA 3OTIA 5A02A 2AKEA 2P4EA 3B5JA 2XXAB 4UXIA 2O48X 1E2UA 2H31A 1ND6A 2SHKA 3N8KA 3NH9A 3R3YA 4HH1A 3TB6A 2PUAA 3DOEA 3C4JA 4X6YA 3G8BA 3ZCVA 4ZVLA 1Q7BA 5DTJA 1QRRA 2AE1A 2CBZA 3ZY3A 2Q28A 3LOUA 4NBSA 1H5QA 4U7FA 1SQFA 1T5BA 2BFFB 3KWJA 4JITA 5DGXA 4II3A 4CMBA 4C2UA 1O54A 2O2XA 2CLIB 2J5XA 5YASA 3FHCB 3V4PB 4EHBA 1N5KA 4IXMA 2DUWA 1UK6A 2Y3IA 3CLHA 3ILYA 2DUUA 2FDXA 5I7EA 4B4WA 5CCBA 1QP4A 1Q7EA 3LE8A 4L8GA 3G2OA 4QTUB 3E3AA 1P81A 2ZI5A 3IJEB 3CVOA 4Z7QB 5ALYA 4LXYA 1QAOA 3QH4A 1WWKA 3KQKA 3BQMB 2VQSA 2IV2X 3IYLW 4AZ0B 2FEWB 5IDQA 4FYHA 4BQRA 1JU9A 1TW3A 1K9SA 1E1RD 2FG6C 2WIBA 3U48A 3IKTA 1Z8DA 3DZHA 4OPMA 4RLFA 1CVLA 4LUCA 3EZNA 4P3KA 2AHOA 4FBMA 3PEVA 1FX0B 2RJOA 5EUQB 1IY8A 4IH9A 2C0CA 2FWRA 2JLBA 5AM2A 5IT4A 2BC9A 4NJMA 3AXSA 1D4AA 1T8SA 2IVZA 4G5OA 3KUUA 1FFWA 2CSUA 3GAFA 3OOHA 4LJ4A 4WPGA 3KV3O 3RS5A 4H7IA 5AVQA 5JECA 1Q0PA 5EIBD 3RODA 3D7LA 3L01A 4MVJP 2W2KA 4C08A 3KVRA 2WYUA 4QAJA 3TVYA 5IYZA 2H11A 5LOVF 1UPFA 2FJPA 1W9MA 5DHSA 4MPPA 2HGZA 4J0JA 4KTVE 4US2R 3JX9A 4LF7B 2HJGA 3H2YA 2WWIA 4CKXA 1AZSC 2E89A 2H1SA 2VVTA 2YQ4A 3AH8A 3K4PA 4DDUA 4YDQA 1G5RA 3OQBA 2P2CA 2BM8A 2GN6A 3WGUA 4BWFB 2I6QA 3OT5A 3K35A 3M4ZA 2W2XA 3V8MA 5JUWA 2WM8A 5DOZA 3UFXA 1QZTA 1WMDA 2ADFA 2C2GA 3L8DA 4YRQA 3GZ4A 4IFBA 3WV5A 4DXAA 2WSSD 5DIFA 3HUFA 1NLFA 5B4UA 2PUBA 4D8YA 1MT3A 2I7TA 2XIJA 4XARA 4FR0A 2OMEA 2C7OA 2YC4C 4FR5A 3PI6A 3HP1A 3I5MA 1IH8A 4OO3A 3ZBUA 1XRMA 1UFVA 1ZGJA 2B1RA 4K86A 4PLGA 5LC1A 1KZHA 4EYKA 4B0OA 3TYXA 1D2GA 3GGSA 3GIDA 2WIKA 3IVAA 3KQOA 3Q5GA 4HDMA 4M1WA 3S7TA 1N0HA 5BWLA 5KWJA 4JJ4A 1RKBA 3CRZA 4C22A 5C8YB 1E1QA 5DX8A 5LWQA 2H7XA 4QG3A 1Z5WA 3VGPA 5AUNB 4MGEA 1IHDA 3SR3A 2BE9A 3EGCA 3RVDA 2ATVA 3OKAA 5B1IA 5BSMA 5TGTA 3BN3A 1IRXA 3B38A 5JCOA 2OAGA 5EEHA 3NKLA 5BWNA 2V7QA 1XNGA 4GI1A 1DGQA 2C0QA 1ADFA 2JD1A 1KH1A 3HA2A 4TXMA 4Y9DA 3ZDBA 3TZLA 3TIFA 4N5NA 2VJCA 3K9HA 4ZDKA 2P69A 3EYWA 1KJJA 1X7YB 3DWGA 3BKXA 1RYDA 4ZAZA 4OXXA 3DEZA 3H5WA 4Y6LA 4RMGA 5T3UA 4E4TA 4CFSA 2GHTA 2XDAA 4CM1A 3OMLA 3G82C 1Y6RA 3ND6A 3P9NA 1KMQA 4IDBA 5FQOA 5BR8B 2F3SA 1E92A 1RTKA 4E08A 5E6UB 2MMGA 3ZE6A 1KDVA 1Y98A 1YR7A 3FUUA 3HCCA 4UNSA 4G0OA 1M73E 3F6PA 5K5EA 2A7XA 1YA8A 3FRIA 5B6JA 2BSQA 2BZGA 3DEYX 4AJ1A 4BKPA 4BNKA 3HYSA 4HH0A 1UIMA 3FROA 3JQRA 5DTMA 3PNBA 4I2NA 4EG5A 3OZAA 1XPRA 1U3WA 3BH6A 4PSUA 4OLAA 2IZZA 1A8QA 2AMJA 1H2ZA 3OPQA 1OX6A 3ZYCA 5EJIA 3PNKA 1HNWB 3WGYA 2CCJA 1PZGA 3S2GA 5JAMA 2XGMA 2ZI7A 4DIFA 2R66A 3HDGA 4O4LA 5C8YA 4B87A 5A62A 1G42A 1XMPA 4GH5A 3NC1C 3LQ1A 4MV0A 1N1DA 1XKQA 4IIDA 1XMXA 1JX6A 1HR0B 4G89A 3CLRC 1WO8A 2P6UA 4BNVA 1OVGA 2K87A 3Q40A 3O5AA 2FFHA 2XZOA 3S2IA 1U3VA 3I04A 3RADC 1Y1LA 1JPJA 3UFXB 2C94A 2H63A 3C97A 1WEKA 4GM1A 4E2ZA 2XD4A 4U2GA 2NAPA 2BTQB 2WVHA 1PR5A 2I9PA 4MYTA 5AH0A 1W2WB 2IXDA 3UCEA 1U7TA 3E6AA 5GOZA 3CR3C 3IPLA 4F2DA 4N47A