4MWTA

Crystal structure of human ppca (trigonal crystal form 2)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
422
structure length
413
Chain Sequence
APDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysosomal protective protein
publication title Proteolytic activation of human cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 139
structure length 413
sequence length 422
chains with identical sequence B
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mwtA00
5BOVA 1DT3A 4OB7A 3FLBA 4B9EA 5ALNA 2O2IA 1VXRA 1THTA 4GW3A 4BP9A 3T52A 3WA6A 3L1IA 5AK3A 4BAUA 3BJMA 2I3DA 3UUFA 4C4YA 4LKOA 7YASA 1L7AA 1FFBA 2WJ3A 3FAKA 1F0NA 3QVMA 1EDDA 4OU4A 3IUMA 5ALQA 3GELA 2EDCA 2XUIA 4B0OA 1MX5A 1R9NA 2DQYA 2CMFA 2E3JA 4B7ZA 4Q3OA 4Q3LA 3R41A 5EFZA 2Q0XA 2VEOA 1FFDA 1ODTC 4BCCA 2J4CA 1T2NA 1ODCA 5CT5A 3EQ7A 1DX6A 2IITA 3LS2A 3U1TA 1SCKA 1NU6A 5ALTA 4ZV9A 1QIDA 2RIPA 5IKXA 4G9EA 3C6ZA 4KYVA 2HU7A 3I6MA 3HXKA 2PKYX 1WM1A 3NWOA 5AKLA 4H7EA 1QIIA 4U2CA 5A62A 2WIDA 1DWPA 5ALKA 4CG1A 4BTVA 3I2FA 3I2KA 3SX4A 3NUZA 5AP9A 4DNOA 3OURA 1SCQA 2I03A 3AZQA 2WILA 1P0QA 2OQVA 5ALFA 3QPAA 2GBIA 4ETWA 1N1MA 1H23A 4J0CA 3UUEA 1TCBA 2CEKA 1ZIYA 4X95A 3T4UA 4KJXA 1CRLA 3EBLA 1K63A 4BYMA 3W2TA 1TK3A 5A7GA 1YA4A 1L7RA 3D7RA 2JGKA 3H2HA 3ZLUA 2BCEA 5AKYA 4HS9A 2AJLI 5AI4A 3EF3A 4QDXA 4BE4A 3HSSA 3L1HA 3AIKA 5AI5A 2C58A 3FNBA 1DQYA 3KWJA 1H2XA 4WDRA 5KWJA 3EIOA 2H7CA 3I2HA 1EI9A 1TQHA 1VA5A 3M82A 1DINA 2WU3A 4W1SA 4HVTA 3MGAA 3STXA 3WIOA 4PO3X 4N8EA 4KE6A 5AM0A 5ALRA 3S8YA 4UHDA 1P0MA 4X6YA 1ETHA 2OG1A 4DNFA 4ZRDA 4JNCA 3FVRA 1DWQA 1HBJA 2PL5A 1FFCA 3ED1A 4W63A 3FLEA 1XZEA 3R3ZA 2DHDA 1UK7A 2HU8A 1P0PA 1JU3A 3O4IA 5D3KA 4MXDA 2XQIA 2PVSA 4H7FA 3VKFA 1HDEA 2XT0A 1AZWA 1XRMA 3OC0A 5CH8A 1Q0ZA 4F21A 3LP5A 2WTMA 5AI6A 3Q8WA 3FOBA 1Y7HA 3ICWA 5LZ7A 1J07A 4ZV7A 1AMNA 5LZ8A 1MPXA 4INZA 3KSRA 1U65A 4F5ZA 4IHAA 1OILA 1IVYA 3HRHA 5LZ5A 2VA9A 4MYDA 1ZD3A 1UZAA 4U2FA 5HZGA 2PSJA 1HQDA 4OSEA 2XUFA 2HDWA 1QIHA 3D4LA 2ORYA 3YASA 2GZSA 4AQDA 4DSZA 4J3JA 4J0DA 5AK5A 5ALOA 5SYNA 4J0GA 1A88A 2CB9A 2XUAA 5HF6A 5HK9A 4H18A 2O2GA 3PF9A 1QIEA 1E5TA 3AILA 4X97A 1LBSA 3NOXA 4GLBA 5A7FA 5AH0A 3JYHA 2GYWA 1JFRA 1R4ZA 2CZQA 3C70A 5DNVA 3K2IA 1YAHA 2QJRA 3C6XA 2QOEA 5EHZA 3ANSA 4B83A 4Y7DA 3H2IA 4OYLA 1B6GA 3STTA 2PPLA 4I3FA 4OB6A 2HA6A 3FVTA 4X92A 1CUBA 3I1YA 1XROA 2WU4A 4RNCA 4G4IA 4X85A 4FKBA 4KE8A 1ACJA 4AB1A 3C8HA 3QMMA 4EA6A 3ANTA 3PUIA 2J4FA 4BZWA 4MQLA 1ZD2P 4FBLA 4Y2JA 5AKHA 1BU8A 3A2LA 5HF5A 5AKZA 1HL7A 3H04A 5AOAA 2WIFA 1T4MA 4KE7A 2EDAA 2WUGA 2QJWA 1XZCA 1YCDA 5EHNA 4N5HX 2V9ZA 2AXEA 4HXFB 4KR0A 5AI8A 3R3UA 3H18A 5IH7A 1LNSA 2XQJA 5AK4A 4BRZA 5FXMA 4Q1VA 4C89A 1WPXA 2Z3WA 2O7VA 1UKBA 1A8SA 1XRRA 1CIJA 2OLEA 4FLMA 3R3YA 2XUOA 1JMKC 2CBGA 4NS4A 4J0KA 5K3BA 4AN1A 4EY4A 1XZIA 3H1BA 4OPMA 4DIUA 5ALPA 3O4GA 1PFQA 3C8DA 1XQXA 1VZ2A 2PSFA 1ZD4A 3O4JA 2QUBA 5ALEA 4AMZA 4Y2YA 1LPMA 2BGNA 3BJRA 3H2KA 4LYEA 4X94A 4C87A 4FHZA 3QH4A 4TVKA 1USWA 2ZJFA 3C43A 1QO9A 1XZKA 4U2BA 3F9CA 3VDXA 6YASA 2ZJ6A 4PSDA 2OGZA 4HRXA 5LKAA 2VF2A 1IZ8A 4M0FA 1X2EA 3IA2A 3WKAA 4B9AA 3WLAA 1QLWA 3STYA 5ALUA 4BVKA 3BF8A 3FYUB 3BXPA 2WHPB 5DYYA 3WWOA 2PSHA 3ESCA 2XDWA 2QRUA 2CJPA 1QIGA 1MO2A 4Y2TA 5C8VA 4EZIA 2OCIA 4OD0A 5AI9A 4DSAA 4CI9A 5ALZA 1QONA 5EGNA 1C7IA 1XQYA 2ECFA 4ZGBA 1LZKA 3DQZA 5LZ9A 4J7AA 1TIBA 3D59A 3TEJA 1GT6A 3R3VA 4DNQA 5ALGA 3WQHA 1F8UA 4XWGA 1O6GA 5JYCA 2WJ4A 5E4TA 3M83A 2QZPA 2VATA 1YS1X 2WHPA 2OCKA 4BVLA 2PBLA 4AO7A 3HYSA 2OXEA 4J0IA 1QIFA 3QPCA 1A8QA 1IUNA 1FFAA 3GFFA 1JJBA 1F6WA 3E3AA 3G0IA 2WLSA 3DJYA 5AOBA 1W6RA 4X7BA 5BV7A 3W9BA 4G8CA 3KD2A 3KXPA 1QIJA 3V1LA 1YSCA 3IURA 1J1IA 3R0VA 4JH0A 2XMRA 2Z3ZA 1DTEA 1N5RA 2HA3A 4Y2RA 4W1PA 4X6UA 1XZFA 4Y2VA 5E2IA 2XUJA 2VJBA 4KACA 1CUYA 1DWOA 3HJUA 2HA4A 3Q0TA 1W52X 1ODSA 1QOZA 1JJIA 1H2WA 4HXEB 3OPMA 3AUKA 5ALVA 3WK9A 1LPSA 4PF1A 1EH5A 3EQ8A 3HLKA 3OM8A 2HRQA 1L7QA 1QTRA 3RK4A 2ES4A 1TCCA 4MWSA 5LKRA 4G4JA 5JD5A 5H3HA 2VAXA 4I19A 1THGA 1J06A 5ALYA 5AM3A 2Y2UA 5E4YA 3ESDA 1CUEA 1R1DA 3E4DA 1H2ZA 4DMKA 5JARA 2IIVA 4FFVA 4FLEA 4IH4A 5F4ZA 3A6ZA 2HFJA 1QTIA 4CIAA 2RI6A 3H2GA 4CFSA 3O9VA 1SC9A 2QUAA 4NMWA 4X93A 1VA4A 3QMVA 5HF9A 4WFKA 3BWXA 5HQ3A 3R3WA 4X3CA 3QBJA 2QR5A 4Y2PA 4BVJA 3VJMA 3A70A 2BKLA 3FCXA 4P93A 1UXOA 2XLCA 5ALSA 2GYVA 2DHCA 1BCRA 4K5QA 3WKCA 2WG0A 2G5PA 4EY6A 3VVLA 3ZV7A 3FBWA 1G5FA 3BE8A 4EY5A 5J3JA 1ISPA 1YB6A 4JUIA 5C7YA 5DYWA 5JANA 1Q83A 3HABA 3M81A 2WG1A 1G42A 4LXIA 3G7NA 3SWWA 3W05A 3PFCA 3G02A 1MU0A 4PNZA 1ZI8A 4XIIA 2XMSA 2XMDA 5CBKA 2VT6A 1CEXA 1EHYA 4K6GA 3OOSA 5DTJA 1CUUA 3JWEA 1CVLA 4ARBA 2BFNA 5AM4A 1E89A 5D3ZA 2HA2A 2VSQA 2XUHA 4UPDA 3G9TA 1XQVA 1VZ3A 1H2YA 5K3AA 5HK8A 2JGMA 1G66A 1LPBB 3ESAA 4EY7A 4OUKX 4KRYA 2QXTA 4XJVA 2GZRA 3W06A 3O95A 1YAJA 4BB0A 1W4LA 3DD5A 1PV1A 5AIAA 3WA7A 2CUTA 2WUDA 4LXGA 3B5EA 3F96A 3DKKA 4LIPD 1XZBA 3WWCA 5CH3A 2Y6UA 3IBTA 3DYIA 2H7YA 3W04A 1WB5A 1GGVA 2QT9A 2WFZA 4F60A 4AX4A 3F97A 1XFDA 3WZLA 1CUAA 1H22A 4A5SA 1LBTA 1MX9A 1D07A 3LIPA 3V1KA 1CUHA 2VQ6A 1NX9A 4DTCA 4HZGA 3A2NA 3WWPA 1K8QA 3F67A 1QIKA 1DQZA 2WKWA 3PI6A 2ZYHA 1OXMA 1U8EA 1LZLA 1JT2A 3STUA 1LLFA 1YASA 3PDCA 4UHCA 1NU8A 1A8UA 3FWHA 4UHFA 4HTAA 3MUNA 5JZ9A 3RARA 4XVCA 2B4KA 1C7JA 3DKRA 5AO9A 5FV4A 4WFJA 3IUQA 2WUEA 5DNUA 3ILSA 5DYTA 2OGSA 1WHTA 3AINA 3VVMA 1JMYA 1CQWA 4GECA 2XLBA 2HA0A 5DNWA 4KAAA 4DM7A 1E8MA 2C0QA 2BUBA 3E0XA 3ZLTA 4PV7A 4G9GA 1CQZA 4GBGA 4GI1A 1EK2A 4MQMA 5FRDA 1BN6A 1K6EA 5AOCA 2AJDA 4E11A 1BROA 3ICVA 2V98A 2RAUA 3WIBA 2AJCA 3PE6A 1CV2A 2XUGA 1G4HA 3HZOA 4QE3A 2QMQA 4BCDA 2VJAA 1UT6A 5ALXA 4DGQA 2QS9A 4FBMA 3GBSA 2WJ6A 5EIEA 2V97A 3WJ2A 4H7DA 1MNAA 2XUDA 4G4GA 5T4EA 2B9VA 5JD4A 2HM7A 1BCSA 3X3HA 5T4BA 2DHEA 3GZJA 5T4FA 3N0TA 2X5XA 4QEKA 2XQKA 1N8SA 4K2AA 3STVA 3WL7A 4MYSA 4UFNA 3P2MA 5EI5A 3D2CA 4FDMA 1TRHA 1XZLA 4ARAA 3B3QA 4MEAA 1CFJA 5FP0A 2J3QA 1ZIXA 2G5TA 5HFAA 1XLVA 1UK6A 1R50A 4H7IA 5ALWA 2ZYIA 1XZAA 2XMGA 4C4XA 2C5FA 2FUKA 3H0CA 4DMHA 4B6GA 2OPHA 2JGEA 5ALMA 1P0IA 2GBCA 3F98A 3DEAA 4Q34A 4M0MA 2PUJA 3ZLVA 3CN7A 5AKIA 2XI4A 2Z8ZA 5ISMA 1GQRA 3CN9A 1CLEA 5C8XA 4EHBA 4BP8A 2VAVA 4LYDA 3M3DA 4J0JA 1QIMA 3IIIA 5LZ4A 4ITVA 1CPYA 1GZ7A 3WKDA 1IUOA 4P08A 1VE6A 1IUPA 4FFWA 4UBOA 2X76A 1LPPA 3N2ZB 3KWFA 1E8NA 2P8SA 3FYUC 3H1AA 3AZPA 4PSUA 4B82A 1R3DA 3C87A 2OCGA 3WK6A 1YS2X 4AZ0A 4H7JA 4CCYA 3V1MA 2AJBA 2HA5A 4GXNA 1XRNA 3QZUA 1Q84A 5IVIA 3NGMA 4FLFA 4GDMA 4WJLA 4IO0A 2R11A 2C7BA 2HU5A 3I6ZA 4Y2SA 4UUQA 4EY8A 5A6VA 3O4HA 1XQWA 1KU6A 1QJ4A 4BBZA 1CUXA 1CUZA 4J03A 2DFPA 5ALDA 4RPCA 2WIKA 3HI4A 4BAZA 2ROQA 5LP1A 5JIBA 2ZSIA 2RHTA 5YASA 3IB3A 2WTNA 4QDUA 2YXPX 2BGRA 4BAGA 1XZGA 4H0CA 2WIGA 4Y2QA 3BIXA 2XE4A 3RM3A 4UBLA 4RGYA 2C0PA 4OU5A 2VJDA 4EBBA 1ORVA 2GBFA 3FCYA 2FJPA 1W1IA 3OG9A 4U2DA 5K3DA 2WIJA 1XLWA 4DYHA 2JF0A 4ZXFA 1VOTA 1UOQA 4FNGA 5JAHA 5ALIA 1UOPA 5CMLA 1K4YA 1EB9A 4AXBA 4Q05A 3H2JA 5AKKA 2PSDA 1GPKA 4C4ZA 2O7RA 4WDQA 4P9NA 3WL6A 1AUOA 1CUDA 4UHHA 5DTIA 2D5LA 2W22A 4QDTA 1EDBA 5LIPA 4CCWA 2WHQA 1WHSA 4UHEA 1EB8A 3C6YA 2WFMA 3LLCA 5JALA 4QA9A 5CXXA 5JZSA 1DT5A 5JAUA 4HAIA 3LIIA 4TGLA 1GKLA 4B84A 2Z5GA 5C81A 3PF8A 2OQIA 1QE3A 4X00A 2ZJ7A 4AO6A 2D0DA 3WJ1A 2PU7A 1EA5A 3O9MA 1WPRA 5FKJA 2LIPA 3H17A 4ROTA 5C8ZA 4UBMA 1ZICA 1KEZA 3IUJA 4E46A 5IVHA 2B61A 3AIOA 4AZ3A 1VXOA 1GQSA 1ZI9A 5JASA 3I2IA 5AM5A 5HQ3B 2UZ0A 1AURA 4PSCA 4OCZA 2H7XA 4FMPA 1DX4A 4J0HA 1VJ5A 1CUJA 5HFNA 2ACKA 4BDTA 3R3XA 5JZBA 1LPNA 3U0VA 3IULA 3OTQA 5FPQA 4E14A 4UBKA 5E4JA 5ALHA 4X90A 3GROA 5CT8A 2PSEA 4BTLA 4C88A 2ZYSA 4X71A 1XRLA 3H19A 4PW0A 4YASA 2XMZA 5LZ2A 4JEIA 5BWBA 1BRTA 1AQLA 2O2HA 5JAOA 1F0PA 2YH2A 2HIHA 3FYTA 3WZMA 1SFRA 3CXUA 4KE9A 3WK7A 3V9AA 3WL5A 3ZPXA 3R40A 1UOOA 4G8DA 5EIAA 4GEGA 4H35A 1UFOA 1X2BA 2R8BA 3EQ9A 1EINA 2OCLA 4W1RA 1IMJA 3PFBA 3DYVA 2WSLA 5CT6A 1MNQA 5AICA 2HA7A 4G5XA 5FUMA 3I6YA 5LLSA 2WUFA 4YK7A 3QM1A 4NVRA 5HCUA 2B20A 1ZGCA 5AKXA 1SOMA 2JGJA 2I3ZA 4IH1A 3KOOA 4B85A 3K9BA 5CRIA 4QNNA 1C4XA 5AK6A 1CUIA 1HLGA 2VTVA 2YYSA 3DOHA 1QO7A 3RLIA 1RWQA 4P92A 1CUSA 2IX9A 2HHAA 3MUOA 1ZI6A 1UK8A 1GPNA 4N8DA 2G4LA 1WB4A 4W9RA 3WWEA 1MAAA 2QVBA 4QDOA 5IVDA 2GYUA 1QFSA 4A23A 5I7UA 4QLAA 1QFMA 1E3QA 4V2IA 4AO8A 4Y9SA 1YA8A 2QKYA 1EXWA 5AM2A 2BJHA 1ACLA 3LCRA 4Q82A 3BIWA 4G8BA 3CCCA 1JI3A 2AJ8A 3D3NA 5AI0A 4B81A 5AKEA 1B41A 1Y7IA 5DWDA 3IDAA 4KAJA 2I78A 3C6BA 4L3WA 2ACEA 2OAEA 3DDUA 2WM2A 4BZZA 1BEEA 2WQZA 1Y37A 4AMYA 5CXUA 3DS8A 3VISA 4ZREA 3K6KA 5K3EA 1XKLA 1HPLA 1TCAA 3ZWQA 3BL8A 5IVKA 1MX1A 3ESBA 4G1FA 4U2EA 3L1JA 1I6WA 5FLKA 4CIBA 5I9IA 1QGED 3KDAA 3VXKA 4UHBA 3CCBA 4FWBA 2JGLA 4IH9A 3I2GA 2XQFA 4CG2A 4WCVA 2ONCA 1FJ2A 4L0CA 1MAHA 4XX1A 2JGIA 4TPKA 5AHXA 5CT4A 2Y6VA 5LYYA 3BDIA 1ORWA 1GXSA 5JADA 5K3FB 3FLAA 1LPAB 4UFPA 5JAPA 1MN6A 1CUWA 5AKGA 1FSSA 4W1QA 1OCEA 2HFKA 1U4NA 2JGFA 2ZYRA 1EDEA 4WY8A 2K2QB 1Q0RA 1WCYA 4Y2UA 3G0BA 4BATA 1VKHA 4GWLA 2EEPA 1CUFA 3TRDA 3ZI7A 2HL6A 5KREA 5KBYA 3G0CA 4X91A 2BUAA 3VJLA 5AM1A 5K3FA 1CR6A 1N5MA 1EVEA 5DJ5A 1J2EA 4BC1A 2DCMA 1YB7A 3STWA 3IUNA 2PX6A 4K6KA 2XB6A 4UBJA 2YASA 1TKRA 2QM0A 2FJ0A 4LXHA 1ZD5A 2JEYA 2HRRA 3D2AA 4K6HA 4FOLA 1GKKA 1FFEA 1LPOA 4UBIA 4LHEA 4X6XA 2ZVDA 3C45A 3B12A 1QZ3A 4GHWA 4QWWA 1TAHA 5HKBA 5ESRA 5EIHA 1W76A 5JD6A 1EK1A 1YR2A 2DR0A 2JIDA 3GUUA 1CUVA 1M33A 1XKTA 4L9AA 3QITA 4L72A 4IQ4A 2XMQA 1CUCA 4B80A 4MEBA 4DMFA 2XUKA 4EUSA 4BRSA 2QTBA 2W6CX 3G8YA 1ZJ4A 4BCBA 2DQZA 4CCYB 1VE7A 2GBGA 4Y2XA 4I4CA 3WKBA 2RONA 3E1GA 4AN0A 3V1NA 4M0EA 1IZ7A 1XLUA 3G0DA 4FNMA 5K5EA 5DLPA 1VLQA 2H9YA 4QDZA 3O0DA 4Z49A 5A2GA 2PUHA 1O6FA 2Y2VA 4QWMA 2J3DA 4YX9A 4QLOA 3DOIA 4H7KA 1U2EA 5K3CA 4C6HA 3TJMA 3D2BA 2ZSHA 3WKEA 4NZZA 1UWCA 2XUPA 1AX9A 3MVEA 1EVQA 2XMCA 1KU0A 1GPLA 2QXUA 4KRXA 2C5GA 2RGUA 3HEAA 1WB6A 2PU5A 3JW8A 1ZJ5A 1MTZA 1RP1A 4S0XA 1E8DA 1LGYA 5HF8A 3DCNA 1XZHA 2JEZA 3VJKA 5EHQA 1R88A 5KWIA 1PJAA 4C01A 1UKAA 1R9MA 5CH5A 1XZDA 2OAGA 4DLNA 4A16A 3AIMA 4DNPA 3WMRA 4BDSA 2NW6A 3WK8A 2DSNA 5ALJA 3DL7A 3PICA 3D0KA 4FTWA 3WK5A 3I1IA 3DLTA 2Y1KA 5D6OA 1K5PA 3PUHA 3DNMA 5D7BA 4CG3A 4RE6A 3AFIA 2BAGA 2PM8A 1WOMA 5A7HA 1UK9A 1E66A 4UFOA 3AZOA 1EX9A 3FSGA 4JYMA 4JYPA 1AKNA 4WFIA 1RYYA 3G9XA 5EHXA 1ZGBA 2G63A 1S8OA 4ZI5A 4YPVA 4BC0A 4KEAA 3SC2A 2XUQA 1XZJA 1Z68A 2OGTA 3WYNA 1HKHA 2XQGA 2XMBA 4MWTA 1XRPA 1MJ5A 5CTAA 2WFLB 3RKSA 4H7HA 3WI7A 4B0PA 3QYJA 5CT9A 2H1IA 3G9ZA 5SYMA 5AJHA 2X8BA 2VT7A 3G0GA 4F0JA 3WK4A 1XRQA 1AC5A 3FYUA 4N5IX 4BE9A 3QPDA 4O08A 1ZOIA 2FX5A 5FPPA 3S2ZA 3TGLA 5AIBA 5HKAA 4U2GA 2HADA 5ALLA 2BUCA 1A7UA 5T4HA 4HRYA 2VJCA 3WWDA 2WHRA 1XZMA 4RE5A 2CKMA 2V96A 5BWCA 1JKMA 5A71A 2WFLA 3A2MA 4E15A 5I8PA 1DU4A 4UBNA 4QZVA 1AGYA 1SCIA 3C5VA 2JBWA 3WL8A 3I28A 4N8SA 3G9UA 3HACA 3DL4A 3WYDA 3I2JA 3SK0A 1BE0A 3W9UA 4DMCA 4H77A 2RHWA 4KAFA 3D5EA 5CW2A 3BF7A 1BN7A 3IVMA 4EB0A 3AJAA 3UMJA 5AKJA 3QMWA 4ZWNA 5FOQA 1MT3A 4D9JA 3GA7A 2Z8XA 3FSGD 1CUGA 4OB8A 4WY5A 4HXGA 5FDFA 3BDVA 1BS9A 1W75A 1BEZA 3V48A 1X70A 2WG2A 2C4HA 3HC7A 3F8SA 4MJ3A 5JATA 1UKCA 1JU4A 3C5WP 1JJFA 4PQEA 5CURA 4Q3KA 4OYYA
chains in the Genus database with same CATH superfamily
4XWTA 5KVSA 5EP3A 2WTXA 3P1JA 5BQPA 4DIBA 5K0BA 2K4MA 3FLBA 1BQEA 1G19A 5ALNA 2Q45A 1ITZA 1HV8A 5TQVA 4LWZA 1XHLA 5IAAA 1LFDB 4F8EA 1MW8X 5E9AA 4FT2A 4TT8A 3PHHA 4R9RA 1Q0PA 3A6DA 4XJTA 5DTMA 4GSKA 2E4VA 4BKRA 2I3DA 2QRVB 1A5SB 1NSFA 3JZIA 3UC9A 3M5CA 3UUFA 3EPRA 3KPUA 4LKOA 2GD2A 3L1VA 5AVRA 2GZHA 1NF9A 1GNTA 1GGKA 1FFBA 1Y1LA 1WMFA 1HZZC 1Y3FE 2BI8A 2ZTHA 1CC1S 2JASA 4GM4A 3S1LA 3UUGA 4JDPA 4HNVA 3RHZA 1A3CA 3AESB 1A50B 2GILA 1O54A 4B3BA 3D54D 3PC2A 2XNKA 4XCQA 4HX5A 4L0DA 4KH1A 5AW9A 2EWWA 3A4VA 1K66A 1VRVA 3IUMA 4ZO8A 3PL1A 5KNDH 3K05A 1DJQA 3PC8C 1UBFA 4Q9AA 5AVVA 2EDCA 4KUGA 1Y82A 4B3HA 2JAHA 4P4TA 1HL3A 3T0IA 3T1HB 4KR6A 2FSVC 2XNJA 2ZGVA 4EVRA 1NM5C 3EDMA 3H4IA 5IDWA 2XCOA 4Q3OA 2EBFX 3H9UA 4Q3LA 2FPGB 3RS4A 1SVUA 1II9A 2FN7A 5K0FA 1A04A 4H4DA 1FNCA 1EEHA 3TYXA 5IUNC 1ODTC 2J4CA 2JIMA 3KPWA 4CL0A 4I46A 3PDJA 5AK0A 4X8HA 5H68A 2ZYGA 2J6HA 3EQ7A 1DX6A 3GUCA 3KLOA 2AEJA 1LWNA 2B5WA 3LQQA 2ZYWX 3KEFA 4KXNA 3SBEA 3MILA 2YR0A 1JQLB 5ALTA 1QIDA 3SJZA 2B2CA 2O57A 1E5VA 4G9EA 5IKXA 1QNFA 2HU7A 2X8WA 1ONNA 3JWGA 4OAOA 3FHTA 3E58A 1C81A 1SG0A 2QW8A 4EG8A 4D92A 3KKNA 2BM9A 1JG4A 2EFEB 1T8PA 2B4AA 5I7OA 1NUSA 2P41A 4FJ2A 3ZKWB 4H7EA 4ZYLA 5I01A 1MO5A 1ZZEA 2X4LA 2O0LA 3DTYA 3N2LA 3WDSA 1ESDA 2ZSBA 4EPWA 4U63A 1JLLA 4LVOA 2CVPA 1SVMA 2HY7A 3D81A 1DWPA 2IY7A 3D3KA 3T5TA 5ALKA 2IEIA 1HF3A 4BTVA 3QUQA 3I2KA 2C4WA 3RUPA 4R2LA 3SX4A 3W4JA 5J23A 4DNOA 3EX7C 3T54A 4LZWA 3F1LA 4GMGA 1SCQA 2ISSD 3IXMA 3WG9A 4EYQA 5KQGA 5BN1A 5FEMA 2M98A 3CSSA 2WILA 5C0OE 1J0AA 4IP0A 4ERNA 8LDHA 1GITA 3TM4A 1IVSA 5LIRA 4QEDA 2XCSB 4Y18A 3BXZA 5KU1A 4UTXA 421PA 4D9EA 2OVBA 5EG5A 3UAXA 2YV3A 2X8JA 1FW8A 2ATVA 4ILEA 4J0CA 4KXLA 4AZSA 3HNRA 5F23A 3AUJB 2UVPB 2BBOA 5LJIA 1XYYA 3T9DA 2AYYA 3L6BA 2CVHA 4K03A 1HTBA 4NNPA 1H1LA 2PXCA 1E3IA 2FEAA 3C4VA 1KDTA 2NSYA 3AYZB 3SJAA 3Q6MA 2RDMA 4KJXA 2IXDA 1VG9B 4MV6A 4Z2YA 5AVUA 2GASA 3FNHA 3F1KA 3W2HA 5IAOA 1UDXA 3CT6A 3P0IA 5TXGA 3BXFA 3IEIA 4HDSA 4R81A 5JWHA 1Z2DA 1GPDG 4RTPA 1A82A 4AY3A 4Z1MD 2JD2A 5HJ2A 3EF1A 2C2KA 2W2KA 4LSWA 2JGKA 2CJXA 2HC9A 5A5FA 2I33A 2VJYA 1NLYA 4Z4HA 4E5KA 1K06A 5JS6A 4I1IA 2O1XA 4YRMA 3EF3A 4RTLA 3HWWA 1Y7PA 3V5NA 3VPDA 2IZ5A 1Z17A 3AI7A 3GLHA 2JGNA 3OHMA 5E6UB 5I7RA 2X0NA 1ZHOA 4M99A 3P71T 1ID8A 1WQ4A 5K20A 5EJ5A 1GPJA 3WLSA 5AI5A 3VNSA 3GJ8A 2ZUTA 1SU7A 4DEYA 1IPEA 3OZBA 1RZUA 4KUEA 1REQA 1DQYA 3KWJA 1H2XA 2FMFA 4RSGA 5IAEA 3OLCX 5IJZA 3IDZA 5JSUA 1JLRA 3R7FA 5JAMA 2IV3A 2E9SA 5AT1A 1PLLA 1YIAA 3TTTA 3B1ZA 5EP2A 3IP7A 2IYQA 3JALB 5CA0B 1F1BA 1SBQA 2GWHA 4ZVRA 1JSRA 1UPCA 4KQGA 2O1SA 3I2HA 4MWDA 4D9FA 1EI9A 2FN8A 4DR1B 1QK5A 5EMMA 5FJJA 1D03A 4IHQA 2WMDA 4KPUB 2AE2A 2BFEA 2O5VA 4HAUA 2G9UA 4QGGA 1PKXA 2ZDQA 1PWHA 2CNKA 1WP4A 1GAQA 2IYRA 5EWJA 1VPTA 1LY1A 2XV1A 3L8MA 3MGAA 4PO3X 3H84A 2VUSA 3S28A 3STXA 1F8GA 2P5TB 3TNLA 3EVCA 4N8EA 3WYEA 3EJWA 3BQ9A 4J76A 3TZLA 1G2QA 5LYJA 4CG0A 4TXNA 2X6TA 4US1R 3HB4X 3NAMA 2OD2A 3IJPA 1Y8RA 1GCOA 3OOEA 1KMIY 1RJ9A 4IRMA 2X3UA 4M3NA 5AVJA 4F2WA 3S8YA 3BE4A 5LB4A 1JHMA 3DMTC 3UCFA 1BO6A 1ZC4A 1P0MA 3IQGX 4MMXB 5COAA 3FUCA 3LX4A 1Z6QA 4NS1A 4ZRDA 4IFTA 4JNCA 1VHDA 2ZRFA 2P4UA 1E98A 1L7EA 2HQOA 2OL4A 1OASA 2WICA 4LXQA 5AJVB 5C4GB 3WYAA 4GXQA 3RT9A 2P65A 2NUTA 4UPEA 5AJYA 1YTLA 3SSOA 5CFNA 3Q6NA 4BMYA 5JZOA 1THZA 4PIVA 1PJZA 2ZETA 3TFQA 1V9SA 3O8QA 5IAGA 3MWKA 1T5LA 3GEHA 3FMIA 3OJCA 3B2EA 2J6IA 4W9NA 2DHDA 5JYBA 3GJTA 4QNRA 3PSAA 4QYIA 3KKEA 3WWYA 1E64A 2P9JA 3NBUA 4YAIA 1AKVA 1U2DA 2OV6A 1G5RA 2LIVA 5FBZA 3SVLA 2GCIA 4H1WA 3OWOA 3BHMA 2VLBA 4N7BA 3GLGE 3TTUA 4JBHA 5HJ7A 3QW2A 3DHVA 1EGHA 4MGEA 2DFDA 4WE3A 3JYOA 2YJ3A 2YFKA 3QLVC 1P9LA 5DT2A 2XR1A 3H8JA 3L0PA 4OIMA 4WINA 2HKIA 3T3EA 3FUVA 5ESWA 3VMFA 4H7FA 1P4RA 1HTTA 2OPBA 1POWA 4BV2A 2WINI 1TFRA 2ZJ1A 4GZ3A 4PNPA 3TN7A 3QKUA 4LDAA 1I4EB 4QYMA 1KZGB 1XRMA 3OC0A 4ZI2A 4MHTA 2NSHA 1GRCA 1Q0ZA 2ZI6A 2DUJA 4HBZA 3LP5A 4MCAA 2WTMA 2JKVA 2ZIWB 3ITKA 4AS3A 2RKOA 4O5AA 2NV2B 3Q8WA 1BHQ1 3UNXA 1Y7HA 5BN5A 2PUCA 3CUYA 3CU5A 2ZJOA 3ROEA 1A95A 3FJ1A 2HEIA 4FCVA 3LRXA 6GPBA 3R6TA 3PNVA 2QF7A 3TNDA 3N3BC 4M9SA 4QAQA 4BNVA 5IPFA 1GIAA 2YRWA 1QQ7A 1GZ6A 1U65A 3ZX4A 4IGFA 1KNQA 1JS1X 1ISMA 1WZUA 2M2IA 4IHAA 3KQSA 1YDWA 1PUXA 3PJGA 2H00A 1NP3A 4IO1A 4BGEA 3EDQA 1JPNA 4BYGA 1KWKA 3B3AA 4D3SA 2VL7A 1X15A 1BQ3A 2FTKE 2J3LA 1G6KA 3KXIA 5JSHA 2YXNA 3G7SA 2FZVA 4X1KB 1NQUA 1OWOA 3LG2A 2P2DA 3QLTA 1RAIA 4NICA 3FUWA 3S27A 4R6XA 3WGVA 2WT4A 1ANKA 1NQOA 4F6CA 2WT9A 3GVIA 4L15A 3WLFA 3FYSA 5J40A 2RH8A 3WQSB 5IM5A 1C0IA 3M6LA 4CKCA 2G07A 1VJDA 5K1ZA 1QCYA 2ORYA 4PTZA 4D41A 3M5WA 5AW7A 5IFKA 2GZSA 3RKRA 3GEEA 3NM6B 4P7JA 2Y0DA 3DE3X 1IHYA 3NT4A 4J3JA 2P4SA 1XOIA 4X8OA 3MWEB 5B58C 1D7OA 4LBYA 2IZZA 2OB1A 3T3HA 5ALOA 5SYNA 4Q4DA 4WOCA 2P0EA 2YDXA 4V2UA 1JFLA 3WSVA 4OH7A 3DWIA 4HTFB 1TTTA 4HLUA 3LO8A 4MHOA 1ZHHA 4C6RA 2CLKB 3DW3X 3PF9A 4LNUA 4PZEA 4UCXA 5JG7A 1AZSC 1IY1A 1Z28A 2BKVA 2PMDA 3MJSA 4E5PA 1BWQA 2VDOB 1WW3A 2TYSB 3F74A 3FCAA 3PJFA 2NZWA 4WNCA 1JAXA 1ZKMA 3MTEA 5E3IA 1JQAA 4JGIA 3SDZA 3K2IA 2WW8A 1TIKA 1HYGA 1A8IA 3C6XA 3NX4A 1P18A 2UUPA 2G6BA 5K0ZA 3JWIA 2QM8A 3ZWNA 2HSEA 2R6AA 4B83A 4R8VA 3UKOA 2GNOA 4QXRA 1IONA 9LDTA 3H2IA 4MZXA 4MRPA 4OKNA 4H1VA 4C2AA 4OXRA 3VSAA 3WRYC 4Z8YA 3STTA 4P53A 4OM7A 3GGPA 3BTUA 3ZBQA 2F6RA 3BWYA 1R6TA 3IKMB 1FK8A 2AD5A 1KFCB 2FUNB 2IXEA 3KU4A 4X63A 2B8TA 4E51A 5DNCA 4PPNA 2C83A 2E5LB 4WH0A 2KLBA 2WU4A 3PUWA 4RNCA 3T1TA 1QTNA 2JVKA 2YCLA 3E18A 3O38A 3PX2A 4NLLA 3QLUC 4NPHA 1ICEA 1H85A 4LQ4A 3S8MA 1WETA 1R4AA 9LDBA 2HBRA 1SB9A 2W58A 3VR2D 4C4OA 3THYA 2Y4NA 1FS4A 4UDXX 1DNPA 5TPWB 3QMMA 3N5CA 1CQJB 2XOXA 2ZKIA 3BD6A 4R1UA 1PJSA 3ANTA 3LE8A 2CDNA 2OAP1 3KUXA 1XTJA 2G67A 3E27A 5E38A 5H16A 2QVCA 2HUPA 3GN2A 4E7OA 2Z1DA 5CXSA 3THYB 1VC2A 2FXVA 3OFNA 4YDSA 1E7MA 1WX1A 4BZWA 2W2TA 4MQLA 2V6IA 4X3PA 5CLHA 1W85A 1ZD2P 2QZ9A 3EMBA 4FBLA 1YB1A 1IPFA 3LYHA 1RXIA 1JLMA 2ZS8A 5EJGA 3VZPA 4ER3A 2IZ0A 4F8JA 3W3AH 2H2AA 3VHQA 5JMWA 3O1LA 2BRUA 4BKOA 1T4MA 1DWUA 2RB4A 4M1ZA 1VPLA 4CEHB 1V41E 3E9DA 3FNIA 1QOQB 3K35A 4CDNA 1Z5VA 3PFNA 5KNCH 3N2GB 2EYUA 1OV6A 2QJWA 3TB6A 3HFRA 3AM1A 5A5EA 3N53A 5EHNA 3WGGA 4EPTA 4BIIA 1QGUA 3RIGA 3JVDA 4HXFB 3TCNA 1FXWF 3LQ1A 1XTRA 4PBRA 5LOVB 1AS3A 4B74A 2QN3A 2YZ2A 1E0AA 1G16A 2VDKB 4KC0A 1G8AA 1G5PA 4QPCA 3GLGA 1VCOA 1NJFA 1JJ7A 4G36A 4RH3A 3TMAA 3NV7A 2DR3A 5DW3A 2CFSA 3WHPA 1N6IA 2BGJA 3MMSA 4CM4B 3QGMA 2FRDC 3R3UA 4FYKA 3GG2A 3KC2A 2OQRA 1ETUA 1TUGA 3TO5A 4BLUA 4ZCTA 1ZRHA 3HG7A 1YS4A 1PS9A 4LJRA 1G8FA 1UBMS 3AYXB 3IBYA 1FX0B 1HKUA 5D1HA 4MV1A 1YBFA 2FUCA 1UKBA 4U9IS 4FLMA 3KL2A 4BLPA 1SQ5A 4FMCB 3R3YA 1JMKC 3N58A 1R18A 2POCA 2Q4EA 2YWDA 4J0KA 4NS4A 4Q15A 5K3BA 5IF9A 3VYUB 4K8OA 4JBXA 2ZUEA 2H57A 2JCBA 2OBMA 3Q15C 5JC1A 4HH3C 3JAKB 1YF3A 3E7XA 2UYCA 4DIUA 2Q1TA 4AY5A 1SM4A 1D2RA 4HQ0A 4C0KA 3WLIA 3QHPA 1SUDA 3E5HA 2PSFA 1VZ2A 5F7JA 3ZDXB 4Q3BA 2W6MA 1N2SA 3N6XA 3UMFA 1XKXA 3HGQA 3TGPA 1YIOA 2RG7A 2OBXA 1NXWA 1ZD4A 2GRJA 2HF8A 3CJTA 3VFDA 4BNDB 3G85A 4ND6A 2AUTA 3SPXA 5JVDA 5M04A 1QH9A 2EHDA 1ZCBA 4B48A 3K70C 5JAZA 5F64A 4AMZA 4Y2YA 4L28A 2G76A 2IYFA 3RS8A 1NDQA 2P3QA 2JGAA 3NTOA 4L8GA 1RI2A 3SC2B 4C7BA 3AUUA 4KK3A 4I55B 3ESXA 1RMYA 3UB2A 3T0GA 4I9NA 3IOCA 1E4OA 1A2KC 1EEXB 1PGQA 1UEJA 4M7WA 4GLOA 4PAWA 1JI0A 3OZ7A 3PHJA 4RPGA 3QH4A 4U39A 1GLNA 5G1NA 4B8WA 2XBMA 5EY5B 4P54A 1EQ2A 2RAVA 1XZKA 1FNNA 4DQKA 4DTIA 1H93A 4Z53A 2G83A 4TQAA 5E2AA 4PSDA 5EUCA 4FYYA 4M0UA 4HRXA 1L5OA 2WR8A 5IAKA 3K5HA 2OM6A 3QEOA 4HAOA 4I8IA 4NV3A 1U9YA 4LGMA 2VRCD 3R0ZA 2QRJA 5EJ6A 3KQLA 1TQ2A 1N0UA 2FZLA 2BGGA 1X7XB 3WKAA 3LK7A 1R0WA 2GDZA 2Y0PA 4XE5A 4AKHA 3CURA 3OZWA 4H3KB 2OBNA 4BZPA 2AC4A 5D87A 3H2YA 4KTTE 3LPDA 1WMAA 4A2CA 2WWHA 5FR2A 3MEQA 2WHPB 3D5TA 1X1TA 5KMGA 3W8EA 3ESCA 4O29A 2EFYA 3TTVA 2YDYA 3IAM1 4XXHA 1E3WA 3NGXA 3JASA 1H8HD 3R9IA 3WISA 3LH5A 4JC5A 1A5AB 4LRUA 2B35A 3O03A 4AJPA 4EDFA 2XZTA 4I4IA 1SN7A 2PLNA 2RSLA 3A1NA 4O4IA 2J9RA 3KELA 4YRJA 3OLWA 3SNHA 2R1TA 4PNHA 5HM8A 5C8VA 3PNKA 3KJZA 1GUYA 2V7BA 2QL7A 5IEBA 1HMPA 1RQXA 2BEKA 1WVGA 4EZIA 5K8CA 1E6UA 1IHXA 4JQZA 2ZE7A 3MMNA 4TYQA 1VJ1A 3EXG2 3LUDA 2FSSA 2H07A 2NU7A 4RZSA 3REOA 3QU7A 4P5DA 4EKIA 2AZMA 3LCVB 5B1IA 1FDTA 1SVKA 1YB2A 4EI8A 5IC4A 3CMMA 4LZAA 5ADVA 1L5RA 3LHDA 1Q57A 3BBPA 2EBWA 1NY6A 4J7AA 1NXVA 3GGOA 1XE3A 2BH2A 5C51B 1S2GA 1TIBA 2PVPA 3IO5A 5FPYA 3R3VA 3TEJA 1E2GA 4BGDA 2LR0A 1PR4A 4J29A 3MWLA 1C2YA 1WKCA 2HGSA 1N6HA 4JYCA 5ENVA 3UWDA 3ILVA 3G7UA 2LCFA 4I8DA 1V6SA 4MQBA 4H3SA 2YQ5A 1AQYA 1SOWA 3B7PA 3JQ7A 3UENA 1AHHA 3EPHA 4CZ2A 2ZM5A 3OSZA 3IP1A 3CH6A 1TJNA 1JUDA 4AO7A 1YFLA 5C7OO 2CXHA 3HYSA 1SCBA 3NVAA 4JEUA 1T0BA 2OXEA 5JBIA 4JIGA 3JZDA 3Q5EA 3Q0EA 3ABQB 4OSOA 2P1RA 1NBHA 4RHFA 1IUNA 3VV2A 3HJFA 3PA8A 3GFFA 1WULS 1EGMB 1EFPB 1JJBA 1YC5A 1OX6A 4HRVA 4JP5A 4LMBA 2OKCA 1IOLA 1JIQA 2D54A 3L8ZA 3GYGA 5CB8A 3HU3A 4EG6A 2HK8A 4M9UA 1JPVA 5E8RA 3WGYA 1XX6A 4C3ZA 3G0IA 4EKDA 2WLSA 1YD7A 4DM4A 4MLCA 2A1IA 1UAGA 3ZE7A 1TF5A 2XTJA 1DKQA 3V80A 4P3KA 3THWB 4IYJA 5KAMA 4I2NA 2DFTA 4M4SA 2BHNA 4IGAA 5IRCD 1M8PA 4OKIA 3W9BA 5B6JA 2RGYA 5JR3A 3MRXA 2UYOA 5CB4F 1CNFA 3Q9NA 1TW3A 3M6VA 1QIJA 3WHIA 3V1LA 2JI9A 1KEEA 4AJ4A 2PGLA 2O14A 4L2IB 1QG6A 1J1IA 3R0VA 3NBAA 4J16C 1YT5A 2O3QA 3VTKA 3Q8KA 2R6CA 2Z3ZA 4BEWA 4B6PA 2O0KA 1KSHA 3B7WA 3MLEA 1RWOA 3T8YA 1CR0A 3E2PA 3QUSA 4Y2VA 5BR4A 1S7GA 1U7OA 4KACA 4EF5A 5L51A 1CUYA 3BORA 2BFOA 1AA9A 2OHVA 3LGXA 3FPAA 1CULC 3UGQA 5FL7A 1UBLS 2PX3A 2QP4A 1U2GA 4AW9A 4RZ3A 4DY4A 4BBJA 1WRBA 2VAMA 2ZVQX 4PIMA 4TVBA 5CIQA 4ZV4A 1W35A 4OGKA 1M1ZA 4NAVA 3U4QB 4Y2HA 3NNSA 1WWKA 5HBRA 1W8DA 2NUAA 1JKJA 2J30A 4JN6B 4R9SA 4YCCA 5KWVA 1DX9A 1XEWX 4P32A 4QBKA 4WXYB 3UXHA 2CF6A 5L3SB 5C53B 5ALVA 1U8YA 1TGVA 2ZUUA 4FR0A 4FYJA 5FCDA 1DQPA 3AEUB 4PF1A 4II3A 4ZZ2A 5DFAA 3WFZA 2CHUA 3HLKA 3IQDB 3OM8A 2OYRA 3TEMA 1H4TA 3H1FA 1OFGA 4KFUA 1MP0A 5FYQA 4MA0A 4JB2A 2FVYA 3AVPA 4A27A 1R27A 4YV0A 3INNA 3O90A 2JDID 4K9LA 4NBKA 4MWSA 2GZDA 1KMNA 3BA1A 4G4JA 3V97A 5JD5A 5IEJA 1I7QB 3RUHA 2VAXA 2BONA 4C08A 1RKUA 3WHKA 3NGLA 3AFNA 1ZGGA 3ZKAA 4D9GA 4HVAA 1XVAA 3ESQA 3HADA 2QM7A 5ALYA 4JXZA 4ZD6A 3JYQA 2PUBA 1R0CA 4MQEB 4EA9A 2EZ8A 3GFRA 1L2TA 1R1DA 4BN5A 4P8RA 4DMKA 4HDNA 2O2CA 2OLKA 4FSHA 1HDRA 4FFVA 2PCLA 4G84A 1RCTE 4FLEA 4YDHB 4BNKA 1PJCA 5KINB 2R8OA 5LQJA 1C7ZA 1Z6PA 3Q7EA 5LBIA 3THOA 1K86A 3ZGYA 4B6RA 4WNAB 3AKDA 4OI1A 1MABA 5BSRA 3K20A 3ZY6A 5CEFA 2Y0BA 5LBTA 4QUGA 1SVIA 3QWIA 4GZ6A 5B58T 3SIXA 1JAHA 3SXUA 4CIAA 1T4GA 2I55A 2RI6A 1OHHD 2OHFA 4G1UC 3ZXXA 1WV0A 4FT4A 4Q01A 1NUAA 4MA5A 5AJTA 4QM7A 2X2OA 3O9VA 4ZVPA 3ZNOA 1ZCJA 4ZZ3A 1NMSA 2QAGB 3FWNA 4NMWA 5TEWA 2YFYA 1NN1A 3NYRA 3QMVA 5HF9A 1UAYA 1T3ZA 3GAFA 1RLJA 1UPFA 1CG6A 4Y6OA 3SYLA 1UDBA 2REBA 3R75A 1IXKA 1GAEO 1KS9A 4RZIA 5DHQA 5DK6A 4ZVKA 3ACDA 2H1FA 2OORC 3FCXA 1V25A 5HIMA 4X1OA 1B23P 3BCSA 4JGGA 3TZKA 4X54A 3CM0A 2JK0A 2GYVA 4D0NA 3CUSA 3IJ5A 2QW1A 3L7OA 3MINB 4G0XA 3AERA 2W8ZA 3IDFA 1FFXA 3CQ9A 3U1BA 4AKIA 4LQLA 2VHEA 1BMFD 1Y89A 1XMPA 3GCDA 3UZUA 1PEDA 1KI4A 4RSRA 1Z2CA 1ZISA 2VTKA 3VYVA 2WVAA 3USZA 3I5UA 4EY6A 4C4RA 1OROA 4XKJA 4GP6A 3FOCA 3TEFA 1Q1ZA 2PV7A 2WJYA 1GWNA 4REMA 4DANA 2VDRB 1CQIB 2AMFA 4PG4A 1J6UA 2UZ1B 1G5FA 1XU7A 4UEJA 2IP1A 4ND4A 1VE9A 5J3JA 3TECE 4QTXA 1HFWA 5IK2D 2AFIE 3H5LA 3ITDA 4JUIA 5FBWB 5DYWA 1WZCA 2HHCA 5JANA 2D5IA 1I6LA 1VHTA 2G88A 1Q83A 3HABA 3K70D 1NTRA 4IOKA 4AULA 4DV4B 1VMKA 1NG9A 3OT1B 1G42A 4K9MA 1U6IA 3SWWA 4C21A 3OHSX 2OE2A 5CLIA 3W05A 3Q7RA 1MU0A 1T6ZA 2C7PA 1BD4A 1ZI8A 4PVDA 4BVHA 4YUZA 3GYBA 1PGPA 4H1TA 1KOGA 1NJ1A 3GT4A 4FFPA 3RUDA 2V74B 1J8YF 4TQ9A 2CYAA 4ID3A 2JG3A 1WCV1 2BSXA 3FMVA 4RVSA 3UF0A 2IYUA 4G5FA 3TQTA 2ZE6A 1CUUA 4IIGA 5LD2B 4M1QA 1Z75A 2P91A 4ZU1X 3WGMA 5ECDA 5CDSA 4CFZA 4RFSB 2QTLA 1G5TA 2G1AA 1YUMA 5L8VA 4DT1A 2BFNA 2RAPA 4NZYA 5BV2P 1QGYA 2HA2A 2VSQA 4F4IA 1M6EX 4RK5A 2BZ0A 1VZ3A 1SUEA 1H2YA 4IDPA 1J0CA 3KTOA 5K3AA 4RLSA 4BKQA 2C8KA 5GZ3A 3BQNB 1KKLA 3NDIA 1X8KA 2ATXA 3TLCA 4BUZA 2PRIA 3A05A 4RHYA 1QBKC 5FA6A 3RIYA 2FQYA 1Y4DE 2INGX 2VEDA 5FTNA 3RU7A 4U5QA 1GCAA 4K9QA 1Q7GA 2DTXA 2M9MA 2X9QA 4HDRA 1GR0A 4NEGA 3EB9A 4XB1A 4KRYA 5F1PA 2H65A 3TKLA 4QFBA 1XALA 4KHPB 4QUDA 2NUPB 4DV6B 2ZDGA 3W06A 3O95A 1N2GA 1NNI1 4WZ6A 3V9PA 4UHKA 3KFVA 2DPGA 4QSMA 1YAJA 1D3AA 1P74A 1HLFA 4ZICA 3RFUA 1I3LA 1V9CA 1W4LA 3DD5A 3HXMA 4B32A 1LLCA 3A4YA 1G6Q1 4RVHA 4WBXC 4MO2A 4BQIA 2JGDB 3ZVMA 1J0BA 2O3TA 2WVJA 1JFVA 4BXOA 1U9IA 2FOXA 4O2BB 4F11A 1ZINA 2WJZB 3DKKA 4ZN6A 4LIPD 4JR1A 4TRNA 4NFSA 1NHGA 2Y6UA 3T3IA 5KQSA 3W2GA 4C7VA 3IBTA 1R3UA 1ADJA 1KFEB 2IZ7A 4GXRA 3C3XA 3EZFA 5M3BA 2AEFA 3TLJA 5FBLB 1EFLA 2AG6A 3R0JA 2Q4BA 2XRFA 1ZM7A 2WWIA 3G5UA 3K0HA 3LPLA 4PIPA 3U4DA 3ULKA 2DP4E 4C6SA 3RT7A 1D4AA 4X64B 1DEHA 4QULA 5G53C 3FM9A 3CXRA 1KPIA 2Y1WA 3FWKA 4OQNA 2BMAA 3I09A 2NMVA 3A6EA 4PE5B 1T3LA 3L4BC 4PBSA 1SU8A 2QTZA 4CTMA 5KOHB 4FS8A 4AX4A 3F97A 1JG7A 2RGWA 3GQBB 4JY7A 3T3GA 4MQFB 2P9QA 3VVCA 1XFDA 4RF5A 4X1YB 10MHA 3KJFA 1B8UA 4A5SA 2BFFB 1Z08A 1V1MB 4F3RA 6PFKA 5JS7A 1BC5A 1W2WB 2CNWD 2D7JA 4IQGA 5BWNA 3ZD7A 2H48A 1Z33A 3LIPA 1RP7A 3PUVA 4AG5A 4RJJA 3N0XA 2PWPA 3PD0A 3L1UA 3ZW7A 3WGJA 1W4AA 4HZGA 3A2NA 3DZDA 4MVJI 5BN4B 3T7RA 3OLQA 4ENUA 1IRXA 1XTZA 3TDNA 1O5TA 1VMEA 3F67A 4FE7A 3EIWA 3ZLJA 2ISCA 1DQZA 3T6KA 4YRLA 3H42B 3ORQA 4QXPA 4ZO7A 3PFKA 4DYDA 2GHRA 4JJ8A 1MZPA 1Z4KA 2ORED 1JVBA 3OLZA 1CEQA 1U8EA 2OBYA 1LZLA 3GFQA 3GO4A 3RTBA 1LLFA 3VBEA 2HQ1A 1TA0A 3PDCA 4DL9A 5JZMA 1MRSA 5D51S 4AAYA 4MWEA 1XEFA 4F5WA 1H0SA 2E6KA 1KNXA 4JB3A 4MKHA 2NNLD 4GGOA 1B8VA 4UHFA 1EBFA 5DBFA 1T4BA 3RK0A 3U7FB 1NLFA 1Q1GA 2ZTUA 3NEYA 2BR3A 4BV8A 4CU2A 2HRCA 5CA0F 5J58A 2R2AA 2OO7A 3U44A 1BHJA 2OXFA 1TM4E 2IU4A 1U1FA 5DXFA 4KQHA 3F2IA 4MVXA 1QHSA 1O94A 2ZBPA 5AO9A 5EE0A 4DV3B 4WV3A 2JJ8A 2A7QA 4GOXA 3UAYA 1RRGA 3L7BA 8GPBA 5EMKA 4KR3A 2VZEA 4JI3B 3PLNA 5NLLA 1L9KA 1SGWA 1CJSA 1IEQA 3R0IA 1VG0B 2WB4A 3K94A 2PE5A 3LO5A 2VFAA 4TRRA 1O9BA 1R0BA 4IJ5A 4JWTA 1CS0A 4KNVA 3OQJA 3R8FA 2IXGA 3FDFA 1ZIPA 4AT1A 1QQAA 2HA0A 3CVJA 1OX4A 4OFBA 5DNWA 4KAAA 5FFMA 2AFIA 3AFMA 4G1VA 4KRGA 4DM7A 5HR5A 1KP2A 2NU9A 2FSGA 2I62A 3GP3A 4Q4JB 1Q7TA 1USUA 3WNBA 4BL5A 1IQ0A 4FSDA 1C1DA 2XB8A 4ACBA 4CKBB 1COZA 1JDBC 3TUZC 4UOQA 1HG0A 1ZGAA 4GI1A 2YOFA 3DR5A 1QGZA 2O6LA 4I81A 1MB9A 2BPOA 4DZZA 1K6EA 1NLMA 3DFIA 1XP5A 3R23A 3HB0A 1QH8A 5AOCA 4CMJA 1WLYA 4O4JB 2WF6A 2WWRA 3TINA 1OAAA 4F93B 1V11A 5JC8A 1L7XA 4WZZA 3S2GA 5IKMA 5B12A 3GLIE 3BKWA 3MJ4A 3RQSA 2V98A 2C0CA 4MW6A 1L4HA 3IQIX 3WIBA 3L0OA 1P2UA 3GCWA 5KTPA 4GMXA 1B6TA 1EE9A 5BURA 3H9GA 3IDQA 5FWXB 4Z4EA 1KFJB 4Z2AA 1OVGA 3U3KA 4JJ4A 4TT3D 5T6MA 5CEEA 3R9XA 2EOAA 3DWGA 1AQ6A 2ZRIA 3GRPA 4IGIA 4LC1A 2QA5A 3RKUA 1NQ5A 3T9CA 1R0RE 5ALXA 4DGQA 2JC3A 3EZ7A 2J5RA 1J5PA 3GUVA 2R4TA 4ND2A 2GFHA 2QI9C 1JKIA 2D0IA 4RPIA 2J1LA 5DGIA 5EIEA 1M1XB 1W0KA 1G8HA 1DPFA 3BC1A 1OGYA 1N9GB 3NM5A 4UULA 3BHIA 4H7DA 5CA1B 4QL3A 5K01A 4JYAB 3U60B 3FDJA 2Q3CA 3AGPA 3P0JA 5T4EA 2B9VA 4J9VA 4CW7A 4PN3A 1KY5A 5IZCA 1TZ2A 1CDOA 2X15A 1KORA 4TN1A 1BCSA 1IDN1 1QKKA 2DULA 1N7GA 2ZRHA 3IHLA 3LBFA 1NXPA 2H5LA 3CE6A 4RLQA 4X20A 3OZXA 2IH4A 1NR7A 1E9DA 2AT1A 1ZS9A 3T1VA 1M6NA 3OEED 4DCCA 2V7UA 2WJIA 3AUFA 2V0GA 5DE3A 1GL7A 4MMYB 5T4FA 5DULA 3WDMA 2BFPA 4RKQA 4B3IA 1GV1A 1ONPA 1QQ6A 3KHUA 3RYCB 1YC2A 1C3XA 1N8SA 2XCLA 3RUEA 3D4BA 3HJBA 4HYYA 4O63O 6LDHA 3QE9Y 1QCCA 1V43A 4ZVVA 3DEKA 4A3SA 1WSBA 4ED9A 2XSZA 4J9UE 1NNEA 2OOKA 3MOIA 4FM9A 1I2BA 3OA0A 3T9BA 3D2CA 2ETXA 4AG3A 3JQAB 4JSYA 4DKJA 2IHUA 4OQ4A 3UWSA 5B2EA 1DRWA 1XZLA 5PGMA 3HLTA 4KYUA 1EJ0A 4F2GA 3LLUA 5G41A 4WACA 4EATA 3GL9A 1P44A 4AJOA 5JNTA 3ORFA 1Y4AE 5LN1A 1R4MA 1QK4A 2NM0A 1U5BA 1VMIA 3MRTA 2M1ZA 2VDVE 2VYVA 2G5TA 5ELMA 4AMVA 1XLVA 2XKBA 1S8AA 3NHUA 4B79A 2G40A 2AC2A 4FYIA 3U7JA 1WTAA 2C5LA 1VFNA 4TUYA 1C9JA 4D9KA 2CLMB 1RMQA 4ISBA 5AJZA 4DWVA 4NE2A 4ZI7B 4C4XA 4QHTA 2C5FA 3KIPA 2CLHB 1E6LA 1KYTA 4F85A 2P40A 5C5EA 5G0VA 1A9YA 3H0CA 4YCAA 1BE6A 1FOEB 1Y4SA 5JBQA 2X5KO 4LGYA 1JYSA 1FS6A 3B6KA 4MV0A 3DJFA 4HGNA 1FQWA 1M34B 2QZ4A 4Q34A 3UFXB 3HYNA 3MYYA 4M8SA 4C9BA 5T6BA 4DC0A 4FQ8A 4V24A 2CFTA 1L5SA 1G3IA 3RTEA 2W6JD 2WYWA 3N28A 5JSZA 4NNJA 4FOTA 3M3PA 2AZXA 4Z9BA 1F6DA 1T24A 2B69A 1GU7A 4KZPA 4AYWA 1C29B 3L82B 4FB4A 1EZZA 2IRWA 2Q5FA 3ZQ4A 2PXHA 4KB5A 3THXB 3CN9A 5KYUA 2QY6A 4U6QA 1N8TA 2PUAA 1D2AA 3LLVA 1NZJA 3W2FA 1RXVA 2AZ4A 1BDIA 2Q4TA 1NV8A 4HNSA 1TZBA 3ET4A 1IYZA 3EUFA 3U3OA 4ZGWA 1AM4D 5CDHA 1DEKA 1LI7A 5FFNA 3A1SA 2HYDA 3M9WA 4ZHQB 1QIMA 3OIVA 4PLTA 4WK4B 5LZ4A 1HE5A 3GPLA 2A57A 4Y9UA 1IUOA 3O2QB 4NZ9A 5HG0A 4NH4A 1KOFA 3L8FA 2ODQA 3OX2A 3OZDA 2WIAA 3II6X 2GJ8A 4UBOA 4JHLA 2X76A 2ZR8A 3B1WA 2P8SA 4JROA 1RHUA 1FXWA 4R54A 3RRBA 4XCVA 2VZ9A 2W37A 3WOVA 4TYWA 2A9OA 1Z15A 3AZPA 4RIEA 2J31A 4RBNA 1R3DA 2UUCB 1THMA 3JATB 5AWFC 4AUEA 6CHYA 1RRFA 4BNXA 3I9V1 1IOWA 2REXB 2PKCA 4C0LA 2OCGA 3WK6A 1EIZA 2FN4A 3IAS1 5A0VA 1JTVA 1S2MA 4JHXA 1T1JA 3DZJA 1YS2X 2BISA 2IYSA 1YZNA 3BREA 3E9NA 3O8OA 4FCWA 1FUUA 4FI3C 3QTTA 5CPBA 4CCYA 2GKSA 2HA5A 4INJA 4V0QA 4E33A 4ZAWA 4WBNB 3B5IA 3UMGA 3ZCUA 3QZUA 2I2CA 4RY0A 1Q84A 3ZVLA 1RRMA 3GLIA 3ONVA 3ZGNA 1OC4A 3BL5A 1K5HA 1LBQA 2JHCA 2QLTA 5H83A 1T29A 4FLFA 5LOVF 3KV3O 4WJLA 1QX4A 4EO9A 1Z4LA 2Z43A 2XOKD 2C7BA 3KPYA 5JISA 3IVAA 4LJAA 3AR2A 2R7NA 2ID7A 1L8AA 3GCGA 3R9WA 2DT8A 1GGJA 2D3TA 2IDKA 4HB3A 2QQ5A 4IOLA 5DHSA 4RHCA 3KQVA 3PNLA 1ZVQA 5K51A 3AU8A 4Y6QA 4CR6A 4Q6WA 1QJ4A 4TYMA 2JFQA 4ZYXA 4C22A 5CCXA 3PGA1 4NJMB 1AUVA 2IEZA 1P2BA 4C6TB 3KJHA 1LQ2A 2C92A 2GEVA 2PFGA 3QF4A 1RM0A 2WIKA 4FMCF 3PGVA 4Q4HA 4DN6A 3KAPA 2ROQA 4RTRA 1KQPA 2XGGA 5JIBA 1FP4A 2O8BA 1IK6A 3IR7A 3SMVA 2VYVD 2FPXA 3IB3A 5B1HA 1QF7A 4JBYA 4IUYA 3AVUA 2YWCA 4J0EA 3LWBA 3DV0A 4XH9B 1NPYA 3OE4A 2BGRA 2YOHA 3P7MA 1DTWA 3U31A 4BAGA 4OATA 5DBHX 1XZGA 2JPDA 2QENA 4N47A 2EBHX 4FVTA 2WIGA 3B78A 4Y2QA 3RPEA 4DABA 4UBLA 2BELA 2R44A 1Z2EA 4KGDA 4MVJM 4RVDA 4HEA1 4OU5A 1CP2A 2HTFA 1U3GA 3LDUA 4DDUA 2ADOA 2Z9CA 4QBGB 4RZQA 1HRKA 4BQOA 1Y98A 4YH1A 3EEQA 2QSJA 2X2PA 4OVKA 2N42A 3VUFA 2XKAA 3KEQA 1XLWA 1JR4A 2PIDA 3ABIA 4N5LA 4I55F 4DYHA 5CNKA 2QD5A 2Y67A 4Y98A 2WJAA 1TTPB 4Q93A 1PSWA 1VOTA 1TJ4A 4TKVB 2Q6IA 1A4UA 1I24A 1XA0A 2H0QA 5ALIA 2DKFA 2E18A 3B1XA 5EPUA 2QLNA 5TIIA 3GFVA 2GJ4A 2D8MA 5CMLA 3C39A 3RIMA 4BP1A 1WMEA 4ITRC 1OWNA 4NDAA 5FQNA 4AVYA 4UZSA 2MINB 4AXBA 2AN4A 4NBUA 5AKKA 1I3MA 2AFHE 4MR7B 3BEOA 5I4KA 4MVJG 1EDZA 1Y8QA 3JQ9C 4NAHA 3MWDA 3ZDCA 2TS1A 1UBRS 1BFUA 1GPKA 1XD2A 3BH0A 3L7KA 3Q98A 4BZXA 1VL6A 5MFZA 1W36B 2FUG1 2E21A 4GNKA 2O5RA 1FNSA 3OF3A 5F1YA 1F3LA 1PUIA 1AUOA 2Q1WA 5CLQA 5K9ZA 3NCTA 3AJ8A 4RQUA 5FBKA 2ZBEA 4KOEC 4ZT4A 3COVA 3RTCA 4BWFB 4KWTA 3R7LA 4P1ZA 3T4XA 2BEUB 2YVAA 4CCWA 3IKJA 2PKQO 5K3SA 3CW2A 5J59A 1RCFA 5A06A 4KWCA 4YJ2B 4ZC1A 4QU5A 4IIXA 3VA7A 1TK9A 3EF0A 4KVGA 2RH4A 1IQRA 1B16A 3DOCA 3QU5A 4CMAA 2LDXA 1JQ5A 4FOSA 5L7WA 4RULA 1GEGA 5I9BA 4J91A 2XH8A 4YRRA 3D8BA 5JALA 3HBMA 5EIBC 2XWBF 4LECA 4OF4A 4BVLA 3UC5A 5CXXA 1G60A 3U7GA 1XFAA 3KXKA 5JROA 2I4TA 1ZAYA 1DT5A 3KOXA 4DDMA 2NPOA 3JWPA 5BYAA 5M2QA 3TWOA 1C7EA 3M49A 3V4RA 3AHJA 3H5NA 4DUGA 4EWLA 4AECA 1TD1A 3IHWA 4S1NA 1P2DA 1NF2A 2EFGA 3HDJA 2Z5GA 4HEHA 1DG1G 3GNQA 4D8WA 5HVNA 3WTCA 4C4AA 1QE3A 5EJFA 1E9EA 5G3ZA 4AO6A 2D0DA 5KOYA 4JC0A 2IHKA 4XVUA 3FGPA 4M1OA 4TM7A 5DKFA 1O1YA 3V8BA 1RKXA 3WO1A 3PD1A 2SHKA 1W6UA 1VG1A 5A3JA 2JA2A 1LFAA 2VZ0A 3ETEA 4FFRA 3H17A 5AD1A 4FPXA 3SZRA 1SR8A 4LY0A 4JASB 1ZICA 1FW6A 3SXJA 1RPAA 4JDUA 1L5HB 4EW1A 4BB9A 1NULA 4OFXA 1O77A 3IKLA 2XKKA 4DLAA 2Z2IA 2MYNA 1RQLA 2XF8A 1UBUS 3AHEA 4MB2A 2B61A 5CB4A 1TAUA 1HUQA 2EL9A 4DJFC 2XECA 2EKBA 4AZ3A 1TEVA 1L5GB 4DLVA 2BGMA 3U48A 4FE3A 3DE2X 1ZI9A 4K81B 4M49A 3TCKA 1GDTA 1AUPA 1C1HA 1FP1D 1VKRA 3X1KA 3I12A 1C50A 1UBJS 2DUNA 3E3LA 5DYNA 1QAOA 3KKZA 1N6LA 1F06A 1TMOA 1X87A 3OCXA 5D5PA 1UODA 1P6QA 2XAUA 2FW8A 2GWRA 1KO8A 4GSLA 4KLNA 4MWCA 4RUKA 4OCZA 5FT9A 3G17A 2R96A 1O0BA 3VHXA 2COKA 2D06A 2P0AA 4FMPA 4XIGS 4B09A 4EKNB 4EJFA 2QSYA 3H6HA 1JEJA 4F96A 1YE5A 1DV2A 1DTSA 1OXKB 2GK4A 5DEOA 4DARA 1U2QA 1H2HA 1R4NB 3SIWA 3UCXA 7GPBA 3PDWA 3LL7A 4IZOA 5J2UA 1Z7WA 2ENWA 3FKSD 3R3XA 1I4OA 4D74A 3U7HB 2GLTA 3Q2OA 2AG5A 3QEAZ 3WJ7A 2J33A 3H5WA 3TL3A 5BVHB 3MJHA 2KX7A 3L43A 1WDWB 2QU7A 3EGXB 4LE2A 3AMVA 2B7CA 2X4IA 4H4CA 4JUDX 4K9OA 4UBKA 4YALA 4E09A 1KMHB 3GROA 3LUGA 3TFWA 3LX6A 5JLAA 5AUNB 3UK0A 1PK8A 4UUPA 4C88A 3AUTA 5FNVB 1ORTA 1NATA 2WJHA 3EAGA 3CPSA 1GTJ1 4NBRA 5K8UA 2PJZA 3H19A 3DFFA 4PW0A 1KJ8A 1MQAA 5FV7A 3SQXA 3GFGA 3FZGA 4IJVA 5FOSA 4AJEA 2WHEA 4R2KA 6ADHA 1T1EA 1QR6A 2O2HA 3H11B 2QGNA 1JBQA 1H0RA 1W581 3GLSA 3L7AA 1U1DA 5EUBA 5FB3A 5JAOA 1KDRA 5FF9A 2YH2A 5KS2A 1JHXA 2X5NA 3PK0A 1DOHA 1Z0KA 2BBWA 4OHPA 4EVIA 1JG1A 1WG8A 1YRWA 1G7RA 1WXEA 2HIHA 2Q2VA 3CUUA 1L1RA 4PLWA 5GMOA 5J63A 3TLXA 5JO9A 4MS4A 1SFRA 5J2TB 4CN8A 5EJMA 4KE9A 1AT1A 3SZGA 1J24A 3V7UA 5JCJD 1XAHA 3HXLA 5A0FA 2NXWA 3WL5A 4EL0A 3R40A 1WKVA 2YFQA 4OQXA 2AFHA 2JH9A 2B1JA 4G8DA 5U9CA 1ZA2A 1L4NA 1KC1A 1QZTA 1FVHA 2OXCA 4GEGA 2WZCA 1X2BA 4RIIA 4PQGA 2JFUA 4IVRA 4C4SA 1L6RA 4DUGD 4ZYWA 2BFCA 3CUWA 4EKYA 2WQ7A 1VL1A 3WB9A 1H4VB 1ZK1A 1A5TA 4FINA 4G24A 1KERA 3KR9A 1IZZA 3QXSA 3KWMA 3DC2A 3ZY4A 4L9RA 2H0AA 3PFBA 5GWXA 2Z95A 5HS4A 5AOVA 1H1TA 2QLLA 4JUAA 5CT6A 1M6WA 1QAQA 1NI5A 2J9FA 3ZOKA 1NF3A 2J45A 2LTAA 1VECA 2YMQA 3MWGA 3QV2A 5AVYA 3L6OO 4LHSA 2UYHA 5KDDA 3I5XA 1DBQA 2WUFA 4YK7A 1PT9A 3K9GA 4AS1A 5TDHA 2HDNB 2R6ZA 1T0PA 4NVRA 5HCUA 1JHYA 3BSFA 1TQ8A 5AW5A 5HQJA 2IUUA 2QD4A 4YQEA 4Y1FA 2H51A 3GC6A 3HNOA 3V2HA 4PINA 5CDUA 2H16A 2JGJA 2I3ZA 1W59A 3Q5DA 4KQWA 4B85A 4RSHA 5KREA 2HIMA 3F6EX 5KYNA 3ICQB 2GHQA 2QRVA 1DJNA 4L75A 4N5NA 3RJ9A 4QNNA 2DHQA 3AFOA 4WN9B 3TSOA 1U80A 4LCJA 3ZBUA 3BMCB 4HH0A 4EMBA 2NVBA 1Z63A 9ABPA 4C14A 1MO6A 1SHKA 3KKLA 1CK4A 4NNOA 2CMKA 1WLSA 1Y7LA 1J70A 3CRVA 5JDCC 2I2XB 5BW6B 4HYEA 4WKGA 4EVQA 1ADFA 3TLMA 3RAEC 4ZYTA 3N8KA 4JLAA 3PXDA 3ADKA 1AV6A 3IBCA 2IYNA 2AYZA 1UQTA 2WMYA 1B15A 1F2UB 2GHTA 5TR9A 2DTEA 3VTZA 1V8ZA 3R20A 2QL9A 4QPDA 3GR6A 5KCZA 1LV7A 3QQPA 2YKGA 2B0CA 3HXTA 2E1PA 1OJ7A 1U28C 1T13A 3DA8A 1R8JA 2OEPA 1V6CA 1IAVA 1Q7BA 2O1WA 4N9WA 4EA8A 5JSFA 3A4NA 3ZU5A 3HU5A 3ME5A 3ZW8A 3OEHA 2PMWB 4QDOA 5JW6A 2GJ9A 5IVDA 4HPJB 1UZUA 1EWYA 2J0SA 2PRSA 1P19A 4BEVA 5I7UA 2XGMA 3DDOA 3JXEA 1WL8A 3FOWA 4HX9A 5A9TA 3C6MA 1FLDA 2NP6A 4B35A 3ELWA 4X3OA 2BDTA 4AICA 2WHYA 1ESCA 4A8TA 3IERA 1FTWA 1UJ4A 4FGJA 3NIGB 5INTA 1L6IA 1OX5A 4J3FA 3SDBA 4NONA 4JJZA 4V0KA 2G7ZA 3QUBA 1ACLA 4Q82A 2ENUA 1KHHA 4G8BA 4OM8A 3NHRA 4ZAYA 4DQ0A 4OHBA 5AUPB 4M1YA 2DH5A 4A8PA 1EJ6A 4D1YA 1SBZA 1JHVA 1M2GA 3ZY2A 4BVFA 1GARA 1NFRA 3WTBA 3WADA 2JCSA 2JIQA 2F9MA 4WADA 1FYEA 3FIJA 1YUBA 4CTOA 4NABA 1UWVA 3VOBA 3Q72A 4QQRA 4B6FA 5DWDA 1VBKA 4IBOA 3ZHOA 5DI9A 1HFEL 4A6DA 1AJEA 5B7GA 1GL9B 4BFTA 3C6BA 4L3WA 5K0GA 2LZ0A 4RWZA 2JL1A 2OAEA 2ZCUA 2A5YB 2FSIA 5GOZA 3VI3B 3B38A 4AJJA 3WBFA 2CK3D 1XMSA 1WHTB 3ZWMA 1E7QA 1CVRA 1NFQA 5CLGA 1NPDA 1WY7A 2P6NA 3QVJA 5SV2A 2DLDA 3SS8A 3HM9A 1IY9A 5EIBD 1GXSB 4MQ6A 5HKKA 2DKOA 1NW9B 1QPBA 1NY5A 2J67A 3HDTA 3N7UA 4ZREA 5B7NA 3DM9B 3NIWA 4RJLA 2UVPA 4HAXA 3RRJA 1S01A 2FETA 5F3WB 1ZBDA 1HPLA 1TCAA 2YCBA 5ES3A 1E3TA 1SHTX 1SK8A 4JVOA 2ZB4A 4OG2A 1WBDA 2CKDA 1XXHB 1F3OA 2CF5A 2D2EA 3OKCA 4K6FA 4CIDA 2NUBA 2GVZC 1WS6A 3CC8A 4O2BF 3BG5A 1PFVA 2BH9A 5ADWA 1WP9A 3BB1A 1DKRA 4GOMD 3ICOA 4G1FA 4CIBA 3NDRA 3SEZA 3LSTA 4II2A 4D02A 2EIXA 1UQRA 5CLLA 4UHBA 1RAHA 3T7TA 2A94A 2JGLA 4FWBA 4G5GA 4IH9A 1QU2A 1Z12A 1RAEA 4YJGA 4E2ZA 5LMCA 2C4TA 1EZ1A 2Q8QA 3NBMA 4HQFA 4L57A 3PEVA 4WCVA 4D4GA 1IZ0A 1GV0A 2ONCA 1PDVA 3D8TA 2BMVA 4L0CA 2IHJA 2VCEA 4OJTA 4D6PA 2R0QC 2Z2XA 1SBTA 2HNBA 2VDUE 3HCAA 3VH4A 1J90A 1PX2A 4LY6A 2XB4A 5IXJA 1XG5A 2FEMA 3OICA 3QYAA 3RE1A 5FBQB 3QVOA 1PT6A 5ARCA 1SH7A 2PQ6A 1Y4ZA 5CT4A 1EM8B 1A98A 3KD3A 2WKSA 5I9MA 3GEMA 3BDIA 4TWJA 2OHJA 2Y1CA 3DH0A 3L05A 1SCNE 2HWYA 5CA0A 1ZN9A 5CD9A 2WNIA 4JUBA 5BNIA 2NZXA 5THQA 3EXG1 3OPYI 1ZW1A 2NQ2C 3QJYA 2ODPA 5SZHB 1TMGE 3ZCPA 2WU1A 2IYYA 3D4OA 1L5KA 1OA0A 5F1OA 1U99A 5JAPA 1NQVA 1CUWA 1JPJA 1EUZA 3PR1A 3SQNA 1BKDR 3M2PA 5E6SB 2E82A 1H2EA 1A9XA 2NT4A 1X1BA 1XAJA 1MTOA 5IP5A 2F3PA 4G01B 4JYBA 3I23A 4MUYA 5EUQB 2P67A 3DTVB 1U4NA 2JGFA 4FFBA 2RHDA 4QPNA 4Z51A 5AW3A 2QN6A 1G1MA 2I3GA 2FJUA 3H83A 3IEKA 3DZGA 4WY8A 5D3MB 4BPRA 1WCYA 5ICFA 4CF7A 4CT0A 2JIOA 2NT3A 2R6JA 1CZKA 521PA 2VP9A 2JJYA 2DCUA 2FK7A 1RE1A 4LRSB 4BATA 4RKWA 4EYGA 3H7AA 3IPAA 1TW2A 3TRDA 4RZHA 3GGGA 3ZI7A 1PVOA 1JYEA 2HL6A 4G4SO 1V7QA 5IT0A 1TYDE 2HT6A 2V55B 4IIDA 1V7ZA 3HH8A 1XF9A 1E6WA 3BMQB 4Z3OA 2WAOA 3CF4A 2VBGA 3G8BA 3GPBA 1GFZA 1VSBA 3M89A 1DLJA 2LDBA 3ICPA 5FWNA 3AR8A 3NRBA 1EVEA 2B25A 4MTLA 4AYTA 3MQ2A 1T8RA 4G0OA 4BC1A 3DT9A 3RFVA 3GU3A 1Y6FA 2ONZA 4KXUA 3T7SA 2YIVX 4B1FA 2YIDA 4Q24A 2C9YA 1HMYA 1SUIA 3UATA 4DIKA 3F5QA 3P27A 3SLGA 3BFPA 4B44A 4LGVA 1XCMA 2IC5A 1R7RA 2XB6A 4URFA 4B75A 4D0SA 3HKBA 1KDZA 1P4HA 1YE3A 2BFMA 2ZRKA 3NDJA 3CZQA 4O4JF 4R7ZA 1SWWA 2VCYA 4J1TA 5CM9C 4IV5A 2DPYA 5CM8B 3U4GA 2WT8A 4KO2S 1TKRA 1TXGA 1ZNXA 3FMOB 4CKWB 2CGEA 4LXHA 1OZAA 3AW9A 1N9ZA 1ZOOA 2ZYUX 1YBVA 3WIVA 2Z83A 4KN5A 5JJIA 3QBDA 4P58A 5A03A 5DN9A 3PQ2A 1D5WA 4LNAA 4S2EA 3A3PA 2ZVDA 4TWAA 4FJ0A 5AUQA 3C45A 3DOOA 5KUTA 5MF6A 5DLQC 3IT2A 3M5DA 2IXTA 1AMUA 2HYIC 1UBGA 1AKQA 2FPUA 2SKEA 4WZBB 3K8OE 3EG5A 3LZCA 1OUMA 3BILA 4ZTZB 4QWWA 5HKBA 3AOGA 1HXHA 1XCGB 4KR9A 5E9WA 5B4TA 4CEJB 1RRKA 1Z0ZA 2DWQA 3O4RA 3TTWA 5ENDA 5CA1F 4NXMB 3RF6A 2CNOA 1YTUA 4FMDB 1OZFA 1X7WB 3OF2A 3V6MA 4F2PA 1ND6A 5C5IA 5IZ4A 4ZQEA 1LK0A 3P19A 4WJKB 2Y1XA 1BRMA 5DCUA 4YXWA 3AHFA 2I6QA 4C06A 2FPIA 1XKTA 4L9AA 1OTYA 2ODTX 1GCIA 1QU3A 3SYTA 4MKFA 1KYQA 1O89A 2JHGA 1PT8A 3BIOA 3RS2A 1NYLA 1ZUNB 4JCOA 5JDIC 5MGNA 2R8RA 1Z0IA 2XW6A 1OFVA 3GHHA 3SHTA 1V48A 3I61A 4BV3A 1K6MA 5HYVA 2FWNA 3VPXA 2C4KA 4DRXB 1RIFA 1IN4A 2FMIA 3MWEA 2RJ3A 4EUSA 4ZK6A 2H8KA 1ZH6A 2XEXA 2ZSEA 2V7TA 2W6CX 3EVGA 3GW8A 5I9SA 3WLEA 3NYIA 2WOJA 2DQZA 4HTFA 4LXUA 4MITA 1EXMA 3OZUA 4RA9B 2XB2A 1X94A 2GBGA 1U7TA 4Y2XA 5KTNA 3PPYA 2GKOA 3WKBA 5IBQA 1OV4A 3P5SA 3E1GA 5AHOA 4WK2B 1J49A 3KPVA 1Y6GA 4IMJB 4BNGA 1IZ7A 1XLUA 1P3DA 2RGEA 5EJ4A 1N8KA 3DQQA 2Y0EA 3H97A 1AQUA 2X8LA 3A37A 3D6AA 1CB7A 1ILWA 1N0VC 4FNMA 1ZN2A 4TV8B 5K5EA 2VF5X 3DZKA 5G1PA 2E4XA 4C7JA 3NB0A 2C5SA 5A2GA 2PUHA 2CHEA 3ZIUA 5T7BA 2NYVA 2JLUA 2PLRA 2VUIB 3OM9A 2B82A 4H7KA 1U2EA 3P2JA 5G0SA 4HNTA 1PDWA 4OGGA 3KYJB 4LJYA 4ZI7F 5I47A 1DHRA 4W5OA 2MU1A 5SYAA 1GKUB 1RRVA 4OGFA 4CV3A 3D2BA 2QE7A 3G5MA 3K16A 4KYIB 4NQRA 2GI4A 2Q21A 1KVRA 4AMUA 1YJBA 2C2OA 1CZOA 4GOLD 1ML4A 2C9CA 3LUKA 4AY4A 1Q7RA 4BGIA 1P5JA 3WO0A 2V0CA 2H4FA 3AVXA 3FYDA 2XXJA 3K0BA 3FR8A 2XUPA 3NHFA 4GU5A 4I9FA 1XIVA 1OGIA 3RU2A 5J4KA 1KU0A 1WSDA 3HM2A 4CIXA 3NHBA 4QOJA 1JLKA 1QDEA 3AF4A 1GPLA 2XGJA 2QXUA 3LI2A 2ZI4A 1LLDA 1X86B 1R6AA 2OBFA 1HT2E 2H2DA 5TPWA 1YZTA 4EG1A 5DLDA 1CQJA 1Z83A 3TOCA 3M0EA 4H6WA 3ITNA 1OGJA 4RD0A 1Y1RA 3SR4A 5A4IS 1U7DA 2PU5A 1CYDA 3JW8A 5H4GA 3ROPA 4JOQA 5AVSA 1XDUA 5K8LA 4S0XA 1ZR2A 1QVZA 3D7SA 1DRUA 4LOAA 2NTYC 4IKPA 4QFDA 3GFSA 1QTQA 4YRNA 2JEZA 2XTMA 2X5JO 1ATZA 3AB8A 4ZHQF 1VL8A 3LA6A 3WFIA 1RJFA 3I45A 4UARA 4PZPA 4CEHA 4MYHA 1U7PA 3E9YA 2BM8A 3N2GA 4QECA 3UOWA 4DCPA 3VR5D 3I62A 4KK4A 3KZVA 1UKAA 1EFDN 1XEWY 3RU9A 1Z4JA 3OCZA 4JA2A 2D1YA 2J0UB 2ZI9A 4V1CA 2HT1A 4QGHA 3I5MA 3EGIA 3W4KA 4CM4A 3NKVA 5U1PA 4TMKA 3EXEB 4FP9A 4DLNA 4DNPA 3M9LA 1SUWA 1T3GA 1WXXA 2KLHA 1H2AS 2X14A 3OPYA 5HE8A 2NW6A 4OL0A 5JYDA 1GGMA 4LJ7A 1H0KA 5ALJA 2HHJA 2ZTLA 1H3EA 2AXNA 1FX0A 2Z4TA 4QC2A 4WBNF 3D0KA 1YCHA 1FDWA 1HDZA 1GTSA 1Z5PA 1YCFA 3NNDA 4Y6LA 3CKYA 1Q7EA 2HMSA 1MB2A 1XA4A 3K1TA 4GI2A 3T1QA 4KR2A 1I36A 2XD9A 3B9RA 3MMPA 1JBEA 3PUHA 1BGWA 1DAGA 1RMTA 2VP4A 3DNMA 2H18A 2RMKA 3JAKA 1PEAA 3K8QA 4CG3A 3HVJA 4PLFA 2XNDD 2BAGA 4I5EA 4TSRA 4G26A 2EFDB 4NMLA 5A7HA 1HYHA 1EX9A 2IIPA 3HUTA 1RXYA 4OI2A 3C41J 4C29A 4B3JA 4XWKA 5C1OA 4R1QA 3K0FB 1CR1A 1P0CA 5G0TA 3GJ3A 4OGWA 1QKIA 5TJ9A 1ZIDA 4B7UA 2IOYA 4BNDA 4A15A 4D8XA 4WFIA 1SQFA 3Q3GE 4FOPA 1XB2A 3OZCA 3QEMA 1E2IA 4TM8A 3VHRA 4BNNA 3VR4D 4EM6A 1L7NA 2ZT5A 1I30A 1L1QA 4UUNA 4G0ZA 2DH6A 2B6NA 3SC2A 5I3ZA 3CO0S 3HN2A 4I55A 1NVWQ 4RC9A 3SXPA 4EF6A 2OGTA 1JIKA 1HKHA 3K32A 2R00A 3LF1A 4ZOQI 1U5CA 3NVDA 1DC4A 5BNFA 2XBLA 5CP8A 3DE0X 2B1IA 2D3WA 4QGSA 4NYJQ 3FN4A 3RKSA 1NRXA 4H7HA 1GUDA 5E0OA 1KGDA 5DN6A 4HQNA 4E31A 2H52A 2V7EA 3PXCX 5E6RA 1W96A 3NHAA 2GO7A 3EAQA 4IUDS 1Y63A 1AMOA 3RYIB 3PNMA 4Z0TA 1SUPA 2AB0A 2WPDD 1TU3A 5D5QA 2P9BA 2PGJA 1X7XA 3P0EA 1Q6YA 2FXIA 4Q7LA 3TOZA 4ZHSA 1ZMRA 3FHLA 2XPCA 1QLHA 1XRQA 3CH4B 1VLMA 1F5NA 2OCXA 4QGBA 3ZWVA 2YNMA 1ZQ9A 5G4KA 3QPDA 4EJSB 2IE8A 3LQYA 1W94A 4HQRA 4O08A 4Q7JB 4F5EA 1C41A 5FPPA 1I01A 1QB8A 5DTJA 4GX1A 2EU8A 1XT6A 1EGQA 2G1KA 2QD3A 3VNQA 1QPZA 1YS7A 2HADA 2JIZD 1A7UA 3G2KA 3WGKA 1PDOA 1WPQA 3BJEA 1N34B 2L18A 3M1IA 4G23A 2BMDA 5T4HA 5ILOA 2QTCA 4HRYA 2HOQA 1L4LA 4D9CA 2RIRA 1CR2A 3X43A 2I8CA 2OOSA 1IG3A 2Z98A 1Z5UA 4MUMA 1MQSA 2D13A 1R6VA 1IVNA 1JQDA 2H4WA 4ZU3A 1N3IA 5A04A 2V96A 3HB7A 1RC8A 3V33A 1TAQA 2PGAA 4QX6A 4WL0A 3O7WA 2A5JA 1NMXA 2DTDA 3B48A 4YJ2F 1L8LA 4WCFC 2PL1A 5TX7A 2CZCA 5LMUB 4NFYA 1B2LA 2PZLA 3HVKA 5TSDA 1SK9A 4X45A 3WL8A 4IPTA 3E9CA 2JEOA 3VVBA 1SVWA 3PEEA 1X3SA 1WY5A 4GD3Q 3QVGB 5JU6A 4RVGA 5CFRA 1G6HA 2QPLA 5DASA 3I28A 3VR0A 1NQXA 2IOFK 1VYVA 3T35A 2ACWA 1M7HA 3A6KA 3LY8A 1S2OA 1OREA 2YINC 3A1WA 1ZOLA 1CZNA 1XJCA 1T91A 1P9RA 4MV4A 4U7PB 3WYDA 3SK0A 4NR0A 1A9XB 2VTBA 2JLXA 2Y05A 4IDAA 1U1EA 4YROA 3WAJA 1UWKA 4H77A 5JXGA 3MF4A 1FUEA 2A0WA 3FKJA 1CQPA 1V3TA 4HQKA 5BRJA 1HTWA 5K4GA 2I76A 3CVVA 3QEBZ 1I80A 3GCXA 3NO4A 2J5QA 4DG5A 1IIBA 1EFPA 3FBTA