4MXDA

1.45 angstronm crystal structure of e.coli 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menh)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
255
structure length
255
Chain Sequence
SGSMILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDGFDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQRAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAMLEATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPAGVIASLAQILRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the General Base Catalysis of an alpha/beta-Hydrolase Catalytic Triad
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate syntha
total genus 99
structure length 255
sequence length 255
ec nomenclature ec 4.2.99.20: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mxdA00
5JD4A 3AIMA 5HF5A 3K9BA 3QYJA 4O08A 4U2FA 2PVSA 4OYYA 3R41A 1ISPA 3H1AA 5D3ZA 4HXFB 4F21A 5ALDA 1YCDA 1UK9A 4GWLA 2I3ZA 4ITVA 2QM0A 1CLEA 1H22A 2XQFA 5CXXA 2JIDA 2VJAA 1LLFA 4DGQA 1A7UA 3STVA 2D5LA 5CH3A 4PSDA 2YYSA 4AX4A 2XLBA 1U65A 5JD5A 5IVKA 3I1IA 1MO2A 3C8DA 4DIUA 3FYUC 3O4JA 4Y2UA 4J0GA 2QTBA 4F5ZA 2VT6A 1OXMA 3OM8A 5CH8A 1A8QA 1EDBA 3BDVA 1CPYA 5I7UA 4DMCA 4E15A 1QTIA 5AI6A 3V1KA 2XMQA 4QA9A 1GKLA 5JAHA 1E3QA 3GA7A 5AK6A 4W1QA 2WJ3A 3QPAA 5K3CA 2AJ8A 3O9VA 3C5WP 3IBTA 2VAVA 2WJ4A 1MNAA 2XUAA 1XZJA 4EY4A 2BKLA 4JNCA 1JFRA 1CUGA 2CZQA 4AZ0A 1USWA 5CRIA 2CEKA 5BWCA 4A23A 4CIBA 4X91A 5AM2A 1UK6A 5K3DA 2QJWA 2GYUA 4ZI5A 3NWOA 1UT6A 1XLWA 2O2GA 1XZBA 2RIPA 2QZPA 3S2ZA 5HFAA 2UZ0A 5YASA 3R3WA 2QRUA 2WKWA 2OAEA 2HDWA 4D9JA 4FBLA 3LLCA 4AN0A 2PU5A 3WZLA 1DINA 3FYUB 5ALJA 5HKAA 1BEZA 3DKRA 1U8EA 1SCQA 1YB6A 4DMKA 2ZYIA 5C8ZA 3D5EA 4BDTA 3BDIA 1TCCA 2HA4A 5ALQA 3R3UA 1N5MA 3V9AA 2HA0A 5LZ5A 3CN7A 3HZOA 1R4ZA 5CT4A 4TPKA 4JUIA 5AH0A 5A7GA 4C89A 4EUSA 5CTAA 3I6MA 1WCYA 4P93A 3GZJA 4BRSA 5C8VA 2WIJA 5LKRA 5HKBA 5K3EA 3EQ7A 3ZLTA 3DS8A 3KDAA 1QOZA 1L7QA 1XZDA 1YB7A 5AKLA 4J0JA 4UHFA 5HK8A 4MQLA 5AOAA 1RP1A 5ALKA 3RARA 2PUJA 2O7VA 1VXOA 5AI0A 3H2IA 1LZLA 1R9NA 4NS4A 3C45A 2QMQA 4MEBA 3TGLA 5ALHA 1EINA 5LYYA 5LZ4A 3W9UA 1EK2A 2JGFA 3PUIA 4B0PA 4AQDA 2VJCA 1AUOA 1WHSA 1FSSA 4C4XA 4MWSA 1PFQA 4U2BA 3PF9A 1JU4A 3D2AA 1QO9A 2WG0A 1XQYA 1CQZA 4K6GA 4GLBA 4OUKX 1VXRA 5K3FB 3GUUA 4X93A 1GPLA 1QIJA 2PSDA 3RLIA 4AO7A 1QIHA 3WK5A 4QZVA 4AO6A 3W2TA 3G9ZA 5AI4A 5IKXA 5AKXA 3R40A 4GHWA 5FRDA 1IMJA 5LZ9A 4EHBA 3WWOA 5FOQA 5JZ9A 4CG1A 5JASA 1UOQA 4LKOA 5T4EA 2BUBA 5H3HA 2XMRA 4H7FA 3BIXA 5EGNA 1L7AA 2XUPA 5FLKA 2CMFA 2XMSA 3IURA 5ALUA 3WL7A 2XUKA 4MWTA 1VZ2A 1DT5A 2IITA 4X71A 4UPDA 2O7RA 4ZRDA 2QKYA 3ESCA 2C7BA 3ED1A 2X76A 1CUBA 2OLEA 1UKAA 4KR0A 1MAHA 1KEZA 3D2BA 4Q3LA 5BWBA 1XRMA 4BVKA 2ES4A 3M83A 5E4YA 3AILA 2ZJFA 3G0BA 1ZOIA 3I6ZA 4EY6A 2BGRA 2QT9A 2XQJA 1BCSA 1B41A 5C8XA 5JZSA 1Z68A 1Y37A 3QPDA 2FX5A 4FLMA 1R50A 4GW3A 5LZ2A 1BROA 4EB0A 5JARA 3Q0TA 1K63A 1XKTA 5LLSA 3F98A 5JATA 5AHXA 5SYNA 1XLVA 3WK9A 2Y6UA 3KWFA 4MYDA 3JW8A 3VVMA 3WKDA 3R0VA 1CUYA 1DWOA 3AFIA 1E8DA 5DNVA 2YASA 4GI1A 2VA9A 3BE8A 5ISMA 1W6RA 2WIFA 2CUTA 4KE9A 3DL4A 1CUZA 4FFVA 2ZSHA 3TEJA 1F0PA 5CT9A 4DSAA 1H2YA 3ANSA 3DYIA 5DWDA 1CUHA 2VJDA 2I3DA 2NW6A 5JZBA 1EXWA 5JAOA 3OOSA 4Y2SA 3D59A 3CXUA 3MGAA 3WKEA 3STYA 1FFDA 2XMDA 2WHQA 1LPAB 1ZD4A 2Q0XA 3STUA 4OCZA 3H0CA 2Y2VA 1QIEA 2V98A 4G9EA 1M33A 1C7IA 1CR6A 4ZWNA 4AN1A 5DTIA 4KAAA 2HFKA 1NU6A 1C7JA 2VATA 3WLAA 5D6OA 3H2GA 1W1IA 1E5TA 5E4JA 4QLOA 3I2HA 4QDXA 1VOTA 5EIHA 2RHTA 4Y2QA 1ZD3A 3OTQA 1CUFA 4OB7A 5DNWA 5ALYA 1DWQA 1CUCA 2AXEA 2QXTA 1YSCA 4P9NA 4WY5A 1ZI6A 3IVMA 2OQVA 4UBLA 4C87A 1EH5A 1CQWA 4W1PA 1THTA 2BGNA 4KACA 4N5IX 3QITA 3GBSA 5CXUA 3HRHA 1XZAA 4J0DA 1H2XA 1VE6A 2XDWA 2J3DA 2JGIA 2HRQA 1QGED 1CFJA 2J4CA 3BXPA 2OAGA 1GGVA 4BRZA 4WDQA 1XRNA 2HU8A 3WWEA 1J2EA 3K6KA 2GYWA 3KD2A 4G8BA 3FAKA 4WFJA 1XZCA 3KSRA 1QLWA 3M3DA 1IUNA 2QXUA 4GDMA 3WK7A 3WL6A 1RWQA 2WLSA 3VJKA 2WTMA 1J1IA 4X6UA 4UBJA 3PFCA 4C4ZA 3QVMA 4H7EA 1YS1X 3PE6A 3WWDA 3WJ1A 2GYVA 4WFIA 2DHDA 1E66A 5AK3A 1QIGA 2QUBA 1FFBA 5CMLA 4FDMA 1JU3A 5JYCA 2PX6A 4KEAA 2V97A 3WIOA 2WUGA 5FPPA 2WHRA 4QLAA 5T4HA 2EDAA 4OYLA 4UUQA 3V48A 1DU4A 1CUWA 4XVCA 4NVRA 2JGJA 3WK4A 4FBMA 5LIPA 5FV4A 4BCDA 3BF8A 2WUDA 4X97A 2ZJ7A 4PSUA 2XQIA 4GECA 4K5QA 2CBGA 2IX9A 3FOBA 3R3YA 2YXPX 4X85A 2RI6A 2OGZA 4FFWA 1P0QA 2AJBA 1K5PA 4Y2RA 4X92A 2Y1KA 3HC7A 4F0JA 3LS2A 4H7IA 1GPKA 3EQ8A 4WCVA 2AJLI 4AMZA 1VJ5A 3B5EA 1ORWA 5ALNA 1EVQA 1WB4A 3FLAA 1F6WA 1I6WA 4W9RA 1ZJ4A 1YASA 5FKJA 2HU5A 1WB6A 3ZPXA 1C4XA 2CJPA 5AJHA 4B7ZA 3F8SA 4N8DA 5EI5A 3IIIA 5A2GA 1A8SA 1QE3A 2BCEA 4TVKA 3HABA 4X94A 3WJ2A 4H7JA 4UFPA 3EBLA 4MQMA 4W63A 4BTLA 1L7RA 1UKCA 4P92A 2ACEA 4H0CA 3RK4A 2XUFA 2XUDA 4CG3A 2FJ0A 5HZGA 3WL5A 5AOBA 4C6HA 1NX9A 3QZUA 3R3XA 1XQVA 3ICVA 5LZ8A 3KOOA 2JGLA 5C7YA 3Q8WA 1JJBA 5IVIA 4BZZA 4YPVA 4H18A 1ACLA 3AJAA 5ALMA 2XUJA 3BJMA 4QWMA 1IUPA 1GQRA 3H1BA 1EB9A 5FP0A 2H1IA 1EVEA 4WJLA 4V2IA 3WK6A 5I9IA 4KRYA 2OCIA 2WILA 5ALLA 4FLFA 1Q83A 1XZLA 3FYUA 2VJBA 1AGYA 1FFCA 2RGUA 4GXNA 3WQHA 4JYMA 4AZ3A 4C4YA 3N0TA 1LPSA 3HEAA 4F60A 2WTNA 1BN6A 4FNGA 4KAJA 1CUSA 5CT5A 3QPCA 1UXOA 3A2LA 1JMYA 4Y2PA 1JJFA 2G5PA 4LXHA 4C01A 3MUNA 3LP5A 4DLNA 5JAPA 5A71A 1CIJA 3A2MA 3IDAA 3AZOA 4X6YA 3VJLA 2WU4A 4L9AA 1LPMA 3WA7A 1OCEA 3VDXA 5KBYA 1CV2A 3T52A 2X8BA 4ROTA 1MAAA 2C5FA 2PSJA 2H7XA 4QWWA 1IVYA 1W4LA 1HQDA 1Q0ZA 1MX5A 1PV1A 3DQZA 4G4GA 4J0KA 1HLGA 1EB8A 4CCYB 3FSGA 1XRRA 3HXKA 4KE8A 2I78A 1FFEA 1R1DA 1QTRA 1JKMA 5KWIA 3D3NA 3EQ9A 4RPCA 4OPMA 1CVLA 3CN9A 3CCCA 2IIVA 3V1LA 3PI6A 4Q05A 2V96A 1MX1A 1ETHA 2WG1A 4YX9A 1MTZA 3IA2A 5EHZA 1CUEA 4UBKA 3ZI7A 4H7KA 1AX9A 1GKKA 5D7BA 4ZGBA 1X2EA 2JBWA 4B9AA 1AQLA 4BE9A 3I1YA 2GBCA 3FSGD 4QDZA 2WJ6A 1KU0A 3WI7A 1CUVA 1QIFA 3JYHA 3WIBA 5KWJA 5EIEA 4X95A 1HBJA 5CW2A 5AKIA 4ZV9A 1WM1A 4M0EA 1HL7A 2HA7A 3FNBA 4G8DA 4HAIA 2O2IA 4IQ4A 3C8HA 4PW0A 3WKBA 4BVLA 4PO3X 1Y7IA 4ZXFA 4S0XA 2WIDA 1SFRA 4ETWA 4BATA 3C43A 1G42A 4Y2JA 1WOMA 2XMGA 4E46A 3SK0A 2O2HA 4X6XA 4QDUA 2BJHA 5FUMA 6YASA 1DX6A 1A8UA 3TRDA 1J06A 3SWWA 2HU7A 5IVHA 1UKBA 3DEAA 3QBJA 5IH7A 2R8BA 5AKHA 3QM1A 1GXSA 1T2NA 3M82A 3F96A 4BB0A 2DCMA 1VZ3A 2OGTA 4EY5A 3ICWA 4Y7DA 4DNFA 3L1HA 2JGMA 3H2HA 1CUDA 2C0QA 4PSCA 2WU3A 1GZ7A 1VA5A 3FLBA 2AJCA 3DYVA 4PNZA 4I3FA 3ZLUA 5LZ7A 4QE3A 1IZ8A 1G4HA 3OPMA 2HM7A 5AKYA 3D0KA 3QMWA 4CCWA 3C6XA 1SCIA 3ILSA 1XRQA 4DSZA 2ACKA 3E3AA 1YAHA 1U2EA 3I6YA 4LYEA 2Z8XA 1EX9A 2WFLB 3FWHA 1E89A 3AZQA 4B80A 4UHEA 3AINA 4HVTA 1XZGA 4IHAA 3H2KA 3A2NA 5JADA 4AO8A 3PUHA 2HL6A 3DOHA 1EHYA 3DL7A 1XZFA 5HQ3A 4IH4A 3C5VA 5K3AA 3DOIA 1BRTA 1BN7A 4U2GA 1YS2X 4IH9A 1TAHA 4QNNA 1TIBA 3O9MA 5F4ZA 1A88A 4PF1A 3LIIA 4CCYA 1LBTA 2QR5A 1DQYA 1BEEA 1E8NA 4A16A 2V9ZA 4K6HA 2WSLA 2Y6VA 2H7YA 2HA3A 4H35A 1Y7HA 1MPXA 1R9MA 4ZV7A 3NOXA 2XMCA 3W05A 2JGKA 2GBGA 2R11A 3I28A 5KREA 1HDEA 4UFNA 3DJYA 3BWXA 4J0IA 4Q3OA 3EF3A 4Q1VA 1CUAA 5AKKA 2B61A 3IB3A 2OCGA 3U0VA 4Z49A 1LPOA 4I19A 5FDFA 1TCAA 3IUJA 4KE7A 1JT2A 2XQKA 5AKGA 5EFZA 1AZWA 4WDRA 4CG2A 1O6GA 2YH2A 1UZAA 5AK4A 2JEYA 1YAJA 1EI9A 2GZSA 5CH5A 1O6FA 5AI5A 5ALOA 2ORYA 2ZSIA 1SC9A 2G4LA 2WFZA 2WIKA 1B6GA 2WUEA 3EIOA 4UHBA 4E11A 4G9GA 3G8YA 3H19A 4X3CA 4DNPA 5K3BA 2OQIA 4MEAA 2DHCA 3WZMA 4E14A 1J07A 1THGA 4K6KA 3BL8A 2VAXA 2JGEA 3PDCA 4ARBA 4EBBA 4I4CA 5J3JA 4GEGA 4FMPA 5ALSA 5ALXA 1EK1A 1MX9A 3HSSA 3F97A 4DNOA 5DYYA 3GFFA 4YK7A 1FFAA 3HACA 2EEPA 3WYNA 5FXMA 1F0NA 4PV7A 4ARAA 3S8YA 4B82A 1WPXA 5DYTA 3IUQA 4LIPD 5CT6A 3STTA 1W76A 5AM5A 1LPPA 5AOCA 2Z3WA 4RE6A 4J0HA 3FVTA 4QDOA 4XWGA 2XE4A 4U2CA 3D4LA 2VT7A 2PUHA 1RYYA 1W52X 3GELA 4OU5A 4G8CA 4MJ3A 1CEXA 2OCKA 3L1IA 1LGYA 1MN6A 3BJRA 4BYMA 4LXGA 2XMBA 4XIIA 3PFBA 2WUFA 1PJAA 2HA6A 4P08A 3BF7A 3TJMA 5D3KA 4B9EA 1QIDA 3FYTA 1XLUA 2QOEA 3WL8A 1QJ4A 1QIKA 2RHWA 1JJIA 3HI4A 2EDCA 2CB9A 3O95A 3M81A 4OB8A 2W22A 2X5XA 1JI3A 1IZ7A 4RGYA 5C81A 3QH4A 2XUGA 2ZYSA 2VEOA 4B85A 3OC0A 1F8UA 4U2DA 4OD0A 3HJUA 1UFOA 3G0DA 3KXPA 1TQHA 4UHCA 4EZIA 4TGLA 2VQ6A 2HRRA 4X90A 5ALZA 4QEKA 2WHPA 4WY8A 5JANA 3DNMA 2XLCA 3WKAA 2HA5A 4X7BA 4G4JA 2OCLA 3C6BA 1HKHA 3FCXA 3C87A 3G7NA 2OPHA 1P0PA 1X70A 1WB5A 3I2JA 4L3WA 5IVDA 1ODSA 3O4HA 3GROA 1XZMA 4DYHA 4HTAA 2K2QB 4KAFA 4B0OA 1S8OA 3DKKA 3X3HA 1N8SA 1U4NA 4AMYA 1CUUA 4EA6A 2BUAA 3W06A 2PM8A 4HXGA 4DNQA 4NZZA 4BC0A 2PBLA 1TK3A 2QUAA 4UBOA 4BP8A 1FJ2A 1YA4A 1LPNA 2DFPA 1UK8A 5AIAA 4EY7A 2OXEA 4LYDA 3N2ZB 2OG1A 1XQXA 3VXKA 1OILA 3V1MA 3IUNA 1LBSA 3VISA 1AMNA 4FWBA 4H7DA 2ZYHA 5HQ3B 1CUJA 4BAUA 4K2AA 5ALIA 1ZIYA 3STXA 3G9UA 1EDEA 3PF8A 1VA4A 3DDUA 1ODTC 1XRLA 2PSHA 4JYPA 5ALTA 2AJDA 4UHDA 2C0PA 3SC2A 3ESBA 3WWCA 5K5EA 1BS9A 3WA6A 3G02A 4KJXA 1WPRA 4QDTA 4BVJA 4IH1A 1R3DA 1MJ5A 1R88A 1X2BA 2Y2UA 3L1JA 5JIBA 5CURA 2H9YA 1QIIA 1TRHA 1SCKA 2C58A 2WQZA 5ALWA 4G1FA 1K4YA 4BC1A 4HS9A 4LHEA 4Y2YA 4DM7A 3RM3A 4BP9A 4MXDA 2ZYRA 1ZGBA 5EHXA 4BTVA 1BE0A 2VF2A 4X00A 1QFMA 5T4FA 3F9CA 1WHTA 3I2FA 5T4BA 3QMMA 3B3QA 2C5GA 2DQZA 5JD6A 1K8QA 4U2EA 2DHEA 2HA2A 1ACJA 1CUXA 1UWCA 4FOLA 3NUZA 4AB1A 1LZKA 3E1GA 1H2WA 1VKHA 2XMZA 5HF6A 3ZV7A 3UMJA 4OB6A 1QZ3A 5ALRA 4A5SA 3ESDA 1YR2A 3YASA 3G0IA 4W1RA 2BUCA 3E0XA 1Q0RA 1GT6A 2B9VA 1UOPA 2ZVDA 5DLPA 4DMHA 5AK5A 2HIHA 4UFOA 3CCBA 4MYSA 5AICA 5AIBA 1CUIA 1ZGCA 1DX4A 1ZIXA 2WFMA 3H17A 5DJ5A 5EHQA 2Z5GA 1AC5A 5CBKA 2QJRA 5AKJA 2PL5A 2OGSA 3BIWA 4Y2XA 3H18A 4CI9A 3JWEA 1DWPA 1QIMA 1XROA 5DNUA 4YASA 5LP1A 1SOMA 1DT3A 4N5HX 2HHAA 4HRXA 1TKRA 4J7AA 4N8EA 3OURA 2PSEA 1MU0A 3FBWA 3QMVA 4DTCA 3H2JA 3PICA 5ALPA 2FJPA 4IO0A 5JAUA 2XI4A 2PPLA 3WYDA 4W1SA 1K6EA 3VJMA 3A70A 3WWPA 2I03A 3DLTA 1MT3A 3AZPA 4NMWA 2DQYA 1UOOA 1AKNA 1JMKC 3MVEA 1DTEA 3V1NA 4Q82A 4XJVA 3VKFA 4Y9SA 3HYSA 2WM2A 1ZICA 3G9XA 3LCRA 5AM1A 3HLKA 4BBZA 1W75A 4GBGA 5HF9A 3C6ZA 4XX1A 2XUIA 2XQGA 3ESAA 3AUKA 2FUKA 1N5RA 2GBFA 3LIPA 2DSNA 1IUOA 5JALA 1XFDA 5HFNA 3MUOA 3KWJA 4BDSA 5A62A 4G4IA 4B81A 4FNMA 5ALGA 4M0FA 4RE5A 3F67A 5CT8A 3RKSA 2GBIA 5FPQA 1G66A 7YASA 5AO9A 2XUHA 1AURA 3E4DA 4L72A 4FLEA 4BAGA 2CKMA 3AIKA 4JEIA 5AM0A 5DYWA 4J0CA 3ZWQA 4BZWA 2XUOA 1ZD5A 3D7RA 3STWA 4UBIA 3O4GA 1EDDA 4RNCA 1BU8A 1TCBA 1P0MA 3WMRA 1D07A 3IULA 4FTWA 5ESRA 1UK7A 3P2MA 5E4TA 4DMFA 1CRLA 1DQZA 4UHHA 2ECFA 2B4KA 4M0MA 2B20A 1BCRA 1G5FA 1ZI8A 5I8PA 1GPNA 4Y2TA 2VSQA 3G0CA 5E2IA 2QS9A 5AI8A 5DTJA 2HADA 3D2CA 1QO7A 5SYMA 3FVRA 2J4FA 3R3VA 3B12A 4J03A 4BCCA 2E3JA 3U1TA 1XZKA 1QFSA 4H7HA 1N1MA 4G5XA 3H04A 1ZD2P 3C70A 3O4IA 4B84A 3DD5A 5AM3A 1VLQA 4JH0A 5HCUA 2PKYX 2Z8ZA 3WK8A 4Q34A 1GQSA 1XZEA 5AKEA 4UBNA 4B83A 4PQEA 1VE7A 1T4MA 3DCNA 3C6YA 2G63A 4FHZA 3ANTA 3W9BA 5ALVA 2PSFA 4N8SA 1Q84A 1H23A 1KU6A 2D0DA 1XRPA 5ALEA 1YA8A 1XQWA 1ORVA 3O0DA 4CIAA 4J3JA 1ZJ5A 3NGMA 5AKZA 1HPLA 4INZA 4BE4A 2BFNA 5EHNA 5HK9A 3I2GA 2XT0A 3R3ZA 3K2IA 2RAUA 4B6GA 5BOVA 4OSEA 5HF8A 2XB6A 4UBMA 4KYVA 4OU4A 5EIAA 3UUEA 2HFJA 5LKAA 3VVLA 2BAGA 5AM4A 2PU7A 3G0GA 5A7FA 3I2IA 2WIGA 1XKLA 4WFKA 1XZHA 2WHPB 1E8MA 2DR0A 2ROQA 2QVBA 3SX4A 2J3QA 2VTVA 5AI9A 5K3FA 3UUFA 4Q3KA 2LIPA 4H77A 3T4UA 1EA5A 3G9TA 4HZGA 3A6ZA 4KE6A 3FLEA 2W6CX 3W04A 5A7HA 1MNQA 5ALFA 2RONA 3AIOA 1P0IA 5AP9A 3IUMA 4BCBA 2ONCA 2JEZA 4ZREA 1H2ZA 2G5TA 1LNSA 2ZJ6A 2P8SA 2XUQA 2C4HA 1NU8A 2WFLA 2JF0A 1QONA 5BV7A 1XZIA 1LPBB 4EY8A 4C88A 5A6VA 2GZRA 2WG2A 4BAZA 3OG9A 3ZLVA 4HRYA 3I2KA 3FCYA 4Y2VA 4HXEB 4KRXA 4LXIA 2Z3ZA 4AXBA 4L0CA 4FKBA 3WKCA 1ZI9A 2H7CA 1ODCA 4CFSA
chains in the Genus database with same CATH superfamily
4E1VA 5EJ9A 5U4XA 5JD4A 4P0PB 1IN1A 3K9BA 1PJ3A 4NJMB 2JG3A 1L4UA 2C94A 4LPSA 1ULTA 4HEHA 3RROA 1JZQA 4ZICA 3JQCA 4OYYA 2PWZA 5JO0A 4NIMA 3H1AA 3H83A 1T3LA 2Q8QA 2R25B 1NVBA 3OCZA 3GFPA 4EUFA 3SPXA 3NETA 4ZA2A 1E3IA 1V8DA 3C7CB 4BWFB 5T7BA 3QYFA 1QO0D 1YCDA 3OEHD 1R0RE 1L8XA 1SO8A 3AHGA 3O84A 5EJ4A 3FWPA 1UK9A 4DZRA 1X8XA 4YBRA 1HNNA 1H1TA 2I3ZA 3GN1A 3KQNA 1BQEA 4NHEA 4KQJA 4DR1B 1NC3A 4ITVA 1C2TA 1O89A 4A8PA 1Q0UA 2TYSB 1SC6A 1BX0A 1E6CA 1FW8A 2O1XA 4DMLA 3TTSA 3U3MA 1GSAA 1ISFA 821PA 5ITVA 1EFPA 3AFHA 4MUHA 1AZLA 1GKYA 2XQFA 3KB2A 2QD5A 3PPYA 4IUYA 4ZCQA 4A0GA 3FSJX 3V2UA 1FRNA 3KJGA 3MWJA 3PT9A 4BMOB 3S8EA 4XWOA 5DF1A 2XTAA 5KJEA 1OKKD 1LLFA 1A7UA 3FDJA 2V4UA 2XD4A 4ZALA 3ZIAA 5L6MB 4DB4A 4TTSA 1QC5A 3PEUA 5CH3A 1KVUA 1EUQA 1V5GA 2XLBA 4PC3A 1U65A 1WMSA 3NHBA 1J8VA 2J46A 2WWFA 2PWAA 3RRXA 1NL3A 2CLSA 2XXJA 5REQA 4DE5A 1C3OA 1YTLA 4I9GA 4PGMA 3UAZA 4DMGA 1ZK1A 2QA5A 4NU8X 4Y2UA 2VXBA 1ECFA 2VT6A 3JYOA 2QX6A 2EW1A 3GJZA 2F9LA 3OM8A 4HUJA 4MQFA 2ZUWA 1A8QA 2IUEA 2PR2A 4G56A 4ETNA 1TW2A 4FHGA 3RTBA 5DWVA 4C03A 3EK2A 5E9AA 3VM6A 3PPWA 1DIRA 1IXZA 3SC4A 1MC8A 1JTVA 1TU0A 4NCAA 2WKQA 3SLGA 2PT9A 1X1SA 4MUKA 4G09A 5AXDA 1IBSA 1QTIA 1T9HA 2CGEA 3V1KA 3WGLA 1AV7A 1A96A 1GKLA 1WQ1R 4XQCA 1XU7A 5CLIA 4AG5A 3HCOA 1N5OX 1O2DA 3GA7A 3X1WA 5GAJA 3NDIA 2PD6A 1Z2DA 3NHJA 1Q7BA 2ONZA 5JNLA 3QP9A 5BUQA 4W1QA 1PUXA 2WJ3A 4AKIA 4FGZA 1IXKA 4YO7A 2D7JA 5EJEA 4EF6A 4WESB 2QRPA 1D1TA 3O9VA 1CJMA 1Z2AA 2EZ9A 2WJ4A 1C7EA 1X1DA 2R7LA 3M89A 3TSYA 2J6HA 4F4UA 5IASA 4QAJA 1MNAA 4CVNA 1G9SA 2FPMA 3L4BA 1Q12A 1V7ZA 2IJGX 3M33A 4V38A 4YUAA 1IOWA 4W9NA 1JEYA 2CVPA 1KO1A 1U8AA 4RPJA 4EYGA 1TK9A 4YCCA 1GG8A 1QH9A 1VKJA 2E4VA 3OQPA 5C7OO 3G8BA 1E3EA 2YS7A 2NO4A 3BFVA 4QHTA 4YVFA 3P9PA 2HT6A 4RKEA 2XOEA 1Z0JA 3EXG1 5IM4A 1NY5A 2VDLB 3UB3A 3AVQA 4QU0A 1KDPA 4YJHB 1NI5A 1HFEL 1RPTA 2GZ1A 2FEOA 3P0EA 5LMZA 2Z2JA 2XDAA 4CIBA 5KU1A 1P5FA 1KH3A 1TD9A 2CEKA 2D0IA 4WY2A 4EGSA 5JCJD 4OXIA 5IDXA 5AM2A 4TX1A 4DMMA 3PNYA 1FA9A 1ICEA 3M70A 2B82A 3E22A 4RCZA 1I5RA 1NF3A 2PT7A 3GQVA 3RJ9A 1U0JA 2QX4A 4MTCA 4M1OA 3DMFA 4R1SA 3A0RB 1Z07A 4IF6A 4YJHA 4GI5A 2QZPA 2B4RO 1M72A 3HVHA 5JDCA 3GA5A 4HB2A 2UZ0A 3PQCA 5EIFA 5FH9A 4GE3A 1PZHA 3LFUA 2QRUA 2XZDA 4HNUA 2HDWA 4GPD1 3LHDA 4CQJA 1DADA 1XEWY 1N2CA 3BKWA 4COOA 1HV8A 3IJPA 4LVCA 1KI9A 3P8ZA 4IWXA 3T1OA 4Q19A 4HDRB 2ZUUA 4LOAA 1I4EB 3C48A 1C30B 3NIDB 1KAQA 1F8YA 1T2AA 1A5TA 1YFZA 3Q3IA 4WK0B 1ELOA 1QH1A 3X1KA 5KOHB 1YB4A 3TR5A 3HCDA 4O5OA 1GQ2A 4EP1A 5KSYA 3AX6A 1N3BA 1U8EA 4DCGA 4HTFA 4KDCA 4D5GA 2J3JA 1R37A 4LF6B 1UFKA 1UPTA 2R1VA 3UC5A 3IT2A 4TL8A 1SPBS 3KUXA 1QF6A 3MTAA 2H2GA 4OAOA 3ITEA 5ICCA 1DAPA 3D5EA 2HB6A 4WPGA 1TCCA 2CFSA 2E18A 4R0MA 3M6UA 2NTVA 4IDNA 4ID3A 4DV7B 3BDAA 2MR5A 3R3UA 4KIFA 4EL5A 3QTLA 3TKYA 1GR1A 1EVIA 3HWSA 3MWEB 3EVNA 5LU9A 2XKBA 5CA1B 3B9BA 2CFRA 4BKMA 4EYOA 1TW3A 1TMKA 1SBQA 4IYJA 3T7CA 4DFDA 1TFRA 2C4MA 4EM6A 4D0SA 1R4ZA 5TE9A 4MUBA 3H9GA 4JUIA 2FPGA 2GM3A 4IJWA 4V0NA 5I7RA 1TEZA 1J97A 4J4TA 1VL6A 5AH0A 1KP3A 3VPSA 3DNPA 3HA7A 2P11A 1RWXA 4OL9A 2NVBA 4KPEC 1IY8A 4E4TA 2FSPA 5IYZF 5KSWB 4LWPA 4RW0A 5JXJA 1C3LA 4COKA 3SVLA 1UZUA 2J31A 1W0JA 4P93A 3L79A 4JJ6A 3ZCQA 4D57A 2F8MA 3P94A 3WLFA 4EELA 2NQTA 4XUDA 2OZKA 2SKEA 1UPAA 4YT2A 1CTQA 4K03A 2V6BA 3DW1X 3ITDA 3SBOA 4B3JA 5KQSA 5BWNA 1F7UA 1JXAA 4NV3A 3B78A 3ZJ4A 1WVGA 4O4IB 3BX1A 3DS8A 2UZ1A 3LI2A 3ZLTA 1AGXA 2JKZA 3TOCA 3FCUB 1UM9B 1H8EA 2VOJA 4D4MA 5JVDB 3K9FC 1DMRA 4EHFA 5AKLA 4XFDA 4OMCA 1YOBA 1MC1A 3P5SA 4MQLA 4WA8A 4ZANA 3UKJA 2FHSA 4I5EA 1RXYA 2GKSA 1U0GA 4IMIB 2PYDA 1KEEB 3OMXA 2WVHA 2DC1A 2NZVG 2YV1A 4PFJA 3REQB 4QSMA 4E2WA 3ADBA 1WD7A 3H2IA 2ZZKA 2E1RA 1LZLA 1IJKA 1Q57A 3FPLA 3BGIA 4W7HA 3SS9X 4NS4A 1WETA 3OD5A 3C45A 4LDNA 3A6KA 3CH4B 4CM4A 4L07A 4RPLA 2J30A 1TCUA 2ZBEA 5CR9A 5CDHA 5JDIA 4JQCA 1G60A 2CFCA 4WEQA 2IZ5A 3OFSA 4OLHA 5TF0A 4RIFA 1T5TA 1ZN8A 3R9XA 3N53A 1EK5A 2JGFA 3PUIA 1XVVA 4R83A 5FUWA 1ST2A 2FZLA 1L5OA 3L8DA 4B0PA 1R6TA 1KJ9A 5B5SA 1AUOA 3I64A 4B7XA 4M9SA 1FSSA 3BXHA 1TQ6A 3B1ZA 4AZTA 3F8WA 2EWVA 1XN1A 3BWBA 1R3UA 2AFRA 3WMFA 4CIWA 5KTKA 1NV8A 3LPMA 2WT9A 3W2EA 4Z3OA 2ZITA 3EGIA 3Q9UA 2AX3A 4NPAA 3ZHXA 2VR1A 4N65A 3PIRA 1JU4A 2C9CA 4OLJA 1QO9A 4D3XA 1XQYA 2AG5A 2YW9A 4JLMA 5IS2A 3DFFA 1K4KA 1NTRA 4CL2A 3PRYA 1Z22A 1F51E 3MHPA 2R3SA 1FP2A 3BUSA 4Q7EA 4RESA 1D3AA 1QIHA 4G5YA 1WUHS 3V8PA 2EBHX 4ON9A 5H4HA 3KOUA 4RIGA 4N48A 4YCDA 3JARA 2YN4A 2X0KA 1RPNA 1RPJA 5JY6A 2X77A 3TKLA 5ICEA 2V7GA 2NSDA 1XMSA 4JMPA 3PB3A 3LHFA 1FBNA 1PLJA 2GNAA 3G9ZA 4NZ9A 4KAXA 4MWEA 3I8XA 4Q93A 4AU1A 2HSGA 4X45A 3IO3A 3LXXA 1E79D 4KUEA 4CKZA 4MB0A 2CNWD 1I6KA 3PFIA 1WDWB 4JJ4A 1J9EA 4RK6A 4EHBA 3HM9A 1RS0A 1UF9A 2JAXA 5J2TB 5JYEA 3I39X 2CL7X 5DLDA 3G2IA 2VHVA 5LP6A 1J8QA 1B93A 4FC7A 1D04A 4XYGA 5EESA 1WZCA 4FEGA 4JT4A 4PPQA 1SC3A 4LKOA 1E7SA 2C2YA 4UUMA 1OXKB 2IOHA 2AN9A 1M6HA 3MCWA 2BUBA 4K9SA 4RORA 4RZHA 4Q00A 4BJ5A 4YJGA 3TRIA 1D09A 1X3SA 4YJ2F 4TVBA 1QRRA 1OYWA 2JLQA 2YHBA 4HFJA 2XHZA 1I7PA 4GPAA 2XKKA 2XUPA 3G2PA 4HD8A 2DX7A 4MARA 3ZDBA 3EBOA 3FHOA 2PUVA 2JFPA 2F9FA 2C7GA 2MMGA 1L4GA 3JCZA 4OHOA 1U4SA 1QS0B 5B6PA 1FDIA 3IQXA 4M60A 1DT5A 1TC2A 4IX9A 4X71A 3GRZA 4MW5A 4UPDA 1KZ7B 5FPTA 4ABYA 4YJ3A 1O94D 1N9KA 1WG8A 2JI6A 2QKYA 4NBSA 4PC6A 1V5WA 5SY4A 3RR2A 3RWOA 4UNSA 2XNCA 2P6RA 1ENPA 4MV9A 1TD1A 3KRTA 3ZV6A 2AI2A 1FU8A 1FLDA 2AHRA 4IDEA 1SVOA 4ZO9A 4JUAA 1E7QA 4LHVA 1KQ3A 4TZKA 4RENA 3U7JA 1D9XA 2YZNA 2ZOSA 2ZUBA 3KD3A 4WAUA 4H1WA 1ODFA 1ZLXA 2YMLA 4EMTA 5IU6A 5K8CA 4ZVSA 4NWIA 5JLJA 3I09A 1VYTA 2O7NA 4CQMA 5D1NA 3W5AA 3IVGA 3QVVA 2GA9A 1NVVR 5LXTF 1EVLA 2GHIA 1T2FA 3PQ7A 4ZHQF 3M83A 5E4YA 1WMDA 3GLKA 4U7DA 3ZD7A 3EIWA 1XEXA 1EBBA 1IEQA 3I6ZA 4DRXA 1GVNB 4D80A 1BCSA 4YCAA 2XDQA 3QWAA 4HDQB 1B41A 3A3NA 1XX6A 3EAGA 1VHJA 3OE4A 4GSLA 4Z99A 4DLZA 3OQ6A 2HLHA 2W8ZA 1D4AA 2HH9A 1LCIA 2C59A 1NI4B 1WZEA 2FX5A 2LNDA 2QIOA 3PG5A 1NVEA 2XSZD 3KHUA 1GG5A 2X8JB 5C18A 5JARA 5KVQA 3W2IA 1CB0A 4B6QA 1OA1A 1FSZA 4DEYA 2ZSUA 3Q0TA 4OREX 1P1JA 2EYQA 3FFBA 1P4AA 3CH7A 4H3VA 4MQ6A 1JQAA 1B74A 1XKTA 2P4QA 5IARA 2WB4A 3QOWA 2AEEA 3BHNA 3F98A 4PAOA 4BBPA 2JCBA 3CINA 3O0TA 1V9CA 1K7SN 2NX2A 3TJZA 5DBEX 1JA0A 1O94C 1ZJYA 2VXCA 2Y1OA 2ZTMA 1UANA 1MIHA 2DG2A 5IAOA 3RKRA 4FNOA 1GITA 4L08A 1PQ4A 4YR7A 4DV4B 3SKXA 5IDWA 3LTNC 1IQ0A 3EDYA 5CDSA 3Q40A 4E3ZA 3L40A 2PDAA 4I1VA 4MK4A 3AFIA 3MJRA 3ZXXA 2GZHA 1E8DA 1C7RA 3CPHA 3GH1A 3OJFA 4ZRNA 4QTZA 2HLNA 4Z0NA 5DNVA 4GI1A 1VI5A 4ITRC 1JEOA 1S8AA 4IIDA 2HSZA 1W6RA 2Q6TA 2WIFA 3D6UA 1JGTA 4MB2A 4O33A 2B94A 5H83A 5LDDC 3DZKA 4JEMA 3QOXA 2OR3A 3FDZB 1ECPA 2J7PD 3IDQA 4FFVA 2ZSHA 3PLNA 4LK2A 4XFKA 4ZOLA 5BN3A 2HT1A 3VKWA 4DSAA 4RV4A 4B4KA 1KMNA 2VHEA 1OH5A 4DDKA 3ANSA 4U63A 2AEMA 2GD2A 2PL9A 3AR5A 4C0KA 3GMSA 4GMKA 4AS1A 3C3CA 4PM4A 5KIAA 3W5HA 2V3VA 4URUR 5DWDA 1CUHA 4Z51A 5FFNA 2VF4X 4AIIA 1W9HA 1N4AA 2ODAA 4K7JA 3O47A 2Q4TA 3KKMA 3QPWA 4NK5A 3WY9A 1ZY2A 4O4IF 3D3KA 5E0OA 3UA3A 3W1VA 4B48A 1ZUIA 1BD3A 3G17A 2BPOA 1EXWA 1K6IA 5JAOA 3LWBA 1NFFA 3OOSA 5JQGF 4ZXPA 1OSNA 4CF6A 4CHGA 1PWYE 4K6CA 1JAYA 2IHKA 4KG7A 1DG9A 1OXUA 3MGAA 3DCYA 2YUIA 3K1JA 4KU4A 4TV9F 3PNBA 1FFDA 3STYA 2WJAA 2XMDA 1A76A 2YX1A 4PX2A 1N6NA 3OO1A 1YNOA 3RIMA 3GVXA 4P6VF 1Y9ZA 2FSIA 2O07A 4B6FA 1PK8A 1Q0HA 2XXBA 2V6GA 4EGJA 3RSFA 1QXSA 1BZYA 1AOXA 1KY5A 2EX4A 4IDDA 4P3YA 2QL6A 3Q2OA 2P1RA 3H0CA 3HP4A 3ZV4A 3T3GA 4EG7A 5JJ5A 2LCQA 2P6MA 3HBMA 1M33A 2PGJA 4X1KB 3U16A 3FOFC 2R1UA 3C3AA 2O2ZA 2ZRDA 3JQ7B 5KEIA 3DAFA 2BEUB 4CLHA 4RF4A 4MUNA 4EGAA 4AN1A 2GEVA 1TUIA 1VPTA 2ZYVX 4IZHA 4R7ZA 5ULLA 3RJZA 2R60A 3LF1A 3QTTA 5DTIA 3UIEA 2HFKA 3OAAD 4ZAWA 3V6MA 2HJGA 4QATA 2VATA 5F76A 4WKCA 3H2GA 1UODA 3Q3GE 1CXZA 4OAQA 1R27A 4OF4A 5K0JA 3KNZA 1XB2A 1E5TA 3D1VA 4LV5B 4N5MA 5E4JA 2FKAA 1SHUX 3I2HA 4QDXA 1GZUA 4O2AA 3SJ7A 1VOTA 3E2PA 3OEWA 5HNKA 4X24A 2GFQA 1P45A 4PN3A 3BT7A 2RHTA 1I7QB 4ALKA 4UCWA 4LGYA 1TMYA 1ZS9A 2C9ZA 3EF1A 3HWX1 4BN5A 4YI3A 4F8EA 3OTQA 5JECA 1FS6A 3HJGA 3ERCA 3UBMA 5DNWA 3W5SA 2QGZA 1YJXA 2AG0A 3DLAA 3MNFA 4TWBA 3JTMA 1QF7A 1J23A 4MHOA 4WY5A 2IS1A 2O19A 3IBCA 4G65A 1Y6GA 3IVMA 1OF1A 4WI1A 1EQUA 2OQVA 4ZDIA 2QIPA 5U4QA 4YDHB 2YJ3A 4JU8A 3NEYA 4OA5A 3P71T 1M2EA 2VF8A 1XVIA 2JIZD 2VNHA 3A7DA 2Z58A 5E3IA 5LWQA 4PHGA 1Q17A 3JAWB 1X0VA 4L74A 5LBUA 1OLUB 3U4QA 1Z5PA 1JHMA 1Q22A 1TEXA 5L45A 1K06A 3OX2A 4ZQIA 4DNXA 1JA9A 3K9HA 4Q1EA 2O0KA 1M74A 3UTDA 1Z0DA 1QG2A 2IXFA 4JBGA 4RWEA 5IP5A 3UQZA 2V6FA 3EZ7A 3ZLBA 4DT1A 5CK4A 1Q0SA 3WG9A 4B6JA 3GAMA 4EJ6A 2AG1A 1VE6A 5PGMA 2B1QA 4Z86A 4CQMD 1G98A 2JI9A 2PJZA 1UR5A 5LM3A 4O4JF 4U9UA 5BNWA 1SKAA 2YWCA 2I1QA 1BYIA 4GU5A 3UT6A 5KNDH 2ZBUA 3F3SA 1XRNA 2R65A 5A4IS 1J2RA 1C7QA 2AF4C 3K0SA 2EHJA 1J2EA 2QE7D 3KD2A 4G8BA 2XNJA 4X1IB 1G3RA 2IGBA 5ITWA 1U11A 2AFHA 1XZCA 4WFJA 1FL9A 5TT0A 3UQYS 5KSZA 5LR6A 2BRUC 4PC1A 4RTJA 1O77A 4XCVA 1SOVA 1ZSNA 2G07A 1RC8A 5JISA 3EUWA 1LJUA 3OUTA 3SQMA 3VC3A 5J23A 2BEKA 5FX2A 3TGPA 3B6ZA 2GHRA 2X23A 2ZEJA 5TJHA 2P3OA 3E5HA 1V7PC 2OCAA 3WL6A 1A82A 3KSMA 4LOKA 1MJGM 2I3BA 2BP7B 3VJKA 3U5TA 3ZE6A 1J1IA 2JFQA 4UEJA 3RS2A 4UBJA 3CWZA 4C4ZA 1FUUA 1BWQA 1N9GB 1PGQA 2E2WA 1T43A 4LWQA 2Q27A 1EFKA 3EMKA 4H6WA 4GZ5A 2JLZA 4DF3A 5CLHA 1WS6A 2DHQA 2VQFB 2D7CA 3WWDA 1ZAKA 1PJ8A 3MA0A 2HREA 2DHDA 5HP4A 1PGPA 3P2YA 1IN8A 2YXEA 3PX2A 5AK3A 4XA8A 4XX0B 3WE7A 2P4UA 4FHCA 2QXYA 4UATA 5JYCA 4LNUA 5EWLB 3RT7A 3KWLA 3FXAA 3AW8A 5IHPA 2DPMA 3K0FA 1VPVA 4JBLA 2B83A 4YRLA 4BV9A 5IHXA 1MEEA 4Q3NA 3WIOA 3V7YA 4YRCA 4KX5A 4MV6A 5EIBC 1ZK4A 3MRSA 5FPPA 1UC5B 5DWQA 3LYLA 2VDNB 3FVWA 1G55A 5IJAA 2EDAA 3WGHA 1EKXA 4PXAA 2R85A 3JZIA 2W7TA 2Y71A 4TMTA 3IVCA 5TY0A 5B57C 1XD2A 4JUDX 3L7NA 2EERA 2FQ1A 5TPWA 2J0SA 4OAPA 3E8SA 1NJ8A 5LIRA 2K2WA 1VP9A 1P74A 1T8WA 1WUYA 2JGJA 3JAKA 4K8RB 4P7GA 4E21A 1K5GA 3NVKI 4BZPA 5MHTA 3DG9A 5LIPA 1DE0A 1MPTA 4WL0A 4CM5A 1SPXA 3LT1A 4KMSA 2D7DA 3BF8A 1V25A 3T3OA 4DR7B 1JAZA 3FGZA 2D1TA 3GPLA 4TQGA 3QEBZ 5TF4A 2XQIA 3OZVA 4K5QA 5DM60 4F3NA 3Q7TA 3LRPA 3KQPA 3X1ZA 2AKEA 3R6TA 3BERA 3OLVA 2I8CA 3LYUA 2RH5A 5B4TA 3V2GA 4FJ1A 3QU2A 4GMHA 1AA6A 1I4OA 3DKIA 2A33A 1DCKA 4P3KA 1NUQA 3IP8A 1P0QA 3GMTA 3VYSB 4JC8A 3WLKX 2I7CA 1PS0A 4JS0A 4F0JA 4WHMA 4A0SA 4IIJF 3IT1A 4U6SA 2NADA 5HOEA 3PGMA 1AT1A 4RU1A 2Q1TA 2AOTA 1Y3CE 3EQ8A 4IAOA 3JQ6A 3IAXA 4D9MA 2H0QA 4WCVA 1FBTA 4HLUA 4HDOB 3H8WA 1VJ5A 1JG6A 1U28A 4BFCA 3DV2A 3VPHA 2BE9A 1HY3A 2K6GA 3LCMA 1CR2A 4B79A 5JVDF 4L7VA 5BNFA 2FFJA 4WSOA 4UCFA 5ICSA 3H9BA 2HUNA 4NAHA 4DJAA 4R40A 2GAAA 2P5UA 2WABA 3HA2A 3G89A 4FYKA 1EUDA 2HU5A 4LY3A 2JJ2A 2YC4C 3ZPXA 3GOQA 1MV8A 3L7IA 1OV6A 4R8KA 4N6GA 4B7ZA 3TQSA 1SCJA 3HHEA 1YZNA 5AJUA 2D3WA 1RKQA 3ZIUA 2VBFA 5HZMA 4AMVA 3B6KA 2E55A 3R4CA 1RR6A 2JHPA 1QQBA 2NP7A 1G21E 1Z82A 1SUEA 2R5NA 3UKOA 3BKXA 1Y3BE 4OHUA 4L5AA 1K97A 2EARA 3P5BA 1L7RA 4BWVA 2PZJA 1N2SA 4NY1A 4PYOA 1FJGB 1T9CA 3LJKA 2LW7A 4YCSA 1NASA 3E58A 2VSYA 1FU7A 1EG2A 3PT5A 4TTAA 5AVKA 5JXHA 5DCYA 3OJEA 3NGLA 9MHTA 4FFBA 1JFFA 5KB3A 3P9RA 3KR2A 4ZQBA 4QM7A 4CG3A 1G8PA 2BMEA 1FK8A 2JEOA 5F1YA 1IPHA 1N2HA 1Q1BA 3JZFA 1P6QA 1ZMRA 1LKZA 5AOBA 5F1OA 3U9LA 1V26A 2H1SA 4TVSA 4INAA 2PBFA 1A97A 4CKBB 4FGKA 4GXQA 4QQ8A 4OXRA 1T5LA 1RXUA 1T36B 3QBTA 4IDGA 1OX6A 3ZYZA 1V5FA 4C3VA 3K5HA 4AY6A 2QPAA 2FA9A 1TJ4A 3N59A 3MCUA 5CDTA 3KOOA 4D3DA 2JGLA 3WL4A 3NBXX 4IFTA 4QJ4A 3ZQKA 2HYIC 4NCJA 3R9WA 1U7XA 2MDTA 1ZMOA 3W78A 1WQ3A 3E9QA 1JJBA 5EY5B 3KHSA 4YPVA 4JODA 4N4AA 1T25A 3DSRA 1T9BA 1A27A 4XM2A 5DISB 2PE5A 3NHLA 1P9RA 1PJCA 1HQKA 3BPSA 4FI3C 4WMLA 3TW4A 3UFXB 2XUJA 5BUZA 3GARA 4L8YA 3WTBA 2W2KA 1B7GO 1Y4DE 1WW3A 4KHZA 3T9EA 5IF3A 1JN0A 4RULA 1GQRA 1QE0A 5C2JB 3TQIA 1M66A 4WOJA 2A9RA 1YGYA 3VHRA 4EPWA 4YB8A 5FP0A 1V47A 1F1BA 2X7JA 2I4TA 4WZAE 4FPXA 1NMEA 1E64A 1A04A 2ZU6A 4IY1A 5KTMA 5DK6A 2HLDA 2XB4A 3EF0A 5ALLA 3HV0A 4FLFA 4U7HA 4UE3S 5EVJA 2WJPA 4YGYA 3LLSA 3U6KA 2N46A 2C9BA 4MUGA 1ZXLA 3THRA 3HGMA 3O9ZA 2VXYA 1Q2UA 2Q5IA 4CZ2A 3CNNA 3TZQA 1ZAYA 3MLBA 2QN1A 3NZEA 1NN0A 4J7CA 3U3DA 2RGUA 4GXNA 1R6DA 2HRZA 3L92A 4C4YA 1TEHA 2H1WA 2OTCA 3N0TA 8ATCA 5ITZA 3ZOKA 5DHRA 1YJAA 2PUWA 3DF7A 1FYWA 1KR5A 4I50B 2GD6A 1K6XA 4YUVA 4FNGA 4DQ0A 5JYBA 1IOLA 1TK2A 1P72A 2H2HA 3T7IA 4W99A 2JH3A 2OHGA 1FMLA 4ZQHA 1UXOA 1Z7GA 4J8PA 3WYEA 1U9CA 4KV9A 2QGNA 4YMSA 1LK0A 4TKMA 1YL7A 1JJFA 3IQWA 3GLFB 4IXMA 2G5PA 2NSJA 1VSVA 1KDOA 4I9NA 3CGWA 3ETGA 4G5QA 4J7UA 4F72A 1PK9A 1KZHA 4DLNA 1DBVO 4OHRA 5F9HA 4BFZA 2SBTA 2NZ8A 4C78A 4MWGA 3AP1A 3Q8XB 1WB9A 3JWGA 1SUBA 1R0SA 3B1YA 1E69A 2KE5A 3F74A 4MS3B 3SP1A 1VLJA 4J4BA 2WR8A 3H9JA 3UFBA 1ZVQA 3U26A 1ZJZA 2FNAA 3CEAA 4RXUA 2FN8A 1JSLA 2ZJBA 3EVTA 4GVPA 3WA7A 4HNQA 1NKTA 2V9CA 4TOIA 3VDXA 3JXEA 1ZOSA 3R4VA 3K4HA 4U7JA 1SA0A 2XD9A 5JT1A 4EVQA 2IYYA 4WNYA 1EGVB 4X54A 2XVMA 4NE2A 2IRWA 4QYIB 1I7LA 2DLCX 2H1VA 4ZQFA 1J2UA 3N75A 1Z6YA 4UTPA 4O1MA 1J2TA 3SEZA 4F4JA 4K9KA 3ISTA 4R8LA 5FI0B 4XFJA 5H81A 2OBYA 1EB8A 1HEYA 3C3PA 3ZE2B 3BHMA 2QTHA 2DQSA 1X7XA 2CSUA 3HXKA 4H0NA 3SEQA 3WGJA 2CHFA 2I78A 4UUBA 1QH0A 1SRRA 4XCXA 1XI2A 4RADA 1MW8X 2C97A 2RBKA 2QLJA 3KEQA 4WX2B 1Y48E 4XYLA 4PNPA 4OPMA 1CVLA 2C07A 2FWNA 3CCCA 3CN9A 3OFND 2XUZA 4JGBA 1L9KA 3DE3X 2MINA 3N28A 4KL8S 3LM8A 4FUQA 3AGPA 5EZSA 4EPVA 2W90A 3S29A 3F6SA 3VOTA 1QQ6A 5FNVF 4ZIRA 3K2EA 2GAJA 1JSRA 2Q07A 3ROZA 4LZNA 2BH2A 2MINB 2AFIB 5HCIA 2Q5EA 2M6RA 3VU3A 1VMIA 1ADFA 2V96A 1MX1A 1VJCA 4WLUA 2CV1A 5EHZA 4IMRA 5FTLA 1NQTA 1TZKA 3A27A 5SY9A 4NV0A 5EA2A 1ZMXA 3DMPA 2QTNA 1OGIA 1FDRA 4K6MA 4OJYA 4H7KA 4FCTA 4UBKA 5HFJA 4B3CA 4CNQA 1XQ1A 4WK6A 3VO9A 3GXBA 5HJ7A 1U1DA 4FYIA 4IS2A 3ASUA 4LXQA 1HWYA 2NXWA 4V0OA 5FUBA 3W8RA 4ARVA 3ABQB 4O25A 4B9AA 1AQLA 5A4FS 4QUBA 3G0HA 2GBCA 3IPRA 3L7CA 4QBIA 1DAKA 3S40A 4RLHA 3GBPA 4BP3A 4RQTA 2DQ4A 3FUWA 3IKJA 4D81A 4U6QA 5KWVA 2DWUA 3SSAA 4GP9A 5JSFA 5GINE 1W36B 3WIBA 2AOXA 1IB6A 5KWJA 3G1UA 3HG7A 2C4UA 2CXSA 1YJ8A 3DCIA 1O9HA 2Y66A 1ZMBA 2PSSA 3KJEA 3WLEA 1RM0A 4OHCA 4TS9A 5HA5A 3EZLA 4BO6A 5E6UB 3TXYA 2Z57A 3NOVA 8ADHA 5AJYA 2QRHA 4M0EA 1HL7A 1T3HA 2F9MA 2ZBVA 2G7ZA 4HLCA 4MUJA 4TXLA 5B3AA 1X86B 5C8YA 4BX2A 3VU1A 4JV5B 4XIJA 2PHZA 4HAIA 4MAAA 4P54A 5AXAA 2NACA 4IQ4A 3WKBA 1BKDR 3GEDA 3MWKA 4JB2A 2A0YA 3KEOA 3KKQA 1F12A 3SY8A 5KYTA 3J81k 2IH2A 3U4MA 5JNWA 4B4VA 3AVUA 2BGIA 3CY6A 1XXHA 3AJEA 3DULA 4BQEA 1LU9A 4MGIR 5LLTA 2H16A 4I3HA 1WOMA 3G13A 4BLWA 2AZDA 2XF8A 2O2HA 3ND8A 3GFRA 3HDTA 4AJKA 3KTFA 1E1NA 3B5JA 1LDYA 1EIZA 3KKKA 1DX6A 1Y8QA 3T4PA 5SYAA 1FU4A 4RD2A 2IW3A 4S1WA 4XYMA 4PPFA 4R9NA 2VJMA 4EHHA 5H70A 2EBUA 3HGQA 3RU2A 2HU7A 1KSGA 2OSBA 1S9HA 2IHUA 2W2OA 4U4AA 4GP7A 3RVOA 3V46A 1IBKB 1KNXA 3UBTA 5AKHA 3UUWA 1Y3IA 1TDJA 3V5NA 1PFUA 1Z5ZA 1SU6A 3WGGA 2RH9B 5DW0A 5KYGA 3M82A 1R8XA 3UFXA 4UD6A 1VPEA 2OGTA 4FE3A 2QK4A 4UARA 2A67A 2UKDA 4XUEA 3QV1A 1ISMA 3I6IA 4Q18A 5KHAA 2JD1A 3K05A 1LK7A 3FDZA 5CYGA 2IOFK 1KFKB 3L1HA 3U3JA 1Q91A 3I12A 3H86A 4JSYA 3ZCXA 1KI7A 4C7JA 3LUGA 2FFBA 3LG2A 1JFVA 2Z9CA 1GCGA 4MVJF 4JWTA 5M2QA 3NAMA 3H2HA 1WW8A 2VHXA 3PKJA 3VAZA 4PSCA 1I7SB 4V0RA 1YULA 1HLPA 2RBGA 3NU1A 3U17A 1P7ZA 4C4SA 4ZV4A 3VR1A 2XCRB 4X9XA 3FLBA 1W25A 3KM0A 3GR6A 3DYVA 3THXB 2FPPB 4JI0B 2QVGA 1X1EA 1JHQA 4LECA 1C9KA 3IKLA 3RYFA 4GQBA 3V33A 3BREA 1DFHA 5CVTA 1ZKMA 3QFTA 4K26A 4FFSA 5LMUB 2OZVA 2NUBA 1E9FA 4L4ZA 1S1CA 1IZ8A 5AKYA 3H2SA 5TMEA 3A9TA 4BO9A 5KAMA 1AXEA 1EWKA 3FJ1A 4Z9XA 1O5TA 3UAWA 1XT6A 2KM1A 3Q5DA 4CCWA 4BFXA 1YZTA 4BO2A 3DT6A 2C7RA 3ILSA 1PJRA 1AQJA 3BHIA 4DSZA 1GLNA 4OHBA 1FMJA 1U8ZA 3FW1A 1YAHA 4R31A 3WB0A 1Z33A 1G3IA 1Z4NA 3AHFA 1MRZA 1AKTA 2W00A 1RNLA 4LYEA 2WFLB 1W88B 1YVRA 4BLUA 1RPZA 3SHFA 1QFZA 4RGBA 4WZAA 3NP9A 3L8ZA 3ZN2A 4KNVA 4EYKA 5GONA 2UXBB 4QBTA 1S9DA 2ZM6B 4JKIA 4YMVA 3CUTA 1G291 4WXPA 1XR3A 2HL6A 1GNQA 1FUIA 4ZQCB 3RFFA 1YK1A 4KXYA 5JFTA 4P7KA 5E1MA 4QBHA 1RAFA 4H6XA 5EMJA 2IYTA 2ST1A 3L4SO 1VDZA 3T5GA 4E5UA 5HQ3A 5KYWB 2FGJA 1VLZA 1VHTA 2BFFA 3OFNA 4GKAA 4C5AA 2QV7A 4DV5B 5BVHA 1NYTA 1WTAA 2WV9A 5EWJA 5KYUA 1VIDA 1PGJA 1N8TA 1PP4A 3NX4A 1EHIA 4MKFA 1I01A 1KEVA 3DOIA 3WP0A 4L3OA 4B34A 4NRDA 4IQ8A 4HMQA 4UCXA 1PZEA 5CW1A 5LPNA 3L2OB 1BRTA 4KIJA 1E7WA 4S0XA 2B99A 3PR2B 2I1LA 4IH9A 1QHGA 4OLFA 4CUJA 5ABPA 2AC7A 3RCBA 1PW5A 2RD2A 3F8TA 3DBLB 4HWSA 3LIIA 1SD2A 4Q48A 3IALA 5HMMA 4D41A 2YRXA 1LBTA 1C1HA 2HNKA 3ETHA 2RHHA 5G1NA 3O8QA 4UM5A 4PZAA 4NJOA 3AL2A 2FSSA 3U3RA 1XMQB 2ACWA 1H8HA 4GWKA 1M1YB 1W44A 1M34B 4AYTA 4D45A 1BEEA 1Q1AA 3N87A 1HG1A 3CUEF 1NG9A 1ZONA 4W5NA 1M1UA 4U7WA 2V5AA 1XD9A 1AVTA 2VWQA 3N0RA 4LQ4A 2P9EA 1ULAA 3BBLA 4Y7CA 2H7YA 3EYWA 1WQ4A 1SU7A 1YONA 3LUBA 2IYQA 2DEUA 3KTDA 4RJIA 2J5RA 2FR8A 3JD1A 3NOXA 1IZ9A 1X9HA 4FR5A 1JYEA 4DDHA 4ZZIA 1RJ9A 5K01A 5JAZA 1Y3HA 3OOEA 1UC4B 3M2PA 3BMCB 1BX1A 2B6HA 2WF5A 3Q41A 4G41A 5HQJA 1HFKA 1XTRA 2WSSA 4UAUA 5C9ZA 1CBUA 4ID9A 4MUEA 2WB2A 3DJYA 3NEPX 4UZEA 3H4MA 5T6BA 2RDMA 4RSMA 3M9XA 5D5PA 4G85A 4I4TF 3RYCA 2EGGA 5I7EA 3GGOA 3NXSA 5FO1A 5TDHA 4Z2AA 4S04A 2WZDA 3A6GA 3ZGVA 1JDPA 1WSAA 4DB2A 3V7NA 1KRWA 4M53A 2J0EA 1MABB 1GQFA 5DE3A 1UKZA 4E5NA 4HC4A 4IO1A 3KC2A 4W5WA 1VGRA 3P52A 4F96A 4KPYA 1ZEJA 4D97A 1JHPA 3AP2A 4KIUA 2Q1UA 2W0MA 1MEOA 1BVRA 3C8MA 2IWRA 4C0HA 3HB0A 4MIKA 4JR0A 2CYBA 3ZH9B 2YOFA 3KZXA 1FNNA 3FVQA 4Q9DA 2FXIA 3U0VA 4ES6A 4RKWA 1YMVA 4R1MA 1IONA 4Q47A 3WYCA 4L0QA 4PVCA 3NG1A 2FPUA 4I1IA 2GESA 3AJRA 5FDFA 5JSZB 1U3TA 2OHXA 4YGXB 4IUDS 2Q7DA 1JA1A 3RUEA 4J9UE 1W9MA 2QGFA 2DT5A 4BFUA 2A94A 5A5DA 2RG7A 4UDXX 5EFZA 2C84A 2DU8A 1AZWA 3RSHA 1KKMA 2ECQA 2BP7A 2YZMA 3HWWA 4WDRA 1AQIA 5HPYB 2ZSAA 4P80A 4RF2A 1ECGA 1O6GA 1X9IA 2NU9A 2YH2A 4NH0A 1OIXA 4P36A 4ZCPA 5A3VA 4NARA 4C2AA 4ESVA 5BSTA 3SXUB 3FMOB 4C4RA 4ND4A 1AD2A 2PA0A 2WJVA 3GV0A 3JQFA 2PX2A 3A4VA 5CH5A 5ALOA 4YPFA 1BOOA 2ORYA 2C3YA 1AS3A 2VH2A 2G4LA 4QU9A 2P9BA 1RQ7A 5K8JB 3IS3A 3ZJTA 1JXOA 1N1GA 2GPTA 3JPWA 3MMXA 2PS1A 4QEZA 3S70A 3TNYA 2A30A 3AI2A 1I94B 1KFBB 1NFRA 5EEGA 1TQDA 2VUTA 4J1NA 1JHOA 3U39A 1FFHA 1HLFA 3DC7A 3EC1A 3NTVA 4MIOA 1HE1C 1CF9A 1I0IA 3IAUA 5JBQA 2OQIA 1NUAA 5C0OE 4Q4DA 1J07A 5AW5A 5IEJA 4C20A 3DT8A 3IB6A 1T15A 2JGEA 3CEPB 3TOSA 3EODA 3IDFA 4EFKA 3H1GA 2AMFA 2IXBA 4I4CA 4C22A 1PZMA 1SXJD 4GEGA 3IC5A 3ZTYA 4OP2A 1XYVA 2QRLA 4IGIA 3HUTA 1SY7A 5DTMA 4CDRA 3PQFA 4GPEA 4DNOA 2C9YA 1U2DC 4BMXA 1H4TA 2CJXA 2NNLD 1RLUA 5KTTA 1ZK2A 8OHMA 3C97A 3HYRA 1UH5A 3PDJA 4M8NE 4WZBE 4XM0A 4P0QB 1MH1A 1KJIA 4CM1A 2C4VA 1U2DA 1RBZA 1SVKA 3PUYA 1WPXA 3GLGE 1Z4MA 1KZYC 3WR5A 1MIOB 1OYYA 3CMMA 4RVDA 2YOHA 3KPVA 4O29A 2Q6OA 3I01A 5ESWA 1CEYA 4H4DA 4DQVA 5K0GA 5KTRA 4MQEA 3ZJYA 1FW6A 4DZTA 5G0UA 2Z3WA 4RELA 4RE6A 3T7TA 3IL2A 2G1AA 1B2RA 1T4BA 1XCBA 3B48A 3M6LA 4L3VA 4L85A 1JECA 3NHFA 2RHJA 3VKVA 1B3BA 3BRWD 4Y9UA 2VDPB 3REQA 3D4LA 4FYHA 2FG5A 5IW8A 1WXGA 3RIHA 1NMYA 1T34A 2PUHA 1RYYA 1YZYA 5FTNA 4OQMA 3RD5A 3TNJA 3WIEA 3H16A 3CHYA 1LBIA 1L5ZA 3KQMA 4MJ3A 1K0FA 1OXBB 1EFHA 1TF7A 5JJKA 3RC8A 2WJWA 1FX0A 5TNXA 2NMVA 3L1IA 3OM1A 1MN6A 4NG5A 4PAGA 1NLYA 2O2JA 3PXEA 4WZ6A 4YAFA 5SZKB 5IJZA 2GTHA 5KKCA 5BYBA 1WUJS 2NUTB 4O63O 3RVDA 1ADGA 4BGUA 4B7UA 2VUHB 4MRPA 1VIYA 2BY4A 4GLOA 3QELB 4L51A 4ZT3A 1JQKA 4C3UA 2HA6A 4Q1FA 5L3VA 1GKIA 2DBVO 4IIEA 1JSXA 1O6CA 3GLRA 4CF4A 5IT4A 4RLFA 3PRHA 1XDWA 1EP2B 1ULSA 3MQFA 2ZIUB 3FYTA 4TUYA 1YR7A 3RNOA 3ZHRA 4OUDA 3ZUPA 1E5DA 2QQGA 3IIMA 3JD4A 2RAPA 4OGGA 3ZHUA 4DV6B 2H5LA 1EUYA 1CZRA 2II6A 4F9GA 1JAXA 1RQXA 1PRYA 3REFA 1U7UA 4GH5A 1DDOA 5DASA 4BLQA 2PJUA 3KL4A 4ZVKA 1X80A 3RC3A 1FUKA 1OT3A 2I66A 1O94A 4DIFA 4XSVA 4V0ME 5LP6C 1RXVA 3GQBB 3DJFA 2H4YA 4BJ6A 3HKEB 3L8CA 3NDPA 3WNCA 1U9JA 4B5LA 3O95A 2DP4E 4YWJA 2OE2A 4B87A 1NV9A 1NIPA 4MCJA 3ZIAD 5B30A 1Z2NX 1NW5A 3IUEA 1VKNA 1W4AA 2I4IA 3NWEA 5CG2A 1K7XB 2W22A 2VTDA 3EQ2A 2FI1A 4MRVA 1D03A 1A9OA 4KO4S 4Q3AA 3M1AA 3FZEA 1RYDA 1R0ZA 3JASA 2VTEA 4O0MA 2GO1A 1ZESA 3P0RA 4IFIA 3VSEA 1U9YA 2X9VA 7AT1A 4QLBA 2VSFA 5TV2A 4KBYA 1R5NA 1YCGA 3Q1KA 2JFWA 4LRUA 1ESDA 1GUZA 3EDCA 3ES9A 3TN7A 4U2DA 1UT5A 2A8YA 5CX1B 3L4KA 2XB9A 2ANCA 4GXTA 4HB0A 3T99A 1U1IA 3NC1C 4UHCA 4EZIA 4WOKA 1QNLA 4YV0A 5MN6A 5EYPA 1OHHD 1F0YA 3X43A 1VL0A 2PGLA 3R7WB 1JJAA 1KARA 4CLEA 5FOTA 4GUAA 1DJNA 4MR8B 5I5GA 1EE9A 4PR0A 1MQ8B 3P32A 5ALZA 3PBKA 1F2DA 5IC4A 1T1EA 1PFWA 1SBHA 2KYRA 2WHPA 3AR6A 4ENRA 3ZS8A 3R8FA 4B76A 5JANA 1G20B 1RVDA 4IDOA 4J2TA 3ZWWA 4PHFA 4QPNA 1OLSA 1HTTA 1QKKA 2IDJA 3DMRA 4L2IA 2Y1CA 2XLCA 3WKAA 1RI5A 1GV1A 3UB4A 4B73A 2HA5A 3TNDA 4X7BA 3TLCA 2HRCA 4TYNA 2Q5HA 1T91A 2COKA 3IBYA 3LWNA 1HKHA 3FCXA 3C87A 1U2RA 2AUTA 3BMOA 5IKOA 1G5HA 3RS3A 1J7JA 2IUTA 3GRPA 2P91A 1ZL2A 2O0JA 3OIUA 2X1LA 2NUPA 1WB5A 4LBVA 4I46A 3VR4H 3LRTA 2VKTA 2FFHA 1V4BA 3IJEB 4XI9A 1HDCA 3O4HA 3O1IC 3QU9A 5D3MA 3ZHTA 2IEBA 2J5QA 4EQ6A 4K2HA 1U3WA 3DZBA 2OEPA 5CBPA 1ZIOA 1S8OA 1DXQA 4WERA 3GJXC 5HKKD 5JQGB 4HQKA 1N8SA 4HWRA 2C57A 4DM4A 1MVOA 3HNRA 4RMHA 1IC6A 2Z04A 4AMYA 5KMGA 1B8VA 4A1FA 4RTMA 1CUUA 4EENA 1TMOA 2W0SA 4HLQB 4LGCA 4PYJA 1WMFA 2BUAA 2W6NA 5AJZA 1I3CA 3GFOA 3OZTA 2VAPA 4K9RA 4LC1A 3USZA 3W06A 3TOVA 3WWYA 5CXQA 2G72A 3HVKA 4NNOA 4H3HB 2PBLA 4D6YA 1E9VA 4PZ9A 3L3BA 4KLZA 2QUAA 4OI1A 5AVVA 2JPDA 1PDVA 1A9PA 3BS4A 3FGOA 4UMFA 3KQHA 2RGBA 4N3GA 2AN3A 1Y4AE 3AM4A 4BP8A 1FJ2A 2J3IA 3KOXA 2QL5A 3GZNB 1TTPB 1WMAA 2V7TA 4NENB 4ED9A 1KSJA 1Q16A 2BFDB 4RA9A 1FYXA 3AEKB 1TVKB 3BJEA 1FLAA 1OE0A 4CIDA 4EY7A 5A9RA 3UGJA 1KO4A 2OXEA 1G0NA 3AUTA 3WDKA 1Q0QA 4IRUB 4KQKA 5CVVA 3TEMA 5EZ5A 5I48A 3TD9A 4WIAA 5TVGA 3IUNA 4FGJA 1UBSB 2OZLA 3UMRA 3H5RA 1QCYA 1U2SA 4RF3A 3MQ2A 4AJPA 3I34X 5REQB 1A7AA 2DKNA 1LBSA 2NPFA 3EIFA 1RYFA 2QSZA 5BQ5A 4F06A 4YRGA 3RF7A 2FEXA 4FWBA 2ZYHA 3H2BA 1KEPA 2C8VA 2C3OA 4GFDA 4JL5A 3HJCA 4WKOA 4PX9A 3LZDA 5DK4A 4DAEA 1BH2A 1LRJA 3LLVA 4OXNA 9LDBA 2G28A 3O94A 5HQ3B 5FTKA 1I4TD 1OX5A 1GFSA 3DMHA 3DVRX 4K2AA 1NWHA 4J4HA 3IFSA 4I55B 4UULA 2YJGA 3PK0A 4X6LA 1KORA 1W5FA 2X7XA 3P2KA 2H1RA 3G9UA 2PX3A 2C95A 1JFTA 1UXKA 3S2YA 5M5BA 5CVDA 2R4TA 1W1WA 4G01B 2CHUA 4QUGA 3DZGA 4CLRB 1Z2PX 1JIIA 5ICGA 4P7JA 3HR4A 4RXTA 4CM3A 4IJVA 1ODTC 1SBNE 4G0YA 4RSHA 3ZHCA 5IYZA 4O2RA 4H08A 1N6KA 3HCRA 3ZEAA 4BNKA 3DFMA 4JYPA 2P9HA 2QRNA 4RZQA 2AJDA 4UHDA 2BMJA 3CW9A 5A4JA 4FONA 3BICA 2F59A 3QWFA 2C0PA 1P2SA 3KU4A 4KI7A 5LDGA 3AEQB 1JTEA 4FIZA 2AOUB 4KN6A 4D82A 5L51A 4BV8A 2WW8A 4TSKA 5HDQA 5K5EA 1L9XA 3GLIE 1BS9A 4IHKA 3G02A 4FOSA 4KJXA 5IG2A 4QDTA 3P97A 3AL0C 3GNSA 4LMAA 4Y9RA 3NIFB 3JRWA 4WJKB 4XASA 1E99A 1I6LA 5D2CA 2YY6A 5T6MA 1F6BA 2EGUA 4BVJA 4D7AA 5IZCC 1P17A 2BEWA 1EESA 2Q9UA 1X2BA 5DRYA 1SWVA 2AK2A 2YXDA 5CURA 4BNMA 3RBVA 5A2QA 3AFOA 3BZWA 1GN9A 3CQ9A 4N39A 4BNVA 2J3EA 2ZRQA 3P9SA 4KKXB 4FWTA 3F7NA 5C4GB 2FPPA 5DLYA 1SCKA 3TVTA 3MGCA 4OH7A 4DMRA 4G1FA 3PC8A 2AG6A 5IYZB 3PFWO 2B8TA 1RMYA 1DQPA 5A9SA 4P84A 4BC1A 3IEIA 5A1JA 7ABPA 1YF3A 5JG7A 4C04A 5IT0A 1W73A 1N3LA 2DUNA 2WF8A 2VHUA 2JHCA 2PMBA 4R3NA 5C5DA 3ZHYA 1TO1E 4W5HA 2LCFA 4GM1A 1ZITA 1ZGGA 1QGAA 1S3GA 2HMUA 4LX0A 1X1TA 1VECA 1Z0IA 3W6NA 4D9GA 4N3AA 4A91A 1D6JA 1NONA 4KGXA 1NDQA 4I08A 2ECPA 5DP1A 4BTVA 5EHXA 1NXOA 4CKXA 1PDOA 1N5JA 1EDZA 1UFVA 1XFAA 3LX5A 2EKLA 3I9OA 4YUWA 3E9CA 1MBZA 1GRNA 2FZKA 3O38A 4S05A 1SRQA 5T4BA 4JJ8A 5ECDA 4RD6A 5CNJA 1FNCA 2F67A 4P58A 3QQPA 1LDEA 5HIIA 2XODA 1GDHA 2ZUSA 2C5GA 4BRUA 4BVEA 2V0NA 5B58T 4O4LA 5BSVA 3IHTA 4UW9A 1KH1A 4CLRA 3IEKA 4FC6A 3T3PB 1DTWB 4KQ9A 4WFQA 3VO2A 4S0ZA 5EOVA 5K0CA 3K4PA 5I9BA 4ENPA 4KB5A 5C1OA 3DE6X 1K89A 3UT5A 3DYBA 1DPGA 1U9ZA 2GEFA 4MRNA 2PMCA 1ZRNA 3VHQA 1IWBB 3OPYA 1ND6A 1W2GA 4C5BA 2E4WA 1ACJA 4B09A 1BXRB 5AW3A 1UFQA 3E4CA 4EUKA 3KB8A 2QNBA 5F21A 3Q8KA 5KNBD 1QQ5A 2NM0A 1Y9AA 3U3ZA 3AV0B 1Z36A 1XNQB 1Y81A 4TXNA 4KGDA 1KYYA 2IPXA 4FMBB 5BN5A 3ACDA 5LL6P 1D9ZA 2W6ZA 3FN4A 4OB6A 3QJYA 3UZUA 3DPIA 2R8ZA 4BEVA 1KMQA 1LVUA 3VYTB 2XWSA 3FHTA 1JG3A 4INPA 3DWFA 4IJQA 1TAUA 1JDNA 3EUEA 2OYSA 4BN0A 3NV7A 4HADA 4YJ2A 3BIOA 4YIKA 3G0IA 1A7KA 3TE7A 4C4PA 5E9WA 1GCUA 1CR1A 4FR2A 2VK2A 3QG1A 4J1TA 4V0SA 5ECWA 3ZZ0A 1K2WA 4KN9S 3KZKA 4ER6A 4V3BA 3VR6H 1GT6A 1ZVMA 2BZSA 1DAOA 4H60A 1DQSA 4NG4A 1JFLA 3HR8A 2J3KA 4N7BA 4E5VA 4MKZA 4OSPA 1JEEA 1EVJA 2JIZA 2R86A 1GR0A 1UC9A 2HIHA 3HNPA 4DDMA 3ZHZA 4DXHA 3DDZX 1H6DA 1IHUA 3PDIB 5GIPE 2HSEA 2NUPB 3TRHA 3TE6A 3ZE0B 2F43A 1IN4A 4ZTZB 3EXFA 1L5SA 3CM0A 1ZGCA 4GSYA 4LG1A 3TH5A 2VA8A 4KNYA 3GLHB 1C9DB 1ZIXA 4HDMA 2FUG6 2DUMA 1HE2A 1I4DD 4K9LA 4UREA 4BQRA 2FFRA 1FDOA 2ETXA 2HMYB 1Y8AA 2ZYGA 3E3OA 1UP6A 4I4IA 2ZM5A 3D6MA 3I4FA 4C0QC 4XIGS 3QF4A 1T0JB 1E2NA 2Z5GA 3CC8A 4QHSA 5JZOA 1JW9B 1EFRD 1HE4A 4LSGA 4WCFB 3FKJA 4BKPA 3V4ZA 1CSEE 2VWPA 3SYTA 4DHWA 4EZBA 3AR8A 4MKIA 2ZT7A 5B1IA 2J08A 1KF0A 2P9ZA 2JAWA 3IIKA 4D0NA 4UVHA 2BGLA 1HZZA 1T6NA 5E2AA 1N2BA 1RYMA 4KFRA 1KBQA 1RI1A 3TW8B 4C7VA 4ARIA 3NKFA 3VA7A 1DKOA 4LBZA 2C29D 3BFKA 3QVSA 5IPFA 3T5CA 3BMOB 5DNUA 3DWGA 4YASA 4JLWA 2CNWA 4E5PA 3EXHC 5FBVB 4RSRA 3NM4A 1J2YA 1KETA 1SB8A 2HHAA 1TA9A 3ZBTA 4V02A 4JBWA 5D7NA 4QU5A 1O08A 4EAAA 2R7KA 1L1QA 1RKUA 4M0LA 4K3VA 4XJTA 4NPHA 5BT9A 4NC9A 4KWCA 2Z2YA 3EXEB 3COZA 4F3TA 1CJUC 1FQOA 2QG4A 1FXWA 4QNMA 5BSMA 1ZFNA 3ENNA 3OCUA 3HB9A 2FJPA 4NFSA 4CTJA 2F3PA 2PPLA 1DRKA 5KX5B 1PWHA 3HJHA 1SB9A 1XALA 3CS3A 3I83A 1ODKA 1X19A 1Z3IX 3G5MA 2I03A 1WO8A 3R9KA 1X7GA 4NMWA 1R0LA 3EVAA 2UUCB 3TUJC 2ZZMA 2DQYA 3C3WA 1UIMA 4XZ3A 4MKHA 4PPYA 4WH0A 1OWPA 1CJKC 1JLLA 1ENOA 1KERA 2CKDA 4QPDA 4XOUA 1LDNA 2X14A 3I58A 1N8NA 4KN8A 1DTEA 2HQRA 4IIGA 3RAJA 3ABOB 2R8PA 3QBEA 1M0EA 4NDZA 5J59A 1E2GA 2G67A 2QE7A 3LBAA 4GGOA 2H06A 1ZMTA 2WZQA 3VKFA 1XPJA 3M4ZA 3GLQA 4RTPA 4ZOLF 3L01A 3MTBA 1P4GA 3ENWA 2XAUA 4J75A 4ANFA 3HYSA 3HN7A 4Q4JA 3OY2A 4KIWA 1ZICA 2PBZA 4XWTA 3OJOA 4NZYA 1A50B 1YQQA 2NXEA 4CLDA 3LCRA 1ZCFA 1YCHA 3GDHA 4DADA 3HLKA 3PXGA 3JX9A 4AJOA 3EZYA 4GBGA 2ORED 5JZMA 4E6EA 3K71B 2XQGA 2QB5A 2UYYA 3NHMA 4XVUA 3EGDA 2PGNA 3ECAA 1K86A 2GBFA 4M98A 4V03A 5DGIA 1TQ4A 1BFKA 1P2GA 3QVTA 1PL0A 1IUOA 1Z6GA 2E82A 4FHFA 4E4YA 2UUPA 5JALA 1COWA 1W5AA 5K99A 3KWJA 2QRQA 2PKQO 1OWLA 5G40A 2O7QA 1KRXA 1P44A 2GKGA 5BSUA 1BTOA 1YMUA 4IJ6A 4OHFA 3OLYA 4TMYA 3W34A 3ZD6A 5KU7A 3LUCA 2WLTA 3WGNA 3HN6A 4H7PA 4BLSA 1K3UB 3RV4A 4M0FA 3K4QA 5K05A 3CUUA 3ESQA 3RKSA 4JD5A 1KO5A 4I50F 7YASA 5B6IA 2JDID 2XUHA 3EPKA 1AURA 1CJSA 1USIA 1NUHA 3WV5A 3CNEA 4FLEA 1X7ZA 3EN0A 2OP0A 1K5DA 4MCAA 1FS5A 3GGGA 4HQLA 4JCCA 5TGDA 2QUHA 1JQDA 2J4DA 1M2NA 5JXWA 3E23A 3TBHA 3RRBA 1LJ8A 3FTFA 3U4DA 1GYPA 1KYVA 3EMBA 2IYOA 3ZWVA 4MA0A 3OOJA 3UOAB 3UGKA 1P5ZB 1VLMA 1L4FA 1N1EA 1SC1A 1X8LA 3C3YA 3VR2D 1UEJA 5ED4A 1E3JA 4KMOA 4D92A 1S7GA 4GC9A 2JANA 4TQUS 3WMRA 3NDBB 3Q0EA 1HK7A 1D07A 1QKIA 1K66A 3NI2A 4H1HA 2PO5A 2GTIA 2P9JA 4GPBA 4KO2S 4QOEA 4A0FA 5ESRA 3GXOA 1ZLYA 5D84A 1UK7A 4R9VA 4MSUA 4BX3A 4AWBA 1GGMA 1VJRA 2CN1A 2J9YB 2R00A 3H11B 3OE7A 4H2DA 3E70C 2XWPA 3P27A 4LHYA 2OHFA 2IHVA 4QFBA 5GOTA 2RJ3A 1CRLA 1ML3A 3K35A 1XEAA 3KK0A 4JWKA 5B1DA 1C0EA 1W35A 2B4KA 2JFUA 3ZU4A 4DPMA 5CD9A 1IN7A 3C4JA 1G5FA 3RLFA 3I42A 1X6VA 3ANNA 1Y6FA 1EJ2A 5L4LA 2OY0A 1GPNA 4Y2TA 2ASEA 1VBNA 5J4HA 2V54A 3PV0A 3N07A 2FN9A 4BFSA 5E2IA 2QMEA 3E9YA 1U0NA 5DTJA 4D99A 2VZ9A 3Q6MA 1ES9A 3CZ4A 3K8YA 2FMFA 3NH9A 3NW9A 2ZB8A 3M9LA 3TZCA 1QZUA 3BQMB 3KZNA 2AXPA 2PX4A 1JLSA 2JI4A 3A1NA 2C9MA 3I37X 3OQ1A 4GYWA 4J03A 4ZU3A 3BRCA 3OKFA 5A1TA 1EFLA 1WZ2A 4OMUA 3KQYA 2I29A 1R4NB 5E6RA 3H5LA 4XWKA 3TW0A 2KB0A 3COYA 1XZKA 4JZYA 1V6SA 2OAQ1 1W85B 2X0RA 3HGTA 1FS4A 4TXHA 3S0JA 5K51A 5A4KA 2O0LA 4DC9A 2EW8A 3GA0A 2VP9A 2ZP1A 4KFCA 1AN9A 3DD5A 3SYMA 3W4IA 3ICPA 2VP2A 1PTJA 3T34A 4D3FA 2Q9BA 3PHJA 3H0KA 2J9FB 3PJDA 5DTRA 3SLKA 3B82A 4NICA 2IQ5A 2YV5A 1ZPDA 4HQ6A 3HS3A 1TJNA 4FT2A 1I24A 4Q4LA 4TV9B 1WZUA 1Q3KA 1C7ZA 1PHRA 1R5OA 4DN6A 3AXTA 2RE8A 1TT5A 2H2IA 4QFCA 3OQOA 1VE7A 1E2MA 2FZ5A 3NBMA 3DCNA 2FZGA 3AG5A 2G63A 4KPGA 2YHUA 4MVJP 1WY5A 2RK6A 3KUCA 4XDGA 2Z2ZA 3ANTA 4TROA 5ALVA 1LBQA 1HYGA 3O90A 2YBEA 3WX0A 1C4KA 1AUVA 3GJSA 1P9LA 3OM9A 5DGHA 2FX3A 5EZYA 1EE1A 3P96A 4HZUB 2BZ0A 4ENUA 1XRPA 3KQTA 1DCTA 3WRYC 5F7OA 1PHPA 3E7DA 3NV9A 3BH7A 4YRAA 1XQWA 1MGOA 1ORVA 4Y1RA 1CVIA 5EIOA 2XZOA 2DGDA 1HDXA 3EXAA 1JHAA 2Z4SA 5CD1A 3QWIA 3NGMA 3VR3D 2ZIGA 2XHEA 4FT4A 2ZQ5A 3O8QB 4PC2A 5A0FA 3A04A 2Y4NA 3VYWA 3AESB 2ONKA 4KO1S 5EZYB 4JLKA 1EGHA 2F00A 4INZA 4MDYA 1E4EA 1PNVA 1DL5A 5L3RA 4HDSA 3NNDA 1SCUB 4MA5A 5LU8A 4KDRA 1N5DA 2ID4A 4QQNA 3I2GA 5JRZA 1WDMA 3H84A 4FXPA 1CY8A 1GZHB 3R3ZA 1MFZA 4YHBA 3RRMA 5BMVF 3U5ZB 2DXIA 2FZEA 4U0JA 2BDUA 3F6RA 4EH1A 3MN1A 2JJQA 2R5WA 5JSKA 4B6GA 5BOVA 4WK2B 2J48A 4KODA 4XE5A 4FFDA 1L7NA 5FQNA 3EDOA 1CY0A 4CKEB 1M6WA 4FFRA 3V00A 4F91B 2XOXA 4L8VA 1PJZA 3ZWDA 3MGGA 1J0XO 4H15A 2X4LA 2PT5A 2GN0A 4PAMA 3OWHA 2ZE7A 2WYOA 3AI1A 4MS4B 5GJVC 3UOGA 3UO8B 4KYVA 1H3NA 4RABA 3RUCA 4YCJA 1QLJA 4AICA 1B8OA 5JBIA 2HFJA 4FB5A 1V6AA 5I4CA 1E9RA 2G0NA 3VH4A 2CY0A 1WSDA 1FE8A 2YL2A 4FEAA 2WDZA 2I34A 5DHQA 2VLIA 3G0GA 4UTNA 5H80A 3I76A 4A8TA 3MJTA 1P19A 3BZUA 4JLUA 2C2ZA 2E49A 3ABSB 1FTWA 3OCWA 5HIAA 4G0XA 1XKLA 1Z4LA 3W3AH 3DHVA 4Z9AA 2G0TA 5BV0A 1XZHA 3A1UA 4CTNA 4DHEA 1X8JA 1XF9A 3RUAA 3I6BA 1DIBA 5DO9A 3HUUA 3T3IA 1TUBB 2NU7A 1HMYA 2GTPA 2QTZA 2WMDA 3OAAA 3ORRA 2L0XA 5CIQA 1Z73A 2Q8PA 2QVBA 1CY7A 2ROQA 2IGTA 2XPCA 4BFWA 2J3QA 2IZ7A 3CR7A 2NTYC 4IKOA 4R8SA 5FNVA 5K3FA 3THYB 2B3TA 3TTXA 3ZE9A 4LTDA 4OGKA 1GV0A 2O2DA 4MTLA 3UXEA 1U3VA 2H57A 1Z0SA 4RZUA 1Z4KA 4Y0AA 3B2NA 2W6CX 3FLEA 1T0PA 1NBOA 5A7HA 3B51X 3NKVA 4RJKA 3TPZA 5ALFA 2RONA 4M83A 4LFBB 4S1NA 3N8NA 5ARDA 5AP9A 2GN6A 4ILEA 3IGFA 4C08A 5KCZA 2H1LA 2CYAA 5HCNA 4EO7A 1YD7A 4G26A 4XXHA 5LCXA 4NAUA 2MSLA 3QLEA 4UVEA 1SXPA 1SZDA 1CNFA 3ROEA 3ZUGA 4BQSA 5FJJA 5GIOE 3L0OA 3VDMA 4Q9AA 4B3FX 2P9TA 3ROPA 1H2ZA 3ANMA 4FJ0A 1J99A 1DKQA 5LSAA 1VMKA 1BW9A 3A4NA 4MVJA 3URKA 5EERA 1Q3HA 1WXIA 3GHYA