4MXIA

Clpp ser98dha
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
170
Chain Sequence
b'DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAAMGSFLLAAGAKGKRFALPNAEVMIHQPQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Disruption of Oligomerization and Dehydroalanine Formation as Mechanisms for ClpP Protease Inhibition.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 58
structure length 170
sequence length 177
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4mxiA00
3BF0A 5E0NX 1YG6A 3QYRA 1WDMA 2IEXA 3KQFA 2FZSA 2A7KA 5DUFA 4U0GA 3OC7A 4B3IA 3WG5A 5INIA 3H0UA 4FN8A 5DZKH 1XNWA 5DU6A 3H81A 1FC6A 4FZWC 1HNUA 2VSSA 1XX4A 4QFEA 2QQ3A 3TDCA 4EMPA 4JFCA 2F6IA 3V5EA 1X0UA 3M6NA 3QXZA 2DEOA 3TZ3A 3I47A 3N6RB 3Q0JA 1PJHA 3U9TB 3QKAA 2CE3A 3P5MA 4JWVA 5DKPA 4ZU2A 5E0SA 3T8BA 4IZBA 3STAA 4OLQA 3QMJA 3TLFA 3PGQA 4JCRA 4JOTA 1DCIA 5DU8A 3RSTA 3TVWA 3ZW8A 1K39A 4HC8A 3OT6A 3T8AA 2BZRA 3H0QA 3U9SB 3ZWBA 1NZYB 1NZYA 4EMMA 4RYFA 1N6FA 2EJ5A 3BPPA 4GM2A 1O8UA 5DU4A 4FB8A 3ZW9A 3TRRA 1HZDA 2WTBA 5JBWA 4KWBA 4JVTA 3ISAA 1PIXA 3HP0A 3QXIA 1EF9A 2CBYA 2ZQQA 3HLN1 4FN7A 3DJAA 4OMRA 2PBPA 3PEAA 3OMEA 3ZWAA 4FJWD 4MOUA 3GMAA 4ZDCA 5DTPA 5DUCA 3R9SA 2VSUE 4NNQA 1K32A 2C8TA 1SG4A 2Q35A 1W2XA 2Q34A 4FZWA 4K29A 5JBXA 1SZOA 4JCQA 3JU1A 2ZL0A 1UYVA 4DI1A 3IBBA 3R6HA 4HNKA 1YG8A 3HE2A 5G1RA 3KTHA 4YLHA 5INGA 4WZ8B 2Q2XA 5DZKA 3NJDA 3NJBA 3R9TA 1TG6A 3TT7A 1EF8A 2UZFA 3BEZA 3T89A 3PE8A 3SLLA 5KDRB 5KDRA 3RSIA 4KPKA 5MGBA 3R0OA 5KJPA 3P2LA 4IZDA 4K3WA 3H0JA 4ZDDA 3FF6A 3KTGA 3QWDA 4MXIA 4EMLA 3GLMA 3PZKA 5CTBA 4QIIA 2NP9A 1HNOA 1ON9A 3H0SA 3QREA 3V5IA 3T88A 4U1AA 2ZL3A 4OG1A 1WDLA 4Z0MA 4NEKA 3KTKA 3ST9A 3R9QA 1XNYA 5FUSA 2ZL2A 2W3PA 4FNDA 2GTRA 2HW5A 5C90A 1Y7OA 2J5IB 2J5IA 3GF3A 4FNBA 2J5II 2VSSE 2X24A 2VREA 4MI2A 4F47A 1J7XA 2PPYA 1XNVA 1UYSA 4JYLA 3LAOA 3T3WA 1Q51A 4I4ZA 4U0HA 2J5GD 3H02A 4RCNA 2F9YB 2VSSF 4JCTA 1N6DA 4JSBA 2F9IB 2F9IA 3MYBA 4KD6A 5FIFA 1Q52A 1ON3A 1XO6A 2X58A 3K8XA 5CTCA 3SWXA 3K50A 4U0GH 1DUBA 2VSUF 3HRXA 4JJTA 1FC7A 1MJ3A 4K2NA 1N6EA 3M6MA 5C9GA 4I42A 3U9RB 3GF7A 4ELSA 3G64A 3Q7HA 2FBMA 4WYOB 2ZL4A 2J5SA 4IZCA 5IKLB 3IAVA 1RJMA 4KNPA 1FCFA 3TT6A 3MFMA 4U19A 1WZ8A 3TV5A 4I52A 3VIVA 1OD2A 1FC9A 5DTWA 2VSUA 1WDKA 5G1QA 5E0SH 1EY3A 2A81A 4U18A 1OD4A 2FW2A 3KTIA 2VSUC 5INFA 1TYFA 2A7SA 5DL1A 3Q0GA 2J5GA 4ELXA 4QIJA 3KTJA 4LK5A 3GKBA 4ZDBA 2F6QA 4GHNA 3TVUA 4Q0GA 4WCZA 4JYJA 3IB9A 3LKEA 1JXZA 3L3SA 3Q1TA 4ASIA 4RYFH 4ZDFA 2PG8A 4JCSA 3MT6A 2D3TA 2VX2A 2ZQRA 4B3HA 3RRVA 3MOYA 3P85A 4L6WA 1UIYA 4ELWA 1UYTA 2DUBA 3QK8A 4ZDEA 4G2RA 4Q1IA 3HINA 1VRGA 4B3JA 2F9YA 4L8KA 3ZWCA 3FDUA 1RJNA 1UYRA 5G1SA 3DORA
chains in the Genus database with same CATH superfamily
3BF0A 5E0NX 1YG6A 3QYRA 1WDMA 2IEXA 3KQFA 2FZSA 2A7KA 5DUFA 4U0GA 3OC7A 4B3IA 3WG5A 5INIA 3H0UA 4FN8A 5DZKH 1XNWA 5DU6A 3H81A 1FC6A 4FZWC 1HNUA 2VSSA 1XX4A 4QFEA 2QQ3A 3TDCA 4EMPA 4JFCA 2F6IA 4J2UA 3V5EA 1X0UA 3M6NA 3QXZA 2DEOA 3TZ3A 3I47A 3N6RB 3Q0JA 1PJHA 3U9TB 3QKAA 2CE3A 3P5MA 4JWVA 5DKPA 4ZU2A 5E0SA 3T8BA 4IZBA 3STAA 4OLQA 3QMJA 3TLFA 3PGQA 4JCRA 4JOTA 1DCIA 5DU8A 3RSTA 3TVWA 3ZW8A 1K39A 4HC8A 3OT6A 3T8AA 2BZRA 3H0QA 3U9SB 3ZWBA 1NZYB 1NZYA 4EMMA 4RYFA 1N6FA 2EJ5A 3BPPA 4GM2A 1O8UA 5DU4A 4FB8A 3ZW9A 3TRRA 1HZDA 2WTBA 5JBWA 4KWBA 4JVTA 3ISAA 1PIXA 3HP0A 3QXIA 1EF9A 2CBYA 2ZQQA 3HLN1 4FN7A 3DJAA 4OMRA 2PBPA 3PEAA 3OMEA 3ZWAA 4FJWD 4MOUA 3GMAA 4ZDCA 5DTPA 5DUCA 3R9SA 2VSUE 4NNQA 1K32A 2C8TA 1SG4A 2Q35A 1W2XA 2Q34A 4FZWA 4K29A 5JBXA 1SZOA 4JCQA 3JU1A 2ZL0A 1UYVA 4DI1A 3IBBA 3R6HA 4HNKA 1YG8A 3HE2A 5G1RA 3KTHA 4YLHA 5INGA 4WZ8B 2Q2XA 5DZKA 3NJDA 3NJBA 3R9TA 1TG6A 3TT7A 1EF8A 2UZFA 3BEZA 3T89A 3PE8A 3SLLA 5KDRB 5KDRA 3RSIA 4KPKA 5MGBA 3R0OA 5KJPA 3P2LA 4IZDA 4K3WA 3H0JA 4ZDDA 3FF6A 3KTGA 3QWDA 4MXIA 4EMLA 3GLMA 3PZKA 5CTBA 4QIIA 2NP9A 1HNOA 1ON9A 3H0SA 3QREA 3V5IA 3T88A 4U1AA 2ZL3A 4OG1A 1WDLA 4Z0MA 4NEKA 3KTKA 3ST9A 3R9QA 1XNYA 5FUSA 2ZL2A 2W3PA 4FNDA 2GTRA 2HW5A 5C90A 1Y7OA 2J5IB 2J5IA 3GF3A 4FNBA 2J5II 2VSSE 2X24A 2VREA 4MI2A 4F47A 1J7XA 2PPYA 1XNVA 1UYSA 4JYLA 3LAOA 3T3WA 1Q51A 4I4ZA 4U0HA 2J5GD 3H02A 4RCNA 2F9YB 2VSSF 4JCTA 1N6DA 4JSBA 2F9IB 2F9IA 3MYBA 4KD6A 5FIFA 1Q52A 1ON3A 1XO6A 2X58A 3K8XA 5CTCA 3SWXA 3K50A 4U0GH 1DUBA 2VSUF 3HRXA 4JJTA 1FC7A 1MJ3A 4K2NA 1N6EA 3M6MA 5C9GA 4I42A 4NARA 3U9RB 3GF7A 4ELSA 3G64A 3Q7HA 2FBMA 4WYOB 2ZL4A 2J5SA 4IZCA 5IKLB 3IAVA 1RJMA 4KNPA 1FCFA 3TT6A 3MFMA 4U19A 1WZ8A 3TV5A 4I52A 3VIVA 1OD2A 1FC9A 5DTWA 2VSUA 1WDKA 5G1QA 5E0SH 1EY3A 2A81A 4U18A 5HUQA 1OD4A 2FW2A 3KTIA 2VSUC 5INFA 1TYFA 2A7SA 5DL1A 3Q0GA 2J5GA 3BPTA 4ELXA 4QIJA 3KTJA 4LK5A 3GKBA 4ZDBA 2YJGA 2F6QA 4GHNA 3TVUA 4Q0GA 4WCZA 4JYJA 3IB9A 3LKEA 1JXZA 3L3SA 3Q1TA 4ASIA 4RYFH 4ZDFA 2PG8A 4JCSA 4HDTA 3MT6A 2D3TA 2VX2A 2ZQRA 4B3HA 3RRVA 3MOYA 3P85A 4L6WA 1UIYA 4ELWA 1UYTA 2DUBA 3QK8A 4ZDEA 4G2RA 4Q1IA 3HINA 1VRGA 4B3JA 2F9YA 4L8KA 3ZWCA 3FDUA 1RJNA 1UYRA 5G1SA 3DORA
chains in the Genus database with same CATH topology
3BF0A 5E0NX 1YG6A 3QYRA 1WDMA 2IEXA 3KQFA 2FZSA 2A7KA 5DUFA 4U0GA 3OC7A 4B3IA 3WG5A 5INIA 3H0UA 4FN8A 5DZKH 1XNWA 5DU6A 3H81A 1FC6A 4FZWC 1HNUA 2VSSA 1XX4A 4QFEA 2QQ3A 3TDCA 4EMPA 4JFCA 2F6IA 4J2UA 3V5EA 1X0UA 3M6NA 3QXZA 2DEOA 3TZ3A 3I47A 3N6RB 3Q0JA 1PJHA 3U9TB 3QKAA 2CE3A 3P5MA 4JWVA 5DKPA 4ZU2A 5E0SA 3T8BA 4IZBA 3STAA 4OLQA 3QMJA 3TLFA 3PGQA 4JCRA 4JOTA 1DCIA 5DU8A 3RSTA 3TVWA 3ZW8A 1K39A 4HC8A 3OT6A 3T8AA 2BZRA 3H0QA 3U9SB 3ZWBA 1NZYB 1NZYA 4EMMA 4RYFA 1N6FA 2EJ5A 3BPPA 4GM2A 1O8UA 5DU4A 4FB8A 3ZW9A 3TRRA 1HZDA 2WTBA 5JBWA 4KWBA 4JVTA 3ISAA 1PIXA 3HP0A 3QXIA 1EF9A 2CBYA 2ZQQA 3HLN1 4FN7A 3DJAA 4OMRA 2PBPA 3PEAA 3OMEA 3ZWAA 4FJWD 4MOUA 3GMAA 4ZDCA 5DTPA 5DUCA 3R9SA 2VSUE 4NNQA 1K32A 2C8TA 1SG4A 2Q35A 1W2XA 2Q34A 4FZWA 4K29A 5JBXA 1SZOA 4JCQA 3JU1A 2ZL0A 1UYVA 4DI1A 3IBBA 3R6HA 4HNKA 1YG8A 3HE2A 5G1RA 3KTHA 4YLHA 5INGA 4WZ8B 2Q2XA 5DZKA 3NJDA 3NJBA 3R9TA 1TG6A 3TT7A 1EF8A 2UZFA 3BEZA 3T89A 3PE8A 3SLLA 5KDRB 5KDRA 3RSIA 4KPKA 5MGBA 3R0OA 5KJPA 3P2LA 4IZDA 4K3WA 3H0JA 4ZDDA 3FF6A 3KTGA 3QWDA 4MXIA 4EMLA 3GLMA 3PZKA 5CTBA 4QIIA 2NP9A 1HNOA 1ON9A 3H0SA 3QREA 3V5IA 3T88A 4U1AA 2ZL3A 4OG1A 1WDLA 4Z0MA 4NEKA 3KTKA 3ST9A 3R9QA 1XNYA 5FUSA 2ZL2A 2W3PA 4FNDA 2GTRA 2HW5A 5C90A 1Y7OA 2J5IB 2J5IA 3GF3A 4FNBA 2J5II 2VSSE 2X24A 2VREA 4MI2A 4F47A 1J7XA 2PPYA 1XNVA 1UYSA 4JYLA 3LAOA 3T3WA 1Q51A 4I4ZA 4U0HA 2J5GD 3H02A 4RCNA 2F9YB 2VSSF 4JCTA 1N6DA 4JSBA 2F9IB 2F9IA 3MYBA 4KD6A 5FIFA 1Q52A 1ON3A 1XO6A 2X58A 3K8XA 5CTCA 3SWXA 3K50A 4U0GH 1DUBA 2VSUF 3HRXA 4JJTA 1FC7A 1MJ3A 4K2NA 1N6EA 3M6MA 5C9GA 4I42A 4NARA 3U9RB 3GF7A 4ELSA 3G64A 3Q7HA 2FBMA 4WYOB 2ZL4A 2J5SA 4IZCA 5IKLB 3IAVA 1RJMA 4KNPA 1FCFA 3TT6A 3MFMA 4U19A 1WZ8A 3TV5A 4I52A 3VIVA 1OD2A 1FC9A 5DTWA 2VSUA 1WDKA 5G1QA 5E0SH 1EY3A 2A81A 4U18A 5HUQA 1OD4A 2FW2A 3KTIA 2VSUC 5INFA 1TYFA 2A7SA 5DL1A 3Q0GA 2J5GA 3BPTA 4ELXA 4QIJA 3KTJA 4LK5A 3GKBA 4ZDBA 2YJGA 2F6QA 4GHNA 3TVUA 4Q0GA 4WCZA 4JYJA 3IB9A 3LKEA 1JXZA 3L3SA 3Q1TA 4ASIA 4RYFH 4ZDFA 2PG8A 4JCSA 4HDTA 3MT6A 2D3TA 2VX2A 2ZQRA 4B3HA 3RRVA 3MOYA 3P85A 4L6WA 1UIYA 4ELWA 1UYTA 2DUBA 3QK8A 4ZDEA 4G2RA 4Q1IA 3HINA 1VRGA 4B3JA 2F9YA 4L8KA 3ZWCA 3FDUA 1RJNA 1UYRA 5G1SA 3DORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF0 A;  5E0N X;  1YG6 A;  3QYR A;  1WDM A;  2IEX A;  3KQF A;  2FZS A;  2A7K A;  5DUF A;  4U0G A;  3OC7 A;  4B3I A;  3WG5 A;  5INI A;  3H0U A;  4FN8 A;  5DZK H;  1XNW A;  5DU6 A;  3H81 A;  1FC6 A;  4FZW C;  1HNU A;  2VSS A;  1XX4 A;  4QFE A;  2QQ3 A;  3TDC A;  4EMP A;  4JFC A;  2F6I A;  3V5E A;  1X0U A;  3M6N A;  3QXZ A;  2DEO A;  3TZ3 A;  3I47 A;  3N6R B;  3Q0J A;  1PJH A;  3U9T B;  3QKA A;  2CE3 A;  3P5M A;  4JWV A;  5DKP A;  4ZU2 A;  5E0S A;  3T8B A;  4IZB A;  3STA A;  4OLQ A;  3QMJ A;  3TLF A;  3PGQ A;  4JCR A;  4JOT A;  1DCI A;  5DU8 A;  3RST A;  3TVW A;  3ZW8 A;  1K39 A;  4HC8 A;  3OT6 A;  3T8A A;  2BZR A;  3H0Q A;  3U9S B;  3ZWB A;  1NZY B;  1NZY A;  4EMM A;  4RYF A;  1N6F A;  2EJ5 A;  3BPP A;  4GM2 A;  1O8U A;  5DU4 A;  4FB8 A;  3ZW9 A;  3TRR A;  1HZD A;  2WTB A;  5JBW A;  4KWB A;  4JVT A;  3ISA A;  1PIX A;  3HP0 A;  3QXI A;  1EF9 A;  2CBY A;  2ZQQ A;  3HLN 1;  4FN7 A;  3DJA A;  4OMR A;  2PBP A;  3PEA A;  3OME A;  3ZWA A;  4FJW D;  4MOU A;  3GMA A;  4ZDC A;  5DTP A;  5DUC A;  3R9S A;  2VSU E;  4NNQ A;  1K32 A;  2C8T A;  1SG4 A;  2Q35 A;  1W2X A;  2Q34 A;  4FZW A;  4K29 A;  5JBX A;  1SZO A;  4JCQ A;  3JU1 A;  2ZL0 A;  1UYV A;  4DI1 A;  3IBB A;  3R6H A;  4HNK A;  1YG8 A;  3HE2 A;  5G1R A;  3KTH A;  4YLH A;  5ING A;  4WZ8 B;  2Q2X A;  5DZK A;  3NJD A;  3NJB A;  3R9T A;  1TG6 A;  3TT7 A;  1EF8 A;  2UZF A;  3BEZ A;  3T89 A;  3PE8 A;  3SLL A;  5KDR B;  5KDR A;  3RSI A;  4KPK A;  5MGB A;  3R0O A;  5KJP A;  3P2L A;  4IZD A;  4K3W A;  3H0J A;  4ZDD A;  3FF6 A;  3KTG A;  3QWD A;  4MXI A;  4EML A;  3GLM A;  3PZK A;  5CTB A;  4QII A;  2NP9 A;  1HNO A;  1ON9 A;  3H0S A;  3QRE A;  3V5I A;  3T88 A;  4U1A A;  2ZL3 A;  4OG1 A;  1WDL A;  4Z0M A;  4NEK A;  3KTK A;  3ST9 A;  3R9Q A;  1XNY A;  5FUS A;  2ZL2 A;  2W3P A;  4FND A;  2GTR A;  2HW5 A;  5C90 A;  1Y7O A;  2J5I B;  2J5I A;  3GF3 A;  4FNB A;  2J5I I;  2VSS E;  2X24 A;  2VRE A;  4MI2 A;  4F47 A;  1J7X A;  2PPY A;  1XNV A;  1UYS A;  4JYL A;  3LAO A;  3T3W A;  1Q51 A;  4I4Z A;  4U0H A;  2J5G D;  3H02 A;  4RCN A;  2F9Y B;  2VSS F;  4JCT A;  1N6D A;  4JSB A;  2F9I B;  2F9I A;  3MYB A;  4KD6 A;  5FIF A;  1Q52 A;  1ON3 A;  1XO6 A;  2X58 A;  3K8X A;  5CTC A;  3SWX A;  3K50 A;  4U0G H;  1DUB A;  2VSU F;  3HRX A;  4JJT A;  1FC7 A;  1MJ3 A;  4K2N A;  1N6E A;  3M6M A;  5C9G A;  4I42 A;  3U9R B;  3GF7 A;  4ELS A;  3G64 A;  3Q7H A;  2FBM A;  4WYO B;  2ZL4 A;  2J5S A;  4IZC A;  5IKL B;  3IAV A;  1RJM A;  4KNP A;  1FCF A;  3TT6 A;  3MFM A;  4U19 A;  1WZ8 A;  3TV5 A;  4I52 A;  3VIV A;  1OD2 A;  1FC9 A;  5DTW A;  2VSU A;  1WDK A;  5G1Q A;  5E0S H;  1EY3 A;  2A81 A;  4U18 A;  1OD4 A;  2FW2 A;  3KTI A;  2VSU C;  5INF A;  1TYF A;  2A7S A;  5DL1 A;  3Q0G A;  2J5G A;  4ELX A;  4QIJ A;  3KTJ A;  4LK5 A;  3GKB A;  4ZDB A;  2F6Q A;  4GHN A;  3TVU A;  4Q0G A;  4WCZ A;  4JYJ A;  3IB9 A;  3LKE A;  1JXZ A;  3L3S A;  3Q1T A;  4ASI A;  4RYF H;  4ZDF A;  2PG8 A;  4JCS A;  3MT6 A;  2D3T A;  2VX2 A;  2ZQR A;  4B3H A;  3RRV A;  3MOY A;  3P85 A;  4L6W A;  1UIY A;  4ELW A;  1UYT A;  2DUB A;  3QK8 A;  4ZDE A;  4G2R A;  4Q1I A;  3HIN A;  1VRG A;  4B3J A;  2F9Y A;  4L8K A;  3ZWC A;  3FDU A;  1RJN A;  1UYR A;  5G1S A;  3DOR A; 
#chains in the Genus database with same CATH topology
 3BF0 A;  5E0N X;  1YG6 A;  3QYR A;  1WDM A;  2IEX A;  3KQF A;  2FZS A;  2A7K A;  5DUF A;  4U0G A;  3OC7 A;  4B3I A;  3WG5 A;  5INI A;  3H0U A;  4FN8 A;  5DZK H;  1XNW A;  5DU6 A;  3H81 A;  1FC6 A;  4FZW C;  1HNU A;  2VSS A;  1XX4 A;  4QFE A;  2QQ3 A;  3TDC A;  4EMP A;  4JFC A;  2F6I A;  4J2U A;  3V5E A;  1X0U A;  3M6N A;  3QXZ A;  2DEO A;  3TZ3 A;  3I47 A;  3N6R B;  3Q0J A;  1PJH A;  3U9T B;  3QKA A;  2CE3 A;  3P5M A;  4JWV A;  5DKP A;  4ZU2 A;  5E0S A;  3T8B A;  4IZB A;  3STA A;  4OLQ A;  3QMJ A;  3TLF A;  3PGQ A;  4JCR A;  4JOT A;  1DCI A;  5DU8 A;  3RST A;  3TVW A;  3ZW8 A;  1K39 A;  4HC8 A;  3OT6 A;  3T8A A;  2BZR A;  3H0Q A;  3U9S B;  3ZWB A;  1NZY B;  1NZY A;  4EMM A;  4RYF A;  1N6F A;  2EJ5 A;  3BPP A;  4GM2 A;  1O8U A;  5DU4 A;  4FB8 A;  3ZW9 A;  3TRR A;  1HZD A;  2WTB A;  5JBW A;  4KWB A;  4JVT A;  3ISA A;  1PIX A;  3HP0 A;  3QXI A;  1EF9 A;  2CBY A;  2ZQQ A;  3HLN 1;  4FN7 A;  3DJA A;  4OMR A;  2PBP A;  3PEA A;  3OME A;  3ZWA A;  4FJW D;  4MOU A;  3GMA A;  4ZDC A;  5DTP A;  5DUC A;  3R9S A;  2VSU E;  4NNQ A;  1K32 A;  2C8T A;  1SG4 A;  2Q35 A;  1W2X A;  2Q34 A;  4FZW A;  4K29 A;  5JBX A;  1SZO A;  4JCQ A;  3JU1 A;  2ZL0 A;  1UYV A;  4DI1 A;  3IBB A;  3R6H A;  4HNK A;  1YG8 A;  3HE2 A;  5G1R A;  3KTH A;  4YLH A;  5ING A;  4WZ8 B;  2Q2X A;  5DZK A;  3NJD A;  3NJB A;  3R9T A;  1TG6 A;  3TT7 A;  1EF8 A;  2UZF A;  3BEZ A;  3T89 A;  3PE8 A;  3SLL A;  5KDR B;  5KDR A;  3RSI A;  4KPK A;  5MGB A;  3R0O A;  5KJP A;  3P2L A;  4IZD A;  4K3W A;  3H0J A;  4ZDD A;  3FF6 A;  3KTG A;  3QWD A;  4MXI A;  4EML A;  3GLM A;  3PZK A;  5CTB A;  4QII A;  2NP9 A;  1HNO A;  1ON9 A;  3H0S A;  3QRE A;  3V5I A;  3T88 A;  4U1A A;  2ZL3 A;  4OG1 A;  1WDL A;  4Z0M A;  4NEK A;  3KTK A;  3ST9 A;  3R9Q A;  1XNY A;  5FUS A;  2ZL2 A;  2W3P A;  4FND A;  2GTR A;  2HW5 A;  5C90 A;  1Y7O A;  2J5I B;  2J5I A;  3GF3 A;  4FNB A;  2J5I I;  2VSS E;  2X24 A;  2VRE A;  4MI2 A;  4F47 A;  1J7X A;  2PPY A;  1XNV A;  1UYS A;  4JYL A;  3LAO A;  3T3W A;  1Q51 A;  4I4Z A;  4U0H A;  2J5G D;  3H02 A;  4RCN A;  2F9Y B;  2VSS F;  4JCT A;  1N6D A;  4JSB A;  2F9I B;  2F9I A;  3MYB A;  4KD6 A;  5FIF A;  1Q52 A;  1ON3 A;  1XO6 A;  2X58 A;  3K8X A;  5CTC A;  3SWX A;  3K50 A;  4U0G H;  1DUB A;  2VSU F;  3HRX A;  4JJT A;  1FC7 A;  1MJ3 A;  4K2N A;  1N6E A;  3M6M A;  5C9G A;  4I42 A;  4NAR A;  3U9R B;  3GF7 A;  4ELS A;  3G64 A;  3Q7H A;  2FBM A;  4WYO B;  2ZL4 A;  2J5S A;  4IZC A;  5IKL B;  3IAV A;  1RJM A;  4KNP A;  1FCF A;  3TT6 A;  3MFM A;  4U19 A;  1WZ8 A;  3TV5 A;  4I52 A;  3VIV A;  1OD2 A;  1FC9 A;  5DTW A;  2VSU A;  1WDK A;  5G1Q A;  5E0S H;  1EY3 A;  2A81 A;  4U18 A;  5HUQ A;  1OD4 A;  2FW2 A;  3KTI A;  2VSU C;  5INF A;  1TYF A;  2A7S A;  5DL1 A;  3Q0G A;  2J5G A;  3BPT A;  4ELX A;  4QIJ A;  3KTJ A;  4LK5 A;  3GKB A;  4ZDB A;  2YJG A;  2F6Q A;  4GHN A;  3TVU A;  4Q0G A;  4WCZ A;  4JYJ A;  3IB9 A;  3LKE A;  1JXZ A;  3L3S A;  3Q1T A;  4ASI A;  4RYF H;  4ZDF A;  2PG8 A;  4JCS A;  4HDT A;  3MT6 A;  2D3T A;  2VX2 A;  2ZQR A;  4B3H A;  3RRV A;  3MOY A;  3P85 A;  4L6W A;  1UIY A;  4ELW A;  1UYT A;  2DUB A;  3QK8 A;  4ZDE A;  4G2R A;  4Q1I A;  3HIN A;  1VRG A;  4B3J A;  2F9Y A;  4L8K A;  3ZWC A;  3FDU A;  1RJN A;  1UYR A;  5G1S A;  3DOR A; 
#chains in the Genus database with same CATH homology
 3BF0 A;  5E0N X;  1YG6 A;  3QYR A;  1WDM A;  2IEX A;  3KQF A;  2FZS A;  2A7K A;  5DUF A;  4U0G A;  3OC7 A;  4B3I A;  3WG5 A;  5INI A;  3H0U A;  4FN8 A;  5DZK H;  1XNW A;  5DU6 A;  3H81 A;  1FC6 A;  4FZW C;  1HNU A;  2VSS A;  1XX4 A;  4QFE A;  2QQ3 A;  3TDC A;  4EMP A;  4JFC A;  2F6I A;  4J2U A;  3V5E A;  1X0U A;  3M6N A;  3QXZ A;  2DEO A;  3TZ3 A;  3I47 A;  3N6R B;  3Q0J A;  1PJH A;  3U9T B;  3QKA A;  2CE3 A;  3P5M A;  4JWV A;  5DKP A;  4ZU2 A;  5E0S A;  3T8B A;  4IZB A;  3STA A;  4OLQ A;  3QMJ A;  3TLF A;  3PGQ A;  4JCR A;  4JOT A;  1DCI A;  5DU8 A;  3RST A;  3TVW A;  3ZW8 A;  1K39 A;  4HC8 A;  3OT6 A;  3T8A A;  2BZR A;  3H0Q A;  3U9S B;  3ZWB A;  1NZY B;  1NZY A;  4EMM A;  4RYF A;  1N6F A;  2EJ5 A;  3BPP A;  4GM2 A;  1O8U A;  5DU4 A;  4FB8 A;  3ZW9 A;  3TRR A;  1HZD A;  2WTB A;  5JBW A;  4KWB A;  4JVT A;  3ISA A;  1PIX A;  3HP0 A;  3QXI A;  1EF9 A;  2CBY A;  2ZQQ A;  3HLN 1;  4FN7 A;  3DJA A;  4OMR A;  2PBP A;  3PEA A;  3OME A;  3ZWA A;  4FJW D;  4MOU A;  3GMA A;  4ZDC A;  5DTP A;  5DUC A;  3R9S A;  2VSU E;  4NNQ A;  1K32 A;  2C8T A;  1SG4 A;  2Q35 A;  1W2X A;  2Q34 A;  4FZW A;  4K29 A;  5JBX A;  1SZO A;  4JCQ A;  3JU1 A;  2ZL0 A;  1UYV A;  4DI1 A;  3IBB A;  3R6H A;  4HNK A;  1YG8 A;  3HE2 A;  5G1R A;  3KTH A;  4YLH A;  5ING A;  4WZ8 B;  2Q2X A;  5DZK A;  3NJD A;  3NJB A;  3R9T A;  1TG6 A;  3TT7 A;  1EF8 A;  2UZF A;  3BEZ A;  3T89 A;  3PE8 A;  3SLL A;  5KDR B;  5KDR A;  3RSI A;  4KPK A;  5MGB A;  3R0O A;  5KJP A;  3P2L A;  4IZD A;  4K3W A;  3H0J A;  4ZDD A;  3FF6 A;  3KTG A;  3QWD A;  4MXI A;  4EML A;  3GLM A;  3PZK A;  5CTB A;  4QII A;  2NP9 A;  1HNO A;  1ON9 A;  3H0S A;  3QRE A;  3V5I A;  3T88 A;  4U1A A;  2ZL3 A;  4OG1 A;  1WDL A;  4Z0M A;  4NEK A;  3KTK A;  3ST9 A;  3R9Q A;  1XNY A;  5FUS A;  2ZL2 A;  2W3P A;  4FND A;  2GTR A;  2HW5 A;  5C90 A;  1Y7O A;  2J5I B;  2J5I A;  3GF3 A;  4FNB A;  2J5I I;  2VSS E;  2X24 A;  2VRE A;  4MI2 A;  4F47 A;  1J7X A;  2PPY A;  1XNV A;  1UYS A;  4JYL A;  3LAO A;  3T3W A;  1Q51 A;  4I4Z A;  4U0H A;  2J5G D;  3H02 A;  4RCN A;  2F9Y B;  2VSS F;  4JCT A;  1N6D A;  4JSB A;  2F9I B;  2F9I A;  3MYB A;  4KD6 A;  5FIF A;  1Q52 A;  1ON3 A;  1XO6 A;  2X58 A;  3K8X A;  5CTC A;  3SWX A;  3K50 A;  4U0G H;  1DUB A;  2VSU F;  3HRX A;  4JJT A;  1FC7 A;  1MJ3 A;  4K2N A;  1N6E A;  3M6M A;  5C9G A;  4I42 A;  4NAR A;  3U9R B;  3GF7 A;  4ELS A;  3G64 A;  3Q7H A;  2FBM A;  4WYO B;  2ZL4 A;  2J5S A;  4IZC A;  5IKL B;  3IAV A;  1RJM A;  4KNP A;  1FCF A;  3TT6 A;  3MFM A;  4U19 A;  1WZ8 A;  3TV5 A;  4I52 A;  3VIV A;  1OD2 A;  1FC9 A;  5DTW A;  2VSU A;  1WDK A;  5G1Q A;  5E0S H;  1EY3 A;  2A81 A;  4U18 A;  5HUQ A;  1OD4 A;  2FW2 A;  3KTI A;  2VSU C;  5INF A;  1TYF A;  2A7S A;  5DL1 A;  3Q0G A;  2J5G A;  3BPT A;  4ELX A;  4QIJ A;  3KTJ A;  4LK5 A;  3GKB A;  4ZDB A;  2YJG A;  2F6Q A;  4GHN A;  3TVU A;  4Q0G A;  4WCZ A;  4JYJ A;  3IB9 A;  3LKE A;  1JXZ A;  3L3S A;  3Q1T A;  4ASI A;  4RYF H;  4ZDF A;  2PG8 A;  4JCS A;  4HDT A;  3MT6 A;  2D3T A;  2VX2 A;  2ZQR A;  4B3H A;  3RRV A;  3MOY A;  3P85 A;  4L6W A;  1UIY A;  4ELW A;  1UYT A;  2DUB A;  3QK8 A;  4ZDE A;  4G2R A;  4Q1I A;  3HIN A;  1VRG A;  4B3J A;  2F9Y A;  4L8K A;  3ZWC A;  3FDU A;  1RJN A;  1UYR A;  5G1S A;  3DOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...