4MXIA

Clpp ser98dha
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
170
Chain Sequence
DIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAAMGSFLLAAGAKGKRFALPNAEVMIHQPQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disruption of Oligomerization and Dehydroalanine Formation as Mechanisms for ClpP Protease Inhibition.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 58
structure length 170
sequence length 177
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4mxiA00
1ON9A 3T8BA 1EF8A 4MI2A 2BZRA 4FN7A 4FNDA 4JSBA 4KPKA 3L3SA 3KTJA 4KD6A 4JYLA 3NJBA 3R9SA 1J7XA 3T3WA 3R9TA 5E0NX 3U9RB 4JCSA 3KTIA 4Z0MA 2QQ3A 3PEAA 3QMJA 4L6WA 3QK8A 1WZ8A 3DJAA 1UYVA 3H02A 4RCNA 4FN8A 4EMMA 5DU4A 5FIFA 5INIA 3GLMA 5DU8A 4JFCA 2J5SA 3TLFA 2ZL2A 1DCIA 1HNOA 5DUFA 4B3HA 5DZKH 4JVTA 3RSTA 5IKLB 4NNQA 1FC6A 2WTBA 4I42A 4HNKA 3IB9A 4U1AA 4GM2A 1XNVA 3OC7A 3MOYA 3ZW9A 5JBXA 4QFEA 2A7KA 3HP0A 2PPYA 2UZFA 1EF9A 1VRGA 3BPPA 3Q7HA 1X0UA 5C9GA 3TZ3A 3BEZA 2C8TA 3H0SA 4ELXA 5MGBA 4ZDDA 5JBWA 1K39A 4ZDCA 3H0QA 3P85A 1YG8A 4I52A 3H0JA 2J5IB 4JCRA 3PE8A 3FF6A 5DZKA 3GMAA 3RRVA 4KWBA 1OD2A 4K29A 2CE3A 2DEOA 5KDRB 3K50A 3LKEA 2VSSA 4QIJA 3I47A 3WG5A 1ON3A 3H0UA 4GHNA 3ZW8A 4Q0GA 3TV5A 3PGQA 4MXIA 4EMPA 4IZCA 1Y7OA 3KTKA 3MYBA 2D3TA 2GTRA 4B3JA 3TT7A 4JCQA 5E0SH 4YLHA 4QIIA 3KQFA 5KDRA 3ISAA 1TYFA 1OD4A 1UYTA 1WDKA 5DTWA 2ZL4A 3N6RB 4U0GH 3MFMA 4IZBA 3SLLA 3KTHA 4FJWD 4K2NA 4RYFH 4LK5A 1PIXA 2A7SA 1XNWA 2Q34A 3HE2A 4JWVA 3QXZA 4FNBA 3QKAA 1RJNA 3QYRA 5CTBA 3KTGA 1RJMA 2F9YA 3PZKA 3ZWCA 4WCZA 2J5GA 4FZWC 4EMLA 5DL1A 5DKPA 1XX4A 3TVUA 2A81A 3ZWBA 1W2XA 4I4ZA 1TG6A 1WDMA 2ZQRA 1K32A 3V5EA 3P5MA 3RSIA 2J5GD 2PBPA 1WDLA 3P2LA 1HNUA 3ST9A 2NP9A 3QXIA 3G64A 2X24A 1O8UA 2ZQQA 5INGA 1NZYA 2FZSA 3NJDA 3T8AA 3VIVA 2EJ5A 1UIYA 4OMRA 4JCTA 4L8KA 3Q1TA 3GKBA 4Q1IA 3TVWA 1UYSA 1XNYA 3Q0JA 4ZDEA 4ELSA 2F6QA 3OT6A 1DUBA 3M6NA 4ZDFA 2W3PA 3BF0A 3V5IA 4B3IA 3HLN1 3MT6A 4ZDBA 3R6HA 4KNPA 4MOUA 3HINA 1XO6A 3Q0GA 1PJHA 5FUSA 2VREA 4K3WA 4OG1A 5C90A 2VSUA 2J5IA 5CTCA 5G1QA 1FC7A 1FC9A 1N6EA 4HC8A 5G1SA 1MJ3A 3R9QA 5DU6A 1N6DA 2VSSF 3ZWAA 4FZWA 2F9YB 2PG8A 3IBBA 3U9SB 4JJTA 2ZL3A 1SZOA 4ZU2A 3GF3A 1HZDA 1YG6A 3JU1A 3DORA 2VSUF 2DUBA 4F47A 3FDUA 1Q51A 2Q2XA 5G1RA 4WZ8B 4U0GA 2CBYA 5KJPA 4NEKA 1NZYB 2HW5A 4JOTA 4RYFA 5E0SA 1SG4A 3LAOA 4IZDA 3SWXA 5DTPA 4WYOB 3GF7A 1EY3A 2F9IA 2VSUC 3OMEA 3IAVA 3QWDA 4U0HA 1N6FA 1JXZA 3TT6A 1Q52A 4G2RA 1UYRA 4DI1A 3K8XA 3QREA 1FCFA 2VX2A 2VSUE 2FBMA 4ELWA 2FW2A 2Q35A 3R0OA 2IEXA 3U9TB 2F6IA 4ASIA 2X58A 3T88A 3TDCA 2VSSE 2F9IB 4U18A 3HRXA 3T89A 5INFA 4U19A 3TRRA 4JYJA 5DUCA 3H81A 3M6MA 3STAA 4OLQA 4FB8A 2ZL0A 2J5II
chains in the Genus database with same CATH superfamily
1ON9A 4J2UA 1EF8A 3T8BA 4MI2A 2BZRA 4FN7A 4FNDA 4JSBA 4KPKA 3L3SA 3KTJA 4KD6A 4JYLA 3NJBA 3R9SA 1J7XA 3T3WA 3R9TA 5E0NX 3U9RB 4JCSA 3KTIA 4Z0MA 2QQ3A 3PEAA 3QMJA 4L6WA 3QK8A 1WZ8A 3DJAA 1UYVA 3H02A 4RCNA 4FN8A 4EMMA 5DU4A 5FIFA 5INIA 3GLMA 5DU8A 4JFCA 2J5SA 3TLFA 2ZL2A 1DCIA 1HNOA 5DUFA 4B3HA 5DZKH 4JVTA 3RSTA 5IKLB 4NNQA 1FC6A 2WTBA 4I42A 4HNKA 3IB9A 4U1AA 4GM2A 1XNVA 3OC7A 3MOYA 3ZW9A 5JBXA 4QFEA 2A7KA 3HP0A 2PPYA 2UZFA 1EF9A 1VRGA 3BPPA 3Q7HA 1X0UA 5C9GA 3TZ3A 3BEZA 2C8TA 3H0SA 4ELXA 5MGBA 4ZDDA 5JBWA 1K39A 4ZDCA 3H0QA 3P85A 1YG8A 4I52A 3H0JA 2J5IB 4JCRA 3PE8A 3FF6A 5DZKA 3GMAA 3RRVA 4KWBA 1OD2A 4K29A 2CE3A 2DEOA 5KDRB 3K50A 3LKEA 2VSSA 4QIJA 3I47A 3WG5A 1ON3A 3H0UA 4GHNA 3ZW8A 4Q0GA 3TV5A 3PGQA 4MXIA 4EMPA 4IZCA 1Y7OA 3KTKA 3MYBA 2D3TA 2GTRA 4B3JA 3TT7A 4JCQA 5E0SH 4YLHA 3BPTA 4QIIA 3KQFA 3ISAA 5KDRA 1TYFA 1OD4A 1UYTA 1WDKA 5DTWA 2ZL4A 3N6RB 4U0GH 3MFMA 4IZBA 3SLLA 3KTHA 4FJWD 4K2NA 4RYFH 4LK5A 1PIXA 2A7SA 1XNWA 2Q34A 3HE2A 4JWVA 3QXZA 4FNBA 3QKAA 1RJNA 3QYRA 5CTBA 3KTGA 1RJMA 2F9YA 3PZKA 3ZWCA 4WCZA 2J5GA 4FZWC 4EMLA 5DL1A 5DKPA 1XX4A 3TVUA 2A81A 3ZWBA 1W2XA 4I4ZA 1TG6A 1WDMA 2ZQRA 1K32A 3V5EA 3P5MA 4NARA 3RSIA 2J5GD 2PBPA 1WDLA 3P2LA 1HNUA 3ST9A 2NP9A 3QXIA 3G64A 2X24A 1O8UA 2ZQQA 5INGA 1NZYA 2FZSA 3NJDA 3T8AA 3VIVA 2EJ5A 1UIYA 4OMRA 4JCTA 4L8KA 3Q1TA 3GKBA 4Q1IA 3TVWA 1UYSA 1XNYA 4ELSA 3Q0JA 4ZDEA 2F6QA 3OT6A 1DUBA 3M6NA 4ZDFA 2W3PA 3BF0A 3V5IA 4B3IA 3HLN1 3MT6A 4ZDBA 3R6HA 4KNPA 4MOUA 3HINA 1XO6A 3Q0GA 1PJHA 5FUSA 2VREA 4K3WA 4OG1A 5C90A 2VSUA 2J5IA 5CTCA 5G1QA 1FC7A 1FC9A 1N6EA 4HC8A 5G1SA 1MJ3A 3R9QA 5DU6A 1N6DA 2VSSF 3ZWAA 4FZWA 2F9YB 2PG8A 3IBBA 3U9SB 4JJTA 2ZL3A 1SZOA 4ZU2A 3GF3A 1HZDA 1YG6A 3JU1A 3DORA 2VSUF 2DUBA 4F47A 3FDUA 1Q51A 2Q2XA 5G1RA 4WZ8B 4U0GA 2CBYA 5KJPA 4NEKA 1NZYB 2HW5A 4JOTA 4RYFA 5E0SA 1SG4A 3LAOA 4IZDA 3SWXA 5DTPA 4WYOB 5HUQA 3GF7A 1EY3A 2F9IA 2VSUC 3OMEA 3IAVA 3QWDA 4HDTA 4U0HA 1N6FA 1JXZA 3TT6A 1Q52A 4G2RA 1UYRA 4DI1A 3K8XA 3QREA 1FCFA 2VX2A 2VSUE 2FBMA 4ELWA 2FW2A 2Q35A 3R0OA 2IEXA 3U9TB 2F6IA 4ASIA 2X58A 3T88A 3TDCA 2VSSE 2F9IB 4U18A 3HRXA 2YJGA 3T89A 5INFA 4U19A 3TRRA 4JYJA 5DUCA 3H81A 3M6MA 3STAA 4OLQA 4FB8A 2ZL0A 2J5II
chains in the Genus database with same CATH topology
1ON9A 4J2UA 1EF8A 3T8BA 4MI2A 2BZRA 4FN7A 4FNDA 4JSBA 4KPKA 3L3SA 3KTJA 4KD6A 4JYLA 3NJBA 3R9SA 1J7XA 3T3WA 3R9TA 5E0NX 3U9RB 4JCSA 3KTIA 4Z0MA 2QQ3A 3PEAA 3QMJA 4L6WA 3QK8A 1WZ8A 3DJAA 1UYVA 3H02A 4RCNA 4FN8A 4EMMA 5DU4A 5FIFA 5INIA 3GLMA 5DU8A 4JFCA 2J5SA 3TLFA 2ZL2A 1DCIA 1HNOA 5DUFA 4B3HA 5DZKH 4JVTA 3RSTA 5IKLB 4NNQA 1FC6A 2WTBA 4I42A 4HNKA 3IB9A 4U1AA 4GM2A 1XNVA 3OC7A 3MOYA 3ZW9A 5JBXA 4QFEA 2A7KA 3HP0A 2PPYA 2UZFA 1EF9A 1VRGA 3BPPA 3Q7HA 1X0UA 5C9GA 3TZ3A 3BEZA 2C8TA 3H0SA 4ELXA 5MGBA 4ZDDA 5JBWA 1K39A 4ZDCA 3H0QA 3P85A 1YG8A 4I52A 3H0JA 2J5IB 4JCRA 3PE8A 3FF6A 5DZKA 3GMAA 3RRVA 4KWBA 1OD2A 4K29A 2CE3A 2DEOA 5KDRB 3K50A 3LKEA 2VSSA 4QIJA 3I47A 3WG5A 1ON3A 3H0UA 4GHNA 3ZW8A 4Q0GA 3TV5A 3PGQA 4MXIA 4EMPA 4IZCA 1Y7OA 3KTKA 3MYBA 2D3TA 2GTRA 4B3JA 3TT7A 4JCQA 5E0SH 4YLHA 3BPTA 4QIIA 3KQFA 3ISAA 5KDRA 1TYFA 1OD4A 1UYTA 1WDKA 5DTWA 2ZL4A 3N6RB 4U0GH 3MFMA 4IZBA 3SLLA 3KTHA 4FJWD 4K2NA 4RYFH 4LK5A 1PIXA 2A7SA 1XNWA 2Q34A 3HE2A 4JWVA 3QXZA 4FNBA 3QKAA 1RJNA 3QYRA 5CTBA 3KTGA 1RJMA 2F9YA 3PZKA 3ZWCA 4WCZA 2J5GA 4FZWC 4EMLA 5DL1A 5DKPA 1XX4A 3TVUA 2A81A 3ZWBA 1W2XA 4I4ZA 1TG6A 1WDMA 2ZQRA 1K32A 3V5EA 3P5MA 4NARA 3RSIA 2J5GD 2PBPA 1WDLA 3P2LA 1HNUA 3ST9A 2NP9A 3QXIA 3G64A 2X24A 1O8UA 2ZQQA 5INGA 1NZYA 2FZSA 3NJDA 3T8AA 3VIVA 2EJ5A 1UIYA 4OMRA 4JCTA 4L8KA 3Q1TA 3GKBA 4Q1IA 3TVWA 1UYSA 1XNYA 4ELSA 3Q0JA 4ZDEA 2F6QA 3OT6A 1DUBA 3M6NA 4ZDFA 2W3PA 3BF0A 3V5IA 4B3IA 3HLN1 3MT6A 4ZDBA 3R6HA 4KNPA 4MOUA 3HINA 1XO6A 3Q0GA 1PJHA 5FUSA 2VREA 4K3WA 4OG1A 5C90A 2VSUA 2J5IA 5CTCA 5G1QA 1FC7A 1FC9A 1N6EA 4HC8A 5G1SA 1MJ3A 3R9QA 5DU6A 1N6DA 2VSSF 3ZWAA 4FZWA 2F9YB 2PG8A 3IBBA 3U9SB 4JJTA 2ZL3A 1SZOA 4ZU2A 3GF3A 1HZDA 1YG6A 3JU1A 3DORA 2VSUF 2DUBA 4F47A 3FDUA 1Q51A 2Q2XA 5G1RA 4WZ8B 4U0GA 2CBYA 5KJPA 4NEKA 1NZYB 2HW5A 4JOTA 4RYFA 5E0SA 1SG4A 3LAOA 4IZDA 3SWXA 5DTPA 4WYOB 5HUQA 3GF7A 1EY3A 2F9IA 2VSUC 3OMEA 3IAVA 3QWDA 4HDTA 4U0HA 1N6FA 1JXZA 3TT6A 1Q52A 4G2RA 1UYRA 4DI1A 3K8XA 3QREA 1FCFA 2VX2A 2VSUE 2FBMA 4ELWA 2FW2A 2Q35A 3R0OA 2IEXA 3U9TB 2F6IA 4ASIA 2X58A 3T88A 3TDCA 2VSSE 2F9IB 4U18A 3HRXA 2YJGA 3T89A 5INFA 4U19A 3TRRA 4JYJA 5DUCA 3H81A 3M6MA 3STAA 4OLQA 4FB8A 2ZL0A 2J5II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON9 A;  3T8B A;  1EF8 A;  4MI2 A;  2BZR A;  4FN7 A;  4FND A;  4JSB A;  4KPK A;  3L3S A;  3KTJ A;  4KD6 A;  4JYL A;  3NJB A;  3R9S A;  1J7X A;  3T3W A;  3R9T A;  5E0N X;  3U9R B;  4JCS A;  3KTI A;  4Z0M A;  2QQ3 A;  3PEA A;  3QMJ A;  4L6W A;  3QK8 A;  1WZ8 A;  3DJA A;  1UYV A;  3H02 A;  4RCN A;  4FN8 A;  4EMM A;  5DU4 A;  5FIF A;  5INI A;  3GLM A;  5DU8 A;  4JFC A;  2J5S A;  3TLF A;  2ZL2 A;  1DCI A;  1HNO A;  5DUF A;  4B3H A;  5DZK H;  4JVT A;  3RST A;  5IKL B;  4NNQ A;  1FC6 A;  2WTB A;  4I42 A;  4HNK A;  3IB9 A;  4U1A A;  4GM2 A;  1XNV A;  3OC7 A;  3MOY A;  3ZW9 A;  5JBX A;  4QFE A;  2A7K A;  3HP0 A;  2PPY A;  2UZF A;  1EF9 A;  1VRG A;  3BPP A;  3Q7H A;  1X0U A;  5C9G A;  3TZ3 A;  3BEZ A;  2C8T A;  3H0S A;  4ELX A;  5MGB A;  4ZDD A;  5JBW A;  1K39 A;  4ZDC A;  3H0Q A;  3P85 A;  1YG8 A;  4I52 A;  3H0J A;  2J5I B;  4JCR A;  3PE8 A;  3FF6 A;  5DZK A;  3GMA A;  3RRV A;  4KWB A;  1OD2 A;  4K29 A;  2CE3 A;  2DEO A;  5KDR B;  3K50 A;  3LKE A;  2VSS A;  4QIJ A;  3I47 A;  3WG5 A;  1ON3 A;  3H0U A;  4GHN A;  3ZW8 A;  4Q0G A;  3TV5 A;  3PGQ A;  4MXI A;  4EMP A;  4IZC A;  1Y7O A;  3KTK A;  3MYB A;  2D3T A;  2GTR A;  4B3J A;  3TT7 A;  4JCQ A;  5E0S H;  4YLH A;  4QII A;  3KQF A;  5KDR A;  3ISA A;  1TYF A;  1OD4 A;  1UYT A;  1WDK A;  5DTW A;  2ZL4 A;  3N6R B;  4U0G H;  3MFM A;  4IZB A;  3SLL A;  3KTH A;  4FJW D;  4K2N A;  4RYF H;  4LK5 A;  1PIX A;  2A7S A;  1XNW A;  2Q34 A;  3HE2 A;  4JWV A;  3QXZ A;  4FNB A;  3QKA A;  1RJN A;  3QYR A;  5CTB A;  3KTG A;  1RJM A;  2F9Y A;  3PZK A;  3ZWC A;  4WCZ A;  2J5G A;  4FZW C;  4EML A;  5DL1 A;  5DKP A;  1XX4 A;  3TVU A;  2A81 A;  3ZWB A;  1W2X A;  4I4Z A;  1TG6 A;  1WDM A;  2ZQR A;  1K32 A;  3V5E A;  3P5M A;  3RSI A;  2J5G D;  2PBP A;  1WDL A;  3P2L A;  1HNU A;  3ST9 A;  2NP9 A;  3QXI A;  3G64 A;  2X24 A;  1O8U A;  2ZQQ A;  5ING A;  1NZY A;  2FZS A;  3NJD A;  3T8A A;  3VIV A;  2EJ5 A;  1UIY A;  4OMR A;  4JCT A;  4L8K A;  3Q1T A;  3GKB A;  4Q1I A;  3TVW A;  1UYS A;  1XNY A;  3Q0J A;  4ZDE A;  4ELS A;  2F6Q A;  3OT6 A;  1DUB A;  3M6N A;  4ZDF A;  2W3P A;  3BF0 A;  3V5I A;  4B3I A;  3HLN 1;  3MT6 A;  4ZDB A;  3R6H A;  4KNP A;  4MOU A;  3HIN A;  1XO6 A;  3Q0G A;  1PJH A;  5FUS A;  2VRE A;  4K3W A;  4OG1 A;  5C90 A;  2VSU A;  2J5I A;  5CTC A;  5G1Q A;  1FC7 A;  1FC9 A;  1N6E A;  4HC8 A;  5G1S A;  1MJ3 A;  3R9Q A;  5DU6 A;  1N6D A;  2VSS F;  3ZWA A;  4FZW A;  2F9Y B;  2PG8 A;  3IBB A;  3U9S B;  4JJT A;  2ZL3 A;  1SZO A;  4ZU2 A;  3GF3 A;  1HZD A;  1YG6 A;  3JU1 A;  3DOR A;  2VSU F;  2DUB A;  4F47 A;  3FDU A;  1Q51 A;  2Q2X A;  5G1R A;  4WZ8 B;  4U0G A;  2CBY A;  5KJP A;  4NEK A;  1NZY B;  2HW5 A;  4JOT A;  4RYF A;  5E0S A;  1SG4 A;  3LAO A;  4IZD A;  3SWX A;  5DTP A;  4WYO B;  3GF7 A;  1EY3 A;  2F9I A;  2VSU C;  3OME A;  3IAV A;  3QWD A;  4U0H A;  1N6F A;  1JXZ A;  3TT6 A;  1Q52 A;  4G2R A;  1UYR A;  4DI1 A;  3K8X A;  3QRE A;  1FCF A;  2VX2 A;  2VSU E;  2FBM A;  4ELW A;  2FW2 A;  2Q35 A;  3R0O A;  2IEX A;  3U9T B;  2F6I A;  4ASI A;  2X58 A;  3T88 A;  3TDC A;  2VSS E;  2F9I B;  4U18 A;  3HRX A;  3T89 A;  5INF A;  4U19 A;  3TRR A;  4JYJ A;  5DUC A;  3H81 A;  3M6M A;  3STA A;  4OLQ A;  4FB8 A;  2ZL0 A;  2J5I I; 
#chains in the Genus database with same CATH topology
 1ON9 A;  4J2U A;  1EF8 A;  3T8B A;  4MI2 A;  2BZR A;  4FN7 A;  4FND A;  4JSB A;  4KPK A;  3L3S A;  3KTJ A;  4KD6 A;  4JYL A;  3NJB A;  3R9S A;  1J7X A;  3T3W A;  3R9T A;  5E0N X;  3U9R B;  4JCS A;  3KTI A;  4Z0M A;  2QQ3 A;  3PEA A;  3QMJ A;  4L6W A;  3QK8 A;  1WZ8 A;  3DJA A;  1UYV A;  3H02 A;  4RCN A;  4FN8 A;  4EMM A;  5DU4 A;  5FIF A;  5INI A;  3GLM A;  5DU8 A;  4JFC A;  2J5S A;  3TLF A;  2ZL2 A;  1DCI A;  1HNO A;  5DUF A;  4B3H A;  5DZK H;  4JVT A;  3RST A;  5IKL B;  4NNQ A;  1FC6 A;  2WTB A;  4I42 A;  4HNK A;  3IB9 A;  4U1A A;  4GM2 A;  1XNV A;  3OC7 A;  3MOY A;  3ZW9 A;  5JBX A;  4QFE A;  2A7K A;  3HP0 A;  2PPY A;  2UZF A;  1EF9 A;  1VRG A;  3BPP A;  3Q7H A;  1X0U A;  5C9G A;  3TZ3 A;  3BEZ A;  2C8T A;  3H0S A;  4ELX A;  5MGB A;  4ZDD A;  5JBW A;  1K39 A;  4ZDC A;  3H0Q A;  3P85 A;  1YG8 A;  4I52 A;  3H0J A;  2J5I B;  4JCR A;  3PE8 A;  3FF6 A;  5DZK A;  3GMA A;  3RRV A;  4KWB A;  1OD2 A;  4K29 A;  2CE3 A;  2DEO A;  5KDR B;  3K50 A;  3LKE A;  2VSS A;  4QIJ A;  3I47 A;  3WG5 A;  1ON3 A;  3H0U A;  4GHN A;  3ZW8 A;  4Q0G A;  3TV5 A;  3PGQ A;  4MXI A;  4EMP A;  4IZC A;  1Y7O A;  3KTK A;  3MYB A;  2D3T A;  2GTR A;  4B3J A;  3TT7 A;  4JCQ A;  5E0S H;  4YLH A;  3BPT A;  4QII A;  3KQF A;  3ISA A;  5KDR A;  1TYF A;  1OD4 A;  1UYT A;  1WDK A;  5DTW A;  2ZL4 A;  3N6R B;  4U0G H;  3MFM A;  4IZB A;  3SLL A;  3KTH A;  4FJW D;  4K2N A;  4RYF H;  4LK5 A;  1PIX A;  2A7S A;  1XNW A;  2Q34 A;  3HE2 A;  4JWV A;  3QXZ A;  4FNB A;  3QKA A;  1RJN A;  3QYR A;  5CTB A;  3KTG A;  1RJM A;  2F9Y A;  3PZK A;  3ZWC A;  4WCZ A;  2J5G A;  4FZW C;  4EML A;  5DL1 A;  5DKP A;  1XX4 A;  3TVU A;  2A81 A;  3ZWB A;  1W2X A;  4I4Z A;  1TG6 A;  1WDM A;  2ZQR A;  1K32 A;  3V5E A;  3P5M A;  4NAR A;  3RSI A;  2J5G D;  2PBP A;  1WDL A;  3P2L A;  1HNU A;  3ST9 A;  2NP9 A;  3QXI A;  3G64 A;  2X24 A;  1O8U A;  2ZQQ A;  5ING A;  1NZY A;  2FZS A;  3NJD A;  3T8A A;  3VIV A;  2EJ5 A;  1UIY A;  4OMR A;  4JCT A;  4L8K A;  3Q1T A;  3GKB A;  4Q1I A;  3TVW A;  1UYS A;  1XNY A;  4ELS A;  3Q0J A;  4ZDE A;  2F6Q A;  3OT6 A;  1DUB A;  3M6N A;  4ZDF A;  2W3P A;  3BF0 A;  3V5I A;  4B3I A;  3HLN 1;  3MT6 A;  4ZDB A;  3R6H A;  4KNP A;  4MOU A;  3HIN A;  1XO6 A;  3Q0G A;  1PJH A;  5FUS A;  2VRE A;  4K3W A;  4OG1 A;  5C90 A;  2VSU A;  2J5I A;  5CTC A;  5G1Q A;  1FC7 A;  1FC9 A;  1N6E A;  4HC8 A;  5G1S A;  1MJ3 A;  3R9Q A;  5DU6 A;  1N6D A;  2VSS F;  3ZWA A;  4FZW A;  2F9Y B;  2PG8 A;  3IBB A;  3U9S B;  4JJT A;  2ZL3 A;  1SZO A;  4ZU2 A;  3GF3 A;  1HZD A;  1YG6 A;  3JU1 A;  3DOR A;  2VSU F;  2DUB A;  4F47 A;  3FDU A;  1Q51 A;  2Q2X A;  5G1R A;  4WZ8 B;  4U0G A;  2CBY A;  5KJP A;  4NEK A;  1NZY B;  2HW5 A;  4JOT A;  4RYF A;  5E0S A;  1SG4 A;  3LAO A;  4IZD A;  3SWX A;  5DTP A;  4WYO B;  5HUQ A;  3GF7 A;  1EY3 A;  2F9I A;  2VSU C;  3OME A;  3IAV A;  3QWD A;  4HDT A;  4U0H A;  1N6F A;  1JXZ A;  3TT6 A;  1Q52 A;  4G2R A;  1UYR A;  4DI1 A;  3K8X A;  3QRE A;  1FCF A;  2VX2 A;  2VSU E;  2FBM A;  4ELW A;  2FW2 A;  2Q35 A;  3R0O A;  2IEX A;  3U9T B;  2F6I A;  4ASI A;  2X58 A;  3T88 A;  3TDC A;  2VSS E;  2F9I B;  4U18 A;  3HRX A;  2YJG A;  3T89 A;  5INF A;  4U19 A;  3TRR A;  4JYJ A;  5DUC A;  3H81 A;  3M6M A;  3STA A;  4OLQ A;  4FB8 A;  2ZL0 A;  2J5I I; 
#chains in the Genus database with same CATH homology
 1ON9 A;  4J2U A;  1EF8 A;  3T8B A;  4MI2 A;  2BZR A;  4FN7 A;  4FND A;  4JSB A;  4KPK A;  3L3S A;  3KTJ A;  4KD6 A;  4JYL A;  3NJB A;  3R9S A;  1J7X A;  3T3W A;  3R9T A;  5E0N X;  3U9R B;  4JCS A;  3KTI A;  4Z0M A;  2QQ3 A;  3PEA A;  3QMJ A;  4L6W A;  3QK8 A;  1WZ8 A;  3DJA A;  1UYV A;  3H02 A;  4RCN A;  4FN8 A;  4EMM A;  5DU4 A;  5FIF A;  5INI A;  3GLM A;  5DU8 A;  4JFC A;  2J5S A;  3TLF A;  2ZL2 A;  1DCI A;  1HNO A;  5DUF A;  4B3H A;  5DZK H;  4JVT A;  3RST A;  5IKL B;  4NNQ A;  1FC6 A;  2WTB A;  4I42 A;  4HNK A;  3IB9 A;  4U1A A;  4GM2 A;  1XNV A;  3OC7 A;  3MOY A;  3ZW9 A;  5JBX A;  4QFE A;  2A7K A;  3HP0 A;  2PPY A;  2UZF A;  1EF9 A;  1VRG A;  3BPP A;  3Q7H A;  1X0U A;  5C9G A;  3TZ3 A;  3BEZ A;  2C8T A;  3H0S A;  4ELX A;  5MGB A;  4ZDD A;  5JBW A;  1K39 A;  4ZDC A;  3H0Q A;  3P85 A;  1YG8 A;  4I52 A;  3H0J A;  2J5I B;  4JCR A;  3PE8 A;  3FF6 A;  5DZK A;  3GMA A;  3RRV A;  4KWB A;  1OD2 A;  4K29 A;  2CE3 A;  2DEO A;  5KDR B;  3K50 A;  3LKE A;  2VSS A;  4QIJ A;  3I47 A;  3WG5 A;  1ON3 A;  3H0U A;  4GHN A;  3ZW8 A;  4Q0G A;  3TV5 A;  3PGQ A;  4MXI A;  4EMP A;  4IZC A;  1Y7O A;  3KTK A;  3MYB A;  2D3T A;  2GTR A;  4B3J A;  3TT7 A;  4JCQ A;  5E0S H;  4YLH A;  3BPT A;  4QII A;  3KQF A;  3ISA A;  5KDR A;  1TYF A;  1OD4 A;  1UYT A;  1WDK A;  5DTW A;  2ZL4 A;  3N6R B;  4U0G H;  3MFM A;  4IZB A;  3SLL A;  3KTH A;  4FJW D;  4K2N A;  4RYF H;  4LK5 A;  1PIX A;  2A7S A;  1XNW A;  2Q34 A;  3HE2 A;  4JWV A;  3QXZ A;  4FNB A;  3QKA A;  1RJN A;  3QYR A;  5CTB A;  3KTG A;  1RJM A;  2F9Y A;  3PZK A;  3ZWC A;  4WCZ A;  2J5G A;  4FZW C;  4EML A;  5DL1 A;  5DKP A;  1XX4 A;  3TVU A;  2A81 A;  3ZWB A;  1W2X A;  4I4Z A;  1TG6 A;  1WDM A;  2ZQR A;  1K32 A;  3V5E A;  3P5M A;  4NAR A;  3RSI A;  2J5G D;  2PBP A;  1WDL A;  3P2L A;  1HNU A;  3ST9 A;  2NP9 A;  3QXI A;  3G64 A;  2X24 A;  1O8U A;  2ZQQ A;  5ING A;  1NZY A;  2FZS A;  3NJD A;  3T8A A;  3VIV A;  2EJ5 A;  1UIY A;  4OMR A;  4JCT A;  4L8K A;  3Q1T A;  3GKB A;  4Q1I A;  3TVW A;  1UYS A;  1XNY A;  4ELS A;  3Q0J A;  4ZDE A;  2F6Q A;  3OT6 A;  1DUB A;  3M6N A;  4ZDF A;  2W3P A;  3BF0 A;  3V5I A;  4B3I A;  3HLN 1;  3MT6 A;  4ZDB A;  3R6H A;  4KNP A;  4MOU A;  3HIN A;  1XO6 A;  3Q0G A;  1PJH A;  5FUS A;  2VRE A;  4K3W A;  4OG1 A;  5C90 A;  2VSU A;  2J5I A;  5CTC A;  5G1Q A;  1FC7 A;  1FC9 A;  1N6E A;  4HC8 A;  5G1S A;  1MJ3 A;  3R9Q A;  5DU6 A;  1N6D A;  2VSS F;  3ZWA A;  4FZW A;  2F9Y B;  2PG8 A;  3IBB A;  3U9S B;  4JJT A;  2ZL3 A;  1SZO A;  4ZU2 A;  3GF3 A;  1HZD A;  1YG6 A;  3JU1 A;  3DOR A;  2VSU F;  2DUB A;  4F47 A;  3FDU A;  1Q51 A;  2Q2X A;  5G1R A;  4WZ8 B;  4U0G A;  2CBY A;  5KJP A;  4NEK A;  1NZY B;  2HW5 A;  4JOT A;  4RYF A;  5E0S A;  1SG4 A;  3LAO A;  4IZD A;  3SWX A;  5DTP A;  4WYO B;  5HUQ A;  3GF7 A;  1EY3 A;  2F9I A;  2VSU C;  3OME A;  3IAV A;  3QWD A;  4HDT A;  4U0H A;  1N6F A;  1JXZ A;  3TT6 A;  1Q52 A;  4G2R A;  1UYR A;  4DI1 A;  3K8X A;  3QRE A;  1FCF A;  2VX2 A;  2VSU E;  2FBM A;  4ELW A;  2FW2 A;  2Q35 A;  3R0O A;  2IEX A;  3U9T B;  2F6I A;  4ASI A;  2X58 A;  3T88 A;  3TDC A;  2VSS E;  2F9I B;  4U18 A;  3HRX A;  2YJG A;  3T89 A;  5INF A;  4U19 A;  3TRR A;  4JYJ A;  5DUC A;  3H81 A;  3M6M A;  3STA A;  4OLQ A;  4FB8 A;  2ZL0 A;  2J5I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...