4MXMA

Crystal structure of superantigen pfit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
199
Chain Sequence
GPLGSMRTMVDSGQLTDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRCELQSIMGGSGEAMAVEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTGALSWTTTWFRAQGSLTLEELAEEALLMVLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator I2
publication title Pfit is a structurally novel Crohn's disease-associated superantigen.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Dna binding protein
total genus 64
structure length 199
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mxmA00
1T56A 2I10A 3G1OA 2UXIA 5GPAA 2IEKA 5CXIA 1JT6A 3HTHA 3V78A 1JTYA 4GCTA 2GBYA 2V57A 4AF5A 3SFIA 2DG8A 3Q0VA 4M3EA 3GEUA 3F0CA 5CW8A 5F08A 2JK3A 2G3BA 3DCFA 5K7FA 3BR6A 3BNIA 5IOYA 5K58A 3DEWA 1UI6A 3O8GA 2ZB9A 2VKVA 2Q24A 2FBQA 3SDGA 5F1JA 3FIWA 1VI0A 2GENA 2XGDA 4I76A 5J1YA 2OI8A 4V2GA 2ZCXA 2HYTA 2XPWA 1QPIA 5F0HA 3QBMA 3VPRA 3CWRA 2NP5A 3CJDA 3VVXA 1BJZA 3G7RA 4ACIA 3NNRA 3ANPA 1JUSA 4GFKA 3JSJA 2OERA 3MVPA 1JT0A 2WUIA 3BJBA 4G12A 3IH3A 2OPTA 4MK6A 3VIBA 3ZQIA 3EUPA 4GFLA 3VW0A 3T6NA 3LOCA 4M3BA 3Q3SA 2YVHA 3BR3A 3G1LA 2XRLA 2NP3A 2X6OA 3CDLA 4YZEA 3BTLA 3BR1A 3BR5A 3LWJA 3BQZA 2TRTA 3BR0A 5GPCA 1SGMA 3AQSA 5DAJA 3LSPA 1JTXA 3G1MA 3BTCA 3QPSA 3E7QA 3KKCA 2ID3A 3RH2A 4JKZA 2HKUA 4GCKA 5FGLA 3QPLA 3NXCA 4M3DA 3HGGA 5D19A 2PZ9A 2D6YA 2G7SA 2HXIA 2REKA 2ZOZA 3VOXA 3IH2A 4MO7A 3ON4A 3NI7A 2XPVA 5D18A 5FKLA 2Y30A 4V2FA 1ORKA 3WHBA 2ZOYA 1QVTA 5F0FA 2FQ4A 4JNNA 3TP0A 5K7HA 3TP3A 4D7MA 3VP5A 5IOZA 2GUHA 4HKUA 3B81A 3QKXA 3COLA 2VPRA 1RKWA 4NELA 3G56A 5K7ZA 3MNLA 2X9DA 2TCTA 5FKMA 5HSZA 3Q0UA 2DTZA 3HIMA 3VOKA 2PBXA 3WHCA 5F04A 4MXMA 2WGBA 1T33A 2UXOA 3IUVA 3QQAA 3O8HA 5EZGA 2HXOA 3CRJA 5IPAA 2Y31A 4W97A 2VKEA 5J3LA 1Z77A 3HGYA 3ZQHA 2F07A 3P9TA 3IH4A 2NS8A 3ZQLA 3BRUA 2QTQA 5J1UA 2HYJA 5F0CA 2ZCNA 1JUMA 2IBDA 5IP6A 3KZ9A 4JYKA 4AUXA 3LHQA 5HBUA 5HAWA 2HQ5A 2IAIA 3PPBA 1QVUA 1ZK8A 3DPJA 4DW6A 1UI5A 3FK7A 2O7TA 2UXPA 2Y2ZA 2XPUA 2G7GA 4GCLA 2QOPA 3Q0WA 2RAEA 2O7OA 5F27A 3C2BA 2WV1A 2UXUA 4ABZA 3BHQA 4ME9A 1Z0XA 4KWAA 4L62A 3BTJA 4D5CA 3CCYA 3HTIA 4NN1A 5GP9A 2ZCMA 3NPIA 3PASA 4CGRA 2OF7A 5AQCA 5EZHA 4PXIA 1U9NA 1RPWA 2EH3A 2QIBA 3ZQFA 1RKTA 2DG7A 2ID6A 2XDNA 5EFYA 3KNWA 3VVYA 2YVEA 5FKKA 2NX4A 3C07A 2QCOA 4XK4A 4ICHA 2NS7A 4D7NA 4UDSA 2QKOA 5H9TA 3EGQA 3AQTA 3VW2A 3NRGA 5CXGA 3LJLA 3O60A 2JJ7A 5D1RA 3GZIA 3FRQA 3BTIA 3PM1A 2GFNA 3VVZA 3LSJA 5C4YA 3FK6A 3S5RA 1JUPA 1A6IA 3BT9A 5FMPA 4I6ZA 3LSRA 1U9OA 3RD3A 2UXHA 3BR2A 3HE0A 4W1UA 2RASA 2G0EA 5FHPA 5J1RA 4M3GA 3HTJA 4AC6A 4B3AA 2RHAA 4JL3A 5FKNA 3ON2A 3HTAA 2XGEA 3B6CA 5EYRA 2QWTA 1ZKGA 2FX0A 5FKOA 4M3FA 2FJ1A 3ANGA 4D5FA 3KKDA 2XB5A 3B6AA 3ZQGA 2XGCA 2W53A 4AC0A 2G7LA 2FD5A 3VUQA 2IU5A 3VW1A 3V6GA 3BQYA 3F1BA 4B1RA 4X1EA 3BCGA
chains in the Genus database with same CATH superfamily
1T56A 2R7VA 2I10A 3G1OA 2UXIA 5GPAA 2IEKA 5CXIA 4C2MA 1JT6A 3HTHA 3V78A 1JTYA 4GCTA 2GBYA 2V57A 4AF5A 2A2FX 3SFIA 2DG8A 3Q0VA 4M3EA 3GEUA 3F0CA 5CW8A 5F08A 2JK3A 2G3BA 3DCFA 5K7FA 4DVYP 3BR6A 3DU5A 3BNIA 5IOYA 5K58A 3DEWA 1UI6A 2R7RA 3O8GA 2ZB9A 2VKVA 2Q24A 2R7WA 2FBQA 3SDGA 5F1JA 3FIWA 1VI0A 2GENA 2XGDA 4I76A 5J1YA 2OI8A 4V2GA 2ZCXA 2HYTA 2XPWA 1QPIA 5F0HA 3QBMA 3VPRA 3CWRA 2NP5A 3CJDA 3VVXA 1BJZA 3G7RA 4ACIA 3NNRA 3ANPA 1JUSA 3FHNA 4GFKA 3JSJA 2OERA 3MVPA 3SWHA 1JT0A 2WUIA 3BJBA 4G12A 3IH3A 2OPTA 4MK6A 3VIBA 3ZQIA 3EUPA 4GFLA 3VW0A 3T6NA 3LOCA 4M3BA 3Q3SA 2YVHA 3BR3A 3G1LA 2XRLA 2NP3A 2X6OA 3CDLA 4YZEA 3BTLA 3BR1A 3BR5A 3LWJA 3BQZA 2TRTA 3BR0A 5GPCA 1SGMA 3AQSA 5DAJA 3LSPA 1JTXA 3G1MA 3BTCA 3QPSA 3E7QA 3KKCA 2ID3A 3RH2A 4JKZA 2HKUA 4GCKA 5FGLA 3QPLA 3NXCA 4M3DA 3HGGA 5D19A 2PZ9A 2D6YA 5CQGA 2G7SA 2HXIA 2REKA 2ZOZA 3VOXA 3IH2A 4MO7A 3ON4A 3NI7A 2XPVA 5D18A 5FKLA 2Y30A 4V2FA 1ORKA 3WHBA 2ZOYA 1QVTA 5F0FA 2FQ4A 4JNNA 3TP0A 5K7HA 3TP3A 4D7MA 3VP5A 5IOZA 2GUHA 4HKUA 3B81A 3QKXA 3COLA 2VPRA 1RKWA 4NELA 4OD5A 3G56A 5K7ZA 3MNLA 2B1EA 2X9DA 2TCTA 5FKMA 5HSZA 2ZY9A 3Q0UA 2DTZA 3HIMA 3VOKA 2PBXA 3WHCA 5F04A 4MXMA 2WGBA 1T33A 2UXOA 3IUVA 3QQAA 3O8HA 5EZGA 2HXOA 3CRJA 5IPAA 2Y31A 4W97A 2VKEA 5J3LA 1Z77A 3HGYA 3ZQHA 2F07A 3P9TA 3IH4A 2NS8A 3ZQLA 3BRUA 2QTQA 5J1UA 2HYJA 5F0CA 2ZCNA 1JUMA 2IBDA 5IP6A 3KZ9A 4JYKA 4AUXA 3LHQA 5HBUA 5HAWA 2HQ5A 2IAIA 3PPBA 1QVUA 1ZK8A 3DPJA 4DW6A 1UI5A 4WIBA 3FK7A 2O7TA 2UXPA 2Y2ZA 2XPUA 2G7GA 4GCLA 2QOPA 3Q0WA 2RAEA 2O7OA 2R7OA 5F27A 3C2BA 2WV1A 2UXUA 4ABZA 3BHQA 4ME9A 1Z0XA 4KWAA 4L62A 3BTJA 4D5CA 3CCYA 3HTIA 4NN1A 5GP9A 2ZCMA 3NPIA 3PASA 4CGRA 2OF7A 5AQCA 5EZHA 4PXIA 1U9NA 1RPWA 2EH3A 2QIBA 3K8PC 3ZQFA 1RKTA 2DG7A 2ID6A 2XDNA 5EFYA 3KNWA 3VVYA 2YVEA 5FKKA 2NX4A 3C07A 2QCOA 4XK4A 4ICHA 2NS7A 4D7NA 4UDSA 2QKOA 5H9TA 3EGQA 4OD4A 2R7TA 3AQTA 3VW2A 2PFVA 3NRGA 2R7XA 5CXGA 3LJLA 3O60A 2JJ7A 5D1RA 3GZIA 3FRQA 3BTIA 3PM1A 2GFNA 4U9NA 3VVZA 3LSJA 5C4YA 3FK6A 3S5RA 1JUPA 1A6IA 3BT9A 5FMPA 4I6ZA 3LSRA 1U9OA 3RD3A 2R7QA 2UXHA 3BR2A 3HE0A 4W1UA 2YVXA 2FJI1 2RASA 2G0EA 5FHPA 5J1RA 4M3GA 4U9LA 3HTJA 3DU6A 4AC6A 4B3AA 2RHAA 4JL3A 5FKNA 3ON2A 3HTAA 2R7SA 2XGEA 3B6CA 5EYRA 2R7UA 2QWTA 1ZKGA 2FX0A 3NS4A 5FKOA 4M3FA 2FJ1A 3ANGA 4D5FA 3KKDA 2XB5A 3B6AA 3KYLA 4IRVA 3ZQGA 2XGCA 2W53A 4AC0A 2G7LA 2FD5A 3VUQA 2IU5A 3VW1A 3VTIA 3V6GA 2B3WA 3BQYA 3F1BA 4B1RA 4X1EA 3BCGA
chains in the Genus database with same CATH topology
1T56A 2I10A 3G1OA 2UXIA 5GPAA 2IEKA 5CXIA 1JT6A 3HTHA 3V78A 1JTYA 4GCTA 2GBYA 2V57A 4AF5A 3SFIA 2DG8A 3Q0VA 4M3EA 3GEUA 3F0CA 5CW8A 5F08A 2JK3A 2G3BA 3DCFA 5K7FA 3BR6A 3BNIA 5IOYA 5K58A 3DEWA 1UI6A 3O8GA 2ZB9A 2VKVA 2Q24A 2FBQA 3SDGA 5F1JA 3FIWA 1VI0A 2GENA 2XGDA 4I76A 5J1YA 2OI8A 4V2GA 2ZCXA 2HYTA 2XPWA 1QPIA 5F0HA 3QBMA 3VPRA 3CWRA 2NP5A 3CJDA 3VVXA 1BJZA 3G7RA 4ACIA 3NNRA 3ANPA 1JUSA 4GFKA 3JSJA 2OERA 3MVPA 1JT0A 2WUIA 3BJBA 4G12A 3IH3A 2OPTA 4MK6A 3VIBA 3ZQIA 3EUPA 4GFLA 3VW0A 3T6NA 3LOCA 4M3BA 3Q3SA 2YVHA 3BR3A 3G1LA 2XRLA 2NP3A 2X6OA 3CDLA 4YZEA 3BTLA 3BR1A 3BR5A 3LWJA 3BQZA 2TRTA 3BR0A 5GPCA 1SGMA 3AQSA 5DAJA 3LSPA 1JTXA 3G1MA 3BTCA 3QPSA 3E7QA 3KKCA 2ID3A 3RH2A 4JKZA 2HKUA 4GCKA 5FGLA 3QPLA 3NXCA 4M3DA 3HGGA 5D19A 2PZ9A 2D6YA 2G7SA 2HXIA 2REKA 2ZOZA 3VOXA 3IH2A 4MO7A 3ON4A 3NI7A 2XPVA 5D18A 5FKLA 2Y30A 4V2FA 1ORKA 3WHBA 2ZOYA 1QVTA 5F0FA 2FQ4A 4JNNA 3TP0A 5K7HA 3TP3A 4D7MA 3VP5A 5IOZA 2GUHA 4HKUA 3B81A 3QKXA 3COLA 2VPRA 1RKWA 4NELA 3G56A 5K7ZA 3MNLA 2X9DA 2TCTA 5FKMA 5HSZA 3Q0UA 2DTZA 3HIMA 3VOKA 2PBXA 3WHCA 5F04A 4MXMA 2WGBA 1T33A 2UXOA 3IUVA 3QQAA 3O8HA 5EZGA 2HXOA 3CRJA 5IPAA 2Y31A 4W97A 2VKEA 5J3LA 1Z77A 3HGYA 3ZQHA 2F07A 3P9TA 3IH4A 2NS8A 3ZQLA 3BRUA 2QTQA 5J1UA 2HYJA 5F0CA 2ZCNA 1JUMA 2IBDA 5IP6A 3KZ9A 4JYKA 4AUXA 3LHQA 5HBUA 5HAWA 2HQ5A 2IAIA 3PPBA 1QVUA 1ZK8A 3DPJA 4DW6A 1UI5A 3FK7A 2O7TA 2UXPA 2Y2ZA 2XPUA 2G7GA 4GCLA 2QOPA 3Q0WA 2RAEA 2O7OA 5F27A 3C2BA 2WV1A 2UXUA 4ABZA 3BHQA 4ME9A 1Z0XA 4KWAA 4L62A 3BTJA 4D5CA 3CCYA 3HTIA 4NN1A 5GP9A 2ZCMA 3NPIA 3PASA 4CGRA 2OF7A 5AQCA 5EZHA 4PXIA 1U9NA 1RPWA 2EH3A 2QIBA 3ZQFA 1RKTA 2DG7A 2ID6A 2XDNA 5EFYA 3KNWA 3VVYA 2YVEA 5FKKA 2NX4A 3C07A 2QCOA 4XK4A 4ICHA 2NS7A 4D7NA 4UDSA 2QKOA 5H9TA 3EGQA 3AQTA 3VW2A 3NRGA 5CXGA 3LJLA 3O60A 2JJ7A 5D1RA 3GZIA 3FRQA 3BTIA 3PM1A 2GFNA 3VVZA 3LSJA 5C4YA 3FK6A 3S5RA 1JUPA 1A6IA 3BT9A 5FMPA 4I6ZA 3LSRA 1U9OA 3RD3A 2UXHA 3BR2A 3HE0A 4W1UA 2RASA 2G0EA 5FHPA 5J1RA 4M3GA 3HTJA 4AC6A 4B3AA 2RHAA 4JL3A 5FKNA 3ON2A 3HTAA 2XGEA 3B6CA 5EYRA 2QWTA 1ZKGA 2FX0A 5FKOA 4M3FA 2FJ1A 3ANGA 4D5FA 3KKDA 2XB5A 3B6AA 3ZQGA 2XGCA 2W53A 4AC0A 2G7LA 2FD5A 3VUQA 2IU5A 3VW1A 3V6GA 3BQYA 3F1BA 4B1RA 4X1EA 3BCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T56 A;  2I10 A;  3G1O A;  2UXI A;  5GPA A;  2IEK A;  5CXI A;  1JT6 A;  3HTH A;  3V78 A;  1JTY A;  4GCT A;  2GBY A;  2V57 A;  4AF5 A;  3SFI A;  2DG8 A;  3Q0V A;  4M3E A;  3GEU A;  3F0C A;  5CW8 A;  5F08 A;  2JK3 A;  2G3B A;  3DCF A;  5K7F A;  3BR6 A;  3BNI A;  5IOY A;  5K58 A;  3DEW A;  1UI6 A;  3O8G A;  2ZB9 A;  2VKV A;  2Q24 A;  2FBQ A;  3SDG A;  5F1J A;  3FIW A;  1VI0 A;  2GEN A;  2XGD A;  4I76 A;  5J1Y A;  2OI8 A;  4V2G A;  2ZCX A;  2HYT A;  2XPW A;  1QPI A;  5F0H A;  3QBM A;  3VPR A;  3CWR A;  2NP5 A;  3CJD A;  3VVX A;  1BJZ A;  3G7R A;  4ACI A;  3NNR A;  3ANP A;  1JUS A;  4GFK A;  3JSJ A;  2OER A;  3MVP A;  1JT0 A;  2WUI A;  3BJB A;  4G12 A;  3IH3 A;  2OPT A;  4MK6 A;  3VIB A;  3ZQI A;  3EUP A;  4GFL A;  3VW0 A;  3T6N A;  3LOC A;  4M3B A;  3Q3S A;  2YVH A;  3BR3 A;  3G1L A;  2XRL A;  2NP3 A;  2X6O A;  3CDL A;  4YZE A;  3BTL A;  3BR1 A;  3BR5 A;  3LWJ A;  3BQZ A;  2TRT A;  3BR0 A;  5GPC A;  1SGM A;  3AQS A;  5DAJ A;  3LSP A;  1JTX A;  3G1M A;  3BTC A;  3QPS A;  3E7Q A;  3KKC A;  2ID3 A;  3RH2 A;  4JKZ A;  2HKU A;  4GCK A;  5FGL A;  3QPL A;  3NXC A;  4M3D A;  3HGG A;  5D19 A;  2PZ9 A;  2D6Y A;  2G7S A;  2HXI A;  2REK A;  2ZOZ A;  3VOX A;  3IH2 A;  4MO7 A;  3ON4 A;  3NI7 A;  2XPV A;  5D18 A;  5FKL A;  2Y30 A;  4V2F A;  1ORK A;  3WHB A;  2ZOY A;  1QVT A;  5F0F A;  2FQ4 A;  4JNN A;  3TP0 A;  5K7H A;  3TP3 A;  4D7M A;  3VP5 A;  5IOZ A;  2GUH A;  4HKU A;  3B81 A;  3QKX A;  3COL A;  2VPR A;  1RKW A;  4NEL A;  3G56 A;  5K7Z A;  3MNL A;  2X9D A;  2TCT A;  5FKM A;  5HSZ A;  3Q0U A;  2DTZ A;  3HIM A;  3VOK A;  2PBX A;  3WHC A;  5F04 A;  4MXM A;  2WGB A;  1T33 A;  2UXO A;  3IUV A;  3QQA A;  3O8H A;  5EZG A;  2HXO A;  3CRJ A;  5IPA A;  2Y31 A;  4W97 A;  2VKE A;  5J3L A;  1Z77 A;  3HGY A;  3ZQH A;  2F07 A;  3P9T A;  3IH4 A;  2NS8 A;  3ZQL A;  3BRU A;  2QTQ A;  5J1U A;  2HYJ A;  5F0C A;  2ZCN A;  1JUM A;  2IBD A;  5IP6 A;  3KZ9 A;  4JYK A;  4AUX A;  3LHQ A;  5HBU A;  5HAW A;  2HQ5 A;  2IAI A;  3PPB A;  1QVU A;  1ZK8 A;  3DPJ A;  4DW6 A;  1UI5 A;  3FK7 A;  2O7T A;  2UXP A;  2Y2Z A;  2XPU A;  2G7G A;  4GCL A;  2QOP A;  3Q0W A;  2RAE A;  2O7O A;  5F27 A;  3C2B A;  2WV1 A;  2UXU A;  4ABZ A;  3BHQ A;  4ME9 A;  1Z0X A;  4KWA A;  4L62 A;  3BTJ A;  4D5C A;  3CCY A;  3HTI A;  4NN1 A;  5GP9 A;  2ZCM A;  3NPI A;  3PAS A;  4CGR A;  2OF7 A;  5AQC A;  5EZH A;  4PXI A;  1U9N A;  1RPW A;  2EH3 A;  2QIB A;  3ZQF A;  1RKT A;  2DG7 A;  2ID6 A;  2XDN A;  5EFY A;  3KNW A;  3VVY A;  2YVE A;  5FKK A;  2NX4 A;  3C07 A;  2QCO A;  4XK4 A;  4ICH A;  2NS7 A;  4D7N A;  4UDS A;  2QKO A;  5H9T A;  3EGQ A;  3AQT A;  3VW2 A;  3NRG A;  5CXG A;  3LJL A;  3O60 A;  2JJ7 A;  5D1R A;  3GZI A;  3FRQ A;  3BTI A;  3PM1 A;  2GFN A;  3VVZ A;  3LSJ A;  5C4Y A;  3FK6 A;  3S5R A;  1JUP A;  1A6I A;  3BT9 A;  5FMP A;  4I6Z A;  3LSR A;  1U9O A;  3RD3 A;  2UXH A;  3BR2 A;  3HE0 A;  4W1U A;  2RAS A;  2G0E A;  5FHP A;  5J1R A;  4M3G A;  3HTJ A;  4AC6 A;  4B3A A;  2RHA A;  4JL3 A;  5FKN A;  3ON2 A;  3HTA A;  2XGE A;  3B6C A;  5EYR A;  2QWT A;  1ZKG A;  2FX0 A;  5FKO A;  4M3F A;  2FJ1 A;  3ANG A;  4D5F A;  3KKD A;  2XB5 A;  3B6A A;  3ZQG A;  2XGC A;  2W53 A;  4AC0 A;  2G7L A;  2FD5 A;  3VUQ A;  2IU5 A;  3VW1 A;  3V6G A;  3BQY A;  3F1B A;  4B1R A;  4X1E A;  3BCG A; 
#chains in the Genus database with same CATH topology
 1T56 A;  2R7V A;  2I10 A;  3G1O A;  2UXI A;  5GPA A;  2IEK A;  5CXI A;  4C2M A;  1JT6 A;  3HTH A;  3V78 A;  1JTY A;  4GCT A;  2GBY A;  2V57 A;  4AF5 A;  2A2F X;  3SFI A;  2DG8 A;  3Q0V A;  4M3E A;  3GEU A;  3F0C A;  5CW8 A;  5F08 A;  2JK3 A;  2G3B A;  3DCF A;  5K7F A;  4DVY P;  3BR6 A;  3DU5 A;  3BNI A;  5IOY A;  5K58 A;  3DEW A;  1UI6 A;  2R7R A;  3O8G A;  2ZB9 A;  2VKV A;  2Q24 A;  2R7W A;  2FBQ A;  3SDG A;  5F1J A;  3FIW A;  1VI0 A;  2GEN A;  2XGD A;  4I76 A;  5J1Y A;  2OI8 A;  4V2G A;  2ZCX A;  2HYT A;  2XPW A;  1QPI A;  5F0H A;  3QBM A;  3VPR A;  3CWR A;  2NP5 A;  3CJD A;  3VVX A;  1BJZ A;  3G7R A;  4ACI A;  3NNR A;  3ANP A;  1JUS A;  3FHN A;  4GFK A;  3JSJ A;  2OER A;  3MVP A;  3SWH A;  1JT0 A;  2WUI A;  3BJB A;  4G12 A;  3IH3 A;  2OPT A;  4MK6 A;  3VIB A;  3ZQI A;  3EUP A;  4GFL A;  3VW0 A;  3T6N A;  3LOC A;  4M3B A;  3Q3S A;  2YVH A;  3BR3 A;  3G1L A;  2XRL A;  2NP3 A;  2X6O A;  3CDL A;  4YZE A;  3BTL A;  3BR1 A;  3BR5 A;  3LWJ A;  3BQZ A;  2TRT A;  3BR0 A;  5GPC A;  1SGM A;  3AQS A;  5DAJ A;  3LSP A;  1JTX A;  3G1M A;  3BTC A;  3QPS A;  3E7Q A;  3KKC A;  2ID3 A;  3RH2 A;  4JKZ A;  2HKU A;  4GCK A;  5FGL A;  3QPL A;  3NXC A;  4M3D A;  3HGG A;  5D19 A;  2PZ9 A;  2D6Y A;  5CQG A;  2G7S A;  2HXI A;  2REK A;  2ZOZ A;  3VOX A;  3IH2 A;  4MO7 A;  3ON4 A;  3NI7 A;  2XPV A;  5D18 A;  5FKL A;  2Y30 A;  4V2F A;  1ORK A;  3WHB A;  2ZOY A;  1QVT A;  5F0F A;  2FQ4 A;  4JNN A;  3TP0 A;  5K7H A;  3TP3 A;  4D7M A;  3VP5 A;  5IOZ A;  2GUH A;  4HKU A;  3B81 A;  3QKX A;  3COL A;  2VPR A;  1RKW A;  4NEL A;  4OD5 A;  3G56 A;  5K7Z A;  3MNL A;  2B1E A;  2X9D A;  2TCT A;  5FKM A;  5HSZ A;  2ZY9 A;  3Q0U A;  2DTZ A;  3HIM A;  3VOK A;  2PBX A;  3WHC A;  5F04 A;  4MXM A;  2WGB A;  1T33 A;  2UXO A;  3IUV A;  3QQA A;  3O8H A;  5EZG A;  2HXO A;  3CRJ A;  5IPA A;  2Y31 A;  4W97 A;  2VKE A;  5J3L A;  1Z77 A;  3HGY A;  3ZQH A;  2F07 A;  3P9T A;  3IH4 A;  2NS8 A;  3ZQL A;  3BRU A;  2QTQ A;  5J1U A;  2HYJ A;  5F0C A;  2ZCN A;  1JUM A;  2IBD A;  5IP6 A;  3KZ9 A;  4JYK A;  4AUX A;  3LHQ A;  5HBU A;  5HAW A;  2HQ5 A;  2IAI A;  3PPB A;  1QVU A;  1ZK8 A;  3DPJ A;  4DW6 A;  1UI5 A;  4WIB A;  3FK7 A;  2O7T A;  2UXP A;  2Y2Z A;  2XPU A;  2G7G A;  4GCL A;  2QOP A;  3Q0W A;  2RAE A;  2O7O A;  2R7O A;  5F27 A;  3C2B A;  2WV1 A;  2UXU A;  4ABZ A;  3BHQ A;  4ME9 A;  1Z0X A;  4KWA A;  4L62 A;  3BTJ A;  4D5C A;  3CCY A;  3HTI A;  4NN1 A;  5GP9 A;  2ZCM A;  3NPI A;  3PAS A;  4CGR A;  2OF7 A;  5AQC A;  5EZH A;  4PXI A;  1U9N A;  1RPW A;  2EH3 A;  2QIB A;  3K8P C;  3ZQF A;  1RKT A;  2DG7 A;  2ID6 A;  2XDN A;  5EFY A;  3KNW A;  3VVY A;  2YVE A;  5FKK A;  2NX4 A;  3C07 A;  2QCO A;  4XK4 A;  4ICH A;  2NS7 A;  4D7N A;  4UDS A;  2QKO A;  5H9T A;  3EGQ A;  4OD4 A;  2R7T A;  3AQT A;  3VW2 A;  2PFV A;  3NRG A;  2R7X A;  5CXG A;  3LJL A;  3O60 A;  2JJ7 A;  5D1R A;  3GZI A;  3FRQ A;  3BTI A;  3PM1 A;  2GFN A;  4U9N A;  3VVZ A;  3LSJ A;  5C4Y A;  3FK6 A;  3S5R A;  1JUP A;  1A6I A;  3BT9 A;  5FMP A;  4I6Z A;  3LSR A;  1U9O A;  3RD3 A;  2R7Q A;  2UXH A;  3BR2 A;  3HE0 A;  4W1U A;  2YVX A;  2FJI 1;  2RAS A;  2G0E A;  5FHP A;  5J1R A;  4M3G A;  4U9L A;  3HTJ A;  3DU6 A;  4AC6 A;  4B3A A;  2RHA A;  4JL3 A;  5FKN A;  3ON2 A;  3HTA A;  2R7S A;  2XGE A;  3B6C A;  5EYR A;  2R7U A;  2QWT A;  1ZKG A;  2FX0 A;  3NS4 A;  5FKO A;  4M3F A;  2FJ1 A;  3ANG A;  4D5F A;  3KKD A;  2XB5 A;  3B6A A;  3KYL A;  4IRV A;  3ZQG A;  2XGC A;  2W53 A;  4AC0 A;  2G7L A;  2FD5 A;  3VUQ A;  2IU5 A;  3VW1 A;  3VTI A;  3V6G A;  2B3W A;  3BQY A;  3F1B A;  4B1R A;  4X1E A;  3BCG A; 
#chains in the Genus database with same CATH homology
 1T56 A;  2I10 A;  3G1O A;  2UXI A;  5GPA A;  2IEK A;  5CXI A;  1JT6 A;  3HTH A;  3V78 A;  1JTY A;  4GCT A;  2GBY A;  2V57 A;  4AF5 A;  3SFI A;  2DG8 A;  3Q0V A;  4M3E A;  3GEU A;  3F0C A;  5CW8 A;  5F08 A;  2JK3 A;  2G3B A;  3DCF A;  5K7F A;  3BR6 A;  3BNI A;  5IOY A;  5K58 A;  3DEW A;  1UI6 A;  3O8G A;  2ZB9 A;  2VKV A;  2Q24 A;  2FBQ A;  3SDG A;  5F1J A;  3FIW A;  1VI0 A;  2GEN A;  2XGD A;  4I76 A;  5J1Y A;  2OI8 A;  4V2G A;  2ZCX A;  2HYT A;  2XPW A;  1QPI A;  5F0H A;  3QBM A;  3VPR A;  3CWR A;  2NP5 A;  3CJD A;  3VVX A;  1BJZ A;  3G7R A;  4ACI A;  3NNR A;  3ANP A;  1JUS A;  4GFK A;  3JSJ A;  2OER A;  3MVP A;  1JT0 A;  2WUI A;  3BJB A;  4G12 A;  3IH3 A;  2OPT A;  4MK6 A;  3VIB A;  3ZQI A;  3EUP A;  4GFL A;  3VW0 A;  3T6N A;  3LOC A;  4M3B A;  3Q3S A;  2YVH A;  3BR3 A;  3G1L A;  2XRL A;  2NP3 A;  2X6O A;  3CDL A;  4YZE A;  3BTL A;  3BR1 A;  3BR5 A;  3LWJ A;  3BQZ A;  2TRT A;  3BR0 A;  5GPC A;  1SGM A;  3AQS A;  5DAJ A;  3LSP A;  1JTX A;  3G1M A;  3BTC A;  3QPS A;  3E7Q A;  3KKC A;  2ID3 A;  3RH2 A;  4JKZ A;  2HKU A;  4GCK A;  5FGL A;  3QPL A;  3NXC A;  4M3D A;  3HGG A;  5D19 A;  2PZ9 A;  2D6Y A;  2G7S A;  2HXI A;  2REK A;  2ZOZ A;  3VOX A;  3IH2 A;  4MO7 A;  3ON4 A;  3NI7 A;  2XPV A;  5D18 A;  5FKL A;  2Y30 A;  4V2F A;  1ORK A;  3WHB A;  2ZOY A;  1QVT A;  5F0F A;  2FQ4 A;  4JNN A;  3TP0 A;  5K7H A;  3TP3 A;  4D7M A;  3VP5 A;  5IOZ A;  2GUH A;  4HKU A;  3B81 A;  3QKX A;  3COL A;  2VPR A;  1RKW A;  4NEL A;  3G56 A;  5K7Z A;  3MNL A;  2X9D A;  2TCT A;  5FKM A;  5HSZ A;  3Q0U A;  2DTZ A;  3HIM A;  3VOK A;  2PBX A;  3WHC A;  5F04 A;  4MXM A;  2WGB A;  1T33 A;  2UXO A;  3IUV A;  3QQA A;  3O8H A;  5EZG A;  2HXO A;  3CRJ A;  5IPA A;  2Y31 A;  4W97 A;  2VKE A;  5J3L A;  1Z77 A;  3HGY A;  3ZQH A;  2F07 A;  3P9T A;  3IH4 A;  2NS8 A;  3ZQL A;  3BRU A;  2QTQ A;  5J1U A;  2HYJ A;  5F0C A;  2ZCN A;  1JUM A;  2IBD A;  5IP6 A;  3KZ9 A;  4JYK A;  4AUX A;  3LHQ A;  5HBU A;  5HAW A;  2HQ5 A;  2IAI A;  3PPB A;  1QVU A;  1ZK8 A;  3DPJ A;  4DW6 A;  1UI5 A;  3FK7 A;  2O7T A;  2UXP A;  2Y2Z A;  2XPU A;  2G7G A;  4GCL A;  2QOP A;  3Q0W A;  2RAE A;  2O7O A;  5F27 A;  3C2B A;  2WV1 A;  2UXU A;  4ABZ A;  3BHQ A;  4ME9 A;  1Z0X A;  4KWA A;  4L62 A;  3BTJ A;  4D5C A;  3CCY A;  3HTI A;  4NN1 A;  5GP9 A;  2ZCM A;  3NPI A;  3PAS A;  4CGR A;  2OF7 A;  5AQC A;  5EZH A;  4PXI A;  1U9N A;  1RPW A;  2EH3 A;  2QIB A;  3ZQF A;  1RKT A;  2DG7 A;  2ID6 A;  2XDN A;  5EFY A;  3KNW A;  3VVY A;  2YVE A;  5FKK A;  2NX4 A;  3C07 A;  2QCO A;  4XK4 A;  4ICH A;  2NS7 A;  4D7N A;  4UDS A;  2QKO A;  5H9T A;  3EGQ A;  3AQT A;  3VW2 A;  3NRG A;  5CXG A;  3LJL A;  3O60 A;  2JJ7 A;  5D1R A;  3GZI A;  3FRQ A;  3BTI A;  3PM1 A;  2GFN A;  3VVZ A;  3LSJ A;  5C4Y A;  3FK6 A;  3S5R A;  1JUP A;  1A6I A;  3BT9 A;  5FMP A;  4I6Z A;  3LSR A;  1U9O A;  3RD3 A;  2UXH A;  3BR2 A;  3HE0 A;  4W1U A;  2RAS A;  2G0E A;  5FHP A;  5J1R A;  4M3G A;  3HTJ A;  4AC6 A;  4B3A A;  2RHA A;  4JL3 A;  5FKN A;  3ON2 A;  3HTA A;  2XGE A;  3B6C A;  5EYR A;  2QWT A;  1ZKG A;  2FX0 A;  5FKO A;  4M3F A;  2FJ1 A;  3ANG A;  4D5F A;  3KKD A;  2XB5 A;  3B6A A;  3ZQG A;  2XGC A;  2W53 A;  4AC0 A;  2G7L A;  2FD5 A;  3VUQ A;  2IU5 A;  3VW1 A;  3V6G A;  3BQY A;  3F1B A;  4B1R A;  4X1E A;  3BCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...