4MXMA

Crystal structure of superantigen pfit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
199
Chain Sequence
b'GPLGSMRTMVDSGQLTDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRCELQSIMGGSGEAMAVEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTGALSWTTTWFRAQGSLTLEELAEEALLMVLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator I2
publication title Pfit is a structurally novel Crohn's disease-associated superantigen.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Dna binding protein
total genus 64
structure length 199
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mxmA00
2GFNA 5J1UA 3ANPA 4ME9A 4XK4A 3IH3A 4JKZA 2OF7A 3V6GA 3VIBA 1SGMA 2F07A 5J1YA 3B6CA 2EH3A 3BCGA 2HYJA 3BJBA 4V2GA 3Q0UA 3HGGA 4W1UA 1BJZA 3NXCA 1JUMA 3BT9A 4ACIA 5F0CA 2IBDA 4B1RA 3CDLA 2JJ7A 2XDNA 3VW0A 3BHQA 2Y30A 2NP5A 5F08A 4MO7A 3F1BA 3LSRA 2D6YA 3ZQFA 2FJ1A 4GCTA 5EFYA 3O8GA 2I10A 3VOKA 4AUXA 2HXIA 2O7OA 3O60A 2TCTA 2UXHA 5D1RA 2NS8A 1UI5A 1U9OA 3RD3A 3BTIA 1QVUA 1VI0A 2OPTA 2RASA 3C2BA 5H9TA 2UXIA 3VOXA 2X9DA 3NI7A 2O7TA 4JNNA 3VP5A 3FK6A 2XGEA 3HE0A 5FGLA 3CCYA 2X6OA 3BQZA 3NPIA 1JT0A 3BQYA 1ZK8A 5J1RA 3DCFA 2IU5A 5F0HA 3G1LA 3LWJA 1JT6A 5D19A 3G7RA 3LSPA 2XPUA 3IH2A 2FQ4A 2G7GA 3B81A 1RKWA 2VPRA 2Y2ZA 3GZIA 2UXUA 3VPRA 3G1OA 3IH4A 2VKEA 3ZQLA 2ID3A 4KWAA 3NRGA 3QBMA 5EZHA 3LJLA 3KKCA 4YZEA 3P9TA 5D18A 2NX4A 3ZQHA 5J3LA 4D7MA 4JYKA 2ZOYA 4B3AA 1T33A 5CW8A 2FD5A 4PXIA 3PM1A 3BR0A 2IEKA 4M3BA 3BR5A 4MXMA 4NELA 5FKNA 1A6IA 2GENA 2RAEA 3BR2A 4ICHA 2ZCXA 2TRTA 4ABZA 1JTYA 2YVHA 5GPCA 2FX0A 2IAIA 2UXPA 4AF5A 5F04A 3KZ9A 3BR6A 3MNLA 4AC6A 3AQTA 2WGBA 3VVYA 5FKKA 3HGYA 2YVEA 3Q0VA 4G12A 2QIBA 4M3EA 2XPWA 2QCOA 5AQCA 4GCKA 3IUVA 3VW1A 3LHQA 3T6NA 1RKTA 2QOPA 2PBXA 4AC0A 4X1EA 3Q0WA 2V57A 5CXIA 3CJDA 2G7LA 2HKUA 3NNRA 3Q3SA 3BRUA 3HTAA 4CGRA 3EUPA 3SDGA 4M3GA 4W97A 4JL3A 3COLA 4DW6A 3B6AA 2QWTA 2XPVA 2W53A 2DTZA 3JSJA 1RPWA 5FKLA 3HIMA 2G7SA 3BTJA 1Z0XA 5FHPA 3E7QA 3FIWA 1JUPA 3ON4A 5K7HA 3CRJA 4M3FA 4HKUA 2QTQA 2HYTA 1ZKGA 3ZQIA 5FKOA 1QVTA 2XGCA 3LOCA 3F0CA 2GBYA 3V78A 2ZB9A 3KKDA 3HTJA 5HAWA 3G56A 3VUQA 3QPLA 3VW2A 4I6ZA 5GP9A 5C4YA 1U9NA 3ZQGA 4GFLA 2XGDA 1T56A 2Q24A 3KNWA 5HSZA 2ZOZA 1ORKA 2ID6A 3ON2A 3QKXA 5F1JA 2G3BA 2FBQA 3CWRA 1QPIA 4M3DA 3HTHA 3FRQA 3G1MA 5F0FA 3LSJA 5IPAA 4GCLA 5CXGA 5FMPA 3BR1A 3PPBA 4D5CA 2Y31A 3C07A 5EZGA 5K58A 3DPJA 3AQSA 5IOZA 3S5RA 3QPSA 3VVXA 1JUSA 3ANGA 2G0EA 2XRLA 2PZ9A 2WUIA 3BNIA 2DG7A 4NN1A 2DG8A 2JK3A 5K7FA 3BR3A 4GFKA 5IP6A 4MK6A 2OI8A 5FKMA 5F27A 4D7NA 3FK7A 2WV1A 3WHBA 4L62A 5HBUA 4V2FA 3HTIA 5K7ZA 4D5FA 3EGQA 1JTXA 2QKOA 2UXOA 5DAJA 2XB5A 3GEUA 4UDSA 5IOYA 2REKA 2OERA 3TP0A 3PASA 3O8HA 2HXOA 5GPAA 2NS7A 1UI6A 3DEWA 1Z77A 3TP3A 3SFIA 3BTLA 2RHAA 3WHCA 5EYRA 2NP3A 3VVZA 3MVPA 3RH2A 3QQAA 3BTCA 2ZCNA 2HQ5A 2ZCMA 2VKVA 2GUHA 4I76A
chains in the Genus database with same CATH superfamily
2GFNA 5J1UA 3ANPA 4ME9A 4XK4A 3IH3A 4JKZA 2OF7A 3V6GA 3VIBA 1SGMA 2F07A 5J1YA 3B6CA 2EH3A 3BCGA 2B3WA 2HYJA 3BJBA 4V2GA 3Q0UA 3HGGA 4W1UA 3K8PC 1BJZA 3NXCA 1JUMA 3BT9A 4ACIA 5F0CA 2IBDA 4B1RA 3CDLA 2JJ7A 2XDNA 3VW0A 3BHQA 2Y30A 2NP5A 5F08A 2PFVA 4MO7A 3F1BA 3LSRA 2D6YA 3ZQFA 2FJ1A 4GCTA 5EFYA 3O8GA 2I10A 3VOKA 3FHNA 4AUXA 2HXIA 2O7OA 3O60A 2TCTA 2UXHA 5D1RA 2NS8A 1UI5A 1U9OA 3RD3A 3BTIA 1QVUA 1VI0A 2OPTA 3NS4A 2RASA 3C2BA 5H9TA 2UXIA 3VOXA 2X9DA 3NI7A 2O7TA 4JNNA 3VP5A 3FK6A 2XGEA 3HE0A 5FGLA 3CCYA 2X6OA 3BQZA 4C2MA 3NPIA 1JT0A 3BQYA 1ZK8A 5J1RA 3DCFA 2IU5A 5F0HA 3G1LA 3LWJA 1JT6A 5D19A 3G7RA 2R7SA 3LSPA 2XPUA 3IH2A 2FQ4A 2G7GA 3B81A 1RKWA 2VPRA 2Y2ZA 3GZIA 2UXUA 3VPRA 3G1OA 3IH4A 3SWHA 2VKEA 3ZQLA 2ID3A 4KWAA 3NRGA 3QBMA 5EZHA 3LJLA 3KKCA 4YZEA 4U9NA 3P9TA 5D18A 2NX4A 3ZQHA 5J3LA 4D7MA 4JYKA 2ZOYA 4B3AA 1T33A 5CW8A 2FD5A 4PXIA 3PM1A 3BR0A 2IEKA 4M3BA 3BR5A 4MXMA 4NELA 5FKNA 1A6IA 2GENA 2RAEA 3BR2A 4ICHA 2ZCXA 2TRTA 4DVYP 4ABZA 1JTYA 2YVHA 5GPCA 2FX0A 2IAIA 2UXPA 4AF5A 5F04A 3KZ9A 3BR6A 3MNLA 4AC6A 3AQTA 2WGBA 3VVYA 5FKKA 3HGYA 2YVEA 3Q0VA 4G12A 2QIBA 4M3EA 2R7VA 2XPWA 2QCOA 5AQCA 4GCKA 2R7XA 3IUVA 3VW1A 3LHQA 3T6NA 2R7OA 1RKTA 2QOPA 2PBXA 4AC0A 4X1EA 3Q0WA 2V57A 5CXIA 3CJDA 2G7LA 2HKUA 3NNRA 3Q3SA 3BRUA 4WIBA 3HTAA 4CGRA 3EUPA 3SDGA 3KYLA 4IRVA 4M3GA 4W97A 4JL3A 3COLA 4DW6A 3B6AA 2QWTA 2XPVA 2W53A 2DTZA 3JSJA 1RPWA 5FKLA 3HIMA 2G7SA 3BTJA 1Z0XA 5FHPA 2B1EA 3E7QA 2FJI1 3FIWA 1JUPA 3ON4A 5K7HA 3CRJA 4M3FA 4HKUA 2QTQA 2HYTA 1ZKGA 3ZQIA 5FKOA 1QVTA 2XGCA 3LOCA 3F0CA 2GBYA 3V78A 2ZB9A 3KKDA 3HTJA 5HAWA 3G56A 3VUQA 3VTIA 3QPLA 3VW2A 4I6ZA 5GP9A 5C4YA 1U9NA 3ZQGA 4GFLA 2XGDA 1T56A 2Q24A 3KNWA 5HSZA 2ZOZA 1ORKA 2ID6A 3ON2A 4U9LA 3QKXA 5F1JA 2G3BA 2R7WA 2FBQA 3CWRA 1QPIA 5CQGA 2R7RA 4M3DA 3HTHA 3FRQA 3G1MA 5F0FA 3LSJA 5IPAA 2ZY9A 4GCLA 5CXGA 5FMPA 3BR1A 3PPBA 4D5CA 4OD4A 2Y31A 3C07A 5EZGA 5K58A 3DPJA 3AQSA 5IOZA 3S5RA 3QPSA 3VVXA 1JUSA 3ANGA 2G0EA 2XRLA 2PZ9A 2WUIA 3BNIA 2DG7A 4NN1A 2DG8A 2JK3A 5K7FA 3BR3A 4GFKA 5IP6A 4MK6A 2OI8A 5FKMA 5F27A 4D7NA 3FK7A 2WV1A 3WHBA 2R7TA 4L62A 5HBUA 2A2FX 4V2FA 3HTIA 5K7ZA 4D5FA 3EGQA 1JTXA 2QKOA 2UXOA 2R7UA 5DAJA 2XB5A 2R7QA 3GEUA 4UDSA 5IOYA 2REKA 4OD5A 2OERA 3DU5A 3TP0A 3PASA 3O8HA 2HXOA 5GPAA 2NS7A 1UI6A 3DEWA 1Z77A 3TP3A 3SFIA 3BTLA 2RHAA 3DU6A 3WHCA 5EYRA 2NP3A 3VVZA 3MVPA 3RH2A 3QQAA 3BTCA 2ZCNA 2HQ5A 2ZCMA 2VKVA 2GUHA 4I76A 2YVXA
chains in the Genus database with same CATH topology
2GFNA 5J1UA 3ANPA 4ME9A 4XK4A 3IH3A 4JKZA 2OF7A 3V6GA 3VIBA 1SGMA 2F07A 5J1YA 3B6CA 2EH3A 3BCGA 2HYJA 3BJBA 4V2GA 3Q0UA 3HGGA 4W1UA 1BJZA 3NXCA 1JUMA 3BT9A 4ACIA 5F0CA 2IBDA 4B1RA 3CDLA 2JJ7A 2XDNA 3VW0A 3BHQA 2Y30A 2NP5A 5F08A 4MO7A 3F1BA 3LSRA 2D6YA 3ZQFA 2FJ1A 4GCTA 5EFYA 3O8GA 2I10A 3VOKA 4AUXA 2HXIA 2O7OA 3O60A 2TCTA 2UXHA 5D1RA 2NS8A 1UI5A 1U9OA 3RD3A 3BTIA 1QVUA 1VI0A 2OPTA 2RASA 3C2BA 5H9TA 2UXIA 3VOXA 2X9DA 3NI7A 2O7TA 4JNNA 3VP5A 3FK6A 2XGEA 3HE0A 5FGLA 3CCYA 2X6OA 3BQZA 3NPIA 1JT0A 3BQYA 1ZK8A 5J1RA 3DCFA 2IU5A 5F0HA 3G1LA 3LWJA 1JT6A 5D19A 3G7RA 3LSPA 2XPUA 3IH2A 2FQ4A 2G7GA 3B81A 1RKWA 2VPRA 2Y2ZA 3GZIA 2UXUA 3VPRA 3G1OA 3IH4A 2VKEA 3ZQLA 2ID3A 4KWAA 3NRGA 3QBMA 5EZHA 3LJLA 3KKCA 4YZEA 3P9TA 5D18A 2NX4A 3ZQHA 5J3LA 4D7MA 4JYKA 2ZOYA 4B3AA 1T33A 5CW8A 2FD5A 4PXIA 3PM1A 3BR0A 2IEKA 4M3BA 3BR5A 4MXMA 4NELA 5FKNA 1A6IA 2GENA 2RAEA 3BR2A 4ICHA 2ZCXA 2TRTA 4ABZA 1JTYA 2YVHA 5GPCA 2FX0A 2IAIA 2UXPA 4AF5A 5F04A 3KZ9A 3BR6A 3MNLA 4AC6A 3AQTA 2WGBA 3VVYA 5FKKA 3HGYA 2YVEA 3Q0VA 4G12A 2QIBA 4M3EA 2XPWA 2QCOA 5AQCA 4GCKA 3IUVA 3VW1A 3LHQA 3T6NA 1RKTA 2QOPA 2PBXA 4AC0A 4X1EA 3Q0WA 2V57A 5CXIA 3CJDA 2G7LA 2HKUA 3NNRA 3Q3SA 3BRUA 3HTAA 4CGRA 3EUPA 3SDGA 4M3GA 4W97A 4JL3A 3COLA 4DW6A 3B6AA 2QWTA 2XPVA 2W53A 2DTZA 3JSJA 1RPWA 5FKLA 3HIMA 2G7SA 3BTJA 1Z0XA 5FHPA 3E7QA 3FIWA 1JUPA 3ON4A 5K7HA 3CRJA 4M3FA 4HKUA 2QTQA 2HYTA 1ZKGA 3ZQIA 5FKOA 1QVTA 2XGCA 3LOCA 3F0CA 2GBYA 3V78A 2ZB9A 3KKDA 3HTJA 5HAWA 3G56A 3VUQA 3QPLA 3VW2A 4I6ZA 5GP9A 5C4YA 1U9NA 3ZQGA 4GFLA 2XGDA 1T56A 2Q24A 3KNWA 5HSZA 2ZOZA 1ORKA 2ID6A 3ON2A 3QKXA 5F1JA 2G3BA 2FBQA 3CWRA 1QPIA 4M3DA 3HTHA 3FRQA 3G1MA 5F0FA 3LSJA 5IPAA 4GCLA 5CXGA 5FMPA 3BR1A 3PPBA 4D5CA 2Y31A 3C07A 5EZGA 5K58A 3DPJA 3AQSA 5IOZA 3S5RA 3QPSA 3VVXA 1JUSA 3ANGA 2G0EA 2XRLA 2PZ9A 2WUIA 3BNIA 2DG7A 4NN1A 2DG8A 2JK3A 5K7FA 3BR3A 4GFKA 5IP6A 4MK6A 2OI8A 5FKMA 5F27A 4D7NA 3FK7A 2WV1A 3WHBA 4L62A 5HBUA 4V2FA 3HTIA 5K7ZA 4D5FA 3EGQA 1JTXA 2QKOA 2UXOA 5DAJA 2XB5A 3GEUA 4UDSA 5IOYA 2REKA 2OERA 3TP0A 3PASA 3O8HA 2HXOA 5GPAA 2NS7A 1UI6A 3DEWA 1Z77A 3TP3A 3SFIA 3BTLA 2RHAA 3WHCA 5EYRA 2NP3A 3VVZA 3MVPA 3RH2A 3QQAA 3BTCA 2ZCNA 2HQ5A 2ZCMA 2VKVA 2GUHA 4I76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFN A;  5J1U A;  3ANP A;  4ME9 A;  4XK4 A;  3IH3 A;  4JKZ A;  2OF7 A;  3V6G A;  3VIB A;  1SGM A;  2F07 A;  5J1Y A;  3B6C A;  2EH3 A;  3BCG A;  2HYJ A;  3BJB A;  4V2G A;  3Q0U A;  3HGG A;  4W1U A;  1BJZ A;  3NXC A;  1JUM A;  3BT9 A;  4ACI A;  5F0C A;  2IBD A;  4B1R A;  3CDL A;  2JJ7 A;  2XDN A;  3VW0 A;  3BHQ A;  2Y30 A;  2NP5 A;  5F08 A;  4MO7 A;  3F1B A;  3LSR A;  2D6Y A;  3ZQF A;  2FJ1 A;  4GCT A;  5EFY A;  3O8G A;  2I10 A;  3VOK A;  4AUX A;  2HXI A;  2O7O A;  3O60 A;  2TCT A;  2UXH A;  5D1R A;  2NS8 A;  1UI5 A;  1U9O A;  3RD3 A;  3BTI A;  1QVU A;  1VI0 A;  2OPT A;  2RAS A;  3C2B A;  5H9T A;  2UXI A;  3VOX A;  2X9D A;  3NI7 A;  2O7T A;  4JNN A;  3VP5 A;  3FK6 A;  2XGE A;  3HE0 A;  5FGL A;  3CCY A;  2X6O A;  3BQZ A;  3NPI A;  1JT0 A;  3BQY A;  1ZK8 A;  5J1R A;  3DCF A;  2IU5 A;  5F0H A;  3G1L A;  3LWJ A;  1JT6 A;  5D19 A;  3G7R A;  3LSP A;  2XPU A;  3IH2 A;  2FQ4 A;  2G7G A;  3B81 A;  1RKW A;  2VPR A;  2Y2Z A;  3GZI A;  2UXU A;  3VPR A;  3G1O A;  3IH4 A;  2VKE A;  3ZQL A;  2ID3 A;  4KWA A;  3NRG A;  3QBM A;  5EZH A;  3LJL A;  3KKC A;  4YZE A;  3P9T A;  5D18 A;  2NX4 A;  3ZQH A;  5J3L A;  4D7M A;  4JYK A;  2ZOY A;  4B3A A;  1T33 A;  5CW8 A;  2FD5 A;  4PXI A;  3PM1 A;  3BR0 A;  2IEK A;  4M3B A;  3BR5 A;  4MXM A;  4NEL A;  5FKN A;  1A6I A;  2GEN A;  2RAE A;  3BR2 A;  4ICH A;  2ZCX A;  2TRT A;  4ABZ A;  1JTY A;  2YVH A;  5GPC A;  2FX0 A;  2IAI A;  2UXP A;  4AF5 A;  5F04 A;  3KZ9 A;  3BR6 A;  3MNL A;  4AC6 A;  3AQT A;  2WGB A;  3VVY A;  5FKK A;  3HGY A;  2YVE A;  3Q0V A;  4G12 A;  2QIB A;  4M3E A;  2XPW A;  2QCO A;  5AQC A;  4GCK A;  3IUV A;  3VW1 A;  3LHQ A;  3T6N A;  1RKT A;  2QOP A;  2PBX A;  4AC0 A;  4X1E A;  3Q0W A;  2V57 A;  5CXI A;  3CJD A;  2G7L A;  2HKU A;  3NNR A;  3Q3S A;  3BRU A;  3HTA A;  4CGR A;  3EUP A;  3SDG A;  4M3G A;  4W97 A;  4JL3 A;  3COL A;  4DW6 A;  3B6A A;  2QWT A;  2XPV A;  2W53 A;  2DTZ A;  3JSJ A;  1RPW A;  5FKL A;  3HIM A;  2G7S A;  3BTJ A;  1Z0X A;  5FHP A;  3E7Q A;  3FIW A;  1JUP A;  3ON4 A;  5K7H A;  3CRJ A;  4M3F A;  4HKU A;  2QTQ A;  2HYT A;  1ZKG A;  3ZQI A;  5FKO A;  1QVT A;  2XGC A;  3LOC A;  3F0C A;  2GBY A;  3V78 A;  2ZB9 A;  3KKD A;  3HTJ A;  5HAW A;  3G56 A;  3VUQ A;  3QPL A;  3VW2 A;  4I6Z A;  5GP9 A;  5C4Y A;  1U9N A;  3ZQG A;  4GFL A;  2XGD A;  1T56 A;  2Q24 A;  3KNW A;  5HSZ A;  2ZOZ A;  1ORK A;  2ID6 A;  3ON2 A;  3QKX A;  5F1J A;  2G3B A;  2FBQ A;  3CWR A;  1QPI A;  4M3D A;  3HTH A;  3FRQ A;  3G1M A;  5F0F A;  3LSJ A;  5IPA A;  4GCL A;  5CXG A;  5FMP A;  3BR1 A;  3PPB A;  4D5C A;  2Y31 A;  3C07 A;  5EZG A;  5K58 A;  3DPJ A;  3AQS A;  5IOZ A;  3S5R A;  3QPS A;  3VVX A;  1JUS A;  3ANG A;  2G0E A;  2XRL A;  2PZ9 A;  2WUI A;  3BNI A;  2DG7 A;  4NN1 A;  2DG8 A;  2JK3 A;  5K7F A;  3BR3 A;  4GFK A;  5IP6 A;  4MK6 A;  2OI8 A;  5FKM A;  5F27 A;  4D7N A;  3FK7 A;  2WV1 A;  3WHB A;  4L62 A;  5HBU A;  4V2F A;  3HTI A;  5K7Z A;  4D5F A;  3EGQ A;  1JTX A;  2QKO A;  2UXO A;  5DAJ A;  2XB5 A;  3GEU A;  4UDS A;  5IOY A;  2REK A;  2OER A;  3TP0 A;  3PAS A;  3O8H A;  2HXO A;  5GPA A;  2NS7 A;  1UI6 A;  3DEW A;  1Z77 A;  3TP3 A;  3SFI A;  3BTL A;  2RHA A;  3WHC A;  5EYR A;  2NP3 A;  3VVZ A;  3MVP A;  3RH2 A;  3QQA A;  3BTC A;  2ZCN A;  2HQ5 A;  2ZCM A;  2VKV A;  2GUH A;  4I76 A; 
#chains in the Genus database with same CATH topology
 2GFN A;  5J1U A;  3ANP A;  4ME9 A;  4XK4 A;  3IH3 A;  4JKZ A;  2OF7 A;  3V6G A;  3VIB A;  1SGM A;  2F07 A;  5J1Y A;  3B6C A;  2EH3 A;  3BCG A;  2B3W A;  2HYJ A;  3BJB A;  4V2G A;  3Q0U A;  3HGG A;  4W1U A;  3K8P C;  1BJZ A;  3NXC A;  1JUM A;  3BT9 A;  4ACI A;  5F0C A;  2IBD A;  4B1R A;  3CDL A;  2JJ7 A;  2XDN A;  3VW0 A;  3BHQ A;  2Y30 A;  2NP5 A;  5F08 A;  2PFV A;  4MO7 A;  3F1B A;  3LSR A;  2D6Y A;  3ZQF A;  2FJ1 A;  4GCT A;  5EFY A;  3O8G A;  2I10 A;  3VOK A;  3FHN A;  4AUX A;  2HXI A;  2O7O A;  3O60 A;  2TCT A;  2UXH A;  5D1R A;  2NS8 A;  1UI5 A;  1U9O A;  3RD3 A;  3BTI A;  1QVU A;  1VI0 A;  2OPT A;  3NS4 A;  2RAS A;  3C2B A;  5H9T A;  2UXI A;  3VOX A;  2X9D A;  3NI7 A;  2O7T A;  4JNN A;  3VP5 A;  3FK6 A;  2XGE A;  3HE0 A;  5FGL A;  3CCY A;  2X6O A;  3BQZ A;  4C2M A;  3NPI A;  1JT0 A;  3BQY A;  1ZK8 A;  5J1R A;  3DCF A;  2IU5 A;  5F0H A;  3G1L A;  3LWJ A;  1JT6 A;  5D19 A;  3G7R A;  2R7S A;  3LSP A;  2XPU A;  3IH2 A;  2FQ4 A;  2G7G A;  3B81 A;  1RKW A;  2VPR A;  2Y2Z A;  3GZI A;  2UXU A;  3VPR A;  3G1O A;  3IH4 A;  3SWH A;  2VKE A;  3ZQL A;  2ID3 A;  4KWA A;  3NRG A;  3QBM A;  5EZH A;  3LJL A;  3KKC A;  4YZE A;  4U9N A;  3P9T A;  5D18 A;  2NX4 A;  3ZQH A;  5J3L A;  4D7M A;  4JYK A;  2ZOY A;  4B3A A;  1T33 A;  5CW8 A;  2FD5 A;  4PXI A;  3PM1 A;  3BR0 A;  2IEK A;  4M3B A;  3BR5 A;  4MXM A;  4NEL A;  5FKN A;  1A6I A;  2GEN A;  2RAE A;  3BR2 A;  4ICH A;  2ZCX A;  2TRT A;  4DVY P;  4ABZ A;  1JTY A;  2YVH A;  5GPC A;  2FX0 A;  2IAI A;  2UXP A;  4AF5 A;  5F04 A;  3KZ9 A;  3BR6 A;  3MNL A;  4AC6 A;  3AQT A;  2WGB A;  3VVY A;  5FKK A;  3HGY A;  2YVE A;  3Q0V A;  4G12 A;  2QIB A;  4M3E A;  2R7V A;  2XPW A;  2QCO A;  5AQC A;  4GCK A;  2R7X A;  3IUV A;  3VW1 A;  3LHQ A;  3T6N A;  2R7O A;  1RKT A;  2QOP A;  2PBX A;  4AC0 A;  4X1E A;  3Q0W A;  2V57 A;  5CXI A;  3CJD A;  2G7L A;  2HKU A;  3NNR A;  3Q3S A;  3BRU A;  4WIB A;  3HTA A;  4CGR A;  3EUP A;  3SDG A;  3KYL A;  4IRV A;  4M3G A;  4W97 A;  4JL3 A;  3COL A;  4DW6 A;  3B6A A;  2QWT A;  2XPV A;  2W53 A;  2DTZ A;  3JSJ A;  1RPW A;  5FKL A;  3HIM A;  2G7S A;  3BTJ A;  1Z0X A;  5FHP A;  2B1E A;  3E7Q A;  2FJI 1;  3FIW A;  1JUP A;  3ON4 A;  5K7H A;  3CRJ A;  4M3F A;  4HKU A;  2QTQ A;  2HYT A;  1ZKG A;  3ZQI A;  5FKO A;  1QVT A;  2XGC A;  3LOC A;  3F0C A;  2GBY A;  3V78 A;  2ZB9 A;  3KKD A;  3HTJ A;  5HAW A;  3G56 A;  3VUQ A;  3VTI A;  3QPL A;  3VW2 A;  4I6Z A;  5GP9 A;  5C4Y A;  1U9N A;  3ZQG A;  4GFL A;  2XGD A;  1T56 A;  2Q24 A;  3KNW A;  5HSZ A;  2ZOZ A;  1ORK A;  2ID6 A;  3ON2 A;  4U9L A;  3QKX A;  5F1J A;  2G3B A;  2R7W A;  2FBQ A;  3CWR A;  1QPI A;  5CQG A;  2R7R A;  4M3D A;  3HTH A;  3FRQ A;  3G1M A;  5F0F A;  3LSJ A;  5IPA A;  2ZY9 A;  4GCL A;  5CXG A;  5FMP A;  3BR1 A;  3PPB A;  4D5C A;  4OD4 A;  2Y31 A;  3C07 A;  5EZG A;  5K58 A;  3DPJ A;  3AQS A;  5IOZ A;  3S5R A;  3QPS A;  3VVX A;  1JUS A;  3ANG A;  2G0E A;  2XRL A;  2PZ9 A;  2WUI A;  3BNI A;  2DG7 A;  4NN1 A;  2DG8 A;  2JK3 A;  5K7F A;  3BR3 A;  4GFK A;  5IP6 A;  4MK6 A;  2OI8 A;  5FKM A;  5F27 A;  4D7N A;  3FK7 A;  2WV1 A;  3WHB A;  2R7T A;  4L62 A;  5HBU A;  2A2F X;  4V2F A;  3HTI A;  5K7Z A;  4D5F A;  3EGQ A;  1JTX A;  2QKO A;  2UXO A;  2R7U A;  5DAJ A;  2XB5 A;  2R7Q A;  3GEU A;  4UDS A;  5IOY A;  2REK A;  4OD5 A;  2OER A;  3DU5 A;  3TP0 A;  3PAS A;  3O8H A;  2HXO A;  5GPA A;  2NS7 A;  1UI6 A;  3DEW A;  1Z77 A;  3TP3 A;  3SFI A;  3BTL A;  2RHA A;  3DU6 A;  3WHC A;  5EYR A;  2NP3 A;  3VVZ A;  3MVP A;  3RH2 A;  3QQA A;  3BTC A;  2ZCN A;  2HQ5 A;  2ZCM A;  2VKV A;  2GUH A;  4I76 A;  2YVX A; 
#chains in the Genus database with same CATH homology
 2GFN A;  5J1U A;  3ANP A;  4ME9 A;  4XK4 A;  3IH3 A;  4JKZ A;  2OF7 A;  3V6G A;  3VIB A;  1SGM A;  2F07 A;  5J1Y A;  3B6C A;  2EH3 A;  3BCG A;  2HYJ A;  3BJB A;  4V2G A;  3Q0U A;  3HGG A;  4W1U A;  1BJZ A;  3NXC A;  1JUM A;  3BT9 A;  4ACI A;  5F0C A;  2IBD A;  4B1R A;  3CDL A;  2JJ7 A;  2XDN A;  3VW0 A;  3BHQ A;  2Y30 A;  2NP5 A;  5F08 A;  4MO7 A;  3F1B A;  3LSR A;  2D6Y A;  3ZQF A;  2FJ1 A;  4GCT A;  5EFY A;  3O8G A;  2I10 A;  3VOK A;  4AUX A;  2HXI A;  2O7O A;  3O60 A;  2TCT A;  2UXH A;  5D1R A;  2NS8 A;  1UI5 A;  1U9O A;  3RD3 A;  3BTI A;  1QVU A;  1VI0 A;  2OPT A;  2RAS A;  3C2B A;  5H9T A;  2UXI A;  3VOX A;  2X9D A;  3NI7 A;  2O7T A;  4JNN A;  3VP5 A;  3FK6 A;  2XGE A;  3HE0 A;  5FGL A;  3CCY A;  2X6O A;  3BQZ A;  3NPI A;  1JT0 A;  3BQY A;  1ZK8 A;  5J1R A;  3DCF A;  2IU5 A;  5F0H A;  3G1L A;  3LWJ A;  1JT6 A;  5D19 A;  3G7R A;  3LSP A;  2XPU A;  3IH2 A;  2FQ4 A;  2G7G A;  3B81 A;  1RKW A;  2VPR A;  2Y2Z A;  3GZI A;  2UXU A;  3VPR A;  3G1O A;  3IH4 A;  2VKE A;  3ZQL A;  2ID3 A;  4KWA A;  3NRG A;  3QBM A;  5EZH A;  3LJL A;  3KKC A;  4YZE A;  3P9T A;  5D18 A;  2NX4 A;  3ZQH A;  5J3L A;  4D7M A;  4JYK A;  2ZOY A;  4B3A A;  1T33 A;  5CW8 A;  2FD5 A;  4PXI A;  3PM1 A;  3BR0 A;  2IEK A;  4M3B A;  3BR5 A;  4MXM A;  4NEL A;  5FKN A;  1A6I A;  2GEN A;  2RAE A;  3BR2 A;  4ICH A;  2ZCX A;  2TRT A;  4ABZ A;  1JTY A;  2YVH A;  5GPC A;  2FX0 A;  2IAI A;  2UXP A;  4AF5 A;  5F04 A;  3KZ9 A;  3BR6 A;  3MNL A;  4AC6 A;  3AQT A;  2WGB A;  3VVY A;  5FKK A;  3HGY A;  2YVE A;  3Q0V A;  4G12 A;  2QIB A;  4M3E A;  2XPW A;  2QCO A;  5AQC A;  4GCK A;  3IUV A;  3VW1 A;  3LHQ A;  3T6N A;  1RKT A;  2QOP A;  2PBX A;  4AC0 A;  4X1E A;  3Q0W A;  2V57 A;  5CXI A;  3CJD A;  2G7L A;  2HKU A;  3NNR A;  3Q3S A;  3BRU A;  3HTA A;  4CGR A;  3EUP A;  3SDG A;  4M3G A;  4W97 A;  4JL3 A;  3COL A;  4DW6 A;  3B6A A;  2QWT A;  2XPV A;  2W53 A;  2DTZ A;  3JSJ A;  1RPW A;  5FKL A;  3HIM A;  2G7S A;  3BTJ A;  1Z0X A;  5FHP A;  3E7Q A;  3FIW A;  1JUP A;  3ON4 A;  5K7H A;  3CRJ A;  4M3F A;  4HKU A;  2QTQ A;  2HYT A;  1ZKG A;  3ZQI A;  5FKO A;  1QVT A;  2XGC A;  3LOC A;  3F0C A;  2GBY A;  3V78 A;  2ZB9 A;  3KKD A;  3HTJ A;  5HAW A;  3G56 A;  3VUQ A;  3QPL A;  3VW2 A;  4I6Z A;  5GP9 A;  5C4Y A;  1U9N A;  3ZQG A;  4GFL A;  2XGD A;  1T56 A;  2Q24 A;  3KNW A;  5HSZ A;  2ZOZ A;  1ORK A;  2ID6 A;  3ON2 A;  3QKX A;  5F1J A;  2G3B A;  2FBQ A;  3CWR A;  1QPI A;  4M3D A;  3HTH A;  3FRQ A;  3G1M A;  5F0F A;  3LSJ A;  5IPA A;  4GCL A;  5CXG A;  5FMP A;  3BR1 A;  3PPB A;  4D5C A;  2Y31 A;  3C07 A;  5EZG A;  5K58 A;  3DPJ A;  3AQS A;  5IOZ A;  3S5R A;  3QPS A;  3VVX A;  1JUS A;  3ANG A;  2G0E A;  2XRL A;  2PZ9 A;  2WUI A;  3BNI A;  2DG7 A;  4NN1 A;  2DG8 A;  2JK3 A;  5K7F A;  3BR3 A;  4GFK A;  5IP6 A;  4MK6 A;  2OI8 A;  5FKM A;  5F27 A;  4D7N A;  3FK7 A;  2WV1 A;  3WHB A;  4L62 A;  5HBU A;  4V2F A;  3HTI A;  5K7Z A;  4D5F A;  3EGQ A;  1JTX A;  2QKO A;  2UXO A;  5DAJ A;  2XB5 A;  3GEU A;  4UDS A;  5IOY A;  2REK A;  2OER A;  3TP0 A;  3PAS A;  3O8H A;  2HXO A;  5GPA A;  2NS7 A;  1UI6 A;  3DEW A;  1Z77 A;  3TP3 A;  3SFI A;  3BTL A;  2RHA A;  3WHC A;  5EYR A;  2NP3 A;  3VVZ A;  3MVP A;  3RH2 A;  3QQA A;  3BTC A;  2ZCN A;  2HQ5 A;  2ZCM A;  2VKV A;  2GUH A;  4I76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...