4MXMA

Crystal structure of superantigen pfit
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
202
structure length
199
Chain Sequence
GPLGSMRTMVDSGQLTDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRCELQSIMGGSGEAMAVEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTGALSWTTTWFRAQGSLTLEELAEEALLMVLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pfit is a structurally novel Crohn's disease-associated superantigen.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Dna binding protein
molecule keywords Transcriptional regulator I2
total genus 64
structure length 199
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mxmA00
4M3DA 4GFKA 3LWJA 3BR0A 2XGCA 5GPAA 2HXIA 2JJ7A 4M3EA 2GENA 2G7GA 3LJLA 3TP0A 3QKXA 4I76A 4B3AA 5EZGA 3VVXA 3ZQIA 3VW1A 3KKDA 4AF5A 5HSZA 4AUXA 3PM1A 2G3BA 3VP5A 3BRUA 5DAJA 2TRTA 5F0CA 5K7ZA 2G7SA 5J1UA 3GEUA 4ABZA 1T56A 3BTJA 2XGEA 3HGYA 3SDGA 3E7QA 3HIMA 5EZHA 4MK6A 2XDNA 3ON2A 3V78A 3NI7A 5J3LA 3BQYA 3ZQHA 3HE0A 4XK4A 5CW8A 5J1YA 2G0EA 3FK6A 2OF7A 2DG7A 4GFLA 3BTIA 3RH2A 2VPRA 3NRGA 2QWTA 2NP5A 2TCTA 2XRLA 3ANGA 2HYTA 3IH4A 5FMPA 2HQ5A 4JNNA 4MO7A 1ORKA 3PPBA 2NX4A 3LSRA 2ZCNA 3B81A 2QTQA 3BJBA 3IH3A 2X9DA 2QIBA 1U9NA 1ZKGA 4AC6A 5K7FA 5J1RA 3BTCA 2PZ9A 3AQSA 1JUSA 5D18A 2FBQA 4KWAA 2NP3A 2QOPA 3ZQLA 4M3GA 4GCLA 5EYRA 5F04A 3V6GA 4ICHA 2ZB9A 5GPCA 1Z0XA 4B1RA 5AQCA 1BJZA 2UXHA 4NN1A 4DW6A 5CXGA 5F0FA 2Q24A 3VOXA 3IH2A 2XPUA 5C4YA 2IBDA 5FKLA 3CDLA 3CWRA 4I6ZA 3B6AA 3S5RA 5EFYA 5HBUA 2UXUA 3JSJA 3GZIA 2FJ1A 1UI5A 3F1BA 2QKOA 5H9TA 2RHAA 3BHQA 5GP9A 3NPIA 3VVZA 1U9OA 3ON4A 2RASA 3CCYA 3KNWA 3VPRA 3MNLA 2IEKA 3KKCA 2W53A 2HKUA 2ZOYA 1A6IA 4GCKA 2YVEA 2WGBA 2Y30A 2VKVA 3Q3SA 4ME9A 2Y31A 3DCFA 3QPLA 3HTHA 3FIWA 2HYJA 3KZ9A 2ZCXA 2F07A 3BTLA 4D7MA 2PBXA 2ZCMA 3P9TA 3G56A 3ANPA 3BR2A 5FKKA 3TP3A 2FX0A 3C07A 3SFIA 3EUPA 3QBMA 4L62A 1QVUA 1ZK8A 3VUQA 3DEWA 4PXIA 5IPAA 3BQZA 2NS8A 2UXIA 3CJDA 3MVPA 5F0HA 2WUIA 2QCOA 5F1JA 4G12A 4X1EA 4V2FA 3VW2A 3C2BA 4M3BA 5F08A 2ZOZA 2ID3A 3QPSA 4JL3A 3COLA 3HTIA 3HTJA 2GUHA 3FRQA 2FD5A 3G1LA 5FKMA 3G1MA 2O7OA 2O7TA 2XGDA 3WHCA 4JYKA 3CRJA 3BT9A 4D5FA 3FK7A 3VW0A 2OERA 5FHPA 2GBYA 4D5CA 1QPIA 3BR3A 2UXPA 1JT6A 5CXIA 1Z77A 5FKNA 2Y2ZA 3LOCA 5K58A 1RPWA 3LHQA 3NNRA 4W1UA 2REKA 2UXOA 2IAIA 3BNIA 4NELA 3BR1A 2OI8A 3Q0WA 1RKTA 4JKZA 2XPWA 4AC0A 3WHBA 3G1OA 3O8GA 1T33A 3G7RA 3LSJA 3O8HA 3PASA 2HXOA 3EGQA 5IOYA 3BR5A 2G7LA 3IUVA 1SGMA 3LSPA 5FGLA 2EH3A 4UDSA 1RKWA 5D19A 4V2GA 1JTXA 1UI6A 2FQ4A 1VI0A 2XPVA 4D7NA 4M3FA 2D6YA 5IOZA 3NXCA 1JUPA 2OPTA 3F0CA 4YZEA 2IU5A 4HKUA 3VIBA 2I10A 3HTAA 2YVHA 5F27A 2WV1A 3T6NA 2NS7A 2X6OA 3HGGA 5IP6A 1JTYA 1QVTA 3ZQGA 4W97A 3QQAA 3ZQFA 2DTZA 3Q0VA 1JT0A 3BCGA 5FKOA 4CGRA 4GCTA 2RAEA 3DPJA 2ID6A 3O60A 2VKEA 2DG8A 3B6CA 5D1RA 3VVYA 5HAWA 4ACIA 2JK3A 2XB5A 3VOKA 4MXMA 3BR6A 3Q0UA 2GFNA 3AQTA 3RD3A 5K7HA 2V57A 1JUMA
chains in the Genus database with same CATH superfamily
4M3DA 4GFKA 3LWJA 3BR0A 2XGCA 5GPAA 2HXIA 2JJ7A 4M3EA 2GENA 2G7GA 3LJLA 3TP0A 3QKXA 4I76A 4B3AA 5EZGA 3VVXA 2R7VA 3ZQIA 3FHNA 3VW1A 3KKDA 4AF5A 5HSZA 4AUXA 3PM1A 2G3BA 3VP5A 3BRUA 5DAJA 2TRTA 5F0CA 5K7ZA 2G7SA 5J1UA 3GEUA 4ABZA 1T56A 3BTJA 2XGEA 3HGYA 3SDGA 3E7QA 3HIMA 5EZHA 4MK6A 2XDNA 3ON2A 3V78A 3NI7A 5J3LA 3BQYA 3ZQHA 3HE0A 4XK4A 5CW8A 5J1YA 2G0EA 3FK6A 2OF7A 2DG7A 4GFLA 4U9LA 3BTIA 3RH2A 4WIBA 2VPRA 3NRGA 2QWTA 2NP5A 2TCTA 2XRLA 3ANGA 2HYTA 3IH4A 5FMPA 2HQ5A 4JNNA 4MO7A 1ORKA 3PPBA 4OD5A 2NX4A 3LSRA 2ZCNA 3B81A 2QTQA 3BJBA 3IH3A 2X9DA 2R7TA 2QIBA 1U9NA 1ZKGA 5CQGA 4AC6A 5K7FA 5J1RA 3BTCA 2PZ9A 3AQSA 1JUSA 5D18A 2FBQA 4KWAA 3VTIA 2NP3A 2QOPA 3ZQLA 3SWHA 4M3GA 4GCLA 5EYRA 5F04A 3V6GA 4ICHA 2ZB9A 5GPCA 1Z0XA 4B1RA 5AQCA 1BJZA 2UXHA 4NN1A 4DW6A 5CXGA 5F0FA 3NS4A 2Q24A 3VOXA 3IH2A 2XPUA 5C4YA 2IBDA 5FKLA 3CDLA 3CWRA 4I6ZA 3B6AA 3S5RA 2R7QA 5EFYA 5HBUA 2UXUA 3JSJA 3GZIA 2FJ1A 1UI5A 3F1BA 2QKOA 5H9TA 2RHAA 3BHQA 5GP9A 3NPIA 3VVZA 3KYLA 1U9OA 3ON4A 2RASA 3CCYA 3KNWA 3VPRA 3MNLA 3K8PC 2IEKA 3KKCA 2W53A 2HKUA 2ZOYA 1A6IA 3DU5A 4GCKA 2YVEA 2WGBA 2Y30A 2VKVA 3Q3SA 4ME9A 2Y31A 3DCFA 3QPLA 2ZY9A 3HTHA 3FIWA 2HYJA 3KZ9A 2ZCXA 2F07A 3BTLA 4D7MA 4U9NA 2PBXA 2ZCMA 3P9TA 3G56A 3ANPA 3BR2A 5FKKA 3TP3A 2FX0A 3C07A 3SFIA 3EUPA 3QBMA 4L62A 1QVUA 1ZK8A 3VUQA 3DEWA 4PXIA 5IPAA 3BQZA 2NS8A 2UXIA 3CJDA 3MVPA 5F0HA 2WUIA 2QCOA 5F1JA 4G12A 2R7XA 4X1EA 4V2FA 3DU6A 3VW2A 3C2BA 4IRVA 4M3BA 5F08A 2ZOZA 2ID3A 3QPSA 4JL3A 3COLA 3HTIA 3HTJA 2GUHA 4DVYP 3FRQA 2FD5A 3G1LA 5FKMA 3G1MA 2O7OA 2O7TA 2XGDA 3WHCA 4JYKA 3CRJA 3BT9A 4D5FA 2R7UA 3FK7A 3VW0A 2OERA 5FHPA 2GBYA 4D5CA 1QPIA 3BR3A 2UXPA 2R7OA 1JT6A 5CXIA 1Z77A 2A2FX 2Y2ZA 5FKNA 3LOCA 5K58A 1RPWA 3LHQA 3NNRA 4W1UA 2REKA 4OD4A 2UXOA 2IAIA 3BNIA 4NELA 3BR1A 2OI8A 2B1EA 3Q0WA 1RKTA 4JKZA 2R7RA 2XPWA 4AC0A 3WHBA 3G1OA 3O8GA 1T33A 3G7RA 3LSJA 3O8HA 3PASA 2HXOA 3EGQA 5IOYA 3BR5A 2G7LA 3IUVA 2PFVA 1SGMA 3LSPA 5FGLA 2EH3A 4UDSA 1RKWA 2B3WA 5D19A 4V2GA 1JTXA 1UI6A 2FQ4A 4C2MA 1VI0A 2XPVA 2YVXA 4D7NA 4M3FA 2D6YA 2R7SA 5IOZA 3NXCA 1JUPA 2OPTA 3F0CA 4YZEA 2IU5A 4HKUA 3VIBA 2I10A 3HTAA 2YVHA 5F27A 2WV1A 3T6NA 2NS7A 2X6OA 3HGGA 5IP6A 1JTYA 1QVTA 3ZQGA 4W97A 3QQAA 3ZQFA 2DTZA 3Q0VA 1JT0A 3BCGA 5FKOA 4CGRA 4GCTA 2RAEA 3DPJA 2ID6A 3O60A 2R7WA 2VKEA 2DG8A 3B6CA 5D1RA 3VVYA 5HAWA 4ACIA 2JK3A 2XB5A 3VOKA 2FJI1 4MXMA 3BR6A 3Q0UA 2GFNA 3AQTA 3RD3A 5K7HA 2V57A 1JUMA
chains in the Genus database with same CATH topology
4M3DA 4GFKA 3LWJA 3BR0A 2XGCA 5GPAA 2HXIA 2JJ7A 4M3EA 2GENA 2G7GA 3LJLA 3TP0A 3QKXA 4I76A 4B3AA 5EZGA 3VVXA 3ZQIA 3VW1A 3KKDA 4AF5A 5HSZA 4AUXA 3PM1A 2G3BA 3VP5A 3BRUA 5DAJA 2TRTA 5F0CA 5K7ZA 2G7SA 5J1UA 3GEUA 4ABZA 1T56A 3BTJA 2XGEA 3HGYA 3SDGA 3E7QA 3HIMA 5EZHA 4MK6A 2XDNA 3ON2A 3V78A 3NI7A 5J3LA 3BQYA 3ZQHA 3HE0A 4XK4A 5CW8A 5J1YA 2G0EA 3FK6A 2OF7A 2DG7A 4GFLA 3BTIA 3RH2A 2VPRA 3NRGA 2QWTA 2NP5A 2TCTA 2XRLA 3ANGA 2HYTA 3IH4A 5FMPA 2HQ5A 4JNNA 4MO7A 1ORKA 3PPBA 2NX4A 3LSRA 2ZCNA 3B81A 2QTQA 3BJBA 3IH3A 2X9DA 2QIBA 1U9NA 1ZKGA 4AC6A 5K7FA 5J1RA 3BTCA 2PZ9A 3AQSA 1JUSA 5D18A 2FBQA 4KWAA 2NP3A 2QOPA 3ZQLA 4M3GA 4GCLA 5EYRA 5F04A 3V6GA 4ICHA 2ZB9A 5GPCA 1Z0XA 4B1RA 5AQCA 1BJZA 2UXHA 4NN1A 4DW6A 5CXGA 5F0FA 2Q24A 3VOXA 3IH2A 2XPUA 5C4YA 2IBDA 5FKLA 3CDLA 3CWRA 4I6ZA 3B6AA 3S5RA 5EFYA 5HBUA 2UXUA 3JSJA 3GZIA 2FJ1A 1UI5A 3F1BA 2QKOA 5H9TA 2RHAA 3BHQA 5GP9A 3NPIA 3VVZA 1U9OA 3ON4A 2RASA 3CCYA 3KNWA 3VPRA 3MNLA 2IEKA 3KKCA 2W53A 2HKUA 2ZOYA 1A6IA 4GCKA 2YVEA 2WGBA 2Y30A 2VKVA 3Q3SA 4ME9A 2Y31A 3DCFA 3QPLA 3HTHA 3FIWA 2HYJA 3KZ9A 2ZCXA 2F07A 3BTLA 4D7MA 2PBXA 2ZCMA 3P9TA 3G56A 3ANPA 3BR2A 5FKKA 3TP3A 2FX0A 3C07A 3SFIA 3EUPA 3QBMA 4L62A 1QVUA 1ZK8A 3VUQA 3DEWA 4PXIA 5IPAA 3BQZA 2NS8A 2UXIA 3CJDA 3MVPA 5F0HA 2WUIA 2QCOA 5F1JA 4G12A 4X1EA 4V2FA 3VW2A 3C2BA 4M3BA 5F08A 2ZOZA 2ID3A 3QPSA 4JL3A 3COLA 3HTIA 3HTJA 2GUHA 3FRQA 2FD5A 3G1LA 5FKMA 3G1MA 2O7OA 2O7TA 2XGDA 3WHCA 4JYKA 3CRJA 3BT9A 4D5FA 3FK7A 3VW0A 2OERA 5FHPA 2GBYA 4D5CA 1QPIA 3BR3A 2UXPA 1JT6A 5CXIA 1Z77A 5FKNA 2Y2ZA 3LOCA 5K58A 1RPWA 3LHQA 3NNRA 4W1UA 2REKA 2UXOA 2IAIA 3BNIA 4NELA 3BR1A 2OI8A 3Q0WA 1RKTA 4JKZA 2XPWA 4AC0A 3WHBA 3G1OA 3O8GA 1T33A 3G7RA 3LSJA 3O8HA 3PASA 2HXOA 3EGQA 5IOYA 3BR5A 2G7LA 3IUVA 1SGMA 3LSPA 5FGLA 2EH3A 4UDSA 1RKWA 5D19A 4V2GA 1JTXA 1UI6A 2FQ4A 1VI0A 2XPVA 4D7NA 4M3FA 2D6YA 5IOZA 3NXCA 1JUPA 2OPTA 3F0CA 4YZEA 2IU5A 4HKUA 3VIBA 2I10A 3HTAA 2YVHA 5F27A 2WV1A 3T6NA 2NS7A 2X6OA 3HGGA 5IP6A 1JTYA 1QVTA 3ZQGA 4W97A 3QQAA 3ZQFA 2DTZA 3Q0VA 1JT0A 3BCGA 5FKOA 4CGRA 4GCTA 2RAEA 3DPJA 2ID6A 3O60A 2VKEA 2DG8A 3B6CA 5D1RA 3VVYA 5HAWA 4ACIA 2JK3A 2XB5A 3VOKA 4MXMA 3BR6A 3Q0UA 2GFNA 3AQTA 3RD3A 5K7HA 2V57A 1JUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3D A;  4GFK A;  3LWJ A;  3BR0 A;  2XGC A;  5GPA A;  2HXI A;  2JJ7 A;  4M3E A;  2GEN A;  2G7G A;  3LJL A;  3TP0 A;  3QKX A;  4I76 A;  4B3A A;  5EZG A;  3VVX A;  3ZQI A;  3VW1 A;  3KKD A;  4AF5 A;  5HSZ A;  4AUX A;  3PM1 A;  2G3B A;  3VP5 A;  3BRU A;  5DAJ A;  2TRT A;  5F0C A;  5K7Z A;  2G7S A;  5J1U A;  3GEU A;  4ABZ A;  1T56 A;  3BTJ A;  2XGE A;  3HGY A;  3SDG A;  3E7Q A;  3HIM A;  5EZH A;  4MK6 A;  2XDN A;  3ON2 A;  3V78 A;  3NI7 A;  5J3L A;  3BQY A;  3ZQH A;  3HE0 A;  4XK4 A;  5CW8 A;  5J1Y A;  2G0E A;  3FK6 A;  2OF7 A;  2DG7 A;  4GFL A;  3BTI A;  3RH2 A;  2VPR A;  3NRG A;  2QWT A;  2NP5 A;  2TCT A;  2XRL A;  3ANG A;  2HYT A;  3IH4 A;  5FMP A;  2HQ5 A;  4JNN A;  4MO7 A;  1ORK A;  3PPB A;  2NX4 A;  3LSR A;  2ZCN A;  3B81 A;  2QTQ A;  3BJB A;  3IH3 A;  2X9D A;  2QIB A;  1U9N A;  1ZKG A;  4AC6 A;  5K7F A;  5J1R A;  3BTC A;  2PZ9 A;  3AQS A;  1JUS A;  5D18 A;  2FBQ A;  4KWA A;  2NP3 A;  2QOP A;  3ZQL A;  4M3G A;  4GCL A;  5EYR A;  5F04 A;  3V6G A;  4ICH A;  2ZB9 A;  5GPC A;  1Z0X A;  4B1R A;  5AQC A;  1BJZ A;  2UXH A;  4NN1 A;  4DW6 A;  5CXG A;  5F0F A;  2Q24 A;  3VOX A;  3IH2 A;  2XPU A;  5C4Y A;  2IBD A;  5FKL A;  3CDL A;  3CWR A;  4I6Z A;  3B6A A;  3S5R A;  5EFY A;  5HBU A;  2UXU A;  3JSJ A;  3GZI A;  2FJ1 A;  1UI5 A;  3F1B A;  2QKO A;  5H9T A;  2RHA A;  3BHQ A;  5GP9 A;  3NPI A;  3VVZ A;  1U9O A;  3ON4 A;  2RAS A;  3CCY A;  3KNW A;  3VPR A;  3MNL A;  2IEK A;  3KKC A;  2W53 A;  2HKU A;  2ZOY A;  1A6I A;  4GCK A;  2YVE A;  2WGB A;  2Y30 A;  2VKV A;  3Q3S A;  4ME9 A;  2Y31 A;  3DCF A;  3QPL A;  3HTH A;  3FIW A;  2HYJ A;  3KZ9 A;  2ZCX A;  2F07 A;  3BTL A;  4D7M A;  2PBX A;  2ZCM A;  3P9T A;  3G56 A;  3ANP A;  3BR2 A;  5FKK A;  3TP3 A;  2FX0 A;  3C07 A;  3SFI A;  3EUP A;  3QBM A;  4L62 A;  1QVU A;  1ZK8 A;  3VUQ A;  3DEW A;  4PXI A;  5IPA A;  3BQZ A;  2NS8 A;  2UXI A;  3CJD A;  3MVP A;  5F0H A;  2WUI A;  2QCO A;  5F1J A;  4G12 A;  4X1E A;  4V2F A;  3VW2 A;  3C2B A;  4M3B A;  5F08 A;  2ZOZ A;  2ID3 A;  3QPS A;  4JL3 A;  3COL A;  3HTI A;  3HTJ A;  2GUH A;  3FRQ A;  2FD5 A;  3G1L A;  5FKM A;  3G1M A;  2O7O A;  2O7T A;  2XGD A;  3WHC A;  4JYK A;  3CRJ A;  3BT9 A;  4D5F A;  3FK7 A;  3VW0 A;  2OER A;  5FHP A;  2GBY A;  4D5C A;  1QPI A;  3BR3 A;  2UXP A;  1JT6 A;  5CXI A;  1Z77 A;  5FKN A;  2Y2Z A;  3LOC A;  5K58 A;  1RPW A;  3LHQ A;  3NNR A;  4W1U A;  2REK A;  2UXO A;  2IAI A;  3BNI A;  4NEL A;  3BR1 A;  2OI8 A;  3Q0W A;  1RKT A;  4JKZ A;  2XPW A;  4AC0 A;  3WHB A;  3G1O A;  3O8G A;  1T33 A;  3G7R A;  3LSJ A;  3O8H A;  3PAS A;  2HXO A;  3EGQ A;  5IOY A;  3BR5 A;  2G7L A;  3IUV A;  1SGM A;  3LSP A;  5FGL A;  2EH3 A;  4UDS A;  1RKW A;  5D19 A;  4V2G A;  1JTX A;  1UI6 A;  2FQ4 A;  1VI0 A;  2XPV A;  4D7N A;  4M3F A;  2D6Y A;  5IOZ A;  3NXC A;  1JUP A;  2OPT A;  3F0C A;  4YZE A;  2IU5 A;  4HKU A;  3VIB A;  2I10 A;  3HTA A;  2YVH A;  5F27 A;  2WV1 A;  3T6N A;  2NS7 A;  2X6O A;  3HGG A;  5IP6 A;  1JTY A;  1QVT A;  3ZQG A;  4W97 A;  3QQA A;  3ZQF A;  2DTZ A;  3Q0V A;  1JT0 A;  3BCG A;  5FKO A;  4CGR A;  4GCT A;  2RAE A;  3DPJ A;  2ID6 A;  3O60 A;  2VKE A;  2DG8 A;  3B6C A;  5D1R A;  3VVY A;  5HAW A;  4ACI A;  2JK3 A;  2XB5 A;  3VOK A;  4MXM A;  3BR6 A;  3Q0U A;  2GFN A;  3AQT A;  3RD3 A;  5K7H A;  2V57 A;  1JUM A; 
#chains in the Genus database with same CATH topology
 4M3D A;  4GFK A;  3LWJ A;  3BR0 A;  2XGC A;  5GPA A;  2HXI A;  2JJ7 A;  4M3E A;  2GEN A;  2G7G A;  3LJL A;  3TP0 A;  3QKX A;  4I76 A;  4B3A A;  5EZG A;  3VVX A;  2R7V A;  3ZQI A;  3FHN A;  3VW1 A;  3KKD A;  4AF5 A;  5HSZ A;  4AUX A;  3PM1 A;  2G3B A;  3VP5 A;  3BRU A;  5DAJ A;  2TRT A;  5F0C A;  5K7Z A;  2G7S A;  5J1U A;  3GEU A;  4ABZ A;  1T56 A;  3BTJ A;  2XGE A;  3HGY A;  3SDG A;  3E7Q A;  3HIM A;  5EZH A;  4MK6 A;  2XDN A;  3ON2 A;  3V78 A;  3NI7 A;  5J3L A;  3BQY A;  3ZQH A;  3HE0 A;  4XK4 A;  5CW8 A;  5J1Y A;  2G0E A;  3FK6 A;  2OF7 A;  2DG7 A;  4GFL A;  4U9L A;  3BTI A;  3RH2 A;  4WIB A;  2VPR A;  3NRG A;  2QWT A;  2NP5 A;  2TCT A;  2XRL A;  3ANG A;  2HYT A;  3IH4 A;  5FMP A;  2HQ5 A;  4JNN A;  4MO7 A;  1ORK A;  3PPB A;  4OD5 A;  2NX4 A;  3LSR A;  2ZCN A;  3B81 A;  2QTQ A;  3BJB A;  3IH3 A;  2X9D A;  2R7T A;  2QIB A;  1U9N A;  1ZKG A;  5CQG A;  4AC6 A;  5K7F A;  5J1R A;  3BTC A;  2PZ9 A;  3AQS A;  1JUS A;  5D18 A;  2FBQ A;  4KWA A;  3VTI A;  2NP3 A;  2QOP A;  3ZQL A;  3SWH A;  4M3G A;  4GCL A;  5EYR A;  5F04 A;  3V6G A;  4ICH A;  2ZB9 A;  5GPC A;  1Z0X A;  4B1R A;  5AQC A;  1BJZ A;  2UXH A;  4NN1 A;  4DW6 A;  5CXG A;  5F0F A;  3NS4 A;  2Q24 A;  3VOX A;  3IH2 A;  2XPU A;  5C4Y A;  2IBD A;  5FKL A;  3CDL A;  3CWR A;  4I6Z A;  3B6A A;  3S5R A;  2R7Q A;  5EFY A;  5HBU A;  2UXU A;  3JSJ A;  3GZI A;  2FJ1 A;  1UI5 A;  3F1B A;  2QKO A;  5H9T A;  2RHA A;  3BHQ A;  5GP9 A;  3NPI A;  3VVZ A;  3KYL A;  1U9O A;  3ON4 A;  2RAS A;  3CCY A;  3KNW A;  3VPR A;  3MNL A;  3K8P C;  2IEK A;  3KKC A;  2W53 A;  2HKU A;  2ZOY A;  1A6I A;  3DU5 A;  4GCK A;  2YVE A;  2WGB A;  2Y30 A;  2VKV A;  3Q3S A;  4ME9 A;  2Y31 A;  3DCF A;  3QPL A;  2ZY9 A;  3HTH A;  3FIW A;  2HYJ A;  3KZ9 A;  2ZCX A;  2F07 A;  3BTL A;  4D7M A;  4U9N A;  2PBX A;  2ZCM A;  3P9T A;  3G56 A;  3ANP A;  3BR2 A;  5FKK A;  3TP3 A;  2FX0 A;  3C07 A;  3SFI A;  3EUP A;  3QBM A;  4L62 A;  1QVU A;  1ZK8 A;  3VUQ A;  3DEW A;  4PXI A;  5IPA A;  3BQZ A;  2NS8 A;  2UXI A;  3CJD A;  3MVP A;  5F0H A;  2WUI A;  2QCO A;  5F1J A;  4G12 A;  2R7X A;  4X1E A;  4V2F A;  3DU6 A;  3VW2 A;  3C2B A;  4IRV A;  4M3B A;  5F08 A;  2ZOZ A;  2ID3 A;  3QPS A;  4JL3 A;  3COL A;  3HTI A;  3HTJ A;  2GUH A;  4DVY P;  3FRQ A;  2FD5 A;  3G1L A;  5FKM A;  3G1M A;  2O7O A;  2O7T A;  2XGD A;  3WHC A;  4JYK A;  3CRJ A;  3BT9 A;  4D5F A;  2R7U A;  3FK7 A;  3VW0 A;  2OER A;  5FHP A;  2GBY A;  4D5C A;  1QPI A;  3BR3 A;  2UXP A;  2R7O A;  1JT6 A;  5CXI A;  1Z77 A;  2A2F X;  2Y2Z A;  5FKN A;  3LOC A;  5K58 A;  1RPW A;  3LHQ A;  3NNR A;  4W1U A;  2REK A;  4OD4 A;  2UXO A;  2IAI A;  3BNI A;  4NEL A;  3BR1 A;  2OI8 A;  2B1E A;  3Q0W A;  1RKT A;  4JKZ A;  2R7R A;  2XPW A;  4AC0 A;  3WHB A;  3G1O A;  3O8G A;  1T33 A;  3G7R A;  3LSJ A;  3O8H A;  3PAS A;  2HXO A;  3EGQ A;  5IOY A;  3BR5 A;  2G7L A;  3IUV A;  2PFV A;  1SGM A;  3LSP A;  5FGL A;  2EH3 A;  4UDS A;  1RKW A;  2B3W A;  5D19 A;  4V2G A;  1JTX A;  1UI6 A;  2FQ4 A;  4C2M A;  1VI0 A;  2XPV A;  2YVX A;  4D7N A;  4M3F A;  2D6Y A;  2R7S A;  5IOZ A;  3NXC A;  1JUP A;  2OPT A;  3F0C A;  4YZE A;  2IU5 A;  4HKU A;  3VIB A;  2I10 A;  3HTA A;  2YVH A;  5F27 A;  2WV1 A;  3T6N A;  2NS7 A;  2X6O A;  3HGG A;  5IP6 A;  1JTY A;  1QVT A;  3ZQG A;  4W97 A;  3QQA A;  3ZQF A;  2DTZ A;  3Q0V A;  1JT0 A;  3BCG A;  5FKO A;  4CGR A;  4GCT A;  2RAE A;  3DPJ A;  2ID6 A;  3O60 A;  2R7W A;  2VKE A;  2DG8 A;  3B6C A;  5D1R A;  3VVY A;  5HAW A;  4ACI A;  2JK3 A;  2XB5 A;  3VOK A;  2FJI 1;  4MXM A;  3BR6 A;  3Q0U A;  2GFN A;  3AQT A;  3RD3 A;  5K7H A;  2V57 A;  1JUM A; 
#chains in the Genus database with same CATH homology
 4M3D A;  4GFK A;  3LWJ A;  3BR0 A;  2XGC A;  5GPA A;  2HXI A;  2JJ7 A;  4M3E A;  2GEN A;  2G7G A;  3LJL A;  3TP0 A;  3QKX A;  4I76 A;  4B3A A;  5EZG A;  3VVX A;  3ZQI A;  3VW1 A;  3KKD A;  4AF5 A;  5HSZ A;  4AUX A;  3PM1 A;  2G3B A;  3VP5 A;  3BRU A;  5DAJ A;  2TRT A;  5F0C A;  5K7Z A;  2G7S A;  5J1U A;  3GEU A;  4ABZ A;  1T56 A;  3BTJ A;  2XGE A;  3HGY A;  3SDG A;  3E7Q A;  3HIM A;  5EZH A;  4MK6 A;  2XDN A;  3ON2 A;  3V78 A;  3NI7 A;  5J3L A;  3BQY A;  3ZQH A;  3HE0 A;  4XK4 A;  5CW8 A;  5J1Y A;  2G0E A;  3FK6 A;  2OF7 A;  2DG7 A;  4GFL A;  3BTI A;  3RH2 A;  2VPR A;  3NRG A;  2QWT A;  2NP5 A;  2TCT A;  2XRL A;  3ANG A;  2HYT A;  3IH4 A;  5FMP A;  2HQ5 A;  4JNN A;  4MO7 A;  1ORK A;  3PPB A;  2NX4 A;  3LSR A;  2ZCN A;  3B81 A;  2QTQ A;  3BJB A;  3IH3 A;  2X9D A;  2QIB A;  1U9N A;  1ZKG A;  4AC6 A;  5K7F A;  5J1R A;  3BTC A;  2PZ9 A;  3AQS A;  1JUS A;  5D18 A;  2FBQ A;  4KWA A;  2NP3 A;  2QOP A;  3ZQL A;  4M3G A;  4GCL A;  5EYR A;  5F04 A;  3V6G A;  4ICH A;  2ZB9 A;  5GPC A;  1Z0X A;  4B1R A;  5AQC A;  1BJZ A;  2UXH A;  4NN1 A;  4DW6 A;  5CXG A;  5F0F A;  2Q24 A;  3VOX A;  3IH2 A;  2XPU A;  5C4Y A;  2IBD A;  5FKL A;  3CDL A;  3CWR A;  4I6Z A;  3B6A A;  3S5R A;  5EFY A;  5HBU A;  2UXU A;  3JSJ A;  3GZI A;  2FJ1 A;  1UI5 A;  3F1B A;  2QKO A;  5H9T A;  2RHA A;  3BHQ A;  5GP9 A;  3NPI A;  3VVZ A;  1U9O A;  3ON4 A;  2RAS A;  3CCY A;  3KNW A;  3VPR A;  3MNL A;  2IEK A;  3KKC A;  2W53 A;  2HKU A;  2ZOY A;  1A6I A;  4GCK A;  2YVE A;  2WGB A;  2Y30 A;  2VKV A;  3Q3S A;  4ME9 A;  2Y31 A;  3DCF A;  3QPL A;  3HTH A;  3FIW A;  2HYJ A;  3KZ9 A;  2ZCX A;  2F07 A;  3BTL A;  4D7M A;  2PBX A;  2ZCM A;  3P9T A;  3G56 A;  3ANP A;  3BR2 A;  5FKK A;  3TP3 A;  2FX0 A;  3C07 A;  3SFI A;  3EUP A;  3QBM A;  4L62 A;  1QVU A;  1ZK8 A;  3VUQ A;  3DEW A;  4PXI A;  5IPA A;  3BQZ A;  2NS8 A;  2UXI A;  3CJD A;  3MVP A;  5F0H A;  2WUI A;  2QCO A;  5F1J A;  4G12 A;  4X1E A;  4V2F A;  3VW2 A;  3C2B A;  4M3B A;  5F08 A;  2ZOZ A;  2ID3 A;  3QPS A;  4JL3 A;  3COL A;  3HTI A;  3HTJ A;  2GUH A;  3FRQ A;  2FD5 A;  3G1L A;  5FKM A;  3G1M A;  2O7O A;  2O7T A;  2XGD A;  3WHC A;  4JYK A;  3CRJ A;  3BT9 A;  4D5F A;  3FK7 A;  3VW0 A;  2OER A;  5FHP A;  2GBY A;  4D5C A;  1QPI A;  3BR3 A;  2UXP A;  1JT6 A;  5CXI A;  1Z77 A;  5FKN A;  2Y2Z A;  3LOC A;  5K58 A;  1RPW A;  3LHQ A;  3NNR A;  4W1U A;  2REK A;  2UXO A;  2IAI A;  3BNI A;  4NEL A;  3BR1 A;  2OI8 A;  3Q0W A;  1RKT A;  4JKZ A;  2XPW A;  4AC0 A;  3WHB A;  3G1O A;  3O8G A;  1T33 A;  3G7R A;  3LSJ A;  3O8H A;  3PAS A;  2HXO A;  3EGQ A;  5IOY A;  3BR5 A;  2G7L A;  3IUV A;  1SGM A;  3LSP A;  5FGL A;  2EH3 A;  4UDS A;  1RKW A;  5D19 A;  4V2G A;  1JTX A;  1UI6 A;  2FQ4 A;  1VI0 A;  2XPV A;  4D7N A;  4M3F A;  2D6Y A;  5IOZ A;  3NXC A;  1JUP A;  2OPT A;  3F0C A;  4YZE A;  2IU5 A;  4HKU A;  3VIB A;  2I10 A;  3HTA A;  2YVH A;  5F27 A;  2WV1 A;  3T6N A;  2NS7 A;  2X6O A;  3HGG A;  5IP6 A;  1JTY A;  1QVT A;  3ZQG A;  4W97 A;  3QQA A;  3ZQF A;  2DTZ A;  3Q0V A;  1JT0 A;  3BCG A;  5FKO A;  4CGR A;  4GCT A;  2RAE A;  3DPJ A;  2ID6 A;  3O60 A;  2VKE A;  2DG8 A;  3B6C A;  5D1R A;  3VVY A;  5HAW A;  4ACI A;  2JK3 A;  2XB5 A;  3VOK A;  4MXM A;  3BR6 A;  3Q0U A;  2GFN A;  3AQT A;  3RD3 A;  5K7H A;  2V57 A;  1JUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...