4MXNA

Crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIFYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKGIIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCITPDGKAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
molecule keywords Uncharacterized protein
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4mxnA00
4MR0A 3ZSCA 1KTWA 2O04A 4XLFA 4YEJA 2QY1A 1XG2A 1DBOA 2BSPA 4XL9A 4Z03A 1O8MA 4YZAA 2NSPA 2QXZA 4OJLA 1CZFA 5AMVA 4XLEA 2ODLA 1KCDA 1O8IA 4YZXA 4NK6A 5C1EA 3GQ8A 3VSTA 4W8SA 3VMWA 2VBEA 1EE6A 2PECA 2X6XA 3UW0A 1AIRA 2QX3A 1K5CA 1O8KA 4XLHA 3ZPPA 1QCXA 2Z8GA 4W8TA 1GQ8A 1RWRA 4XKWA 4OJ6A 2O17A 4XMYA 4XONA 1O88A 1O8FA 2PYGA 4EW9A 4XOTA 1BHEA 2NT6A 3WWGA 4OJ5A 2O0WA 4OZZA 3B8YA 3GQ9A 2NTQA 4HWVA 4Z06A 4XLAA 1HG8A 1OFLA 2X6WA 3VMVA 4XORA 1PE9A 1VBLA 2VBMA 1BN8A 3FY3A 3EQOA 3B90A 4OJPA 2NSTA 1PXZA 3KRGA 4AVZA 4YZ0A 2UVEA 1OFMA 1X0CA 2IQ7A 3GRHA 4XQFA 1RU4A 1IB4A 1DBGA 2NZMA 4XKVA 1JRGA 1O8LA 4XN3A 2NTBA 4XNFA 4C2LA 1WMRA 4YELA 1IDJA 2X85A 1IDKA 1OOCA 1QJVA 2X6YA 3GQAA 1O8EA 3VSVA 1O8DA 1RMGA 3SUCA 5C1CA 2NT9A 4XN0A 1IA5A 3EQNA 1OGMX 4U49A 2UVFA 4NK8A 1O8HA 1O8GA 3T9GA 3B4NA 4W8RA 2VJJA 4OZYA 4XR6A 2VJIA 3GQ7A 4PMHA 1PLUA 1NHCA 1O8JA 4YZQA 3JURA 2O1DA 4XM3A 2O0VA 4OJOA 1JTAA 2INVA 2INUA 2VBKA 4W8QA 2X3HA 4URRA 4XOPA 3VSUA 1H80A 4I84A 1OGOX 4MXNA 4XLCA 4Z05A 4U4BA 1KCCA 2EWEA 3LMWA 2PYHA 2NTPA
chains in the Genus database with same CATH superfamily
4MR0A 3ZSCA 1KTWA 2O04A 3ML3A 3SQVA 4XLFA 4YEJA 2QY1A 1LLZA 1XG2A 3N90A 3NAWA 1DBOA 2VFNA 2BSPA 4XL9A 4Z03A 2VFQA 1O8MA 4V02C 2QYUA 2NSPA 2QXZA 4OJLA 4YZAA 5JMCB 1CZFA 5AMVA 4XLEA 2ODLA 1KCDA 1O8IA 2IOUG 2XTXA 1TYUA 2VFPA 4YZXA 4NK6A 5C1EA 1K4ZA 2XTYA 3GQ8A 3VSTA 2B0RA 1LM1A 1TSPA 4W8SA 3VMWA 3PSZA 2VBEA 1OFDA 2J8IA 1EE6A 2PECA 2X6XA 3UW0A 1AIRA 2QX3A 3BH7B 4YDTA 1K5CA 1O8KA 2XTWA 4XLHA 1HF2A 3ZPPA 1QCXA 2Z8GA 4W8TA 1GQ8A 1RWRA 4XKWA 4OJ6A 1QRBA 1EZGA 2O17A 1TYXA 4YEIA 1EA0A 4XMYA 3PSSA 4XONA 1O88A 1O8FA 2PYGA 4EW9A 4XOTA 1BHEA 2NT6A 3WWGA 4OJ5A 2O0WA 4OZZA 3SYJA 2BM5A 3B8YA 2VFOA 2NTQA 3GQ9A 2XC1A 3SZEA 4HWVA 1QA3A 4Z06A 4XLAA 1HG8A 1QA1A 1OFLA 2X6WA 4KH3A 3VMVA 1LLWA 2BM7A 4XORA 2VFMA 2W7ZA 1PE9A 1VBLA 1TYWA 3LJYA 2VBMA 1BN8A 2XT2A 3FY3A 3EQOA 3B90A 4OJPA 2XT4A 2NSTA 1PXZA 1K8FA 4YFOA 1DABA 2O6WA 3KRGA 4AVZA 4YZ0A 2UVEA 1OFMA 1X0CA 2IQ7A 3GRHA 4XQFA 1RU4A 1IB4A 1DBGA 2NZMA 2V5IA 1JRGA 4XKVA 3TH0A 1O8LA 4XN3A 2NTBA 4XNFA 1TYVA 4C2LA 1WMRA 4YELA 1QA2A 3N6ZA 3AK5A 3LYCA 4YCQA 1IDJA 1OOCA 1IDKA 1QJVA 2X6YA 1OFEA 2X85A 3GQAA 1O8EA 3DU1X 3VSVA 1O8DA 3H09A 1QQ1A 1RMGA 3SUCA 5C1CA 2NT9A 4XN0A 1IA5A 3EQNA 1OGMX 4U49A 2UVFA 4NK8A 1O8HA 1O8GA 3SY2A 3B4NA 1QRCA 3T9GA 4W8RA 4OM9A 2VJJA 4OZYA 4XR6A 1KQ5A 2VJIA 3GQ7A 5JLVC 2F3LA 2BM4A 3NB2A 4OPWA 4PMHA 2YUHA 1PLUA 1NHCA 1WXRA 1O8JA 2BM6A 2BX6A 4YZQA 2QZAA 3JX8A 4YC5A 3JURA 2O1DA 4XM3A 2O0VA 3P4GA 4OJOA 4JRAC 1JTAA 2INVA 2INUA 1CLWA 2G0YA 2VBKA 4W8QA 2X3HA 4URRA 4XOPA 2J8KA 3VSUA 1H80A 3BH6B 4I84A 1OGOX 4MXNA 4XLCA 5DNSA 4U4BA 4Z05A 2EWEA 3LMWA 1KCCA 3RIQA 1L1IA 2PYHA 2NTPA 3PETA
chains in the Genus database with same CATH topology
4MR0A 3ZSCA 1KTWA 2O04A 4XLFA 4YEJA 2QY1A 1XG2A 1DBOA 2BSPA 4XL9A 4Z03A 1O8MA 4YZAA 2NSPA 2QXZA 4OJLA 1CZFA 5AMVA 4XLEA 2ODLA 1KCDA 1O8IA 4YZXA 4NK6A 5C1EA 3GQ8A 3VSTA 4W8SA 3VMWA 2VBEA 1EE6A 2PECA 2X6XA 3UW0A 1AIRA 2QX3A 1K5CA 1O8KA 4XLHA 3ZPPA 1QCXA 2Z8GA 4W8TA 1GQ8A 1RWRA 4XKWA 4OJ6A 2O17A 4XMYA 4XONA 1O88A 1O8FA 2PYGA 4EW9A 4XOTA 1BHEA 2NT6A 3WWGA 4OJ5A 2O0WA 4OZZA 3B8YA 3GQ9A 2NTQA 4HWVA 4Z06A 4XLAA 1HG8A 1OFLA 2X6WA 3VMVA 4XORA 1PE9A 1VBLA 2VBMA 1BN8A 3FY3A 3EQOA 3B90A 4OJPA 2NSTA 1PXZA 3KRGA 4AVZA 4YZ0A 2UVEA 1OFMA 1X0CA 2IQ7A 3GRHA 4XQFA 1RU4A 1IB4A 1DBGA 2NZMA 4XKVA 1JRGA 1O8LA 4XN3A 2NTBA 4XNFA 4C2LA 1WMRA 4YELA 1IDJA 2X85A 1IDKA 1OOCA 1QJVA 2X6YA 3GQAA 1O8EA 3VSVA 1O8DA 1RMGA 3SUCA 5C1CA 2NT9A 4XN0A 1IA5A 3EQNA 1OGMX 4U49A 2UVFA 4NK8A 1O8HA 1O8GA 3T9GA 3B4NA 4W8RA 2VJJA 4OZYA 4XR6A 2VJIA 3GQ7A 4PMHA 1PLUA 1NHCA 1O8JA 4YZQA 3JURA 2O1DA 4XM3A 2O0VA 4OJOA 1JTAA 2INVA 2INUA 2VBKA 4W8QA 2X3HA 4URRA 4XOPA 3VSUA 1H80A 4I84A 1OGOX 4MXNA 4XLCA 4Z05A 4U4BA 1KCCA 2EWEA 3LMWA 2PYHA 2NTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR0 A;  3ZSC A;  1KTW A;  2O04 A;  4XLF A;  4YEJ A;  2QY1 A;  1XG2 A;  1DBO A;  2BSP A;  4XL9 A;  4Z03 A;  1O8M A;  4YZA A;  2NSP A;  2QXZ A;  4OJL A;  1CZF A;  5AMV A;  4XLE A;  2ODL A;  1KCD A;  1O8I A;  4YZX A;  4NK6 A;  5C1E A;  3GQ8 A;  3VST A;  4W8S A;  3VMW A;  2VBE A;  1EE6 A;  2PEC A;  2X6X A;  3UW0 A;  1AIR A;  2QX3 A;  1K5C A;  1O8K A;  4XLH A;  3ZPP A;  1QCX A;  2Z8G A;  4W8T A;  1GQ8 A;  1RWR A;  4XKW A;  4OJ6 A;  2O17 A;  4XMY A;  4XON A;  1O88 A;  1O8F A;  2PYG A;  4EW9 A;  4XOT A;  1BHE A;  2NT6 A;  3WWG A;  4OJ5 A;  2O0W A;  4OZZ A;  3B8Y A;  3GQ9 A;  2NTQ A;  4HWV A;  4Z06 A;  4XLA A;  1HG8 A;  1OFL A;  2X6W A;  3VMV A;  4XOR A;  1PE9 A;  1VBL A;  2VBM A;  1BN8 A;  3FY3 A;  3EQO A;  3B90 A;  4OJP A;  2NST A;  1PXZ A;  3KRG A;  4AVZ A;  4YZ0 A;  2UVE A;  1OFM A;  1X0C A;  2IQ7 A;  3GRH A;  4XQF A;  1RU4 A;  1IB4 A;  1DBG A;  2NZM A;  4XKV A;  1JRG A;  1O8L A;  4XN3 A;  2NTB A;  4XNF A;  4C2L A;  1WMR A;  4YEL A;  1IDJ A;  2X85 A;  1IDK A;  1OOC A;  1QJV A;  2X6Y A;  3GQA A;  1O8E A;  3VSV A;  1O8D A;  1RMG A;  3SUC A;  5C1C A;  2NT9 A;  4XN0 A;  1IA5 A;  3EQN A;  1OGM X;  4U49 A;  2UVF A;  4NK8 A;  1O8H A;  1O8G A;  3T9G A;  3B4N A;  4W8R A;  2VJJ A;  4OZY A;  4XR6 A;  2VJI A;  3GQ7 A;  4PMH A;  1PLU A;  1NHC A;  1O8J A;  4YZQ A;  3JUR A;  2O1D A;  4XM3 A;  2O0V A;  4OJO A;  1JTA A;  2INV A;  2INU A;  2VBK A;  4W8Q A;  2X3H A;  4URR A;  4XOP A;  3VSU A;  1H80 A;  4I84 A;  1OGO X;  4MXN A;  4XLC A;  4Z05 A;  4U4B A;  1KCC A;  2EWE A;  3LMW A;  2PYH A;  2NTP A; 
#chains in the Genus database with same CATH topology
 4MR0 A;  3ZSC A;  1KTW A;  2O04 A;  3ML3 A;  3SQV A;  4XLF A;  4YEJ A;  2QY1 A;  1LLZ A;  1XG2 A;  3N90 A;  3NAW A;  1DBO A;  2VFN A;  2BSP A;  4XL9 A;  4Z03 A;  2VFQ A;  1O8M A;  4V02 C;  2QYU A;  2NSP A;  2QXZ A;  4OJL A;  4YZA A;  5JMC B;  1CZF A;  5AMV A;  4XLE A;  2ODL A;  1KCD A;  1O8I A;  2IOU G;  2XTX A;  1TYU A;  2VFP A;  4YZX A;  4NK6 A;  5C1E A;  1K4Z A;  2XTY A;  3GQ8 A;  3VST A;  2B0R A;  1LM1 A;  1TSP A;  4W8S A;  3VMW A;  3PSZ A;  2VBE A;  1OFD A;  2J8I A;  1EE6 A;  2PEC A;  2X6X A;  3UW0 A;  1AIR A;  2QX3 A;  3BH7 B;  4YDT A;  1K5C A;  1O8K A;  2XTW A;  4XLH A;  1HF2 A;  3ZPP A;  1QCX A;  2Z8G A;  4W8T A;  1GQ8 A;  1RWR A;  4XKW A;  4OJ6 A;  1QRB A;  1EZG A;  2O17 A;  1TYX A;  4YEI A;  1EA0 A;  4XMY A;  3PSS A;  4XON A;  1O88 A;  1O8F A;  2PYG A;  4EW9 A;  4XOT A;  1BHE A;  2NT6 A;  3WWG A;  4OJ5 A;  2O0W A;  4OZZ A;  3SYJ A;  2BM5 A;  3B8Y A;  2VFO A;  2NTQ A;  3GQ9 A;  2XC1 A;  3SZE A;  4HWV A;  1QA3 A;  4Z06 A;  4XLA A;  1HG8 A;  1QA1 A;  1OFL A;  2X6W A;  4KH3 A;  3VMV A;  1LLW A;  2BM7 A;  4XOR A;  2VFM A;  2W7Z A;  1PE9 A;  1VBL A;  1TYW A;  3LJY A;  2VBM A;  1BN8 A;  2XT2 A;  3FY3 A;  3EQO A;  3B90 A;  4OJP A;  2XT4 A;  2NST A;  1PXZ A;  1K8F A;  4YFO A;  1DAB A;  2O6W A;  3KRG A;  4AVZ A;  4YZ0 A;  2UVE A;  1OFM A;  1X0C A;  2IQ7 A;  3GRH A;  4XQF A;  1RU4 A;  1IB4 A;  1DBG A;  2NZM A;  2V5I A;  1JRG A;  4XKV A;  3TH0 A;  1O8L A;  4XN3 A;  2NTB A;  4XNF A;  1TYV A;  4C2L A;  1WMR A;  4YEL A;  1QA2 A;  3N6Z A;  3AK5 A;  3LYC A;  4YCQ A;  1IDJ A;  1OOC A;  1IDK A;  1QJV A;  2X6Y A;  1OFE A;  2X85 A;  3GQA A;  1O8E A;  3DU1 X;  3VSV A;  1O8D A;  3H09 A;  1QQ1 A;  1RMG A;  3SUC A;  5C1C A;  2NT9 A;  4XN0 A;  1IA5 A;  3EQN A;  1OGM X;  4U49 A;  2UVF A;  4NK8 A;  1O8H A;  1O8G A;  3SY2 A;  3B4N A;  1QRC A;  3T9G A;  4W8R A;  4OM9 A;  2VJJ A;  4OZY A;  4XR6 A;  1KQ5 A;  2VJI A;  3GQ7 A;  5JLV C;  2F3L A;  2BM4 A;  3NB2 A;  4OPW A;  4PMH A;  2YUH A;  1PLU A;  1NHC A;  1WXR A;  1O8J A;  2BM6 A;  2BX6 A;  4YZQ A;  2QZA A;  3JX8 A;  4YC5 A;  3JUR A;  2O1D A;  4XM3 A;  2O0V A;  3P4G A;  4OJO A;  4JRA C;  1JTA A;  2INV A;  2INU A;  1CLW A;  2G0Y A;  2VBK A;  4W8Q A;  2X3H A;  4URR A;  4XOP A;  2J8K A;  3VSU A;  1H80 A;  3BH6 B;  4I84 A;  1OGO X;  4MXN A;  4XLC A;  5DNS A;  4U4B A;  4Z05 A;  2EWE A;  3LMW A;  1KCC A;  3RIQ A;  1L1I A;  2PYH A;  2NTP A;  3PET A; 
#chains in the Genus database with same CATH homology
 4MR0 A;  3ZSC A;  1KTW A;  2O04 A;  4XLF A;  4YEJ A;  2QY1 A;  1XG2 A;  1DBO A;  2BSP A;  4XL9 A;  4Z03 A;  1O8M A;  4YZA A;  2NSP A;  2QXZ A;  4OJL A;  1CZF A;  5AMV A;  4XLE A;  2ODL A;  1KCD A;  1O8I A;  4YZX A;  4NK6 A;  5C1E A;  3GQ8 A;  3VST A;  4W8S A;  3VMW A;  2VBE A;  1EE6 A;  2PEC A;  2X6X A;  3UW0 A;  1AIR A;  2QX3 A;  1K5C A;  1O8K A;  4XLH A;  3ZPP A;  1QCX A;  2Z8G A;  4W8T A;  1GQ8 A;  1RWR A;  4XKW A;  4OJ6 A;  2O17 A;  4XMY A;  4XON A;  1O88 A;  1O8F A;  2PYG A;  4EW9 A;  4XOT A;  1BHE A;  2NT6 A;  3WWG A;  4OJ5 A;  2O0W A;  4OZZ A;  3B8Y A;  3GQ9 A;  2NTQ A;  4HWV A;  4Z06 A;  4XLA A;  1HG8 A;  1OFL A;  2X6W A;  3VMV A;  4XOR A;  1PE9 A;  1VBL A;  2VBM A;  1BN8 A;  3FY3 A;  3EQO A;  3B90 A;  4OJP A;  2NST A;  1PXZ A;  3KRG A;  4AVZ A;  4YZ0 A;  2UVE A;  1OFM A;  1X0C A;  2IQ7 A;  3GRH A;  4XQF A;  1RU4 A;  1IB4 A;  1DBG A;  2NZM A;  4XKV A;  1JRG A;  1O8L A;  4XN3 A;  2NTB A;  4XNF A;  4C2L A;  1WMR A;  4YEL A;  1IDJ A;  2X85 A;  1IDK A;  1OOC A;  1QJV A;  2X6Y A;  3GQA A;  1O8E A;  3VSV A;  1O8D A;  1RMG A;  3SUC A;  5C1C A;  2NT9 A;  4XN0 A;  1IA5 A;  3EQN A;  1OGM X;  4U49 A;  2UVF A;  4NK8 A;  1O8H A;  1O8G A;  3T9G A;  3B4N A;  4W8R A;  2VJJ A;  4OZY A;  4XR6 A;  2VJI A;  3GQ7 A;  4PMH A;  1PLU A;  1NHC A;  1O8J A;  4YZQ A;  3JUR A;  2O1D A;  4XM3 A;  2O0V A;  4OJO A;  1JTA A;  2INV A;  2INU A;  2VBK A;  4W8Q A;  2X3H A;  4URR A;  4XOP A;  3VSU A;  1H80 A;  4I84 A;  1OGO X;  4MXN A;  4XLC A;  4Z05 A;  4U4B A;  1KCC A;  2EWE A;  3LMW A;  2PYH A;  2NTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...