4MXNA

Crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIFYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKGIIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCITPDGKAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4mxnA00
1BN8A 4Z06A 3GRHA 1JRGA 4Z05A 2QX3A 4U49A 3B90A 4XLHA 4W8TA 4YZ0A 5C1CA 2ODLA 4XOTA 2VBMA 2X6WA 5AMVA 1EE6A 2NT6A 2VJJA 4YZXA 1O8KA 4YZQA 1WMRA 2BSPA 1K5CA 1O8EA 1KTWA 4MR0A 2UVFA 2VJIA 3WWGA 3GQ9A 3VSTA 4XLCA 2X6XA 4XL9A 1O8HA 1NHCA 2PYHA 4XNFA 1O8GA 4XONA 4XQFA 3JURA 1PLUA 1PE9A 1O8DA 1O8IA 1O88A 4XKVA 4XMYA 1HG8A 3VMVA 4EW9A 4HWVA 4W8RA 4OZZA 2VBKA 4XR6A 4OJ6A 4PMHA 3T9GA 4OJPA 1QJVA 3GQ7A 1CZFA 1O8FA 4Z03A 2NTBA 1RMGA 4I84A 2O04A 3B4NA 1OFMA 2O0VA 4AVZA 4YZAA 2INUA 2VBEA 3UW0A 3GQAA 4OZYA 3GQ8A 1IDKA 1QCXA 2NSTA 3VSUA 4XM3A 2O0WA 3ZSCA 2NT9A 4OJLA 4XOPA 1JTAA 2NSPA 2NTQA 1H80A 4XLFA 3VMWA 3SUCA 4C2LA 2X6YA 1KCDA 1RU4A 2PECA 2EWEA 4XORA 2PYGA 1RWRA 2X85A 1XG2A 1X0CA 3LMWA 4OJ5A 2O1DA 2X3HA 4MXNA 1BHEA 4W8SA 4XLAA 1AIRA 3VSVA 4U4BA 4NK8A 1PXZA 3FY3A 2IQ7A 4W8QA 3KRGA 4XLEA 4XN3A 3ZPPA 3EQNA 1OGMX 1OFLA 1IA5A 1IDJA 1OOCA 1VBLA 2UVEA 4URRA 5C1EA 4YELA 3EQOA 4XKWA 2NZMA 1DBGA 1DBOA 4XN0A 1O8JA 1GQ8A 1O8MA 2O17A 1IB4A 2Z8GA 1OGOX 1O8LA 4NK6A 4OJOA 2QXZA 3B8YA 4YEJA 2NTPA 2QY1A 2INVA 1KCCA
chains in the Genus database with same CATH superfamily
1BN8A 4Z06A 3GRHA 1JRGA 4Z05A 2QX3A 4U49A 3B90A 4XLHA 4W8TA 4YZ0A 5C1CA 1K4ZA 2ODLA 4XOTA 2VBMA 3LJYA 2X6WA 5AMVA 2BM7A 5JLVC 1EE6A 2NT6A 2VJJA 4YZXA 3H09A 1O8KA 2IOUG 2VFNA 3BH7B 1OFDA 4YZQA 1WMRA 2BSPA 1K5CA 1O8EA 1KTWA 4MR0A 3ML3A 2UVFA 2VJIA 3WWGA 3BH6B 3GQ9A 2G0YA 3NAWA 3VSTA 4XLCA 2X6XA 4XL9A 1O8HA 4KH3A 1NHCA 2PYHA 1LLWA 4XNFA 4YDTA 1O8GA 2XTXA 2YUHA 2BX6A 4XONA 5DNSA 3JURA 4XQFA 1PLUA 1PE9A 1O8DA 1O8IA 1O88A 2J8KA 2VFOA 1EZGA 4XKVA 1HG8A 4XMYA 3PETA 3VMVA 4EW9A 4HWVA 4W8RA 4OZZA 1OFEA 2VBKA 4XR6A 4OJ6A 1CLWA 4PMHA 3P4GA 3T9GA 4OJPA 1QJVA 3GQ7A 1CZFA 1O8FA 4YCQA 4Z03A 2NTBA 1RMGA 1QA2A 4I84A 2B0RA 2O04A 3B4NA 1OFMA 2O0VA 4AVZA 4YZAA 2INUA 3SYJA 2VBEA 3N90A 3UW0A 1KQ5A 3GQAA 4OZYA 3GQ8A 1DABA 3PSZA 1IDKA 1QCXA 1K8FA 2NSTA 3VSUA 4XM3A 2O0WA 4YFOA 1L1IA 2XC1A 3ZSCA 2NT9A 4OJLA 1TSPA 4XOPA 1JTAA 2NSPA 2NTQA 1H80A 4OPWA 4XLFA 3VMWA 3SUCA 2O6WA 4C2LA 4YEIA 1QQ1A 2X6YA 1KCDA 1RU4A 2W7ZA 2PECA 2EWEA 1TYVA 4XORA 2VFMA 3DU1X 2PYGA 1RWRA 2X85A 2F3LA 2BM4A 1LLZA 1XG2A 1QRBA 1X0CA 2BM5A 3LMWA 1WXRA 4OJ5A 2O1DA 2X3HA 4MXNA 3SQVA 1BHEA 4W8SA 4XLAA 1AIRA 4YC5A 3VSVA 1HF2A 2VFPA 2QYUA 4U4BA 3PSSA 1QA1A 2J8IA 4NK8A 1PXZA 3FY3A 3TH0A 2IQ7A 2XTYA 4W8QA 2XT2A 3KRGA 4XLEA 4XN3A 3ZPPA 2XT4A 1OGMX 3EQNA 1OFLA 5JMCB 4JRAC 4OM9A 1IDJA 1OOCA 1VBLA 1IA5A 2UVEA 2V5IA 4URRA 1EA0A 3SZEA 5C1EA 3LYCA 4YELA 3EQOA 4XKWA 1QA3A 1QRCA 3N6ZA 2NZMA 2BM6A 1DBGA 1DBOA 1TYUA 4XN0A 3JX8A 3AK5A 3RIQA 1O8JA 3SY2A 1GQ8A 3NB2A 1O8MA 2O17A 2QZAA 1IB4A 2Z8GA 2XTWA 1LM1A 1OGOX 1O8LA 4NK6A 4OJOA 2QXZA 3B8YA 4YEJA 2NTPA 2QY1A 1TYXA 2VFQA 2INVA 1KCCA 4V02C 1TYWA
chains in the Genus database with same CATH topology
1BN8A 4Z06A 3GRHA 1JRGA 4Z05A 2QX3A 4U49A 3B90A 4XLHA 4W8TA 4YZ0A 5C1CA 2ODLA 4XOTA 2VBMA 2X6WA 5AMVA 1EE6A 2NT6A 2VJJA 4YZXA 1O8KA 4YZQA 1WMRA 2BSPA 1K5CA 1O8EA 1KTWA 4MR0A 2UVFA 2VJIA 3WWGA 3GQ9A 3VSTA 4XLCA 2X6XA 4XL9A 1O8HA 1NHCA 2PYHA 4XNFA 1O8GA 4XONA 4XQFA 3JURA 1PLUA 1PE9A 1O8DA 1O8IA 1O88A 4XKVA 4XMYA 1HG8A 3VMVA 4EW9A 4HWVA 4W8RA 4OZZA 2VBKA 4XR6A 4OJ6A 4PMHA 3T9GA 4OJPA 1QJVA 3GQ7A 1CZFA 1O8FA 4Z03A 2NTBA 1RMGA 4I84A 2O04A 3B4NA 1OFMA 2O0VA 4AVZA 4YZAA 2INUA 2VBEA 3UW0A 3GQAA 4OZYA 3GQ8A 1IDKA 1QCXA 2NSTA 3VSUA 4XM3A 2O0WA 3ZSCA 2NT9A 4OJLA 4XOPA 1JTAA 2NSPA 2NTQA 1H80A 4XLFA 3VMWA 3SUCA 4C2LA 2X6YA 1KCDA 1RU4A 2PECA 2EWEA 4XORA 2PYGA 1RWRA 2X85A 1XG2A 1X0CA 3LMWA 4OJ5A 2O1DA 2X3HA 4MXNA 1BHEA 4W8SA 4XLAA 1AIRA 3VSVA 4U4BA 4NK8A 1PXZA 3FY3A 2IQ7A 4W8QA 3KRGA 4XLEA 4XN3A 3ZPPA 3EQNA 1OGMX 1OFLA 1IA5A 1IDJA 1OOCA 1VBLA 2UVEA 4URRA 5C1EA 4YELA 3EQOA 4XKWA 2NZMA 1DBGA 1DBOA 4XN0A 1O8JA 1GQ8A 1O8MA 2O17A 1IB4A 2Z8GA 1OGOX 1O8LA 4NK6A 4OJOA 2QXZA 3B8YA 4YEJA 2NTPA 2QY1A 2INVA 1KCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  4Z06 A;  3GRH A;  1JRG A;  4Z05 A;  2QX3 A;  4U49 A;  3B90 A;  4XLH A;  4W8T A;  4YZ0 A;  5C1C A;  2ODL A;  4XOT A;  2VBM A;  2X6W A;  5AMV A;  1EE6 A;  2NT6 A;  2VJJ A;  4YZX A;  1O8K A;  4YZQ A;  1WMR A;  2BSP A;  1K5C A;  1O8E A;  1KTW A;  4MR0 A;  2UVF A;  2VJI A;  3WWG A;  3GQ9 A;  3VST A;  4XLC A;  2X6X A;  4XL9 A;  1O8H A;  1NHC A;  2PYH A;  4XNF A;  1O8G A;  4XON A;  4XQF A;  3JUR A;  1PLU A;  1PE9 A;  1O8D A;  1O8I A;  1O88 A;  4XKV A;  4XMY A;  1HG8 A;  3VMV A;  4EW9 A;  4HWV A;  4W8R A;  4OZZ A;  2VBK A;  4XR6 A;  4OJ6 A;  4PMH A;  3T9G A;  4OJP A;  1QJV A;  3GQ7 A;  1CZF A;  1O8F A;  4Z03 A;  2NTB A;  1RMG A;  4I84 A;  2O04 A;  3B4N A;  1OFM A;  2O0V A;  4AVZ A;  4YZA A;  2INU A;  2VBE A;  3UW0 A;  3GQA A;  4OZY A;  3GQ8 A;  1IDK A;  1QCX A;  2NST A;  3VSU A;  4XM3 A;  2O0W A;  3ZSC A;  2NT9 A;  4OJL A;  4XOP A;  1JTA A;  2NSP A;  2NTQ A;  1H80 A;  4XLF A;  3VMW A;  3SUC A;  4C2L A;  2X6Y A;  1KCD A;  1RU4 A;  2PEC A;  2EWE A;  4XOR A;  2PYG A;  1RWR A;  2X85 A;  1XG2 A;  1X0C A;  3LMW A;  4OJ5 A;  2O1D A;  2X3H A;  4MXN A;  1BHE A;  4W8S A;  4XLA A;  1AIR A;  3VSV A;  4U4B A;  4NK8 A;  1PXZ A;  3FY3 A;  2IQ7 A;  4W8Q A;  3KRG A;  4XLE A;  4XN3 A;  3ZPP A;  3EQN A;  1OGM X;  1OFL A;  1IA5 A;  1IDJ A;  1OOC A;  1VBL A;  2UVE A;  4URR A;  5C1E A;  4YEL A;  3EQO A;  4XKW A;  2NZM A;  1DBG A;  1DBO A;  4XN0 A;  1O8J A;  1GQ8 A;  1O8M A;  2O17 A;  1IB4 A;  2Z8G A;  1OGO X;  1O8L A;  4NK6 A;  4OJO A;  2QXZ A;  3B8Y A;  4YEJ A;  2NTP A;  2QY1 A;  2INV A;  1KCC A; 
#chains in the Genus database with same CATH topology
 1BN8 A;  4Z06 A;  3GRH A;  1JRG A;  4Z05 A;  2QX3 A;  4U49 A;  3B90 A;  4XLH A;  4W8T A;  4YZ0 A;  5C1C A;  1K4Z A;  2ODL A;  4XOT A;  2VBM A;  3LJY A;  2X6W A;  5AMV A;  2BM7 A;  5JLV C;  1EE6 A;  2NT6 A;  2VJJ A;  4YZX A;  3H09 A;  1O8K A;  2IOU G;  2VFN A;  3BH7 B;  1OFD A;  4YZQ A;  1WMR A;  2BSP A;  1K5C A;  1O8E A;  1KTW A;  4MR0 A;  3ML3 A;  2UVF A;  2VJI A;  3WWG A;  3BH6 B;  3GQ9 A;  2G0Y A;  3NAW A;  3VST A;  4XLC A;  2X6X A;  4XL9 A;  1O8H A;  4KH3 A;  1NHC A;  2PYH A;  1LLW A;  4XNF A;  4YDT A;  1O8G A;  2XTX A;  2YUH A;  2BX6 A;  4XON A;  5DNS A;  3JUR A;  4XQF A;  1PLU A;  1PE9 A;  1O8D A;  1O8I A;  1O88 A;  2J8K A;  2VFO A;  1EZG A;  4XKV A;  1HG8 A;  4XMY A;  3PET A;  3VMV A;  4EW9 A;  4HWV A;  4W8R A;  4OZZ A;  1OFE A;  2VBK A;  4XR6 A;  4OJ6 A;  1CLW A;  4PMH A;  3P4G A;  3T9G A;  4OJP A;  1QJV A;  3GQ7 A;  1CZF A;  1O8F A;  4YCQ A;  4Z03 A;  2NTB A;  1RMG A;  1QA2 A;  4I84 A;  2B0R A;  2O04 A;  3B4N A;  1OFM A;  2O0V A;  4AVZ A;  4YZA A;  2INU A;  3SYJ A;  2VBE A;  3N90 A;  3UW0 A;  1KQ5 A;  3GQA A;  4OZY A;  3GQ8 A;  1DAB A;  3PSZ A;  1IDK A;  1QCX A;  1K8F A;  2NST A;  3VSU A;  4XM3 A;  2O0W A;  4YFO A;  1L1I A;  2XC1 A;  3ZSC A;  2NT9 A;  4OJL A;  1TSP A;  4XOP A;  1JTA A;  2NSP A;  2NTQ A;  1H80 A;  4OPW A;  4XLF A;  3VMW A;  3SUC A;  2O6W A;  4C2L A;  4YEI A;  1QQ1 A;  2X6Y A;  1KCD A;  1RU4 A;  2W7Z A;  2PEC A;  2EWE A;  1TYV A;  4XOR A;  2VFM A;  3DU1 X;  2PYG A;  1RWR A;  2X85 A;  2F3L A;  2BM4 A;  1LLZ A;  1XG2 A;  1QRB A;  1X0C A;  2BM5 A;  3LMW A;  1WXR A;  4OJ5 A;  2O1D A;  2X3H A;  4MXN A;  3SQV A;  1BHE A;  4W8S A;  4XLA A;  1AIR A;  4YC5 A;  3VSV A;  1HF2 A;  2VFP A;  2QYU A;  4U4B A;  3PSS A;  1QA1 A;  2J8I A;  4NK8 A;  1PXZ A;  3FY3 A;  3TH0 A;  2IQ7 A;  2XTY A;  4W8Q A;  2XT2 A;  3KRG A;  4XLE A;  4XN3 A;  3ZPP A;  2XT4 A;  1OGM X;  3EQN A;  1OFL A;  5JMC B;  4JRA C;  4OM9 A;  1IDJ A;  1OOC A;  1VBL A;  1IA5 A;  2UVE A;  2V5I A;  4URR A;  1EA0 A;  3SZE A;  5C1E A;  3LYC A;  4YEL A;  3EQO A;  4XKW A;  1QA3 A;  1QRC A;  3N6Z A;  2NZM A;  2BM6 A;  1DBG A;  1DBO A;  1TYU A;  4XN0 A;  3JX8 A;  3AK5 A;  3RIQ A;  1O8J A;  3SY2 A;  1GQ8 A;  3NB2 A;  1O8M A;  2O17 A;  2QZA A;  1IB4 A;  2Z8G A;  2XTW A;  1LM1 A;  1OGO X;  1O8L A;  4NK6 A;  4OJO A;  2QXZ A;  3B8Y A;  4YEJ A;  2NTP A;  2QY1 A;  1TYX A;  2VFQ A;  2INV A;  1KCC A;  4V02 C;  1TYW A; 
#chains in the Genus database with same CATH homology
 1BN8 A;  4Z06 A;  3GRH A;  1JRG A;  4Z05 A;  2QX3 A;  4U49 A;  3B90 A;  4XLH A;  4W8T A;  4YZ0 A;  5C1C A;  2ODL A;  4XOT A;  2VBM A;  2X6W A;  5AMV A;  1EE6 A;  2NT6 A;  2VJJ A;  4YZX A;  1O8K A;  4YZQ A;  1WMR A;  2BSP A;  1K5C A;  1O8E A;  1KTW A;  4MR0 A;  2UVF A;  2VJI A;  3WWG A;  3GQ9 A;  3VST A;  4XLC A;  2X6X A;  4XL9 A;  1O8H A;  1NHC A;  2PYH A;  4XNF A;  1O8G A;  4XON A;  4XQF A;  3JUR A;  1PLU A;  1PE9 A;  1O8D A;  1O8I A;  1O88 A;  4XKV A;  4XMY A;  1HG8 A;  3VMV A;  4EW9 A;  4HWV A;  4W8R A;  4OZZ A;  2VBK A;  4XR6 A;  4OJ6 A;  4PMH A;  3T9G A;  4OJP A;  1QJV A;  3GQ7 A;  1CZF A;  1O8F A;  4Z03 A;  2NTB A;  1RMG A;  4I84 A;  2O04 A;  3B4N A;  1OFM A;  2O0V A;  4AVZ A;  4YZA A;  2INU A;  2VBE A;  3UW0 A;  3GQA A;  4OZY A;  3GQ8 A;  1IDK A;  1QCX A;  2NST A;  3VSU A;  4XM3 A;  2O0W A;  3ZSC A;  2NT9 A;  4OJL A;  4XOP A;  1JTA A;  2NSP A;  2NTQ A;  1H80 A;  4XLF A;  3VMW A;  3SUC A;  4C2L A;  2X6Y A;  1KCD A;  1RU4 A;  2PEC A;  2EWE A;  4XOR A;  2PYG A;  1RWR A;  2X85 A;  1XG2 A;  1X0C A;  3LMW A;  4OJ5 A;  2O1D A;  2X3H A;  4MXN A;  1BHE A;  4W8S A;  4XLA A;  1AIR A;  3VSV A;  4U4B A;  4NK8 A;  1PXZ A;  3FY3 A;  2IQ7 A;  4W8Q A;  3KRG A;  4XLE A;  4XN3 A;  3ZPP A;  3EQN A;  1OGM X;  1OFL A;  1IA5 A;  1IDJ A;  1OOC A;  1VBL A;  2UVE A;  4URR A;  5C1E A;  4YEL A;  3EQO A;  4XKW A;  2NZM A;  1DBG A;  1DBO A;  4XN0 A;  1O8J A;  1GQ8 A;  1O8M A;  2O17 A;  1IB4 A;  2Z8G A;  1OGO X;  1O8L A;  4NK6 A;  4OJO A;  2QXZ A;  3B8Y A;  4YEJ A;  2NTP A;  2QY1 A;  2INV A;  1KCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...