4MXNA

Crystal structure of a putative glycosyl hydrolase (parmer_00599) from parabacteroides merdae atcc 43184 at 1.95 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
b'KDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLIFYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKGIIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYKDCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCITPDGKAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution
rcsb
molecule keywords Uncharacterized protein
source organism Parabacteroides merdae
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4mxnA00
1BN8A 4YZXA 4XMYA 1O8HA 2O1DA 4MXNA 3B4NA 3T9GA 4OJLA 1O8MA 3EQNA 4OJOA 2UVEA 4XOTA 1KCCA 2INUA 1OFMA 4NK6A 1O8DA 3GQ7A 4W8QA 4HWVA 5C1EA 4I84A 3B90A 2NTPA 4U4BA 1O8IA 1OGOX 2QXZA 4XL9A 2EWEA 3VSTA 2X3HA 4XONA 2PYHA 4Z05A 2ODLA 2PECA 3GQ9A 4XORA 3JURA 1IA5A 1AIRA 4XN0A 4EW9A 4XM3A 4XOPA 1IDJA 4OZZA 2INVA 2QY1A 1O8EA 2VJJA 4XR6A 4XKVA 1QJVA 4XLHA 1PE9A 2QX3A 1IDKA 4W8RA 4MR0A 3ZSCA 5C1CA 4OJ6A 4XN3A 1OOCA 3VMWA 1XG2A 2X6YA 2VBMA 3EQOA 5AMVA 1IB4A 3GRHA 2VBKA 1O88A 1O8FA 4W8TA 1X0CA 2UVFA 2X85A 4YZQA 2IQ7A 2NTQA 4OJPA 2NSTA 4YELA 3VSUA 4U49A 1PXZA 1O8JA 1HG8A 2NSPA 4XLAA 2NT6A 2O04A 1DBGA 3KRGA 4XQFA 1JTAA 1EE6A 1QCXA 4Z03A 4XKWA 4Z06A 4XLCA 3UW0A 1PLUA 2VBEA 4XNFA 3LMWA 3VMVA 1NHCA 4XLEA 3FY3A 3GQAA 1GQ8A 2NZMA 3GQ8A 4C2LA 1RMGA 3B8YA 4W8SA 2Z8GA 4YEJA 1VBLA 4NK8A 4XLFA 2BSPA 3VSVA 2X6XA 1WMRA 2NT9A 1RWRA 1H80A 1OFLA 4OJ5A 2O0WA 4URRA 2O0VA 2X6WA 4AVZA 3WWGA 3ZPPA 1BHEA 1CZFA 4PMHA 2VJIA 1O8GA 1O8KA 4YZ0A 2O17A 1DBOA 4YZAA 1OGMX 1O8LA 1RU4A 1K5CA 1KCDA 1KTWA 4OZYA 1JRGA 2PYGA 3SUCA 2NTBA
chains in the Genus database with same CATH superfamily
1BN8A 2BM7A 4YZXA 4XMYA 1QA3A 2B0RA 2XTWA 3PSSA 2G0YA 1O8HA 2O1DA 4MXNA 3B4NA 1OFEA 3RIQA 4OJLA 3T9GA 1O8MA 3EQNA 4OJOA 2UVEA 4XOTA 2QYUA 1KCCA 2INUA 1OFMA 3PETA 4YEIA 1QA1A 4NK6A 1DABA 1O8DA 1QRBA 3GQ7A 2VFPA 3SYJA 4W8QA 4HWVA 5C1EA 4I84A 3B90A 4OM9A 4V02C 2NTPA 2V5IA 4U4BA 1O8IA 1OGOX 2QXZA 3NB2A 4XL9A 2EWEA 3VSTA 2F3LA 2X3HA 1TYVA 4XONA 5DNSA 2PYHA 4Z05A 2ODLA 2PECA 3GQ9A 4XORA 1TYXA 3JURA 3P4GA 3BH7B 3SQVA 1IA5A 1AIRA 2VFQA 4XN0A 4EW9A 1TYUA 4XM3A 1L1IA 4XOPA 3DU1X 4KH3A 1IDJA 1K4ZA 4OZZA 2VFMA 2INVA 1HF2A 1O8EA 1TYWA 2QY1A 2VJJA 3N90A 4XKVA 4XR6A 1QJVA 4XLHA 1PE9A 2QX3A 1IDKA 4W8RA 5JLVC 2YUHA 2NTBA 4MR0A 3ZSCA 5C1CA 4OJ6A 3ML3A 4XN3A 1OOCA 3VMWA 1XG2A 2X6YA 2VBMA 3EQOA 5AMVA 1LLZA 1IB4A 3GRHA 2QZAA 2VBKA 1O88A 1O8FA 4W8TA 1X0CA 1TSPA 2UVFA 2X85A 4YZQA 2IQ7A 2NTQA 2XTXA 2NSTA 4OJPA 4YELA 2IOUG 4U49A 3VSUA 2VFNA 1PXZA 1O8JA 3NAWA 2BX6A 1EA0A 2BM6A 1HG8A 3JX8A 3AK5A 2NSPA 4XLAA 2NT6A 2O04A 2O6WA 1DBGA 3KRGA 4JRAC 4XQFA 1CLWA 1KQ5A 3BH6B 4OPWA 4YFOA 1JTAA 1EE6A 1QCXA 4Z03A 2W7ZA 4XKWA 4Z06A 2XC1A 3LJYA 3PSZA 4XLCA 4YC5A 1PLUA 2VBEA 4XNFA 3LMWA 3UW0A 3VMVA 1NHCA 2J8KA 2J8IA 1LM1A 3FY3A 4XLEA 3GQAA 1GQ8A 2NZMA 3GQ8A 4C2LA 3H09A 1RMGA 3B8YA 4W8SA 2Z8GA 4YEJA 1VBLA 4NK8A 2BM4A 4XLFA 2BSPA 3VSVA 2X6XA 1WMRA 2NT9A 1RWRA 1QQ1A 2VFOA 1H80A 1OFLA 4OJ5A 2O0WA 4URRA 3TH0A 2O0VA 2X6WA 1EZGA 4AVZA 3WWGA 3ZPPA 1BHEA 1CZFA 4PMHA 2VJIA 1O8GA 3LYCA 1K8FA 1O8KA 4YCQA 4YZ0A 5JMCB 2O17A 3SZEA 1DBOA 4YZAA 3N6ZA 1OGMX 1QRCA 3SY2A 1O8LA 1RU4A 2XTYA 1K5CA 4YDTA 1KCDA 1OFDA 1WXRA 1KTWA 4OZYA 2XT2A 1QA2A 1JRGA 2PYGA 2BM5A 3SUCA 2XT4A 1LLWA
chains in the Genus database with same CATH topology
1BN8A 4YZXA 4XMYA 1O8HA 2O1DA 4MXNA 3B4NA 3T9GA 4OJLA 1O8MA 3EQNA 4OJOA 2UVEA 4XOTA 1KCCA 2INUA 1OFMA 4NK6A 1O8DA 3GQ7A 4W8QA 4HWVA 5C1EA 4I84A 3B90A 2NTPA 4U4BA 1O8IA 1OGOX 2QXZA 4XL9A 2EWEA 3VSTA 2X3HA 4XONA 2PYHA 4Z05A 2ODLA 2PECA 3GQ9A 4XORA 3JURA 1IA5A 1AIRA 4XN0A 4EW9A 4XM3A 4XOPA 1IDJA 4OZZA 2INVA 2QY1A 1O8EA 2VJJA 4XR6A 4XKVA 1QJVA 4XLHA 1PE9A 2QX3A 1IDKA 4W8RA 4MR0A 3ZSCA 5C1CA 4OJ6A 4XN3A 1OOCA 3VMWA 1XG2A 2X6YA 2VBMA 3EQOA 5AMVA 1IB4A 3GRHA 2VBKA 1O88A 1O8FA 4W8TA 1X0CA 2UVFA 2X85A 4YZQA 2IQ7A 2NTQA 4OJPA 2NSTA 4YELA 3VSUA 4U49A 1PXZA 1O8JA 1HG8A 2NSPA 4XLAA 2NT6A 2O04A 1DBGA 3KRGA 4XQFA 1JTAA 1EE6A 1QCXA 4Z03A 4XKWA 4Z06A 4XLCA 3UW0A 1PLUA 2VBEA 4XNFA 3LMWA 3VMVA 1NHCA 4XLEA 3FY3A 3GQAA 1GQ8A 2NZMA 3GQ8A 4C2LA 1RMGA 3B8YA 4W8SA 2Z8GA 4YEJA 1VBLA 4NK8A 4XLFA 2BSPA 3VSVA 2X6XA 1WMRA 2NT9A 1RWRA 1H80A 1OFLA 4OJ5A 2O0WA 4URRA 2O0VA 2X6WA 4AVZA 3WWGA 3ZPPA 1BHEA 1CZFA 4PMHA 2VJIA 1O8GA 1O8KA 4YZ0A 2O17A 1DBOA 4YZAA 1OGMX 1O8LA 1RU4A 1K5CA 1KCDA 1KTWA 4OZYA 1JRGA 2PYGA 3SUCA 2NTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BN8 A;  4YZX A;  4XMY A;  1O8H A;  2O1D A;  4MXN A;  3B4N A;  3T9G A;  4OJL A;  1O8M A;  3EQN A;  4OJO A;  2UVE A;  4XOT A;  1KCC A;  2INU A;  1OFM A;  4NK6 A;  1O8D A;  3GQ7 A;  4W8Q A;  4HWV A;  5C1E A;  4I84 A;  3B90 A;  2NTP A;  4U4B A;  1O8I A;  1OGO X;  2QXZ A;  4XL9 A;  2EWE A;  3VST A;  2X3H A;  4XON A;  2PYH A;  4Z05 A;  2ODL A;  2PEC A;  3GQ9 A;  4XOR A;  3JUR A;  1IA5 A;  1AIR A;  4XN0 A;  4EW9 A;  4XM3 A;  4XOP A;  1IDJ A;  4OZZ A;  2INV A;  2QY1 A;  1O8E A;  2VJJ A;  4XR6 A;  4XKV A;  1QJV A;  4XLH A;  1PE9 A;  2QX3 A;  1IDK A;  4W8R A;  4MR0 A;  3ZSC A;  5C1C A;  4OJ6 A;  4XN3 A;  1OOC A;  3VMW A;  1XG2 A;  2X6Y A;  2VBM A;  3EQO A;  5AMV A;  1IB4 A;  3GRH A;  2VBK A;  1O88 A;  1O8F A;  4W8T A;  1X0C A;  2UVF A;  2X85 A;  4YZQ A;  2IQ7 A;  2NTQ A;  4OJP A;  2NST A;  4YEL A;  3VSU A;  4U49 A;  1PXZ A;  1O8J A;  1HG8 A;  2NSP A;  4XLA A;  2NT6 A;  2O04 A;  1DBG A;  3KRG A;  4XQF A;  1JTA A;  1EE6 A;  1QCX A;  4Z03 A;  4XKW A;  4Z06 A;  4XLC A;  3UW0 A;  1PLU A;  2VBE A;  4XNF A;  3LMW A;  3VMV A;  1NHC A;  4XLE A;  3FY3 A;  3GQA A;  1GQ8 A;  2NZM A;  3GQ8 A;  4C2L A;  1RMG A;  3B8Y A;  4W8S A;  2Z8G A;  4YEJ A;  1VBL A;  4NK8 A;  4XLF A;  2BSP A;  3VSV A;  2X6X A;  1WMR A;  2NT9 A;  1RWR A;  1H80 A;  1OFL A;  4OJ5 A;  2O0W A;  4URR A;  2O0V A;  2X6W A;  4AVZ A;  3WWG A;  3ZPP A;  1BHE A;  1CZF A;  4PMH A;  2VJI A;  1O8G A;  1O8K A;  4YZ0 A;  2O17 A;  1DBO A;  4YZA A;  1OGM X;  1O8L A;  1RU4 A;  1K5C A;  1KCD A;  1KTW A;  4OZY A;  1JRG A;  2PYG A;  3SUC A;  2NTB A; 
#chains in the Genus database with same CATH topology
 1BN8 A;  2BM7 A;  4YZX A;  4XMY A;  1QA3 A;  2B0R A;  2XTW A;  3PSS A;  2G0Y A;  1O8H A;  2O1D A;  4MXN A;  3B4N A;  1OFE A;  3RIQ A;  4OJL A;  3T9G A;  1O8M A;  3EQN A;  4OJO A;  2UVE A;  4XOT A;  2QYU A;  1KCC A;  2INU A;  1OFM A;  3PET A;  4YEI A;  1QA1 A;  4NK6 A;  1DAB A;  1O8D A;  1QRB A;  3GQ7 A;  2VFP A;  3SYJ A;  4W8Q A;  4HWV A;  5C1E A;  4I84 A;  3B90 A;  4OM9 A;  4V02 C;  2NTP A;  2V5I A;  4U4B A;  1O8I A;  1OGO X;  2QXZ A;  3NB2 A;  4XL9 A;  2EWE A;  3VST A;  2F3L A;  2X3H A;  1TYV A;  4XON A;  5DNS A;  2PYH A;  4Z05 A;  2ODL A;  2PEC A;  3GQ9 A;  4XOR A;  1TYX A;  3JUR A;  3P4G A;  3BH7 B;  3SQV A;  1IA5 A;  1AIR A;  2VFQ A;  4XN0 A;  4EW9 A;  1TYU A;  4XM3 A;  1L1I A;  4XOP A;  3DU1 X;  4KH3 A;  1IDJ A;  1K4Z A;  4OZZ A;  2VFM A;  2INV A;  1HF2 A;  1O8E A;  1TYW A;  2QY1 A;  2VJJ A;  3N90 A;  4XKV A;  4XR6 A;  1QJV A;  4XLH A;  1PE9 A;  2QX3 A;  1IDK A;  4W8R A;  5JLV C;  2YUH A;  2NTB A;  4MR0 A;  3ZSC A;  5C1C A;  4OJ6 A;  3ML3 A;  4XN3 A;  1OOC A;  3VMW A;  1XG2 A;  2X6Y A;  2VBM A;  3EQO A;  5AMV A;  1LLZ A;  1IB4 A;  3GRH A;  2QZA A;  2VBK A;  1O88 A;  1O8F A;  4W8T A;  1X0C A;  1TSP A;  2UVF A;  2X85 A;  4YZQ A;  2IQ7 A;  2NTQ A;  2XTX A;  2NST A;  4OJP A;  4YEL A;  2IOU G;  4U49 A;  3VSU A;  2VFN A;  1PXZ A;  1O8J A;  3NAW A;  2BX6 A;  1EA0 A;  2BM6 A;  1HG8 A;  3JX8 A;  3AK5 A;  2NSP A;  4XLA A;  2NT6 A;  2O04 A;  2O6W A;  1DBG A;  3KRG A;  4JRA C;  4XQF A;  1CLW A;  1KQ5 A;  3BH6 B;  4OPW A;  4YFO A;  1JTA A;  1EE6 A;  1QCX A;  4Z03 A;  2W7Z A;  4XKW A;  4Z06 A;  2XC1 A;  3LJY A;  3PSZ A;  4XLC A;  4YC5 A;  1PLU A;  2VBE A;  4XNF A;  3LMW A;  3UW0 A;  3VMV A;  1NHC A;  2J8K A;  2J8I A;  1LM1 A;  3FY3 A;  4XLE A;  3GQA A;  1GQ8 A;  2NZM A;  3GQ8 A;  4C2L A;  3H09 A;  1RMG A;  3B8Y A;  4W8S A;  2Z8G A;  4YEJ A;  1VBL A;  4NK8 A;  2BM4 A;  4XLF A;  2BSP A;  3VSV A;  2X6X A;  1WMR A;  2NT9 A;  1RWR A;  1QQ1 A;  2VFO A;  1H80 A;  1OFL A;  4OJ5 A;  2O0W A;  4URR A;  3TH0 A;  2O0V A;  2X6W A;  1EZG A;  4AVZ A;  3WWG A;  3ZPP A;  1BHE A;  1CZF A;  4PMH A;  2VJI A;  1O8G A;  3LYC A;  1K8F A;  1O8K A;  4YCQ A;  4YZ0 A;  5JMC B;  2O17 A;  3SZE A;  1DBO A;  4YZA A;  3N6Z A;  1OGM X;  1QRC A;  3SY2 A;  1O8L A;  1RU4 A;  2XTY A;  1K5C A;  4YDT A;  1KCD A;  1OFD A;  1WXR A;  1KTW A;  4OZY A;  2XT2 A;  1QA2 A;  1JRG A;  2PYG A;  2BM5 A;  3SUC A;  2XT4 A;  1LLW A; 
#chains in the Genus database with same CATH homology
 1BN8 A;  4YZX A;  4XMY A;  1O8H A;  2O1D A;  4MXN A;  3B4N A;  3T9G A;  4OJL A;  1O8M A;  3EQN A;  4OJO A;  2UVE A;  4XOT A;  1KCC A;  2INU A;  1OFM A;  4NK6 A;  1O8D A;  3GQ7 A;  4W8Q A;  4HWV A;  5C1E A;  4I84 A;  3B90 A;  2NTP A;  4U4B A;  1O8I A;  1OGO X;  2QXZ A;  4XL9 A;  2EWE A;  3VST A;  2X3H A;  4XON A;  2PYH A;  4Z05 A;  2ODL A;  2PEC A;  3GQ9 A;  4XOR A;  3JUR A;  1IA5 A;  1AIR A;  4XN0 A;  4EW9 A;  4XM3 A;  4XOP A;  1IDJ A;  4OZZ A;  2INV A;  2QY1 A;  1O8E A;  2VJJ A;  4XR6 A;  4XKV A;  1QJV A;  4XLH A;  1PE9 A;  2QX3 A;  1IDK A;  4W8R A;  4MR0 A;  3ZSC A;  5C1C A;  4OJ6 A;  4XN3 A;  1OOC A;  3VMW A;  1XG2 A;  2X6Y A;  2VBM A;  3EQO A;  5AMV A;  1IB4 A;  3GRH A;  2VBK A;  1O88 A;  1O8F A;  4W8T A;  1X0C A;  2UVF A;  2X85 A;  4YZQ A;  2IQ7 A;  2NTQ A;  4OJP A;  2NST A;  4YEL A;  3VSU A;  4U49 A;  1PXZ A;  1O8J A;  1HG8 A;  2NSP A;  4XLA A;  2NT6 A;  2O04 A;  1DBG A;  3KRG A;  4XQF A;  1JTA A;  1EE6 A;  1QCX A;  4Z03 A;  4XKW A;  4Z06 A;  4XLC A;  3UW0 A;  1PLU A;  2VBE A;  4XNF A;  3LMW A;  3VMV A;  1NHC A;  4XLE A;  3FY3 A;  3GQA A;  1GQ8 A;  2NZM A;  3GQ8 A;  4C2L A;  1RMG A;  3B8Y A;  4W8S A;  2Z8G A;  4YEJ A;  1VBL A;  4NK8 A;  4XLF A;  2BSP A;  3VSV A;  2X6X A;  1WMR A;  2NT9 A;  1RWR A;  1H80 A;  1OFL A;  4OJ5 A;  2O0W A;  4URR A;  2O0V A;  2X6W A;  4AVZ A;  3WWG A;  3ZPP A;  1BHE A;  1CZF A;  4PMH A;  2VJI A;  1O8G A;  1O8K A;  4YZ0 A;  2O17 A;  1DBO A;  4YZA A;  1OGM X;  1O8L A;  1RU4 A;  1K5C A;  1KCD A;  1KTW A;  4OZY A;  1JRG A;  2PYG A;  3SUC A;  2NTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...