4MXQA

42f3 tcr pcpc5/h-2ld complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha VmVh chimera
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 50
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mxqA00
3PWLA 4ZUSA 3P4NA 2V2XA 1EFXA 3BP7A 3S6CA 5C07A 3GMNA 4HWZA 3UPRA 3ES6A 3VCLA 1ZT4A 3X12A 1N3NA 2PYEA 4NQDA 2ESVA 3M17A 3FOLA 5E8NA 5EU4A 4PGBA 2VAAA 3GSNH 4IRSA 1FO0H 2HJKA 3ARDA 3TJHA 3D18A 3OXSA 3CDGA 3VXPA 4N0UA 3M1BA 4UQ2A 3VXMA 2BVOA 4U1IA 4Y16A 5EO0A 3RUGA 1LQVA 4EI5A 1G6RH 3P9MA 5J6HA 1ZS8A 4QRUA 1T7ZA 1OF2A 4HKJA 1EEZA 1LK2A 3X14A 3SCMA 5IB2A 1NEZA 3GIVA 1KJ3H 3SJVA 4PRNA 2X4PA 3P73A 3VXNA 4G43A 1LEKA 4G59A 1BQHA 3P77A 3RGVC 3GSUA 4E5XA 4X6CA 5EUOA 3E6FA 3VRIA 1AGCA 5C0IA 5D7LA 3TFKA 4JFPA 1DUZA 1A1NA 3DX6A 3IXAA 3MRRA 2YPLA 4HUUA 3P9LA 3BO8A 4JQVA 4MXQA 2AKRA 3VFUA 3LKRA 2X4QA 2CIKA 3CCHA 1B0RA 4I48A 1KPUA 2BCKA 1T7VA 4I4WA 3X13A 1ZHBA 3GMPA 3H7BA 5L2KA 3W0WA 3PWNA 1AKJA 1HSAA 1T0MA 4PRBA 4EN3C 5C0CA 3TZVC 3GSRA 5C0GA 4PRDA 1KJMA 2AXGA 3T1FA 2ZOLA 1LEGA 3H9SA 4PJAA 1KJ2H 1S9XA 2CIIA 3LKNA 5ENWA 3KPPA 4NHUE 4NNXA 5SWSA 1E28A 1S7TA 5BRZA 1AGEA 5IB5A 3HLAA 1GZPA 2F54A 3MGTA 3MA7A 4F7TA 3GSOA 3FRUA 5IROA 1K5NA 3BH8A 3DXAA 4EUPA 2AV7A 3RWDA 3TF7A 3D25A 2CLVA 5E8PA 4X6EA 5E9DA 4N5EA 2BNRA 3CVHA 1QEWA 1FZOA 1SYVA 2X4UA 3HUJA 5EU3A 4NO5A 3VFWA 5ACZA 2F53A 2P5WA 3D3VA 3KPOA 3WS6A 3FT2A 2VLKA 4PJCA 4O2FA 2FZ3A 3BZFA 1U58A 2VLJA 4L3EA 3FT3A 2UWEA 3KLAA 4PJEA 5AD0A 5C0FA 1T21A 3AREA 5L2JA 1A1MA 4PGEA 4HUVA 4LHUA 3GSQA 5MERA 3MRJA 5D2NA 1HHKA 3VFOA 4NQVA 3X11A 2P5EA 4L4TA 4X6DA 4Z78A 4PV8A 1VACA 3PQYA 2X4SA 3AU1A 2BNQA 4Z76A 1UXSA 1QLFA 3ARGA 1QQDA 1JPFA 1S8DA 4D0BA 2X4TA 3RL1A 4NQXA 3BZEA 1JUFA 3D39A 4JFOA 5FKPA 2BVPA 1NAMH 1MHEA 1IM3A 3BWAA 4PRAA 1S9WA 2AV1A 3VXSA 3TIDA 3W39A 3AM8A 1FFOA 1AGFA 3L9RA 5HGBA 4PJDA 5IB4A 2C7UA 4PJGA 3QUKA 2J8UA 5E8OA 1ZT1A 3NFNA 2BVQA 4JRXA 3QI9A 3BXNA 3ILQC 1FZMA 4L4VA 4WU7A 3TBVA 4QRPA 4UQ3A 5EO1A 4GKNA 3BEVA 4U1HA 1A1OA 1CD1A 3H9HA 3TBWA 2WY3A 2MHAA 3GSXA 3JTSA 1A9EA 1T1ZA 4U1MA 1CE6A 1P4LA 3FQWA 1I1FA 3MRMA 4CVZA 1R3HA 3CC5A 4MVBA 4NQCA 4U1JA 3MRQA 1T80A 1L8JA 4X6FA 5C0AA 4PJ7A 1MWAH 4G8IA 2RFXA 3V5KA 4L8BA 3MRKA 3MRDA 3VWKA 4PJ9A 3RL2A 2ZSVA 4U1LA 5D7IA 3RWGA 1T7YA 1S7QA 4MQ7A 4U6YA 5H94A 2A83A 3LV3A 3E2HA 4N0FA 1ZT7A 3C8KA 4NT6A 3UTSA 4U1NA 3RTQA 2GAZA 1JHTA 3FQRA 1Q94A 4F7PA 4NO0A 5E6IC 1PQZA 5SWQA 1M05A 1IM9A 3TVMA 1BZ9A 3MV9A 3TO2A 4ZUTA 4Z77A 3HPJA 3O3EA 3LN4A 5HHMA 4NSKA 1A9BA 1XH3A 1P7QA 1P1ZA 3RWIA 3I6GA 3QDGA 3ECBA 3SKOA 5BS0A 1I7RA 2D31A 1GZQA 3VXRA 4PJBA 4WO4A 2GITA 2NX5A 4F7MA 1BIIA 3PWUA 3ROLA 4K71B 3SKMA 5IM7A 3GMQA 4ZUUA 3SDDA 1EXUA 3TBYA 3GMLA 4ZFZA 4CVXA 1YN6A 1ZHLA 3O3AA 4PGCA 1QVOA 5GSRA 5HHQA 3L3GA 3OX8A 3PWPA 3KPNA 3BVNA 2GJ6A 1W72A 3SPVA 3O4LA 1LD9A 4L8DA 3FT4A 1FZJA 1FFPA 3BP4A 2F74A 4QOKA 3QUYA 3TN0A 3RWFA 4JFQA 3QUXA 4WDIA 1YDPA 4LCWA 5F7DA 1AO7A 3P4OA 1XZ0A 4QRQA 4PJXA 1TVHA 4NO3A 5D9SA 4JFDA 3KPMA 5FA4A 2PO6A 3TPUE 3E6HA 3LKSA 4GKSA 3GSVA 4MJ6A 4ELMA 2OI9A 1HHHA 3VFSA 5C0DA 3VXOA 3GMMA 2OL3H 1I7TA 1KPRA 1N59A 1S7WA 3FQTA 2XFXA 4Y4HA 3G08A 4PJ8A 4PGDA 1ZAGA 1JE6A 5C08A 1ZVSA 2E7LE 3REWA 3BEWA 1S7RA 1I4FA 1RJZA 4PJFA 3MREA 4MJIA 3VWJA 3CH1A 3L3JA 1MHCA 3FOMA 4L29A 1HHJA 1WBZA 3VJ6A 3RZCA 5C09A 5GSVA 5C0BA 5INCA 3VFNA 3RWHA 1JF1A 3HCVA 1I1AA 2CKBH 4S0UC 4N8VA 1N2RA 4PREA 3SDXA 3GMOA 3SDCA 2JCCA 1DUYA 5E00A 2CLRA 4N0CA 3O3BA 3WLBA 1AGDA 3C9NA 4PV9A 1QRNA 3MV7A 2BSSA 3V5HA 1ONQA 3TIEA 4ZUWA 3UTTA 1EEYA 3O8XA 5DEFA 1X7QA 2H26A 2X4NA 4Y4KA 4NO2A 3VFTA 3VFRA 3HG1A 5HHOA 4LCCC 1QO3A 4PRHA 4MX7A 5C0EA 3BGMA 3VFMA 1SYSA 1UXWA 5HHNA 1S7SA 3KPLA 4Y2DA 3MRBA 3WS3A 1HHIA 3MRHA 3VRJA 3L3KA 1QSEA 3WL9A 1INQA 3MYJA 3CPLA 4ZUVA 3KPRA 3QEQA 5FA3A 5EU5A 3RWEA 1E27A 3MRCA 1HYRC 3RWJA 5MEOA 3DX8A 3DBXA 1S9YA 1S7VA 3I6KA 5C0JA 5DEGA 5F9JA 3ROOA 3HAEA 1NANH 2BSTA 3VFPA 4D0DA 4E0RA 3QQ4A 3KPQA 5D7JC 3FQXA 1S7UA 3FQUA 4ZAKA 3RWCA 4QRTA 4G8GA 4JFFA 1HSBA 1TVBA 1KJVA 5HHPA 5F1NA 2DYPA 1T1WA 1UQSA 3O9WA 1T7WA 1KPVA 1LP9A 1QSFA 2ZSWA 3ERYA 3MRPA 5C9JA 5MEQA 2X70A 4WUUA 5EOTA 3LKOA 1FZKA 3WUWA 1YPZA 4F7EA 3T8XA 1RK1A 1QR1A 4IHOA 3U0PA 3MR9A 3MRGA 5HGAA 3QFJA 2GT9A 1VADA 3KPSA 4L8SC 1RJYA 3PABA 4L3CA 1XR9A 2X4RA 4G9DA 4HS3A 3MV8A 5D5MA 4HUXA 4LNRA 4XXCA 4U1KA 1CG9A 3KXFA 4FTVA 2HLAA 4HX1A 4HUWA 3LN5A 3IT8D 4K7FA 4O2EA 1I7UA 1LDPH 1W0VA 3CZFA 4L8CA 2VLLA 5IB1A 4WW2C 2VLRA 3JTTA 4G9FA 4JRYA 5SWZA 5IEKA 5IEHA 1ED3A 3O3DA 1G7QA 1T1XA 2X4OA 2VE6A 3ILPA 5HGDA 3QQ3A 4F7CA 1ZSDA 3HE6A 4U6XA 4V3DB 4CW1A 1B0GA 4MNQA 4L9LC 1G7PA 4PG9A 1T0NA 3TO4A 1JFMA 2GTZA 4PG2A 5J6GA 3MRIA 1MI5A 3JVGA 3UTQA 1KBGH 4APQA 3QULA 4PRPA 5DDHA 3QUZA 1WBYA 4IIQC 4MNGA 5JHDA 5MENA 2ZOKA 3KYNA 3LKQA 1KTLA 3KWWA 5D2LA 3VH8A 2HN7A 1OGTA 3P4MA 1AGBA 3KYOA 3HE7A 3VFVA 5F1IA 3TBSA 1TMCA 3FFCA 4PJHA 1VGKA 2AXFA 1DE4A 4PDCE 1FG2A 3MRFA 4PR5A 5IB3A 2H6PA 1T7XA 2FYYA 3GSWA 4PP8C 2GUOA 4GUPA 2XPGA 3LKPA 1YN7A 3TA3A 1I1YA 4QRRA 1JPGA 1OSZA 3E3QA 3TBTA 4NNYA 3GJFA 4D0CA 2Q7YA 3DX7A 1WBXA 3BHBA 5ISZA 5FDWA 1KCGC 3V5DA 1T20A 3OXRA 5HYJA 3PWJA 2FIKA 3L3HA 3MRNA 5INDA 3QDMA 4PJIA 1K8DA 3L3IA 3QDJA 3L3DA 5J1AA 1C16A 3MRLA 1OGAA 1W0WA 2YPKA 4MJ5A 4ONOA 5HGHA 3MGOA 4WU5A 1DDHA 3OV6A 1ZHKA 3D2UA 2YEZA 3I6LD 4WJ5A 2V2WA 3UBXA 2VABA 5BJTA 5EFIA 1JGDA 4LCYA 5B38A 4O2CA 3GMRA 2HJLA 3ARFA 4V3EB 4PJ5A 2NW3A 3B3IA 2FWOA 5MEPA 5B39A 1FFNA 3DMMA 4HV8A 4U1SA 5IVXA 1B3JA 1ZHNA 3FQNA 4WWKC 5EU6A 3BH9A 4FFEX 2AK4A 4MS8A 1HHGA 2FO4A 1RK0A 3DTXA 3SDAA 3VXUA 3QFDA 3B6SA 4JFEA 4G42A 4PRIA 1JGEA 3QZWA 3MROA 1M6OA 2CLZA 4IRJA 3ARBA 3BUYA 1Z5LA 1XR8A 1S7XA 4JQXA 3PWVA 4Y4FA 3JTCA 3FONA 1A6ZA 2GTWA 2BSRA 4QRSA 4NQEA 5BXFA 1T1YA 3BW9A 1N5AA 1T22A 3FTGA 1BD2A 1HOCA
chains in the Genus database with same CATH superfamily
3PWLA 4ZUSA 3P4NA 2V2XA 1EFXA 3BP7A 3S6CA 5C07A 3GMNA 4HWZA 3UPRA 3ES6A 3VCLA 1ZT4A 3X12A 1N3NA 2PYEA 4NQDA 2ESVA 3M17A 3FOLA 5E8NA 5EU4A 4PGBA 2VAAA 3GSNH 4IRSA 1FO0H 2HJKA 3ARDA 3TJHA 3D18A 3OXSA 3CDGA 3VXPA 4N0UA 3M1BA 4UQ2A 3VXMA 2BVOA 4U1IA 4Y16A 5EO0A 3RUGA 1LQVA 4EI5A 1G6RH 3I0TA 3P9MA 5J6HA 1ZS8A 4QRUA 1T7ZA 1OF2A 4HKJA 1EEZA 1LK2A 3X14A 3SCMA 5IB2A 1NEZA 3GIVA 4BKWA 1KJ3H 3SJVA 4PRNA 2X4PA 3P73A 3VXNA 4G43A 1LEKA 4G59A 1BQHA 3P77A 3RGVC 3GSUA 4E5XA 4X6CA 5EUOA 3E6FA 3VRIA 1AGCA 5C0IA 5D7LA 3TFKA 4JFPA 1DUZA 1A1NA 3DX6A 3IXAA 3MRRA 2YPLA 4HUUA 3P9LA 3BO8A 4JQVA 4MXQA 2AKRA 3VFUA 3LKRA 2X4QA 2CIKA 3CCHA 1B0RA 4I48A 1KPUA 2BCKA 1T7VA 4I4WA 3X13A 1ZHBA 3GMPA 3H7BA 5L2KA 3W0WA 3PWNA 1AKJA 1HSAA 1T0MA 4PRBA 4EN3C 5C0CA 3TZVC 3GSRA 5C0GA 4PRDA 1KJMA 2AXGA 3T1FA 2ZOLA 1LEGA 3H9SA 4PJAA 1KJ2H 1S9XA 2CIIA 3LKNA 5ENWA 3KPPA 4NHUE 4NNXA 5SWSA 1E28A 1S7TA 5BRZA 1AGEA 5IB5A 3HLAA 1GZPA 2F54A 3MGTA 3MA7A 4F7TA 3GSOA 3FRUA 5IROA 1K5NA 3BH8A 3DXAA 4EUPA 2AV7A 3RWDA 3TF7A 3D25A 2CLVA 5E8PA 4X6EA 5E9DA 4N5EA 2BNRA 3CVHA 1QEWA 1FZOA 1SYVA 2X4UA 3HUJA 5EU3A 4NO5A 3VFWA 5ACZA 2F53A 2P5WA 3D3VA 3KPOA 3WS6A 3FT2A 2VLKA 4PJCA 4O2FA 2FZ3A 3BZFA 1U58A 2VLJA 4L3EA 3FT3A 2UWEA 3KLAA 4PJEA 5AD0A 5C0FA 1T21A 3AREA 5L2JA 1A1MA 4PGEA 4HUVA 4LHUA 3GSQA 5MERA 3MRJA 5D2NA 1HHKA 3VFOA 4NQVA 3X11A 2P5EA 4L4TA 4X6DA 4Z78A 4PV8A 1VACA 3PQYA 2X4SA 3AU1A 2BNQA 4Z76A 1UXSA 1QLFA 3ARGA 1QQDA 1JPFA 1S8DA 4D0BA 2X4TA 3RL1A 4NQXA 3BZEA 1JUFA 3D39A 4JFOA 5FKPA 2BVPA 1NAMH 1MHEA 1IM3A 3BWAA 4PRAA 1S9WA 2AV1A 3VXSA 3TIDA 3W39A 3AM8A 1FFOA 1AGFA 3L9RA 5HGBA 4PJDA 5IB4A 2C7UA 4PJGA 3QUKA 2J8UA 5E8OA 1ZT1A 3NFNA 2BVQA 4JRXA 3QI9A 3BXNA 3ILQC 1FZMA 4L4VA 4WU7A 3TBVA 4QRPA 4UQ3A 5EO1A 4GKNA 3BEVA 4U1HA 1A1OA 1CD1A 3H9HA 3TBWA 2WY3A 2MHAA 3GSXA 3JTSA 1A9EA 1T1ZA 4U1MA 1CE6A 1P4LA 3FQWA 1I1FA 3MRMA 4CVZA 1R3HA 3CC5A 4MVBA 4NQCA 4U1JA 3MRQA 1T80A 1L8JA 4X6FA 5C0AA 4PJ7A 1MWAH 4G8IA 2RFXA 3V5KA 4L8BA 3MRKA 3MRDA 3VWKA 4PJ9A 3RL2A 2ZSVA 4U1LA 5D7IA 3RWGA 1T7YA 1S7QA 4MQ7A 4U6YA 5H94A 2A83A 3LV3A 3E2HA 4N0FA 1ZT7A 3C8KA 4NT6A 3UTSA 4U1NA 3RTQA 2GAZA 1JHTA 3FQRA 1Q94A 4F7PA 4NO0A 5E6IC 1PQZA 5SWQA 1M05A 1IM9A 3TVMA 1BZ9A 3MV9A 3TO2A 4ZUTA 4Z77A 3HPJA 3O3EA 3LN4A 5HHMA 4NSKA 1A9BA 1XH3A 1P7QA 1P1ZA 3RWIA 3I6GA 3QDGA 3ECBA 3SKOA 5BS0A 1I7RA 2D31A 1GZQA 3VXRA 4PJBA 4WO4A 2GITA 2NX5A 4F7MA 1BIIA 3PWUA 3ROLA 4K71B 3SKMA 5IM7A 3GMQA 4ZUUA 3SDDA 1EXUA 3TBYA 3GMLA 4ZFZA 4CVXA 1YN6A 1ZHLA 3O3AA 4PGCA 1QVOA 5GSRA 5HHQA 3L3GA 3OX8A 3PWPA 3KPNA 3BVNA 2GJ6A 1W72A 3SPVA 3O4LA 1LD9A 4L8DA 3FT4A 1FZJA 1FFPA 3BP4A 2F74A 4QOKA 3QUYA 3TN0A 3RWFA 4JFQA 3QUXA 4WDIA 1YDPA 4LCWA 5F7DA 1AO7A 3P4OA 1XZ0A 4QRQA 4PJXA 1TVHA 4NO3A 5D9SA 4JFDA 3KPMA 5FA4A 2PO6A 3TPUE 3E6HA 3LKSA 4GKSA 3GSVA 4MJ6A 4ELMA 2OI9A 1HHHA 3VFSA 5C0DA 3VXOA 3GMMA 2OL3H 1I7TA 1KPRA 1N59A 1S7WA 3FQTA 2XFXA 4Y4HA 3G08A 4PJ8A 4PGDA 2IA1A 1ZAGA 1JE6A 5C08A 1ZVSA 2E7LE 3REWA 3BEWA 1S7RA 1I4FA 1RJZA 4PJFA 3MREA 4MJIA 3VWJA 3CH1A 3L3JA 1MHCA 3FOMA 4L29A 1HHJA 1WBZA 3VJ6A 3RZCA 5C09A 5GSVA 5C0BA 5INCA 3VFNA 3RWHA 1JF1A 3HCVA 1I1AA 2CKBH 4S0UC 4N8VA 1N2RA 4PREA 2O5NA 3GMOA 3SDCA 3SDXA 2JCCA 1DUYA 5E00A 2CLRA 4N0CA 3O3BA 3WLBA 1AGDA 3C9NA 4PV9A 1QRNA 3MV7A 2BSSA 3V5HA 1ONQA 3TIEA 4ZUWA 3UTTA 1EEYA 3O8XA 5DEFA 1X7QA 2NYKA 2H26A 2X4NA 4Y4KA 4NO2A 3VFTA 3VFRA 3HG1A 5HHOA 4LCCC 1QO3A 4PRHA 4MX7A 5C0EA 3BGMA 3VFMA 1SYSA 1UXWA 5HHNA 1S7SA 3KPLA 4Y2DA 3MRBA 3WS3A 1HHIA 3MRHA 3VRJA 3L3KA 1QSEA 3WL9A 1INQA 3MYJA 3CPLA 4ZUVA 3KPRA 3QEQA 5FA3A 5EU5A 3RWEA 1E27A 3MRCA 1HYRC 3RWJA 5MEOA 3DX8A 3DBXA 1S9YA 1S7VA 3I6KA 5C0JA 5DEGA 5F9JA 3ROOA 3HAEA 1NANH 2BSTA 3VFPA 4D0DA 4E0RA 3QQ4A 3KPQA 5D7JC 3FQXA 1S7UA 3FQUA 4ZAKA 3RWCA 4QRTA 4G8GA 4JFFA 1HSBA 1TVBA 1KJVA 5HHPA 5F1NA 2DYPA 1T1WA 1UQSA 3O9WA 1T7WA 1KPVA 1LP9A 1QSFA 2ZSWA 3ERYA 3MRPA 5C9JA 5MEQA 2X70A 4JO8A 4WUUA 5EOTA 3LKOA 1FZKA 3WUWA 1YPZA 4F7EA 3T8XA 1RK1A 1QR1A 4IHOA 3U0PA 3MR9A 3MRGA 5HGAA 3QFJA 2GT9A 1VADA 3KPSA 4L8SC 1RJYA 3PABA 4L3CA 1XR9A 2X4RA 4G9DA 4HS3A 3MV8A 5D5MA 4HUXA 4LNRA 4XXCA 4U1KA 1CG9A 3KXFA 4FTVA 2HLAA 4HX1A 4HUWA 3LN5A 3IT8D 4K7FA 4O2EA 1I7UA 1LDPH 1W0VA 3CZFA 4L8CA 2VLLA 5IB1A 4WW2C 2VLRA 4G59C 3JTTA 4G9FA 4JRYA 5SWZA 5IEKA 5IEHA 1ED3A 3O3DA 1G7QA 1T1XA 2X4OA 2VE6A 3ILPA 5HGDA 3QQ3A 4F7CA 1ZSDA 3HE6A 4U6XA 4V3DB 4CW1A 1B0GA 4MNQA 4L9LC 1G7PA 4PG9A 1T0NA 3TO4A 1JFMA 2GTZA 4PG2A 5J6GA 3MRIA 1MI5A 3JVGA 3UTQA 1KBGH 4APQA 3QULA 4PRPA 5DDHA 3QUZA 1WBYA 4IIQC 4MNGA 5JHDA 5MENA 2ZOKA 3KYNA 3LKQA 1KTLA 3KWWA 5D2LA 3VH8A 2HN7A 1OGTA 3P4MA 1AGBA 3KYOA 3HE7A 3VFVA 5F1IA 3TBSA 1TMCA 3FFCA 4PJHA 1VGKA 2AXFA 1DE4A 4PDCE 1FG2A 3MRFA 4PR5A 5IB3A 2H6PA 1T7XA 2FYYA 3GSWA 4PP8C 2GUOA 4GUPA 2XPGA 3LKPA 1YN7A 3TA3A 1I1YA 4QRRA 1JPGA 1OSZA 3E3QA 3TBTA 4NNYA 3GJFA 4D0CA 2Q7YA 3DX7A 1WBXA 3BHBA 5ISZA 5FDWA 1KCGC 3V5DA 1T20A 3OXRA 5HYJA 3PWJA 2FIKA 3L3HA 3MRNA 5INDA 3QDMA 4PJIA 1K8DA 3L3IA 3QDJA 3L3DA 5J1AA 1C16A 3MRLA 1OGAA 1W0WA 2YPKA 4MJ5A 4ONOA 5HGHA 3MGOA 4WU5A 1DDHA 3OV6A 1ZHKA 3D2UA 2YEZA 3I6LD 4WJ5A 2V2WA 3UBXA 2VABA 5BJTA 5EFIA 1JGDA 4LCYA 5B38A 4O2CA 3GMRA 2HJLA 3ARFA 4V3EB 4PJ5A 2NW3A 3B3IA 2FWOA 5MEPA 5B39A 1FFNA 3DMMA 4HV8A 4U1SA 5IVXA 1B3JA 1ZHNA 3FQNA 4WWKC 5EU6A 3BH9A 4FFEX 2AK4A 4MS8A 1HHGA 2FO4A 1RK0A 3DTXA 3SDAA 3VXUA 3QFDA 3B6SA 4JFEA 4G42A 4PRIA 1JGEA 3QZWA 3MROA 1M6OA 2CLZA 4IRJA 3ARBA 3BUYA 1Z5LA 1XR8A 1S7XA 4JQXA 3PWVA 4Y4FA 3JTCA 3FONA 1A6ZA 2GTWA 2BSRA 4QRSA 4NQEA 5BXFA 1T1YA 3BW9A 1N5AA 1T22A 3FTGA 1BD2A 1HOCA
chains in the Genus database with same CATH topology
3PWLA 4ZUSA 3P4NA 2V2XA 1EFXA 3BP7A 3S6CA 5C07A 3GMNA 4HWZA 3UPRA 3ES6A 3VCLA 1ZT4A 3X12A 1N3NA 2PYEA 4NQDA 2ESVA 3M17A 3FOLA 5E8NA 5EU4A 4PGBA 2VAAA 3GSNH 4IRSA 1FO0H 2HJKA 3ARDA 3TJHA 3D18A 3OXSA 3CDGA 3VXPA 4N0UA 3M1BA 4UQ2A 3VXMA 2BVOA 4U1IA 4Y16A 5EO0A 3RUGA 1LQVA 4EI5A 1G6RH 3P9MA 5J6HA 1ZS8A 4QRUA 1T7ZA 1OF2A 4HKJA 1EEZA 1LK2A 3X14A 3SCMA 5IB2A 1NEZA 3GIVA 1KJ3H 3SJVA 4PRNA 2X4PA 3P73A 3VXNA 4G43A 1LEKA 4G59A 1BQHA 3P77A 3RGVC 3GSUA 4E5XA 4X6CA 5EUOA 3E6FA 3VRIA 1AGCA 5C0IA 5D7LA 3TFKA 4JFPA 1DUZA 1A1NA 3DX6A 3IXAA 3MRRA 2YPLA 4HUUA 3P9LA 3BO8A 4JQVA 4MXQA 2AKRA 3VFUA 3LKRA 2X4QA 2CIKA 3CCHA 1B0RA 4I48A 1KPUA 2BCKA 1T7VA 4I4WA 3X13A 1ZHBA 3GMPA 3H7BA 5L2KA 3W0WA 3PWNA 1AKJA 1HSAA 1T0MA 4PRBA 4EN3C 5C0CA 3TZVC 3GSRA 5C0GA 4PRDA 1KJMA 2AXGA 3T1FA 2ZOLA 1LEGA 3H9SA 4PJAA 1KJ2H 1S9XA 2CIIA 3LKNA 5ENWA 3KPPA 4NHUE 4NNXA 5SWSA 1E28A 1S7TA 5BRZA 1AGEA 5IB5A 3HLAA 1GZPA 2F54A 3MGTA 3MA7A 4F7TA 3GSOA 3FRUA 5IROA 1K5NA 3BH8A 3DXAA 4EUPA 2AV7A 3RWDA 3TF7A 3D25A 2CLVA 5E8PA 4X6EA 5E9DA 4N5EA 2BNRA 3CVHA 1QEWA 1FZOA 1SYVA 2X4UA 3HUJA 5EU3A 4NO5A 3VFWA 5ACZA 2F53A 2P5WA 3D3VA 3KPOA 3WS6A 3FT2A 2VLKA 4PJCA 4O2FA 2FZ3A 3BZFA 1U58A 2VLJA 4L3EA 3FT3A 2UWEA 3KLAA 4PJEA 5AD0A 5C0FA 1T21A 3AREA 5L2JA 1A1MA 4PGEA 4HUVA 4LHUA 3GSQA 5MERA 3MRJA 5D2NA 1HHKA 3VFOA 4NQVA 3X11A 2P5EA 4L4TA 4X6DA 4Z78A 4PV8A 1VACA 3PQYA 2X4SA 3AU1A 2BNQA 4Z76A 1UXSA 1QLFA 3ARGA 1QQDA 1JPFA 1S8DA 4D0BA 2X4TA 3RL1A 4NQXA 3BZEA 1JUFA 3D39A 4JFOA 5FKPA 2BVPA 1NAMH 1MHEA 1IM3A 3BWAA 4PRAA 1S9WA 2AV1A 3VXSA 3TIDA 3W39A 3AM8A 1FFOA 1AGFA 3L9RA 5HGBA 4PJDA 5IB4A 2C7UA 4PJGA 3QUKA 2J8UA 5E8OA 1ZT1A 3NFNA 2BVQA 4JRXA 3QI9A 3BXNA 3ILQC 1FZMA 4L4VA 4WU7A 3TBVA 4QRPA 4UQ3A 5EO1A 4GKNA 3BEVA 4U1HA 1A1OA 1CD1A 3H9HA 3TBWA 2WY3A 2MHAA 3GSXA 3JTSA 1A9EA 1T1ZA 4U1MA 1CE6A 1P4LA 3FQWA 1I1FA 3MRMA 4CVZA 1R3HA 3CC5A 4MVBA 4NQCA 4U1JA 3MRQA 1T80A 1L8JA 4X6FA 5C0AA 4PJ7A 1MWAH 4G8IA 2RFXA 3V5KA 4L8BA 3MRKA 3MRDA 3VWKA 4PJ9A 3RL2A 2ZSVA 4U1LA 5D7IA 3RWGA 1T7YA 1S7QA 4MQ7A 4U6YA 5H94A 2A83A 3LV3A 3E2HA 4N0FA 1ZT7A 3C8KA 4NT6A 3UTSA 4U1NA 3RTQA 2GAZA 1JHTA 3FQRA 1Q94A 4F7PA 4NO0A 5E6IC 1PQZA 5SWQA 1M05A 1IM9A 3TVMA 1BZ9A 3MV9A 3TO2A 4ZUTA 4Z77A 3HPJA 3O3EA 3LN4A 5HHMA 4NSKA 1A9BA 1XH3A 1P7QA 1P1ZA 3RWIA 3I6GA 3QDGA 3ECBA 3SKOA 5BS0A 1I7RA 2D31A 1GZQA 3VXRA 4PJBA 4WO4A 2GITA 2NX5A 4F7MA 1BIIA 3PWUA 3ROLA 4K71B 3SKMA 5IM7A 3GMQA 4ZUUA 3SDDA 1EXUA 3TBYA 3GMLA 4ZFZA 4CVXA 1YN6A 1ZHLA 3O3AA 4PGCA 1QVOA 5GSRA 5HHQA 3L3GA 3OX8A 3PWPA 3KPNA 3BVNA 2GJ6A 1W72A 3SPVA 3O4LA 1LD9A 4L8DA 3FT4A 1FZJA 1FFPA 3BP4A 2F74A 4QOKA 3QUYA 3TN0A 3RWFA 4JFQA 3QUXA 4WDIA 1YDPA 4LCWA 5F7DA 1AO7A 3P4OA 1XZ0A 4QRQA 4PJXA 1TVHA 4NO3A 5D9SA 4JFDA 3KPMA 5FA4A 2PO6A 3TPUE 3E6HA 3LKSA 4GKSA 3GSVA 4MJ6A 4ELMA 2OI9A 1HHHA 3VFSA 5C0DA 3VXOA 3GMMA 2OL3H 1I7TA 1KPRA 1N59A 1S7WA 3FQTA 2XFXA 4Y4HA 3G08A 4PJ8A 4PGDA 1ZAGA 1JE6A 5C08A 1ZVSA 2E7LE 3REWA 3BEWA 1S7RA 1I4FA 1RJZA 4PJFA 3MREA 4MJIA 3VWJA 3CH1A 3L3JA 1MHCA 3FOMA 4L29A 1HHJA 1WBZA 3VJ6A 3RZCA 5C09A 5GSVA 5C0BA 5INCA 3VFNA 3RWHA 1JF1A 3HCVA 1I1AA 2CKBH 4S0UC 4N8VA 1N2RA 4PREA 3SDXA 3GMOA 3SDCA 2JCCA 1DUYA 5E00A 2CLRA 4N0CA 3O3BA 3WLBA 1AGDA 3C9NA 4PV9A 1QRNA 3MV7A 2BSSA 3V5HA 1ONQA 3TIEA 4ZUWA 3UTTA 1EEYA 3O8XA 5DEFA 1X7QA 2H26A 2X4NA 4Y4KA 4NO2A 3VFTA 3VFRA 3HG1A 5HHOA 4LCCC 1QO3A 4PRHA 4MX7A 5C0EA 3BGMA 3VFMA 1SYSA 1UXWA 5HHNA 1S7SA 3KPLA 4Y2DA 3MRBA 3WS3A 1HHIA 3MRHA 3VRJA 3L3KA 1QSEA 3WL9A 1INQA 3MYJA 3CPLA 4ZUVA 3KPRA 3QEQA 5FA3A 5EU5A 3RWEA 1E27A 3MRCA 1HYRC 3RWJA 5MEOA 3DX8A 3DBXA 1S9YA 1S7VA 3I6KA 5C0JA 5DEGA 5F9JA 3ROOA 3HAEA 1NANH 2BSTA 3VFPA 4D0DA 4E0RA 3QQ4A 3KPQA 5D7JC 3FQXA 1S7UA 3FQUA 4ZAKA 3RWCA 4QRTA 4G8GA 4JFFA 1HSBA 1TVBA 1KJVA 5HHPA 5F1NA 2DYPA 1T1WA 1UQSA 3O9WA 1T7WA 1KPVA 1LP9A 1QSFA 2ZSWA 3ERYA 3MRPA 5C9JA 5MEQA 2X70A 4WUUA 5EOTA 3LKOA 1FZKA 3WUWA 1YPZA 4F7EA 3T8XA 1RK1A 1QR1A 4IHOA 3U0PA 3MR9A 3MRGA 5HGAA 3QFJA 2GT9A 1VADA 3KPSA 4L8SC 1RJYA 3PABA 4L3CA 1XR9A 2X4RA 4G9DA 4HS3A 3MV8A 5D5MA 4HUXA 4LNRA 4XXCA 4U1KA 1CG9A 3KXFA 4FTVA 2HLAA 4HX1A 4HUWA 3LN5A 3IT8D 4K7FA 4O2EA 1I7UA 1LDPH 1W0VA 3CZFA 4L8CA 2VLLA 5IB1A 4WW2C 2VLRA 3JTTA 4G9FA 4JRYA 5SWZA 5IEKA 5IEHA 1ED3A 3O3DA 1G7QA 1T1XA 2X4OA 2VE6A 3ILPA 5HGDA 3QQ3A 4F7CA 1ZSDA 3HE6A 4U6XA 4V3DB 4CW1A 1B0GA 4MNQA 4L9LC 1G7PA 4PG9A 1T0NA 3TO4A 1JFMA 2GTZA 4PG2A 5J6GA 3MRIA 1MI5A 3JVGA 3UTQA 1KBGH 4APQA 3QULA 4PRPA 5DDHA 3QUZA 1WBYA 4IIQC 4MNGA 5JHDA 5MENA 2ZOKA 3KYNA 3LKQA 1KTLA 3KWWA 5D2LA 3VH8A 2HN7A 1OGTA 3P4MA 1AGBA 3KYOA 3HE7A 3VFVA 5F1IA 3TBSA 1TMCA 3FFCA 4PJHA 1VGKA 2AXFA 1DE4A 4PDCE 1FG2A 3MRFA 4PR5A 5IB3A 2H6PA 1T7XA 2FYYA 3GSWA 4PP8C 2GUOA 4GUPA 2XPGA 3LKPA 1YN7A 3TA3A 1I1YA 4QRRA 1JPGA 1OSZA 3E3QA 3TBTA 4NNYA 3GJFA 4D0CA 2Q7YA 3DX7A 1WBXA 3BHBA 5ISZA 5FDWA 1KCGC 3V5DA 1T20A 3OXRA 5HYJA 3PWJA 2FIKA 3L3HA 3MRNA 5INDA 3QDMA 4PJIA 1K8DA 3L3IA 3QDJA 3L3DA 5J1AA 1C16A 3MRLA 1OGAA 1W0WA 2YPKA 4MJ5A 4ONOA 5HGHA 3MGOA 4WU5A 1DDHA 3OV6A 1ZHKA 3D2UA 2YEZA 3I6LD 4WJ5A 2V2WA 3UBXA 2VABA 5BJTA 5EFIA 1JGDA 4LCYA 5B38A 4O2CA 3GMRA 2HJLA 3ARFA 4V3EB 4PJ5A 2NW3A 3B3IA 2FWOA 5MEPA 5B39A 1FFNA 3DMMA 4HV8A 4U1SA 5IVXA 1B3JA 1ZHNA 3FQNA 4WWKC 5EU6A 3BH9A 4FFEX 2AK4A 4MS8A 1HHGA 2FO4A 1RK0A 3DTXA 3SDAA 3VXUA 3QFDA 3B6SA 4JFEA 4G42A 4PRIA 1JGEA 3QZWA 3MROA 1M6OA 2CLZA 4IRJA 3ARBA 3BUYA 1Z5LA 1XR8A 1S7XA 4JQXA 3PWVA 4Y4FA 3JTCA 3FONA 1A6ZA 2GTWA 2BSRA 4QRSA 4NQEA 5BXFA 1T1YA 3BW9A 1N5AA 1T22A 3FTGA 1BD2A 1HOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PWL A;  4ZUS A;  3P4N A;  2V2X A;  1EFX A;  3BP7 A;  3S6C A;  5C07 A;  3GMN A;  4HWZ A;  3UPR A;  3ES6 A;  3VCL A;  1ZT4 A;  3X12 A;  1N3N A;  2PYE A;  4NQD A;  2ESV A;  3M17 A;  3FOL A;  5E8N A;  5EU4 A;  4PGB A;  2VAA A;  3GSN H;  4IRS A;  1FO0 H;  2HJK A;  3ARD A;  3TJH A;  3D18 A;  3OXS A;  3CDG A;  3VXP A;  4N0U A;  3M1B A;  4UQ2 A;  3VXM A;  2BVO A;  4U1I A;  4Y16 A;  5EO0 A;  3RUG A;  1LQV A;  4EI5 A;  1G6R H;  3P9M A;  5J6H A;  1ZS8 A;  4QRU A;  1T7Z A;  1OF2 A;  4HKJ A;  1EEZ A;  1LK2 A;  3X14 A;  3SCM A;  5IB2 A;  1NEZ A;  3GIV A;  1KJ3 H;  3SJV A;  4PRN A;  2X4P A;  3P73 A;  3VXN A;  4G43 A;  1LEK A;  4G59 A;  1BQH A;  3P77 A;  3RGV C;  3GSU A;  4E5X A;  4X6C A;  5EUO A;  3E6F A;  3VRI A;  1AGC A;  5C0I A;  5D7L A;  3TFK A;  4JFP A;  1DUZ A;  1A1N A;  3DX6 A;  3IXA A;  3MRR A;  2YPL A;  4HUU A;  3P9L A;  3BO8 A;  4JQV A;  4MXQ A;  2AKR A;  3VFU A;  3LKR A;  2X4Q A;  2CIK A;  3CCH A;  1B0R A;  4I48 A;  1KPU A;  2BCK A;  1T7V A;  4I4W A;  3X13 A;  1ZHB A;  3GMP A;  3H7B A;  5L2K A;  3W0W A;  3PWN A;  1AKJ A;  1HSA A;  1T0M A;  4PRB A;  4EN3 C;  5C0C A;  3TZV C;  3GSR A;  5C0G A;  4PRD A;  1KJM A;  2AXG A;  3T1F A;  2ZOL A;  1LEG A;  3H9S A;  4PJA A;  1KJ2 H;  1S9X A;  2CII A;  3LKN A;  5ENW A;  3KPP A;  4NHU E;  4NNX A;  5SWS A;  1E28 A;  1S7T A;  5BRZ A;  1AGE A;  5IB5 A;  3HLA A;  1GZP A;  2F54 A;  3MGT A;  3MA7 A;  4F7T A;  3GSO A;  3FRU A;  5IRO A;  1K5N A;  3BH8 A;  3DXA A;  4EUP A;  2AV7 A;  3RWD A;  3TF7 A;  3D25 A;  2CLV A;  5E8P A;  4X6E A;  5E9D A;  4N5E A;  2BNR A;  3CVH A;  1QEW A;  1FZO A;  1SYV A;  2X4U A;  3HUJ A;  5EU3 A;  4NO5 A;  3VFW A;  5ACZ A;  2F53 A;  2P5W A;  3D3V A;  3KPO A;  3WS6 A;  3FT2 A;  2VLK A;  4PJC A;  4O2F A;  2FZ3 A;  3BZF A;  1U58 A;  2VLJ A;  4L3E A;  3FT3 A;  2UWE A;  3KLA A;  4PJE A;  5AD0 A;  5C0F A;  1T21 A;  3ARE A;  5L2J A;  1A1M A;  4PGE A;  4HUV A;  4LHU A;  3GSQ A;  5MER A;  3MRJ A;  5D2N A;  1HHK A;  3VFO A;  4NQV A;  3X11 A;  2P5E A;  4L4T A;  4X6D A;  4Z78 A;  4PV8 A;  1VAC A;  3PQY A;  2X4S A;  3AU1 A;  2BNQ A;  4Z76 A;  1UXS A;  1QLF A;  3ARG A;  1QQD A;  1JPF A;  1S8D A;  4D0B A;  2X4T A;  3RL1 A;  4NQX A;  3BZE A;  1JUF A;  3D39 A;  4JFO A;  5FKP A;  2BVP A;  1NAM H;  1MHE A;  1IM3 A;  3BWA A;  4PRA A;  1S9W A;  2AV1 A;  3VXS A;  3TID A;  3W39 A;  3AM8 A;  1FFO A;  1AGF A;  3L9R A;  5HGB A;  4PJD A;  5IB4 A;  2C7U A;  4PJG A;  3QUK A;  2J8U A;  5E8O A;  1ZT1 A;  3NFN A;  2BVQ A;  4JRX A;  3QI9 A;  3BXN A;  3ILQ C;  1FZM A;  4L4V A;  4WU7 A;  3TBV A;  4QRP A;  4UQ3 A;  5EO1 A;  4GKN A;  3BEV A;  4U1H A;  1A1O A;  1CD1 A;  3H9H A;  3TBW A;  2WY3 A;  2MHA A;  3GSX A;  3JTS A;  1A9E A;  1T1Z A;  4U1M A;  1CE6 A;  1P4L A;  3FQW A;  1I1F A;  3MRM A;  4CVZ A;  1R3H A;  3CC5 A;  4MVB A;  4NQC A;  4U1J A;  3MRQ A;  1T80 A;  1L8J A;  4X6F A;  5C0A A;  4PJ7 A;  1MWA H;  4G8I A;  2RFX A;  3V5K A;  4L8B A;  3MRK A;  3MRD A;  3VWK A;  4PJ9 A;  3RL2 A;  2ZSV A;  4U1L A;  5D7I A;  3RWG A;  1T7Y A;  1S7Q A;  4MQ7 A;  4U6Y A;  5H94 A;  2A83 A;  3LV3 A;  3E2H A;  4N0F A;  1ZT7 A;  3C8K A;  4NT6 A;  3UTS A;  4U1N A;  3RTQ A;  2GAZ A;  1JHT A;  3FQR A;  1Q94 A;  4F7P A;  4NO0 A;  5E6I C;  1PQZ A;  5SWQ A;  1M05 A;  1IM9 A;  3TVM A;  1BZ9 A;  3MV9 A;  3TO2 A;  4ZUT A;  4Z77 A;  3HPJ A;  3O3E A;  3LN4 A;  5HHM A;  4NSK A;  1A9B A;  1XH3 A;  1P7Q A;  1P1Z A;  3RWI A;  3I6G A;  3QDG A;  3ECB A;  3SKO A;  5BS0 A;  1I7R A;  2D31 A;  1GZQ A;  3VXR A;  4PJB A;  4WO4 A;  2GIT A;  2NX5 A;  4F7M A;  1BII A;  3PWU A;  3ROL A;  4K71 B;  3SKM A;  5IM7 A;  3GMQ A;  4ZUU A;  3SDD A;  1EXU A;  3TBY A;  3GML A;  4ZFZ A;  4CVX A;  1YN6 A;  1ZHL A;  3O3A A;  4PGC A;  1QVO A;  5GSR A;  5HHQ A;  3L3G A;  3OX8 A;  3PWP A;  3KPN A;  3BVN A;  2GJ6 A;  1W72 A;  3SPV A;  3O4L A;  1LD9 A;  4L8D A;  3FT4 A;  1FZJ A;  1FFP A;  3BP4 A;  2F74 A;  4QOK A;  3QUY A;  3TN0 A;  3RWF A;  4JFQ A;  3QUX A;  4WDI A;  1YDP A;  4LCW A;  5F7D A;  1AO7 A;  3P4O A;  1XZ0 A;  4QRQ A;  4PJX A;  1TVH A;  4NO3 A;  5D9S A;  4JFD A;  3KPM A;  5FA4 A;  2PO6 A;  3TPU E;  3E6H A;  3LKS A;  4GKS A;  3GSV A;  4MJ6 A;  4ELM A;  2OI9 A;  1HHH A;  3VFS A;  5C0D A;  3VXO A;  3GMM A;  2OL3 H;  1I7T A;  1KPR A;  1N59 A;  1S7W A;  3FQT A;  2XFX A;  4Y4H A;  3G08 A;  4PJ8 A;  4PGD A;  1ZAG A;  1JE6 A;  5C08 A;  1ZVS A;  2E7L E;  3REW A;  3BEW A;  1S7R A;  1I4F A;  1RJZ A;  4PJF A;  3MRE A;  4MJI A;  3VWJ A;  3CH1 A;  3L3J A;  1MHC A;  3FOM A;  4L29 A;  1HHJ A;  1WBZ A;  3VJ6 A;  3RZC A;  5C09 A;  5GSV A;  5C0B A;  5INC A;  3VFN A;  3RWH A;  1JF1 A;  3HCV A;  1I1A A;  2CKB H;  4S0U C;  4N8V A;  1N2R A;  4PRE A;  3SDX A;  3GMO A;  3SDC A;  2JCC A;  1DUY A;  5E00 A;  2CLR A;  4N0C A;  3O3B A;  3WLB A;  1AGD A;  3C9N A;  4PV9 A;  1QRN A;  3MV7 A;  2BSS A;  3V5H A;  1ONQ A;  3TIE A;  4ZUW A;  3UTT A;  1EEY A;  3O8X A;  5DEF A;  1X7Q A;  2H26 A;  2X4N A;  4Y4K A;  4NO2 A;  3VFT A;  3VFR A;  3HG1 A;  5HHO A;  4LCC C;  1QO3 A;  4PRH A;  4MX7 A;  5C0E A;  3BGM A;  3VFM A;  1SYS A;  1UXW A;  5HHN A;  1S7S A;  3KPL A;  4Y2D A;  3MRB A;  3WS3 A;  1HHI A;  3MRH A;  3VRJ A;  3L3K A;  1QSE A;  3WL9 A;  1INQ A;  3MYJ A;  3CPL A;  4ZUV A;  3KPR A;  3QEQ A;  5FA3 A;  5EU5 A;  3RWE A;  1E27 A;  3MRC A;  1HYR C;  3RWJ A;  5MEO A;  3DX8 A;  3DBX A;  1S9Y A;  1S7V A;  3I6K A;  5C0J A;  5DEG A;  5F9J A;  3ROO A;  3HAE A;  1NAN H;  2BST A;  3VFP A;  4D0D A;  4E0R A;  3QQ4 A;  3KPQ A;  5D7J C;  3FQX A;  1S7U A;  3FQU A;  4ZAK A;  3RWC A;  4QRT A;  4G8G A;  4JFF A;  1HSB A;  1TVB A;  1KJV A;  5HHP A;  5F1N A;  2DYP A;  1T1W A;  1UQS A;  3O9W A;  1T7W A;  1KPV A;  1LP9 A;  1QSF A;  2ZSW A;  3ERY A;  3MRP A;  5C9J A;  5MEQ A;  2X70 A;  4WUU A;  5EOT A;  3LKO A;  1FZK A;  3WUW A;  1YPZ A;  4F7E A;  3T8X A;  1RK1 A;  1QR1 A;  4IHO A;  3U0P A;  3MR9 A;  3MRG A;  5HGA A;  3QFJ A;  2GT9 A;  1VAD A;  3KPS A;  4L8S C;  1RJY A;  3PAB A;  4L3C A;  1XR9 A;  2X4R A;  4G9D A;  4HS3 A;  3MV8 A;  5D5M A;  4HUX A;  4LNR A;  4XXC A;  4U1K A;  1CG9 A;  3KXF A;  4FTV A;  2HLA A;  4HX1 A;  4HUW A;  3LN5 A;  3IT8 D;  4K7F A;  4O2E A;  1I7U A;  1LDP H;  1W0V A;  3CZF A;  4L8C A;  2VLL A;  5IB1 A;  4WW2 C;  2VLR A;  3JTT A;  4G9F A;  4JRY A;  5SWZ A;  5IEK A;  5IEH A;  1ED3 A;  3O3D A;  1G7Q A;  1T1X A;  2X4O A;  2VE6 A;  3ILP A;  5HGD A;  3QQ3 A;  4F7C A;  1ZSD A;  3HE6 A;  4U6X A;  4V3D B;  4CW1 A;  1B0G A;  4MNQ A;  4L9L C;  1G7P A;  4PG9 A;  1T0N A;  3TO4 A;  1JFM A;  2GTZ A;  4PG2 A;  5J6G A;  3MRI A;  1MI5 A;  3JVG A;  3UTQ A;  1KBG H;  4APQ A;  3QUL A;  4PRP A;  5DDH A;  3QUZ A;  1WBY A;  4IIQ C;  4MNG A;  5JHD A;  5MEN A;  2ZOK A;  3KYN A;  3LKQ A;  1KTL A;  3KWW A;  5D2L A;  3VH8 A;  2HN7 A;  1OGT A;  3P4M A;  1AGB A;  3KYO A;  3HE7 A;  3VFV A;  5F1I A;  3TBS A;  1TMC A;  3FFC A;  4PJH A;  1VGK A;  2AXF A;  1DE4 A;  4PDC E;  1FG2 A;  3MRF A;  4PR5 A;  5IB3 A;  2H6P A;  1T7X A;  2FYY A;  3GSW A;  4PP8 C;  2GUO A;  4GUP A;  2XPG A;  3LKP A;  1YN7 A;  3TA3 A;  1I1Y A;  4QRR A;  1JPG A;  1OSZ A;  3E3Q A;  3TBT A;  4NNY A;  3GJF A;  4D0C A;  2Q7Y A;  3DX7 A;  1WBX A;  3BHB A;  5ISZ A;  5FDW A;  1KCG C;  3V5D A;  1T20 A;  3OXR A;  5HYJ A;  3PWJ A;  2FIK A;  3L3H A;  3MRN A;  5IND A;  3QDM A;  4PJI A;  1K8D A;  3L3I A;  3QDJ A;  3L3D A;  5J1A A;  1C16 A;  3MRL A;  1OGA A;  1W0W A;  2YPK A;  4MJ5 A;  4ONO A;  5HGH A;  3MGO A;  4WU5 A;  1DDH A;  3OV6 A;  1ZHK A;  3D2U A;  2YEZ A;  3I6L D;  4WJ5 A;  2V2W A;  3UBX A;  2VAB A;  5BJT A;  5EFI A;  1JGD A;  4LCY A;  5B38 A;  4O2C A;  3GMR A;  2HJL A;  3ARF A;  4V3E B;  4PJ5 A;  2NW3 A;  3B3I A;  2FWO A;  5MEP A;  5B39 A;  1FFN A;  3DMM A;  4HV8 A;  4U1S A;  5IVX A;  1B3J A;  1ZHN A;  3FQN A;  4WWK C;  5EU6 A;  3BH9 A;  4FFE X;  2AK4 A;  4MS8 A;  1HHG A;  2FO4 A;  1RK0 A;  3DTX A;  3SDA A;  3VXU A;  3QFD A;  3B6S A;  4JFE A;  4G42 A;  4PRI A;  1JGE A;  3QZW A;  3MRO A;  1M6O A;  2CLZ A;  4IRJ A;  3ARB A;  3BUY A;  1Z5L A;  1XR8 A;  1S7X A;  4JQX A;  3PWV A;  4Y4F A;  3JTC A;  3FON A;  1A6Z A;  2GTW A;  2BSR A;  4QRS A;  4NQE A;  5BXF A;  1T1Y A;  3BW9 A;  1N5A A;  1T22 A;  3FTG A;  1BD2 A;  1HOC A; 
#chains in the Genus database with same CATH topology
 3PWL A;  4ZUS A;  3P4N A;  2V2X A;  1EFX A;  3BP7 A;  3S6C A;  5C07 A;  3GMN A;  4HWZ A;  3UPR A;  3ES6 A;  3VCL A;  1ZT4 A;  3X12 A;  1N3N A;  2PYE A;  4NQD A;  2ESV A;  3M17 A;  3FOL A;  5E8N A;  5EU4 A;  4PGB A;  2VAA A;  3GSN H;  4IRS A;  1FO0 H;  2HJK A;  3ARD A;  3TJH A;  3D18 A;  3OXS A;  3CDG A;  3VXP A;  4N0U A;  3M1B A;  4UQ2 A;  3VXM A;  2BVO A;  4U1I A;  4Y16 A;  5EO0 A;  3RUG A;  1LQV A;  4EI5 A;  1G6R H;  3I0T A;  3P9M A;  5J6H A;  1ZS8 A;  4QRU A;  1T7Z A;  1OF2 A;  4HKJ A;  1EEZ A;  1LK2 A;  3X14 A;  3SCM A;  5IB2 A;  1NEZ A;  3GIV A;  4BKW A;  1KJ3 H;  3SJV A;  4PRN A;  2X4P A;  3P73 A;  3VXN A;  4G43 A;  1LEK A;  4G59 A;  1BQH A;  3P77 A;  3RGV C;  3GSU A;  4E5X A;  4X6C A;  5EUO A;  3E6F A;  3VRI A;  1AGC A;  5C0I A;  5D7L A;  3TFK A;  4JFP A;  1DUZ A;  1A1N A;  3DX6 A;  3IXA A;  3MRR A;  2YPL A;  4HUU A;  3P9L A;  3BO8 A;  4JQV A;  4MXQ A;  2AKR A;  3VFU A;  3LKR A;  2X4Q A;  2CIK A;  3CCH A;  1B0R A;  4I48 A;  1KPU A;  2BCK A;  1T7V A;  4I4W A;  3X13 A;  1ZHB A;  3GMP A;  3H7B A;  5L2K A;  3W0W A;  3PWN A;  1AKJ A;  1HSA A;  1T0M A;  4PRB A;  4EN3 C;  5C0C A;  3TZV C;  3GSR A;  5C0G A;  4PRD A;  1KJM A;  2AXG A;  3T1F A;  2ZOL A;  1LEG A;  3H9S A;  4PJA A;  1KJ2 H;  1S9X A;  2CII A;  3LKN A;  5ENW A;  3KPP A;  4NHU E;  4NNX A;  5SWS A;  1E28 A;  1S7T A;  5BRZ A;  1AGE A;  5IB5 A;  3HLA A;  1GZP A;  2F54 A;  3MGT A;  3MA7 A;  4F7T A;  3GSO A;  3FRU A;  5IRO A;  1K5N A;  3BH8 A;  3DXA A;  4EUP A;  2AV7 A;  3RWD A;  3TF7 A;  3D25 A;  2CLV A;  5E8P A;  4X6E A;  5E9D A;  4N5E A;  2BNR A;  3CVH A;  1QEW A;  1FZO A;  1SYV A;  2X4U A;  3HUJ A;  5EU3 A;  4NO5 A;  3VFW A;  5ACZ A;  2F53 A;  2P5W A;  3D3V A;  3KPO A;  3WS6 A;  3FT2 A;  2VLK A;  4PJC A;  4O2F A;  2FZ3 A;  3BZF A;  1U58 A;  2VLJ A;  4L3E A;  3FT3 A;  2UWE A;  3KLA A;  4PJE A;  5AD0 A;  5C0F A;  1T21 A;  3ARE A;  5L2J A;  1A1M A;  4PGE A;  4HUV A;  4LHU A;  3GSQ A;  5MER A;  3MRJ A;  5D2N A;  1HHK A;  3VFO A;  4NQV A;  3X11 A;  2P5E A;  4L4T A;  4X6D A;  4Z78 A;  4PV8 A;  1VAC A;  3PQY A;  2X4S A;  3AU1 A;  2BNQ A;  4Z76 A;  1UXS A;  1QLF A;  3ARG A;  1QQD A;  1JPF A;  1S8D A;  4D0B A;  2X4T A;  3RL1 A;  4NQX A;  3BZE A;  1JUF A;  3D39 A;  4JFO A;  5FKP A;  2BVP A;  1NAM H;  1MHE A;  1IM3 A;  3BWA A;  4PRA A;  1S9W A;  2AV1 A;  3VXS A;  3TID A;  3W39 A;  3AM8 A;  1FFO A;  1AGF A;  3L9R A;  5HGB A;  4PJD A;  5IB4 A;  2C7U A;  4PJG A;  3QUK A;  2J8U A;  5E8O A;  1ZT1 A;  3NFN A;  2BVQ A;  4JRX A;  3QI9 A;  3BXN A;  3ILQ C;  1FZM A;  4L4V A;  4WU7 A;  3TBV A;  4QRP A;  4UQ3 A;  5EO1 A;  4GKN A;  3BEV A;  4U1H A;  1A1O A;  1CD1 A;  3H9H A;  3TBW A;  2WY3 A;  2MHA A;  3GSX A;  3JTS A;  1A9E A;  1T1Z A;  4U1M A;  1CE6 A;  1P4L A;  3FQW A;  1I1F A;  3MRM A;  4CVZ A;  1R3H A;  3CC5 A;  4MVB A;  4NQC A;  4U1J A;  3MRQ A;  1T80 A;  1L8J A;  4X6F A;  5C0A A;  4PJ7 A;  1MWA H;  4G8I A;  2RFX A;  3V5K A;  4L8B A;  3MRK A;  3MRD A;  3VWK A;  4PJ9 A;  3RL2 A;  2ZSV A;  4U1L A;  5D7I A;  3RWG A;  1T7Y A;  1S7Q A;  4MQ7 A;  4U6Y A;  5H94 A;  2A83 A;  3LV3 A;  3E2H A;  4N0F A;  1ZT7 A;  3C8K A;  4NT6 A;  3UTS A;  4U1N A;  3RTQ A;  2GAZ A;  1JHT A;  3FQR A;  1Q94 A;  4F7P A;  4NO0 A;  5E6I C;  1PQZ A;  5SWQ A;  1M05 A;  1IM9 A;  3TVM A;  1BZ9 A;  3MV9 A;  3TO2 A;  4ZUT A;  4Z77 A;  3HPJ A;  3O3E A;  3LN4 A;  5HHM A;  4NSK A;  1A9B A;  1XH3 A;  1P7Q A;  1P1Z A;  3RWI A;  3I6G A;  3QDG A;  3ECB A;  3SKO A;  5BS0 A;  1I7R A;  2D31 A;  1GZQ A;  3VXR A;  4PJB A;  4WO4 A;  2GIT A;  2NX5 A;  4F7M A;  1BII A;  3PWU A;  3ROL A;  4K71 B;  3SKM A;  5IM7 A;  3GMQ A;  4ZUU A;  3SDD A;  1EXU A;  3TBY A;  3GML A;  4ZFZ A;  4CVX A;  1YN6 A;  1ZHL A;  3O3A A;  4PGC A;  1QVO A;  5GSR A;  5HHQ A;  3L3G A;  3OX8 A;  3PWP A;  3KPN A;  3BVN A;  2GJ6 A;  1W72 A;  3SPV A;  3O4L A;  1LD9 A;  4L8D A;  3FT4 A;  1FZJ A;  1FFP A;  3BP4 A;  2F74 A;  4QOK A;  3QUY A;  3TN0 A;  3RWF A;  4JFQ A;  3QUX A;  4WDI A;  1YDP A;  4LCW A;  5F7D A;  1AO7 A;  3P4O A;  1XZ0 A;  4QRQ A;  4PJX A;  1TVH A;  4NO3 A;  5D9S A;  4JFD A;  3KPM A;  5FA4 A;  2PO6 A;  3TPU E;  3E6H A;  3LKS A;  4GKS A;  3GSV A;  4MJ6 A;  4ELM A;  2OI9 A;  1HHH A;  3VFS A;  5C0D A;  3VXO A;  3GMM A;  2OL3 H;  1I7T A;  1KPR A;  1N59 A;  1S7W A;  3FQT A;  2XFX A;  4Y4H A;  3G08 A;  4PJ8 A;  4PGD A;  2IA1 A;  1ZAG A;  1JE6 A;  5C08 A;  1ZVS A;  2E7L E;  3REW A;  3BEW A;  1S7R A;  1I4F A;  1RJZ A;  4PJF A;  3MRE A;  4MJI A;  3VWJ A;  3CH1 A;  3L3J A;  1MHC A;  3FOM A;  4L29 A;  1HHJ A;  1WBZ A;  3VJ6 A;  3RZC A;  5C09 A;  5GSV A;  5C0B A;  5INC A;  3VFN A;  3RWH A;  1JF1 A;  3HCV A;  1I1A A;  2CKB H;  4S0U C;  4N8V A;  1N2R A;  4PRE A;  2O5N A;  3GMO A;  3SDC A;  3SDX A;  2JCC A;  1DUY A;  5E00 A;  2CLR A;  4N0C A;  3O3B A;  3WLB A;  1AGD A;  3C9N A;  4PV9 A;  1QRN A;  3MV7 A;  2BSS A;  3V5H A;  1ONQ A;  3TIE A;  4ZUW A;  3UTT A;  1EEY A;  3O8X A;  5DEF A;  1X7Q A;  2NYK A;  2H26 A;  2X4N A;  4Y4K A;  4NO2 A;  3VFT A;  3VFR A;  3HG1 A;  5HHO A;  4LCC C;  1QO3 A;  4PRH A;  4MX7 A;  5C0E A;  3BGM A;  3VFM A;  1SYS A;  1UXW A;  5HHN A;  1S7S A;  3KPL A;  4Y2D A;  3MRB A;  3WS3 A;  1HHI A;  3MRH A;  3VRJ A;  3L3K A;  1QSE A;  3WL9 A;  1INQ A;  3MYJ A;  3CPL A;  4ZUV A;  3KPR A;  3QEQ A;  5FA3 A;  5EU5 A;  3RWE A;  1E27 A;  3MRC A;  1HYR C;  3RWJ A;  5MEO A;  3DX8 A;  3DBX A;  1S9Y A;  1S7V A;  3I6K A;  5C0J A;  5DEG A;  5F9J A;  3ROO A;  3HAE A;  1NAN H;  2BST A;  3VFP A;  4D0D A;  4E0R A;  3QQ4 A;  3KPQ A;  5D7J C;  3FQX A;  1S7U A;  3FQU A;  4ZAK A;  3RWC A;  4QRT A;  4G8G A;  4JFF A;  1HSB A;  1TVB A;  1KJV A;  5HHP A;  5F1N A;  2DYP A;  1T1W A;  1UQS A;  3O9W A;  1T7W A;  1KPV A;  1LP9 A;  1QSF A;  2ZSW A;  3ERY A;  3MRP A;  5C9J A;  5MEQ A;  2X70 A;  4JO8 A;  4WUU A;  5EOT A;  3LKO A;  1FZK A;  3WUW A;  1YPZ A;  4F7E A;  3T8X A;  1RK1 A;  1QR1 A;  4IHO A;  3U0P A;  3MR9 A;  3MRG A;  5HGA A;  3QFJ A;  2GT9 A;  1VAD A;  3KPS A;  4L8S C;  1RJY A;  3PAB A;  4L3C A;  1XR9 A;  2X4R A;  4G9D A;  4HS3 A;  3MV8 A;  5D5M A;  4HUX A;  4LNR A;  4XXC A;  4U1K A;  1CG9 A;  3KXF A;  4FTV A;  2HLA A;  4HX1 A;  4HUW A;  3LN5 A;  3IT8 D;  4K7F A;  4O2E A;  1I7U A;  1LDP H;  1W0V A;  3CZF A;  4L8C A;  2VLL A;  5IB1 A;  4WW2 C;  2VLR A;  4G59 C;  3JTT A;  4G9F A;  4JRY A;  5SWZ A;  5IEK A;  5IEH A;  1ED3 A;  3O3D A;  1G7Q A;  1T1X A;  2X4O A;  2VE6 A;  3ILP A;  5HGD A;  3QQ3 A;  4F7C A;  1ZSD A;  3HE6 A;  4U6X A;  4V3D B;  4CW1 A;  1B0G A;  4MNQ A;  4L9L C;  1G7P A;  4PG9 A;  1T0N A;  3TO4 A;  1JFM A;  2GTZ A;  4PG2 A;  5J6G A;  3MRI A;  1MI5 A;  3JVG A;  3UTQ A;  1KBG H;  4APQ A;  3QUL A;  4PRP A;  5DDH A;  3QUZ A;  1WBY A;  4IIQ C;  4MNG A;  5JHD A;  5MEN A;  2ZOK A;  3KYN A;  3LKQ A;  1KTL A;  3KWW A;  5D2L A;  3VH8 A;  2HN7 A;  1OGT A;  3P4M A;  1AGB A;  3KYO A;  3HE7 A;  3VFV A;  5F1I A;  3TBS A;  1TMC A;  3FFC A;  4PJH A;  1VGK A;  2AXF A;  1DE4 A;  4PDC E;  1FG2 A;  3MRF A;  4PR5 A;  5IB3 A;  2H6P A;  1T7X A;  2FYY A;  3GSW A;  4PP8 C;  2GUO A;  4GUP A;  2XPG A;  3LKP A;  1YN7 A;  3TA3 A;  1I1Y A;  4QRR A;  1JPG A;  1OSZ A;  3E3Q A;  3TBT A;  4NNY A;  3GJF A;  4D0C A;  2Q7Y A;  3DX7 A;  1WBX A;  3BHB A;  5ISZ A;  5FDW A;  1KCG C;  3V5D A;  1T20 A;  3OXR A;  5HYJ A;  3PWJ A;  2FIK A;  3L3H A;  3MRN A;  5IND A;  3QDM A;  4PJI A;  1K8D A;  3L3I A;  3QDJ A;  3L3D A;  5J1A A;  1C16 A;  3MRL A;  1OGA A;  1W0W A;  2YPK A;  4MJ5 A;  4ONO A;  5HGH A;  3MGO A;  4WU5 A;  1DDH A;  3OV6 A;  1ZHK A;  3D2U A;  2YEZ A;  3I6L D;  4WJ5 A;  2V2W A;  3UBX A;  2VAB A;  5BJT A;  5EFI A;  1JGD A;  4LCY A;  5B38 A;  4O2C A;  3GMR A;  2HJL A;  3ARF A;  4V3E B;  4PJ5 A;  2NW3 A;  3B3I A;  2FWO A;  5MEP A;  5B39 A;  1FFN A;  3DMM A;  4HV8 A;  4U1S A;  5IVX A;  1B3J A;  1ZHN A;  3FQN A;  4WWK C;  5EU6 A;  3BH9 A;  4FFE X;  2AK4 A;  4MS8 A;  1HHG A;  2FO4 A;  1RK0 A;  3DTX A;  3SDA A;  3VXU A;  3QFD A;  3B6S A;  4JFE A;  4G42 A;  4PRI A;  1JGE A;  3QZW A;  3MRO A;  1M6O A;  2CLZ A;  4IRJ A;  3ARB A;  3BUY A;  1Z5L A;  1XR8 A;  1S7X A;  4JQX A;  3PWV A;  4Y4F A;  3JTC A;  3FON A;  1A6Z A;  2GTW A;  2BSR A;  4QRS A;  4NQE A;  5BXF A;  1T1Y A;  3BW9 A;  1N5A A;  1T22 A;  3FTG A;  1BD2 A;  1HOC A; 
#chains in the Genus database with same CATH homology
 3PWL A;  4ZUS A;  3P4N A;  2V2X A;  1EFX A;  3BP7 A;  3S6C A;  5C07 A;  3GMN A;  4HWZ A;  3UPR A;  3ES6 A;  3VCL A;  1ZT4 A;  3X12 A;  1N3N A;  2PYE A;  4NQD A;  2ESV A;  3M17 A;  3FOL A;  5E8N A;  5EU4 A;  4PGB A;  2VAA A;  3GSN H;  4IRS A;  1FO0 H;  2HJK A;  3ARD A;  3TJH A;  3D18 A;  3OXS A;  3CDG A;  3VXP A;  4N0U A;  3M1B A;  4UQ2 A;  3VXM A;  2BVO A;  4U1I A;  4Y16 A;  5EO0 A;  3RUG A;  1LQV A;  4EI5 A;  1G6R H;  3P9M A;  5J6H A;  1ZS8 A;  4QRU A;  1T7Z A;  1OF2 A;  4HKJ A;  1EEZ A;  1LK2 A;  3X14 A;  3SCM A;  5IB2 A;  1NEZ A;  3GIV A;  1KJ3 H;  3SJV A;  4PRN A;  2X4P A;  3P73 A;  3VXN A;  4G43 A;  1LEK A;  4G59 A;  1BQH A;  3P77 A;  3RGV C;  3GSU A;  4E5X A;  4X6C A;  5EUO A;  3E6F A;  3VRI A;  1AGC A;  5C0I A;  5D7L A;  3TFK A;  4JFP A;  1DUZ A;  1A1N A;  3DX6 A;  3IXA A;  3MRR A;  2YPL A;  4HUU A;  3P9L A;  3BO8 A;  4JQV A;  4MXQ A;  2AKR A;  3VFU A;  3LKR A;  2X4Q A;  2CIK A;  3CCH A;  1B0R A;  4I48 A;  1KPU A;  2BCK A;  1T7V A;  4I4W A;  3X13 A;  1ZHB A;  3GMP A;  3H7B A;  5L2K A;  3W0W A;  3PWN A;  1AKJ A;  1HSA A;  1T0M A;  4PRB A;  4EN3 C;  5C0C A;  3TZV C;  3GSR A;  5C0G A;  4PRD A;  1KJM A;  2AXG A;  3T1F A;  2ZOL A;  1LEG A;  3H9S A;  4PJA A;  1KJ2 H;  1S9X A;  2CII A;  3LKN A;  5ENW A;  3KPP A;  4NHU E;  4NNX A;  5SWS A;  1E28 A;  1S7T A;  5BRZ A;  1AGE A;  5IB5 A;  3HLA A;  1GZP A;  2F54 A;  3MGT A;  3MA7 A;  4F7T A;  3GSO A;  3FRU A;  5IRO A;  1K5N A;  3BH8 A;  3DXA A;  4EUP A;  2AV7 A;  3RWD A;  3TF7 A;  3D25 A;  2CLV A;  5E8P A;  4X6E A;  5E9D A;  4N5E A;  2BNR A;  3CVH A;  1QEW A;  1FZO A;  1SYV A;  2X4U A;  3HUJ A;  5EU3 A;  4NO5 A;  3VFW A;  5ACZ A;  2F53 A;  2P5W A;  3D3V A;  3KPO A;  3WS6 A;  3FT2 A;  2VLK A;  4PJC A;  4O2F A;  2FZ3 A;  3BZF A;  1U58 A;  2VLJ A;  4L3E A;  3FT3 A;  2UWE A;  3KLA A;  4PJE A;  5AD0 A;  5C0F A;  1T21 A;  3ARE A;  5L2J A;  1A1M A;  4PGE A;  4HUV A;  4LHU A;  3GSQ A;  5MER A;  3MRJ A;  5D2N A;  1HHK A;  3VFO A;  4NQV A;  3X11 A;  2P5E A;  4L4T A;  4X6D A;  4Z78 A;  4PV8 A;  1VAC A;  3PQY A;  2X4S A;  3AU1 A;  2BNQ A;  4Z76 A;  1UXS A;  1QLF A;  3ARG A;  1QQD A;  1JPF A;  1S8D A;  4D0B A;  2X4T A;  3RL1 A;  4NQX A;  3BZE A;  1JUF A;  3D39 A;  4JFO A;  5FKP A;  2BVP A;  1NAM H;  1MHE A;  1IM3 A;  3BWA A;  4PRA A;  1S9W A;  2AV1 A;  3VXS A;  3TID A;  3W39 A;  3AM8 A;  1FFO A;  1AGF A;  3L9R A;  5HGB A;  4PJD A;  5IB4 A;  2C7U A;  4PJG A;  3QUK A;  2J8U A;  5E8O A;  1ZT1 A;  3NFN A;  2BVQ A;  4JRX A;  3QI9 A;  3BXN A;  3ILQ C;  1FZM A;  4L4V A;  4WU7 A;  3TBV A;  4QRP A;  4UQ3 A;  5EO1 A;  4GKN A;  3BEV A;  4U1H A;  1A1O A;  1CD1 A;  3H9H A;  3TBW A;  2WY3 A;  2MHA A;  3GSX A;  3JTS A;  1A9E A;  1T1Z A;  4U1M A;  1CE6 A;  1P4L A;  3FQW A;  1I1F A;  3MRM A;  4CVZ A;  1R3H A;  3CC5 A;  4MVB A;  4NQC A;  4U1J A;  3MRQ A;  1T80 A;  1L8J A;  4X6F A;  5C0A A;  4PJ7 A;  1MWA H;  4G8I A;  2RFX A;  3V5K A;  4L8B A;  3MRK A;  3MRD A;  3VWK A;  4PJ9 A;  3RL2 A;  2ZSV A;  4U1L A;  5D7I A;  3RWG A;  1T7Y A;  1S7Q A;  4MQ7 A;  4U6Y A;  5H94 A;  2A83 A;  3LV3 A;  3E2H A;  4N0F A;  1ZT7 A;  3C8K A;  4NT6 A;  3UTS A;  4U1N A;  3RTQ A;  2GAZ A;  1JHT A;  3FQR A;  1Q94 A;  4F7P A;  4NO0 A;  5E6I C;  1PQZ A;  5SWQ A;  1M05 A;  1IM9 A;  3TVM A;  1BZ9 A;  3MV9 A;  3TO2 A;  4ZUT A;  4Z77 A;  3HPJ A;  3O3E A;  3LN4 A;  5HHM A;  4NSK A;  1A9B A;  1XH3 A;  1P7Q A;  1P1Z A;  3RWI A;  3I6G A;  3QDG A;  3ECB A;  3SKO A;  5BS0 A;  1I7R A;  2D31 A;  1GZQ A;  3VXR A;  4PJB A;  4WO4 A;  2GIT A;  2NX5 A;  4F7M A;  1BII A;  3PWU A;  3ROL A;  4K71 B;  3SKM A;  5IM7 A;  3GMQ A;  4ZUU A;  3SDD A;  1EXU A;  3TBY A;  3GML A;  4ZFZ A;  4CVX A;  1YN6 A;  1ZHL A;  3O3A A;  4PGC A;  1QVO A;  5GSR A;  5HHQ A;  3L3G A;  3OX8 A;  3PWP A;  3KPN A;  3BVN A;  2GJ6 A;  1W72 A;  3SPV A;  3O4L A;  1LD9 A;  4L8D A;  3FT4 A;  1FZJ A;  1FFP A;  3BP4 A;  2F74 A;  4QOK A;  3QUY A;  3TN0 A;  3RWF A;  4JFQ A;  3QUX A;  4WDI A;  1YDP A;  4LCW A;  5F7D A;  1AO7 A;  3P4O A;  1XZ0 A;  4QRQ A;  4PJX A;  1TVH A;  4NO3 A;  5D9S A;  4JFD A;  3KPM A;  5FA4 A;  2PO6 A;  3TPU E;  3E6H A;  3LKS A;  4GKS A;  3GSV A;  4MJ6 A;  4ELM A;  2OI9 A;  1HHH A;  3VFS A;  5C0D A;  3VXO A;  3GMM A;  2OL3 H;  1I7T A;  1KPR A;  1N59 A;  1S7W A;  3FQT A;  2XFX A;  4Y4H A;  3G08 A;  4PJ8 A;  4PGD A;  1ZAG A;  1JE6 A;  5C08 A;  1ZVS A;  2E7L E;  3REW A;  3BEW A;  1S7R A;  1I4F A;  1RJZ A;  4PJF A;  3MRE A;  4MJI A;  3VWJ A;  3CH1 A;  3L3J A;  1MHC A;  3FOM A;  4L29 A;  1HHJ A;  1WBZ A;  3VJ6 A;  3RZC A;  5C09 A;  5GSV A;  5C0B A;  5INC A;  3VFN A;  3RWH A;  1JF1 A;  3HCV A;  1I1A A;  2CKB H;  4S0U C;  4N8V A;  1N2R A;  4PRE A;  3SDX A;  3GMO A;  3SDC A;  2JCC A;  1DUY A;  5E00 A;  2CLR A;  4N0C A;  3O3B A;  3WLB A;  1AGD A;  3C9N A;  4PV9 A;  1QRN A;  3MV7 A;  2BSS A;  3V5H A;  1ONQ A;  3TIE A;  4ZUW A;  3UTT A;  1EEY A;  3O8X A;  5DEF A;  1X7Q A;  2H26 A;  2X4N A;  4Y4K A;  4NO2 A;  3VFT A;  3VFR A;  3HG1 A;  5HHO A;  4LCC C;  1QO3 A;  4PRH A;  4MX7 A;  5C0E A;  3BGM A;  3VFM A;  1SYS A;  1UXW A;  5HHN A;  1S7S A;  3KPL A;  4Y2D A;  3MRB A;  3WS3 A;  1HHI A;  3MRH A;  3VRJ A;  3L3K A;  1QSE A;  3WL9 A;  1INQ A;  3MYJ A;  3CPL A;  4ZUV A;  3KPR A;  3QEQ A;  5FA3 A;  5EU5 A;  3RWE A;  1E27 A;  3MRC A;  1HYR C;  3RWJ A;  5MEO A;  3DX8 A;  3DBX A;  1S9Y A;  1S7V A;  3I6K A;  5C0J A;  5DEG A;  5F9J A;  3ROO A;  3HAE A;  1NAN H;  2BST A;  3VFP A;  4D0D A;  4E0R A;  3QQ4 A;  3KPQ A;  5D7J C;  3FQX A;  1S7U A;  3FQU A;  4ZAK A;  3RWC A;  4QRT A;  4G8G A;  4JFF A;  1HSB A;  1TVB A;  1KJV A;  5HHP A;  5F1N A;  2DYP A;  1T1W A;  1UQS A;  3O9W A;  1T7W A;  1KPV A;  1LP9 A;  1QSF A;  2ZSW A;  3ERY A;  3MRP A;  5C9J A;  5MEQ A;  2X70 A;  4WUU A;  5EOT A;  3LKO A;  1FZK A;  3WUW A;  1YPZ A;  4F7E A;  3T8X A;  1RK1 A;  1QR1 A;  4IHO A;  3U0P A;  3MR9 A;  3MRG A;  5HGA A;  3QFJ A;  2GT9 A;  1VAD A;  3KPS A;  4L8S C;  1RJY A;  3PAB A;  4L3C A;  1XR9 A;  2X4R A;  4G9D A;  4HS3 A;  3MV8 A;  5D5M A;  4HUX A;  4LNR A;  4XXC A;  4U1K A;  1CG9 A;  3KXF A;  4FTV A;  2HLA A;  4HX1 A;  4HUW A;  3LN5 A;  3IT8 D;  4K7F A;  4O2E A;  1I7U A;  1LDP H;  1W0V A;  3CZF A;  4L8C A;  2VLL A;  5IB1 A;  4WW2 C;  2VLR A;  3JTT A;  4G9F A;  4JRY A;  5SWZ A;  5IEK A;  5IEH A;  1ED3 A;  3O3D A;  1G7Q A;  1T1X A;  2X4O A;  2VE6 A;  3ILP A;  5HGD A;  3QQ3 A;  4F7C A;  1ZSD A;  3HE6 A;  4U6X A;  4V3D B;  4CW1 A;  1B0G A;  4MNQ A;  4L9L C;  1G7P A;  4PG9 A;  1T0N A;  3TO4 A;  1JFM A;  2GTZ A;  4PG2 A;  5J6G A;  3MRI A;  1MI5 A;  3JVG A;  3UTQ A;  1KBG H;  4APQ A;  3QUL A;  4PRP A;  5DDH A;  3QUZ A;  1WBY A;  4IIQ C;  4MNG A;  5JHD A;  5MEN A;  2ZOK A;  3KYN A;  3LKQ A;  1KTL A;  3KWW A;  5D2L A;  3VH8 A;  2HN7 A;  1OGT A;  3P4M A;  1AGB A;  3KYO A;  3HE7 A;  3VFV A;  5F1I A;  3TBS A;  1TMC A;  3FFC A;  4PJH A;  1VGK A;  2AXF A;  1DE4 A;  4PDC E;  1FG2 A;  3MRF A;  4PR5 A;  5IB3 A;  2H6P A;  1T7X A;  2FYY A;  3GSW A;  4PP8 C;  2GUO A;  4GUP A;  2XPG A;  3LKP A;  1YN7 A;  3TA3 A;  1I1Y A;  4QRR A;  1JPG A;  1OSZ A;  3E3Q A;  3TBT A;  4NNY A;  3GJF A;  4D0C A;  2Q7Y A;  3DX7 A;  1WBX A;  3BHB A;  5ISZ A;  5FDW A;  1KCG C;  3V5D A;  1T20 A;  3OXR A;  5HYJ A;  3PWJ A;  2FIK A;  3L3H A;  3MRN A;  5IND A;  3QDM A;  4PJI A;  1K8D A;  3L3I A;  3QDJ A;  3L3D A;  5J1A A;  1C16 A;  3MRL A;  1OGA A;  1W0W A;  2YPK A;  4MJ5 A;  4ONO A;  5HGH A;  3MGO A;  4WU5 A;  1DDH A;  3OV6 A;  1ZHK A;  3D2U A;  2YEZ A;  3I6L D;  4WJ5 A;  2V2W A;  3UBX A;  2VAB A;  5BJT A;  5EFI A;  1JGD A;  4LCY A;  5B38 A;  4O2C A;  3GMR A;  2HJL A;  3ARF A;  4V3E B;  4PJ5 A;  2NW3 A;  3B3I A;  2FWO A;  5MEP A;  5B39 A;  1FFN A;  3DMM A;  4HV8 A;  4U1S A;  5IVX A;  1B3J A;  1ZHN A;  3FQN A;  4WWK C;  5EU6 A;  3BH9 A;  4FFE X;  2AK4 A;  4MS8 A;  1HHG A;  2FO4 A;  1RK0 A;  3DTX A;  3SDA A;  3VXU A;  3QFD A;  3B6S A;  4JFE A;  4G42 A;  4PRI A;  1JGE A;  3QZW A;  3MRO A;  1M6O A;  2CLZ A;  4IRJ A;  3ARB A;  3BUY A;  1Z5L A;  1XR8 A;  1S7X A;  4JQX A;  3PWV A;  4Y4F A;  3JTC A;  3FON A;  1A6Z A;  2GTW A;  2BSR A;  4QRS A;  4NQE A;  5BXF A;  1T1Y A;  3BW9 A;  1N5A A;  1T22 A;  3FTG A;  1BD2 A;  1HOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...