4MXVF

Structure of lymphotoxin alpha bound to anti-lta fab
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
213
structure length
213
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGYTFTSYVIHWVRQAPGKGLEWVGYNNPYNAGTNYNEKFKGRFTISSDKSKNTAYLQMNSLRAEDTAVYYCSRPTMLPWFAYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphotoxin-alpha
publication title Dimerization of LT beta R by LT alpha 1 beta 2 is necessary and sufficient for signal transduction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 34
structure length 213
sequence length 213
chains with identical sequence H, Y
ec nomenclature
pdb deposition date 2013-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mxvF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mxvF01
1K3IA 2PTTA 1J5OL 4MHHI 5T33L 4RRPA 5EU4B 4HJ0D 5FM5O 5CP3H 4B53A 4ZUSB 4HUNB 4D9LL 4PBXA 2PXYA 1B6UA 3X3FL 4OM1L 3ZT5A 5D1QB 3FJTA 1AO7E 4PJBB 5F8QC 4OLWL 1MCPL 4NM8H 4YBQD 3DXAB 4PJEA 4I0CC 2VR9A 5AUMA 2CLZA 2FD6L 4H1LH 4YIQB 3STBA 2A9NH 4PS4H 5JIHA 5BOPA 4EKXA 4Y5VB 4LGPB 5EULV 1P69B 2I27N 5KZCB 3D3VA 1WFTA 3MODL 4KK6C 2OL3A 5D1ZD 3VXRD 5JXEA 1WZ1L 4F9LA 1KTLA 4NQVA 5GGVH 4NBYB 1KF9B 4LGSB 1YYLL 1D7FA 5A1AA 2BRQA 12E8H 3ULUF 3RGVA 5AWNL 4YHYB 3MRJA 3L7EB 3HCVA 3VXSB 2HTLC 4DVBA 3CDFA 1FNSH 2BFVL 3SPVB 3QJFB 4RFNC 1V7ML 3RIAK 1EEYB 4KV5E 4JCLA 1U9KA 1A64A 1J0KA 3P4OA 4Z9KB 1J1OH 2ZCKL 4M48H 3B9KD 5EUOE 4Q74A 2DJUA 1BGXL 5E24E 4XPHL 1I7RB 3ARGD 2A77L 1AQDB 4X9BA 5GHWH 4NCC1 1MCNA 4I0PD 2CR3A 2Q7NA 2J88H 3OJDA 5KN5B 2VWEE 4FZEH 3DTXB 1MUJA 2CKBH 2VDRH 4NC0B 4P23A 4V1DE 1CTOA 2D9QB 2VAJA 2G75A 5DJCA 4X5XB 4N8PA 3UXFA 3VWJA 1LEIB 5C09E 1I1RA 1HDMA 1A6ZB 4L3EE 1HH6A 4AT6A 5BV7C 1C08A 2FBOJ 4OFVA 4EUPH 2R2HB 4KROB 3KNBB 3QO1B 3R06A 4G8FB 5J9PB 1FYTA 2B7DT 4NM8L 4NKDB 3ESVF 2VITB 3LS5H 1OAZL 2W60B 3O9WA 4L8BA 2A9NL 4PS4L 5I8CA 5E00A 3B8SA 3LHPH 3QXDB 4XHQA 1BPVA 1YECH 1QZ1A 3EOTH 2UWEB 1FAIH 5TFSH 4U49A 4LRIC 4JKWA 4W68A 5GGVL 3HE7B 1JGDB 4P2QE 3OJ2C 1KT2B 4NNXA 4FXLA 12E8L 2FZ3B 5DJZA 4X7EC 1CXFA 4JCMA 4X9FA 4DKFH 3BGFB 3P9LB 1U8HA 1H3TA 4YDLC 4XT1C 1AFVH 1FNSL 3KPRE 4Y19B 1UXSA 4OCRH 2GJ6E 1QKZH 5SV4A 3HUJF 2OR9L 2KL6A 4LKCB 1J11A 1VEOA 2Z4QA 2Z93B 4OF0A 2EDWA 1MFBH 3IJSA 5A43C 2HH0H 1J1OL 1ZS8A 3QJHB 1X5GA 2Q6WB 4M48L 2UYLB 3MRCB 3PL6A 3SJVD 2WBJD 1XCQA 3QEHA 2R0KH 2YEZB 2R4SH 3MLRH 3MZGB 5GHWL 1IC4H 2EKSB 1CDGA 1WIPA 4WI7A 1JWUB 1BJ1J 2J88L 1Q8MA 4FZEL 4O2CB 2CKBL 2VDRL 5LAXB 2F53E 2OXGA 3QEQE 1AGCB 2BXZA 1KG0B 2NYYD 5DRWA 3MRIA 2YA2A 5KSAC 1H5BA 3EYQC 3T1WA 1AXIB 5ABDE 5IOPA 2P8LB 2W91A 4FG6C 1CK0L 3FB7B 3T0BA 5B3JF 1FVEA 5HTSA 2P48B 5J12C 8FABB 2WNGA 2WWKT 3GMMA 4E0RB 3DETC 2XN9D 1L9NA 4OLYH 2EDKA 3W81A 4RIRB 1I85A 1A6TB 1QLFB 3HS0A 4R0LB 5MEQA 4CMMA 3LS5L 4QF1A 5DJYA 5EIIA 4UTAH 4MA1B 2IBZY 3P9MB 1Q9KA 4HKZA 3DRTB 3LHPL 1UWXK 1YECL 1JBJA 1Q72H 3EOTL 3MSPA 1FAIL 2CDFA 2JIXA 5TFSL 5DWUH 2I9TA 4YR6B 1TMCB 3LY6A 2NLJA 3I75A 1DQLH 3IDNA 1RZ8A 1VFUA 4NNYA 3DX8B 1I1AB 4TUJA 4XGZB 3OB8A 1S9KC 4DN3H 3MRDB 3ULVH 3HNVH 5JORB 1GC1C 5GS0D 5JW5A 4DKFL 3LOWA 2AJZA 1HYSD 3C9NB 5D7JB 1AFVL 3T0ED 1L7IH 4CN4A 5IHBA 4GQPH 4OCRL 1QKZL 5DZOA 3BIBX 2I5YH 2NY0D 5EIVA 1MFBL 2HH0L 2RQ8A 2YD9A 3T2NH 1X5YA 3DMMC 1MWAB 4EN3C 5DJDB 3BYTA 3RY6A 5BZDA 2R0KL 3MLRL 2R4SL 3KPQB 2AV7A 1IC4L 5C0AA 5FYKE 4O2FA 5GGTA 2GJZB 3BGMA 1F42A 1BZ9B 4RWYH 3MRRA 5I75C 3IFOB 1ZHLB 3IFPA 4DQOH 3F7YB 5D7IA 5DQJA 2ATPB 1FN4B 1CR9H 4B41A 3EZ8A 2DQIH 5HGAA 2F15A 3DNKA 2XY1A 1S9WA 4JPVH 4OLYL 1JZ2A 2QKIB 2XKNB 2QQQA 3EYOA 1P7HL 5EUOF 4UTAL 4HKJA 3BESR 1RUMH 5MEPB 1QUNA 1Q72L 1UJ3A 5GZOC 5DMIH 1A9EA 3DGCR 5DWUL 5FUCE 5TDPB 1MCLA 5DHVH 5F7UA 1DQLL 4CMHC 4PD4J 1N5AB 1P7QB 1UYWH 1RY7B 3GZKA 3BOVA 4UBDC 1RJZA 5E8OB 3MRFB 4DN3L 1UM6L 3TVMC 3BZEB 2WIIB 3ULVL 3HNVL 1R0AH 4JRXB 2FECL 3ARRA 2E9WA 3HAEH 5FECA 2HLFC 3B3IB 3SQBA 3BWUC 4NFCA 1L7IL 4WV1B 4HH9B 4Z6AT 1ZXQA 5LKNA 3AB0B 5J1SC 2I5YL 1KV3A 2VTFA 2MWCA 3EJYD 4L8CB 3T2NL 4UQ3A 4JFYA 1SBSH 5MENE 3OKOA 4HG4J 5C0BE 1PZ5A 3EFFB 1YNTA 1IGFH 5F6HJ 2JK5A 1MRFH 2NTSP 4NZJA 1X5HA 3RNKA 3B9KA 4YDKH 3BGAA 1EAPB 4YBLC 3ARGA 1FZOA 4RWYL 5ID1A 2NY2B 5K9QG 4I0PA 3IF1B 1NAMH 2UZIH 4K8RH 4MNGA 3KPNB 4DQOL 1W0YT 5FKAA 5HYQA 3SO5A 1CR9L 2P8PA 4LCCB 2DQIL 4HUXB 4M7LH 1WFUA 2VLJE 3Q5YA 1IAII 1ITCA 3P0YH 4JPVL 1FNEA 1MNUH 2J5LC 2R0LH 3QUXC 5F6IB 2X4OA 4KROD 3DUHA 2AEWA 1DZBA 3SCMA 1I1CA 1LILA 5BQ7A 4MA8H 3ABZA 4GSDH 1RUML 2CXGA 3TZVC 1RK0A 3RDTB 4PFEA 4XNQB 5DMIL 4IRJC 4OZFH 1AO7B 1A9BB 1DR9A 4R6UA 2CH8A 1UYWL 5T3XD 2IADA 4CKVX 1LD9B 1MCKA 3RVXC 1RIUH 4PG9A 3HE7D 3U46B 4LBEA 1S9VB 4BFBD 1R0AL 5FYLD 4LHUB 2A6KA 5IMLA 1GZPB 1WTGT 1G7MA 1H8NA 5I9QB 3ARBD 2X4TA 3S37X 1M7DA 1KIPB 1KYOJ 1SBBA 3TBTA 3D87B 3OKLB 1HSBB 5DQ9B 2VOTA 1SBSL 1RHFA 2XPGA 3V7AE 2HJKA 4NIKB 2C26A 1IGFL 1KCVH 2JJSA 3EJJX 1MRFL 4H88H 3AAZA 3GM8A 5CGYC 4R4BA 4GKOA 2Y25A 1DQJB 1MJ7H 1I7UA 1U8PA 1T5WB 4PGCB 3SKOB 2VERN 3ZKNC 1EXUA 3SBWC 4FQCH 4M93C 4PRBA 4Y4FC 1T0NB 3VG9B 1NAML 1J0JA 2UZIL 4K8RL 2B8OT 3QUMB 4JFHD 3BDBA 4G43B 4OKVB 3NIGE 5EUOB 4M7LL 1NC2B 2ADJB 5DJ2A 2B0SH 4NM4H 3U2SB 3P0YL 3RWGB 1MNUL 2R0LL 2OJEB 4P46B 2PXYC 4X6FB 3PQYB 1NFDA 2QR0B 3OF6D 3L9RA 1K5NA 2EE9A 2XN9A 3BIAX 4NCDA 4ODHH 4E41E 3DSFH 4D9RD 1OAKH 5C09B 4MA8L 4GSDL 1Q9OA 1AE6H 4QTHA 4KI5C 1IRAY 4X9HA 4BQ9A 4NQUA 1X5KA 2BC4A 4RMRA 1V05A 4M8QA 4M5ZH 2R29H 2P7TA 3IDJA 3U0TA 1JV5B 4UAOC 4TUOB 3ULUD 1ZHKB 3VFMA 4FTVE 1CGUA 4QXTB 5C0IA 4PJXB 4PV9A 1RIUL 2KDGA 3HZMB 2B20A 3WUWG 3KPSE 1I1AD 3FT4A 4JN2B 2UZYB 3UTZB 2QSTA 2YD7A 5JLZA 3KGRA 5I1IH 4NC2B 4XB8A 1OPGH 2NY7H 2APBA 5DA0B 4XHJC 2P5EE 4R4ND 4Q9QH 3RVTD 3T0EA 2ICWJ 4PBWD 1VFOA 2YD4A 2DF3A 3BSZH 3HPJB 4HGWB 3S88H 2OJZH 4HS3A 4H5SB 5DC0A 4K3DH 5E8PB 1KCVL 4H88L 4WEMB 1MJ7L 3K2MC 3SDCA 3VFPA 3ZKSD 5I66A 3QDJA 2GJ6B 5C3LD 3GSQA 2X4UA 5FO7B 3F12A 4FQCL 3K4DA 5CP7A 4WFHE 1HHGB 4X5WB 5TH2A 3GSOB 4XP1H 2YSSA 4YPJA 1JPFB 4Q0XH 5J0BA 3TIDB 5JW3L 4DGYH 2X1QA 3BD5A 5HYJB 3VWJC 4CVXB 2B0SL 1OARH 4NM4L 2AXFB 1TCRB 1IGMH 5LQBH 5EU4A 2V5MA 5MHSD 3DJ9A 4U1NB 5HHME 3GJFK 4TUKH 4ZUSA 3FQWB 1A14H 4YEFA 4ODHL 3DSFL 1G9EA 4K7PH 5C08E 1OAKL 5D1QA 3RWDB 1AE6L 5A3ID 4PJBA 2EZ0D 3CSGA 4YX2H 2BVTA 5FK9B 3DXAA 4JFPB 4M5ZL 2R29L 2HVJB 3UBXG 2DRUA 4KRPC 1TTGA 3P0VH 2F8XC 4TRPH 5IHZB 3CNKA 4YIQA 1EAJA 3MA7B 4K9EH 3NFPB 4HPOH 4Y5VA 1VESA 1BX2B 4I18C 4MXVE 4N5ED 3IFLH 3HKFA 3QHFH 3MV7B 2N7AA 4MAYC 5EPMB 3EYFB 4J4PD 4I3RH 5I1IL 4ORGB 1OPGL 2NY7L 1XAUA 2AP2A 3GO1H 4JRXD 4ZOBA 1QSEE 3H9HB 4D0CA 4H26B 4Q9QL 4Y5YB 2YR3A 1AHWB 4QWWC 3L7EA 3BSZL 3VXSA 1CI5A 4MJIB 1LHZA 3S88L 5ISZB 3GRWA 4ZTOH 2OJZL 1XFPA 3O2DH 4WW2A 4K3DL 1UKSA 3V7AG 2W59A 3QJFA 1L0QA 1EEYA 2GSIB 3PL6C 2P4AB 2QTEA 1JCKA 4HGKC 2NY4C 4XP1L 1I7RA 1IC5H 2YD6A 4KY1H 4Q0XL 2LU7A 1AQDA 4W6WB 4DGYL 2NY2D 2D7NA 1VFMA 1IQDB 1U36A 4QXWA 3WN5C 1BLNB 2MQ3A 3JWNC 1WBXB 3LKRB 1A1NB 5KN5A 2ILLA 1OARL 3DTXA 5EBMB 4NUGH 1IGCH 3LKNA 4L1DA 1BIIB 4Y4HC 1IGML 5LQBL 1LEIA 5F1SA 1D9KB 3UEZA 1A6ZA 4TUKL 3GUTA 4NN6C 2CXKA 4F9PA 2E9JA 3SE3C 3VGDA 1A14L 2R0WH 4K7PL 4JQVC 3L6FB 5BW7A 1I85C 3KNBA 1FO0B 3OBAA 3QO1A 4G8FA 4C56B 5JDSB 5J9PA 1PYWB 4YX2L 4NKDA 1A1OB 1LP9E 5K9JH 3P0VL 2VITA 3OB0H 4TRPL 2HT3C 4CJ0A 1NJ9B 4YFLF 3HRZB 3RDTD 2F8OA 5K9QI 4K9EL 4HPOL 3B9DA 4JM2B 2KZWA 4LL9A 1AO7D 3QXDA 1BFOA 3NIGF 1BEYH 3Q48A 3IFLL 3LEXB 3D48R 1S7UB 3QHFL 5K9KB 2DQTH 4PTUB 4I3RL 1PLGH 3HE7A 1JGDA 4ISVB 1AY1H 1KT2A 1BZQK 3GO1L 4LHUD 4FABH 2FZ3A 5H37H 3GBNH 2XG4A 4OF7A 4JHZA 1UVQB 3P9LA 4Q2ZB 4QRPB 2EE2A 4KJPC 2ZSWB 3WUWB 4ZTOL 3O2DL 1WISA 4Y19A 4YO0B 3K0WA 5D93B 4WW1A 4HLJA 4GAJL 4LAJH 3VFTA 5HI5D 5EA0H 1RK1B 3QJHA 2Q6WA 3RY6C 2UYLA 3MRCA 5DYOB 3U4AA 1HI6B 1IC5L 2JB6B 4KY1L 5C0JA 1NGWB 2EKSA 5C0BB 1G9MC 5F88B 1JWUA 5JOPE 1CDYA 1PG7X 2XI9A 1AD0B 1KJ3H 4FQ1H 4NUGL 1IGCL 5LAXA 1AGCA 5CZXD 1KG0A 4UIMB 2CUHA 3TIEB 1NC2D 5D1XC 1G7HB 4R7DB 1GYAA 3K1KC 2R0WL 5DI8B 3I85A 3U30C 4GKZB 5BXFA 4JFDA 3DI2B 1DFBH 3QIUC 4MX7B 8FABA 5DC4B 4R9HA 5DF0A 1E6JH 1KCLA 4RIRA 1A6TA 1QLFA 4YBQC 5C09D 5K9JL 4NFBA 4KDVA 5BV7H 5HPOA 5MP6H 1UZ6E 2FIKB 2WQ8A 4I2XA 4R7NB 3P9MA 1QLEH 3DRTA 4QHKI 3FQUB 5IHUH 5HHOE 1BEYL 4NQXB 4W4OA 2HFFB 4YR6A 4LIQE 5D1ZC 1YJDH 2DQTL 5CIPA 1PLGL 3DX8A 4CDHA 1AY1L 1I1AA 1U3HB 4GRWH 4FABL 3MRDA 1ZVYA 2K1MA 3GBNL 3JUYA 3TH2T 4B50A 4PJ7E 5JORA 1YEHH 3LEVH 1G9NC 3C9NA 5D7JA 4M3KB 1JTPA 5IW6B 4NSKB 4IDJH 2EDEA 1QACA 1TFHA 2P24B 3B5TA 4PY7B 3O4OC 3C8KB 5EA0L 4XPGH 1FL6B 1F02I 2BVPB 4X6BB 4G6MH 1P6FA 4MXVF 1MWAA 1QD0A 4K7PY 3B9KC 5DJDA 3ZKMC 3KPRD 3VH8G 4XCEB 2GJ6D 2AKRB 3KPQA 3QQ4B 1R3LB 1RZ7H 2GJZA 4GG6A 1S9XB 32C2B 4I0PC 1BZ9A 4M1CD 4RNRB 1INDH 5CHNB 1KJ3L 1G0DA 3IFOA 4FQ1L 1ZHLA 2DB8A 5JPNB 2BY2A 5HYJD 1VGKB 4AQ1B 2NY6D 4HJJH 2ATPA 1FN4A 3KJ6H 4PJCF 3VCLB 1MCHA 2DD8H 2EDLA 4OTXH 5HPMB 1DFBL 5JMOC 3MA9H 2IWGA 2F53D 3QEQD 4AYFA 1E6JL 1P7KB 2QKIA 1MFAH 2XKNA 4N8VG 3IKCB 5FXCH 3SDDB 2IAMA 5FM5M 2A74A 4NNPH 5BV7L 4QRTB 5MP6L 4AENB 4EJ1C 3CVIH 1VEMA 1QLEL 1QPXA 3R8BB 3TBWB 1U2HA 5MEPA 5IHUL 1S7QB 4XH2B 4A2LA 5TDPA 2FJFB 2AQ3A 2DAVA 1R3JA 1YJDL 4K3GA 1LO5A 4ZO9A 2LV4A 1N5AA 4K3EH 4KK8D 1P7QA 3FONB 4G5ZH 5DLMH 3IGAB 1LNUA 5E8OA 3MRFA 3BZEA 2WIIA 3QZWB 3H8NA 4JRXA 1YEHL 2H9GB 3LEVL 1AXTH 2I24N 5CIPH 5EO9B 3B3IA 3QT2A 1YA5A 1FNAA 4HH9A 1CXLA 3KPSB 2AK4A 4IDJL 5MERB 4MJID 3UBXI 4ZDHA 2ITDB 1DTUA 4QHNB 1YYMH 4L8CA 3G5ZB 4XPGL 1GC1H 4G6ML 1QPPA 2JJSC 2VLKE 1HSAB 3C5SB 4KQ3H 3EFFA 3EDKA 3FT3A 1FFQA 2WBJC 3UDWC 4I9WE 3BE1H 3EW3B 1EAPA 3WS3B 1RZ7L 1KTDB 3ZE2E 3V6ZB 5IVOA 4LEXH 1WZKA 3LN4B 2EYRB 3VG0H 1INDL 1WCQA 2XT1B 1GVIA 3CSYB 3BKYH 4G80B 2NYYC 3KPNA 3KYMB 4HJJL 1N59A 2BNQE 1MELA 4ZSOE 3KJ6L 4LCCA 4HUXA 4YHOH 2DD8L 4OTXL 1M6OB 1D9KD 4MZ3A 4ZOAA 4UUJB 3Q6FB 3MA9L 2WLYA 4XVTH 3QQ9D 1DEEB 5D7LE 4GFTB 3SEPA 4H8WC 1IGIH 1FH5H 4Z78B 2X40A 1LGVA 5AZEH 4NNPL 4C56D 3BEWB 1T1WB 4JREC 3CVIL 4YFLI 1AXSB 5DUBA 2UV3A 2W0LA 3CDGB 5D96C 5J6HB 3RDTA 1TQBB 5IVXF 4YDVB 4XNQA 4ONFH 1ROWA 1AO7A 4JM2D 5DK0B 1S5IH 3SE8H 1A7RH 2QADB 4K3EL 4XP5H 1LD9A 3DURB 1CL7I 1XH3B 4G5ZL 5DLML 5DFVC 3SE9H 4DTGH 3NBNA 3K4ZA 1S9VA 5CCKH 3STZB 4LHUA 2VR4A 4HIHB 1AXTL 4L8DB 1GZPA 1A2YA 5GPRA 4ZNCD 2XACC 4AG4H 3ROLB 3T0EC 3OKLA 2ZUSA 3ARPA 4JEGB 1YYML 1UZ6F 2NY0C 1GC1L 2UUDH 5DQ9A 2JJTA 3GMOA 3S36H 5MEOB 1BOGB 3KYAA 4KQ3L 2ZSVB 4Y4KB 1KGCE 4JO1H 4HKBB 3BE1L 2K3TA 1DQJA 4GRMB 3HE6D 1T5WA 3SKOA 2P5WE 3GM0A 2EYSB 2LE9A 4K55A 4LEXL 3H3BC 3VG0L 5J8OA 4G8EB 1HH9B 5LGHH 5MEND 4FA8A 1MAMH 5C0BD 5C7XH 1T0NA 3BKYL 4LPVA 4PJ7F 3WJJA 1EEUA 3BP4B 4G43A 4OKVA 2X42A 5EUOA 3ILPB 3V6OC 3VH8B 4YHOL 4NZTH 1NC2A 2ADJA 1C16B 2OK0H 4F15B 1E27B 3U2SA 2RGSA 4KMTH 4XVTL 1IMHC 4YHMH 2OJEA 1IC7H 2H32H 1DN2A 4P46A 1IGIL 1FH5L 4X6FA 4BQCA 3PQYA 4QO1A 2QR0A 5AZEL 2FATH 3E2HB 1PZUB 4ZFFB 5C09A 5DMKB 1P84K 5DURB 3ZKXB 4E42B 2BVEA 3VFNB 3H9ZA 3HI5H 4ONFL 3RWFB 4MXQD 5FM4A 1R24B 1S5IL 2RAMA 3SE8L 1JV5A 4Y5VC 3OAUH 1A7RL 5IHLB 4TUOA 3WIFB 4N8VB 5C0RH 4XP5L 1ZHKA 3WHXB 1NMCB 3NIDE 4QXTA 1LP9B 4BQ6A 1XR8B 3LRGA 4PJXA 3SE9L 4DTGL 4EI6B 3HZMA 4PRHA 5CCKL 5FDWB 2WBWB 4JN2A 3VRLE 3QISA 4AG4L 3UTZA 3BDXA 4X9GA 1D5XB 4X6CE 4Q6IB 3P3YA 1A6WH 3P4MA 3NIFE 4KKAC 4XC1H 4YHYC 3WYRA 1F00I 4IM8A 3V4PH 1M71B 5J57B 3Q5OA 4WO4B 5T5NG 5D71H 1CDHA 3HPJA 3S36L 2GKIA 4HGWA 3W39B 4CBPA 1X5AA 1KELH 1CQKA 4H5SA 2P8MB 1MRDH 4LLYB 4M7ZB 5IROA 1JWMB 5E8PA 1IAKB 4JO1L 1CICC 4GBXB 1ZT7B 3T0DA 1FP5A 4ZFOL 3DROB 1NCDH 2GJ6A 5A2KH 5FO7A 3KXFB 5LGHL 1A8JH 1MAML 5C7XL 4X5WA 1BOYA 3GSOA 4M4RA 4AIOA 3VFUA 2E7MA 3TIDA 3V95A 5JZ7D 4OZGE 5HYJA 4NZTL 2VL5A 3C08H 4CVXA 2BSRB 1RZKH 2OK0L 1MIEH 4LHQB 3DX7A 2AXFA 5JOEA 4CU8A 4KMTL 1TCRA 5JNYB 4YHML 5ELIA 5J13C 1IC7L 3NACH 5T5NF 4U1NA 5C8JB 4PJ9D 2FGZA 2FATL 2BP3A 3FQWA 4KROC 4F3FB 3BO8B 5GS1C 2VDPH 4FP8H 2E8ZA 5IMOA 5KVGH 3SDDD 5EOQH 4J6RH 1MIMH 1J18A 2LAGB 3HI5L 3ZE2F 5FK9A 1D6VH 3BRFA 4JFPA 3F6LA 2X89D 2HVJA 1FG9C 4AM0B 5IHZA 3OAUL 5B39A 5C0RL 3C6LB 3MA7A 4HX1A 3NFPA 3C6SB 5B8CB 3RTQB 1BX2A 1TETH 1N6QH 2BNRB 2K7QA 3HE7C 1QFHA 3MV7A 4OB5H 5M7QA 5EPMA 3EYFA 1NFIB 1OLLA 5F1NB 5HHOB 1YY9D 3ARBC 3LV3B 4TVPH 1A6WL 3H9HA 1L6ZA 4XXCA 4XC1L 3V0WH 1JI1A 3V4PL 1AHWA 2EIBA 1RZJH 3KPSD 1Z5LB 4YQXH 5D71L 3V5DA 4MJIA 4OF5A 1KIRA 4HD9A 5DZLA 5ISZA 1KELL 1MRDL 4BSVB 1OGAE 4CVWA 3MMEB 4HMCA 4WTZA 2ORBH 4GKNA 4KDTA 2D7PA 5HGBB 2NY3C 1VCAA 1JIBA 1NCDL 3EUUA 1RJCA 3WFDH 1HEZB 3RIFK 1S7SA 3E3QE 4BH8B 2JF1A 4M62H 1T66D 1OP9A 1BLNA 1WBXA 1C7TA 3LKRA 1LO0H 4BK4A 4UOW1 3C08L 4I8DA 4ZAKB 1RZKL 1T80A 2CDEB 3N1QC 4E5XB 5EBMA 3ZHDA 1TIUA 4WFHD 3GB7B 1ADQA 4LOUD 3NACL 2XZZA 3MOBH 4OZHB 3S97C 1D9KA 3SGKC 4FNLH 5FF6A 4MSWB 2EICA 2P45B 15C8H 2VDPL 4FP8L 5KANI 5C07A 2DQEH 5KBNC 5KVGL 4R0LC 4P4KC 5EOQL 4J6RL 1FO0A 1MIML 5JDSA 4C56A 4EVNB 5BCAA 1PYWA 3P77A 4XBPB 1QFPA 1D6VL 1NLBH 2Q76B 1A1OA 4U7KA 4BYHA 1NJ9A 3EHBD 3HRZA 4ZPTB 5C08D 5F9JB 3ULUC 4JM2A 3O6KH 1TETL 4W4OC 5E1AB 4NHUB 1N6QL 1DP0A 1WFOA 1X44A 2EDJA 1MH5B 4HXBH 3ZSTA 1I9JH 1S7UA 3RAJH 5ITBH 4OB5L 4PTUA 1HN1A 4GUPB 1I8IB 3W2DH 4ISVA 4TVPL 5HHXH 4JANB 4MVBC 4I48B 3C60B 3V0WL 4NC1E 1JN6B 3RVTC 1MEXH 1RZJL 1UVQA 4L8SC 4YQXL 4Q2ZA 4QRPA 1G84A 5F6HI 2ZSWA 3DYMA 2XRAH 5DRXB 4Y0GA 1S3KH 4YO0A 5FGSA 1ERNA 2ORBL 3RY5A 2DQFB 4JGMA 1GGCH 4M7KH 3Q2CA 2AXGB 1SYVB 1RK1A 3NIDF 3HNSH 5IT2H 2GTZB 3WFDL 1S5HB 5DYOA 2V2XB 4FQPA 4GMTH 1HI6A 2AS5M 4XAWH 4F2MB 2JB6A 5ACZB 3O3DB 4M62L 3RJDA 1F3DH 3H7BB 2EO9A 2VLKB 4EBQH 3D85B 5C0BA 1CCZA 5F88A 1LO0L 4X6CF 2VDLH 3NIFF 4Q6YA 1AD0A 4JFFE 3QIBD 4QKXB 4UIMA 3IXTB 3MOBL 1J8HE 1UG9A 4JY6B 1U8LB 4FNLL 3VGAB 1G7HA 1Q0XH 4R7DA 5DI8A 4GKZA 1WUNT 4L4VE 15C8L 5E5MB 4HEPG 2DQEL 2IG2H 4MX7A 2ARJA 1BQHG 4ODXB 5HHQB 2EZ0C 1CXKA 1OP5H 1NLBL 1X3DA 3FFCB 1URLA 5DURD 5GZND 3LQAH 2F9BT 3KHQA 3PWPE 2OI9C 1AD9B 1I3RB 3O6KL 4A6YH 1CGXA 3FQUA 4PLKD 1VPOH 2ZG1A 4NQXA 4OZGF 4N5EC 4HS6B 2HFFA 4HXBL 1I9JL 2APWA 3RAJL 4YZFE 4ZPVB 5ITBL 2ZCLH 1EJOH 3ETBF 3W2DL 3SE4C 4J4PC 5HHXL 1U3HA 4JJ5B 4CADB 4UT7H 1S78D 2G2RB 5DO2D 1H3WM 1MEXL 3UTOA 4WV1C 2X2YA 3TT1H 2EC8A 4LSUH 5E9DB 2XRAL 4OSUH 1FG2B 1S3KL 3SQOH 4NSKA 4KMQA 1KBGH 1J88A 4WO4D 1ZVSB 1I7ZB 3QQ3B 4X6DA 2P24A 4PY7A 4OV5B 1GGCL 4M7KL 3TBVB 3C8KA 2ESVE 1FL6A 1MPAH 3UZEA 3GIZH 2BVPA 3HNSL 4GBXD 5IT2L 3OZ9H 4L5FH 1ZLVH 4DFIA 4GMTL 4XAWL 4XCEA 2R1WA 3QQ4A 4OGZA 4HDIB 4EBQL 4ONHB 1IVLA 1R3LA 1S9XA 32C2A 2NY2C 3QUYB 4AEEA 5CSBA 2EECA 2IH3B 2VDLL 1M05B 5CHNA 3ARED 1CFBA 5JPNA 2P5WB 5F44A 1VGKA 4OF3A 4LCCC 5EFIB 4ZYKB 4QY8A 1Q0XL 4I77H 4B7IA 3ZYZA 2YK1H 2WINB 2IBZX 5HPMA 3P9WB 5JOPD 3RHWK 2IG2L 4GRLB 1RSFA 1VEPA 3LH2H 1P7KA 4XPAH 1JYXA 4LPWA 3IKCA 2ED7A 3HZKB 3LQAL 1DANT 3JV4B 4QRTA 4R2GB 4AENA 3RDTC 1Z0NA 1CQYA 2X89A 1CG9B 4LSVH 4NO5A 1J7VR 4A6YL 3T4AB 3TBWA 3WV0A 1S7QA 1VPOL 4XH2A 1P1ZB 3C6LD 2JELH 5SX5H 2FJFA 3BP7B 3RTQD 3QXTA 2VXUH 1NCTA 5DDHB 2ZCLL 3MYZA 4S1DD 2A0LD 1EJOL 4UT6H 2ICWI 3VXTB 4I3SH 2ZUQB 3FONA 1N0LA 3IGAA 1ORQB 1TTUA 1HHHB 1XEDA 2UVFA 2N1KA 3CUPB 4UT7L 5HHOD 3QZWA 2H9GA 3TT1L 3VFWB 5EO9A 3L3HB 4LSUL 1A21A 4OSUL 1R5IB 3SQOL 1KBGL 4G8IB 5C92A 2FSEB 5FM8A 3FQRA 4KK5D 4D2NA 3NZ8A 2ITDA 4QHNA 2HWZH 3G5ZA 1C5BH 1KFAH 5HI5C 1MPAL 3GIZL 3OZ9L 4L5FL 1HSAA 5EU7E 3C5SA 5D2LE 1BAFH 2MJWA 3BQUB 1EHXA 3JTTB 4MCYB 3BH8B 3WS3A 1FC1A 1KTDA 2HRLA 4IRZH 1XGQA 2FH6A 3V6ZA 3KPLB 2QSQA 2OLDA 3LN4A 2EYRA 5CEZH 3CSYA 5CZXC 4G80A 3KYMA 4Y2DB 3NABH 5FV2A 1QFWM 2W0PA 4PJDE 4I77L 4PRPE 1IEBB 4TSBH 2YK1L 3MQIA 1M6OA 3JUZA 4UUJA 3Q6FA 4Q9BA 2VWEC 4JKMA 3LH2L 4MCZB 4J8RB 4XPAL 4LCWE 1T0MB 2C7UA 3S96A 4UDUB 3BEWA 1T1WA 4JFQB 5C0DB 3WL9B 3PDGA 1AXSA 4LSVL 3PDDA 5I6XC 2IC2A 2HA1A 3CDGA 5J6HA 3W5MA 3R8QA 3TC9A 2JELL 1ETZB 3UX9B 5DK0A 4PRIE 2VXUL 3OAYK 4MD4B 1TZHA 4KH2A 1SJHA 4U6YB 1WV7T 3QB7C 1T1XA 4UT6L 3DURA 4I3SL 1XH3A 1NEZG 3STZA 1F11A 4HIHA 4L8DA 1R5WB 4ELME 5EC1B 3C60D 2EDYA 3ROLA 5L9DH 2EE6A 1OM3H 4LK4A 5K9OB 3B83A 3GFUA 1G6RH 4K07A 2HWZL 1C5BL 1KFAL 1N2RB 5DJ8B 3NMEA 3EKCA 3HLAB 5MEOA 1BOGA 1BAFL 5CILH 4MJ4A 2ZSVA 4Y4KA 1WIOA 1T3FB 2FYYB 5ADOH 4HKBA 4YZFF 4IRZL 4OQTA 2A1WH 3SGJA 2EYSA 4RAHA 1OT2A 5M95B 2OZ4A 5CEZL 2EDFA 1HH9A 4G8EA 4M1CC 4PP1D 2RCSH 2VLKD 5I1HL 2YRZA 3D85D 2P1YA 4RQQB 4Z5RB 3EOAB 3NABL 3BP4A 1ITBB 1F13A 3OR6B 4I9WD 2NY6C 1IEAB 3ILPA 4PLOB 4TSBL 4Y88A 3VH8A 2GITB 2NY5C 3G5YB 3FL7A 3QIWC 1C16A 1KXVC 4WFFE 3S37H 1E27A 3ELAT 1ZSDB 1Z0MA 4QXGH 3FQNB 4QOKB 2BNQD 4ZFFA 1JVKA 2WUBH 3FFCD 5DMKA 1IBGH 1RPQA 1MCIA 5J3HD 3VFNA 3MGOB 2BXYA 3UO1H 5D7LD 1EJ6A 3RWFA 4CUCA 1U42A 5TGBB 1R24A 1B0GB 4MJ2A 4FFWD 3WIFA 3KLAB 4N8VA 1P4IH 4KK8C 5CSGA 2FH8A 4WTXA 1LP9A 1YEEH 1NGXB 1XR8A 4WWKD 4EI6A 4PJAB 3TN0B 3WS6C 4M43H 5FDWA 3CMOL 3VXUE 3DYOA 3X14A 3GJFB 3RKDC 4Y5YC 3F7QA 4Q6IA 5L9DL 1MFCH 3DVNB 1OM3L 3M1BB 4AK1A 5E9DD 1G6RL 2NX5B 1M71A 3G5VB 4EI5A 5C9KA 4WO4A 2GK0B 1TJHH 4HQQH 3PWNA 3W39A 5CILL 2P8MA 4LLYA 4HHAB 4RGNE 1JWMA 3QHZH 3QG6B 3MROB 1IAKA 1ZT7A 5ADOL 5FGRA 5KSBA 1N6UA 3DROA 2A1WL 2JJUA 3KXFA 3VXPA 1KJ2B 2RCSL 4ZXBC 3QUYD 1KGCD 3BPOB 5EOCH 4NFDA 4KKBD 4RISH 1VFAA 3J8F7 2OZ4H 2P5WD 4TNWF 3QNYB 2BSRA 4S2SA 1D9KC 3S37L 2J7LA 5I17B 5JNYA 1WK0A 4OCLC 3QQ9C 4QXGL 3AS2A 5C8JA 4GRLD 1SJVA 3TO4C 2DOCA 4X8JB 5LCVH 3BO8A 3HFMH 2CRZA 4U3CA 5D2LF 3VE0B 1IE5A 2WUBL 4FFVD 3D3VE 1FZKB 1IBGL 4M7LT 1ZA6B 2ICEB 3ZE1E 4U1MB 2MHAB 3UO1L 4R2GD 1UCBH 1MCBA 4JM2C 1HCFX 2ED8A 1KN2H 3C6LA 1P4IL 4LP4A 2VDQH 3C6SA 5B8CA 3RTQA 4HBCH 5F72S 5GS2H 2V9TA 1QFUH 4PJDF 2BNRA 4D8PB 2F5BH 4CU7A 4M43L 5FUCC 2LTQB 1C12B 2H45A 1NFIA 4OJFH 2E7CA 5HHOA 3SKMB 1E4KA 5E70A 2X41A 1MFCL 3G04A 2ATKB 1KPRB 5ILTH 1Z5LA 1YPZA 3IJHB 5KG9B 2CQVA 1TJHL 4HQQL 1HCVA 2W9DH 3QEGH 4XVSH 1NEZB 1WWAX 3MJ9A 4BSVA 3WHE1 3MMEA 3QHZL 4X6EB 3WO4B 1R5VB 1CFQB 3U79A 5HGBA 5DJXB 3HE6C 2R9HC 4APQB 2APVA 1W72A 1J12A 5DTFB 3K74B 3L3IB 1HEZA 1KLUB 5D6DC 5IJVB 3AU1B 2Y5TB 1CD9B 5EOCL 4BH8A 4RISL 2Z91B 4H1LG 2E5EA 5CJ5A 2IMNA 4AIZB 4HV8B 3O4LE 2OZ4L 5F97E 3P11H 4ZAKA 1FYTE 2F54B 3HI1B 1C7SA 4OFYD 4Y2DD 2CDEA 4E5XA 2NZ9C 3GB7A 4U1IB 2IANB 4OZHA 4OUOA 1JYNA 3DIFB 1DN0B 2A6JB 2Q7YB 1QA9A 4LQFH 3UTSE 4MSWA 5LCVL 1F3JB 5DRZB 3JWDC 3MRPA 3HFML 5AG8A 2BMKB 4LKXB 1J0IA 4EVNA 3BKJH 3NA4A 3ULVE 5F9WB 1JHLH 4XBPA 1TQCC 2AVGA 5FV1L 4DZBB 1UCBL 5FCUH 4MXQC 4ZPTA 1KN2L 4CNIB 2VDQL 2JB5L 4HBCL 4GH7B 4URTB 5E1AA 1QFUL 3D39B 4NHUA 3OKMB 4XX1E 3DSNA 2F5BL 1QSFE 1MH5A 3C5JB 1JYWA 3LDBB 5HVHB 2GYSA 3V52H 4UV4H 3EYSH 4GUPA 2AV1B 4OJFL 1I8IA 2N4IA 4JM4H 4U1LB 3MLVH 3UMTA 4JANA 5I73B 3C60A 3A6CH 2F74B 5ILTL 3GNMH 5DD0L 2R2CA 2W9DL 4RCAA 2HT2D 3QEGL 4XVSL 2DI8A 4TTDC 2LFGA 3MFFB 2DQFA 1XGPB 4HC1A 3C2SA 1SYVA 4EUPG 2OTWB 5E99H 3TV3H 4WNQB 2GTZA 3MJ9H 1JFQH 4P5MB 2V2XA 4MAUH 4F2MA 1D5BA 1KPUA 5ACZA 2BZDA 3NH7H 3O3DA 2DBJA 3H7BA 1T22B 1EA9C 5D2LB 2YC1B 5JZ7C 3CD4A 3P11L 4O9HH 4QRSA 1W72H 3QPXH 3RWJB 1GIGH 2FLBT 4YHPA 5A40E 4N90E 2CKNA 1A3QA 1OD7A 5D9SB 4JY6A 4OQ1A 1U8LA 2QLVB 3BDYH 4LQFL 2UUDK 1E6OH 1NUFA 4O4YH 4PJ9C 1AGDB 4MNQB 3E6HB 2BVUA 5E5MA 4BUGA 5I0DA 3O3BB 5I74B 3UPRB 1G7JA 3I84A 4PJDB 4QOKD 4PRPB 5D7SH 3BKJL 3SDDC 5HHQA 5I2IB 1JHLL 1CT8B 1UJTA 3FFCA 3K3QA 5HYIA 3WD5H 5FCUL 3F7RA 2R2EB 3X13B 4JZJC 3T3PE 5IVNA 3UPCA 2DQGH 1RIVH 3O6FB 1AD9A 4HCRA 3BAEH 1TVDA 1I3RA 1BFSA 3KYOB 3CIQA 3RNQB 3F5WB 4Z0XB 1X6LA 4HS6A 4H20H 5GRYA 3V52L 7CGTA 4UV4L 3EYSL 3FTGB 3TN0D 4LEOA 1KB5H 4JM4L 1PG7H 5EBWA 3MLVL 1T7VA 1MLBB 5DJ6B 3A6CL 4JJ5A 2G2RA 3HC3H 4YBHA 2KPNA 4U3HA 1E28B 3GNML 3MLUH 2I26N 3ZE1F 5E9DA 3GJEB 1UB6A 1YEFH 5F7DB 5C0AE 3TH3T 3D1MC 3GSRB 5T3ZH 1ZVSA 2PW1B 1I7ZA 3QQ3A 4ELMB 3QCVH 4OV5A 3TBVA 1WQVT 2W92A 1JNNH 4MQSB 1NQBA 1F6AA 5E99L 3TV3L 4RBPH 2DKSA 3MJ9L 3VJ6B 1JFQL 4MAUL 1KPVB 3HR5B 2IEPA 3MNWB 3NH7L 1MCEA 1DBKH 4HDIA 4ONHA 1T66C 3U82B 1F97A 1MCDA 1ODAA 1UWXH 3QUYA 4ZO7A 4ZD3H 5LJYH 1RUQH 4O9HL 1DLHB 1W72L 1M05A 3QPXL 1GIGL 1JF1B 2VO5A 2HAZA 5FO8B 3U4EB 3VFRB 4LOUC 1IAIH 3BDYL 1E6OL 2H26B 4O4YL 2DL2A 2WINA 4EQ3A 1AR1D 1PD6A 4GRLA 4H1LB 3NPZB 4IMKA 4NRXB 5D7SL 4JFFD 3HZKA 3WD5L 3HZVB 1HXYB 2DQGL 3EHBC 1RIVL 2QSCH 3BAEL 1CG9A 4U0QB 2GFBB 3KLDA 3T4AA 2EIEA 1P1ZA 5I8OH 5E8EB 4XX1G 5K93A 1WAAE 4M61B 4N0FB 1IQWH 1W2KT 4H20L 4HZAA 2DQJH 3T65B 5DDHA 1YN7B 3MUY1 2F58H 3VXTA 1KB5L 2OR7A 1PG7L 3ZKQD 3VGBA 1HHHA 1U2CA 3HC3L 4X7DC 1JZ3A 1U8OB 3MLUL 1LO2H 4U1JA 3VFWA 3FO9B 3L3HA 3RUGE 3WNOA 3ULVF 1R5IA 1YEFL 5AYUH 4G8IA 3MXVH 2FSEA 1T89A 5T3ZL 2PO6D 3SDYH 3VXUB 3QCVL 1JNNL 1NSNH 1N64H 3BFOA 3B9VA 5F21B 2VLLB 2CLRB 3BQUA 1RULH 4KKLD 3WEXB 3AVEA 3JTTA 2CKBB 4APQD 1NH6A 4MCYA 2VE6B 1DBKL 2B4CC 3MRHA 2M1KA 3LKOB 4PREB 1CGYA 4ZD3L 3KPLA 4RGNB 1RUQL 2YA0A 5C0CB 1J1XH 4EUPB 2XICA 3GSXB 4ACPA 3QIBC 1OSZB 4Y2DA 1Z3GH 5FGBC 1IAIL 2F54D 2FR4B 3HN3A 1IEBA 2AJVH 3MRGB 2IAND 5GGUB 4DK6A 4KJYA 5EZJB 4RSVA 4ZFZB 3WFEH 3GKZA 3IETB 5T1DH 3E2HC 4MCZA 4J8RA 1T0MA 2ERJB 3LS4H 4NRZB 3ES6A 1MRCH 3IJYB 1OT1A 2ZNWA 3ZKXC 5GZNC 4MJ6B 1UACH 5HHNA 4JFQA 4GQ9H 3WL9A 4QHLB 2QSCL 1J87A 2MPAH 3CXHJ 4L9LC 1I3UA 5I8OL 4NYLB 4PLKC 5TE4H 3PGDA 2R39A 3D3VB 3WIIH 1BZ7B 1IQWL 2YN5A 4LVHC 5F7YC 2DQJL 2F58L 3AGVA 2XWJB 2D7TH 1M1SA 1QEWB 1YMMA 4PGDB 5DO2C 2CUMA 1LO2L 1NCNA 2VUYA 1R5WA 3VXQB 3RGVB 1N5YH 3OKYA 5D4QA 2UY7A 5AYUL 2C5DC 2WSKA 4X9IA 4IHOB 2ARWA 3MXVL 4WO4C 5K9OA 3FCTA 3T3PF 2EXWD 4OI8A 2FL5B 3EAKA 1N2RA 5DJ8A 1NSNL 1G0YR 1N64L 3HLAA 3WFBH 4NKIH 1T6VN 4GBXC 1CFSA 1RULL 2DIJA 1T3FA 2FYYA 1SYSB 3MRMB 4MD5B 2YA1A 1J1XL 1HYRC 1NFDE 4P0DA 3AREC 4P23B 1A02N 1WICA 2RJMA 4RQQA 1AKJB 1Z3GL 3EOAA 4ZUUA 5DJCB 3DUUB 3OR6A 2X1WL 1Y6NR 1IEAA 2AJVL 2BVQB 4HWUA 2GITA 4PUBH 1JZ6A 4FQ2H 3VFVA 3WFEL 5T1DL 1A7BA 4MNQD 4S1RH 3O4LB 1ZSDA 1JK8A 3LS4L 3FQNA 1MRCL 4JY4B 5HGDB 4QOKA 2FJHB 2HKFH 4PRPD 1UACL 5LGJB 4CAGA 3X11B 3SY0A 3BT2H 2MPAL 3BXNA 5ANMB 2XTJE 3UTSB 4BH7B 2XWTB 3O6FD 5TE4L 2DWDB 2Y72A 3C6LC 3WIIL 4UTBH 5B8CC 4PG2A 5IFJB 4NP4H 4S1DC 2A0LC 1CU4H 2EXYC 3FB8A 5I1EH 1NGXA 4JKPH 2D7TL 2BVOB 3BPNB 4PJAA 3TN0A 3WJLA 1A6AB 1RV6X 1PY4A 5HGHB 4W81A 3W9EB 3SOBH 1N5YL 2HYMA 3AMKA 3GJFA 3DO7B 1BVKB 4LLDB 3TA3C 4XB7A 2DI7A 1QSFB 1OP5K 3MRBB 3DVNA 3M1BA 3RI5F 3QDJE 3AMLA 5GGSY 3LKPB 1LK2B 1J10A 1YEIH 2ARJQ 2NX5A 3G5VA 4GG8B 1VA9A 1YEDB 3WFBL 1JPGB 3ARFA 1ZOXA 4NKIL 3O3EB 1BIHA 2JJVA 2WK2A 4LSTH 2R1YB 1WAAF 3MROA 1U41A 1XCQB 5E4IA 1T5XB 3QYCA 1QHOA 2V9RA 4QRRB 3ROOA 1KJ2A 1INQB 2PYEE 4CVZB 4HKXA 1KC5H 3GIVB 2FJGB 3ZDZE 4GKSA 4JVPA 4PJBE 5IOPB 4PUBL 5EU3B 4FQ2L 3QNYA 2FEDC 1PSKH 3MGTB 3DXAE 4ODWB 2R69H 4Y8DC 5I17A 2CO7B 3WDIA 4S1RL 5IB1B 3NVQA 5T5FH 1BD2B 4AQOA 1PBYA 2HKFL 3HS0B 4N0YH 4X8JA 5F7HA 3RVVD 2I07B 2XA3A 3VE0A 4CMMB 1ZLVK 3KPTA 5DHVB 1FFRA 4J7RA 3BT2L 2VSCA 5EIIB 4N0CD 4WFFD 1ZA6A 2B5IC 2ICEA 1Q9KB 5FB8B 5MI0C 4U1MA 1CLCA 3N9GH 4UTBL 4P9HH 3ARZA 2NLJB 4PGBB 3HAEB 4XP9H 1CU4L 5CUSH 5I1EL 1F8TH 2E7HA 1FNGB 4JKPL 5JW4M 1CDIA 3VXSE 1FIEA 5F9DC 1CZ8H 3VWKC 3QA3B 3IDXH 3SOBL 1RFDH 1C12A 1PY9A 3DI3B 1ZEAH 3SKMA 1KCKA 5BMFH 1SEBB 2YRPA 4OIBA 3JVGA 2AJXH 2FECI 3IDIB 1KPRA 3IYLW 1YEIL 2CSPA 1K6QH 1UEMA 4J3OC 1O7VA 5B3NA 5KG9A 3IAPA 4OCNC 2ZUYA 3JV5A 3VXUD 1NEZA 4LSTL 4X6EA 1R5VA 2VLME 1DQDH 1NAMB 2B1HH 3RHWF 3OR7B 5DJXA 5C0AB 4APQA 4N8CH 5DTFA 1KLUA 5E5RB 2X4RB 3AU1A 4QHMB 5IJVA 4RGND 3QXVA 4TSAH 1KC5L 2Z91A 3VXMB 4AIZA 4HV8A 4MS8C 4PJ5E 2F54A 1PSKL 3HI1A 1AGEB 1UCTA 2J3SA 2R69L 5HGAB 3EBAA 3OKKA 4U1IA 2IANA 1F3RB 5T5FL 5K59E 5E6YA 1DN0A 2A6JA 2Q7YA 4N0YL 5DRZA 5A2LH 4OZFB 2BMKA 5FYKH 3PWVB 2GY5A 3MCKB 5T1LB 2VXVH 4LKXA 5D2NB 4GRWE 5TJWK 5T3XE 3WFCH 2APFA 4FS0A 5J3HC 4MDIB 4DZBA 4YDJB 3B6SB 3N9GL 4P9HL 4CN6A 4PJHA 1NFDF 4CNIA 3BKCH 1MVFA 4XP9L 5CZVH 5CUSL 1F8TL 1UQSB 2G5BA 3D3VD 4YHIB 5J6GA 3D39A 4KJQD 3OKMA 4WWKC 4YH6A 1CZ8L 3IDXL 3C5JA 4X7SH 1W8OA 4JQXA 4Y19E 1RFDL 4HWEH 9CGTA 1ZEAL 4XC3H 2AV1A 2YUZA 5BMFL 2B2XH 1WBZB 4NHCH 4U1LA 3CLEH 5FUOH 5J1AB 2YZ1A 2AJXL 2XXCB 3RGVD 2F74A 4WI9A 3HG1E 2V6HA 3WIHH 1HQRB 1A3LH 3IDYB 1K6QL 2F8VA 3BRDA 1X7QB 3MLSH 4UQ3B 4MXWH 1CFNB 2C4XA 2NW3B 4HWNA 3MFFA 5L8KB 3RUGB 1DQDL 4JFHE 2B1HL 1DDHB 3U7WH 2OTWA 2AXJA 5HVGB 2XKUA 5IBTH 4WNQA 3JTSB 4N8CL 2Y9RT 3H42H 3BMVA 4P5MA 1H3VA 5ID1B 4TSAL 4Z77B 3QUYC 4OZ4B 4YUEH 3BYYA 4JFDE 4NQEB 4QLRA 4KKBC 5D2LA 1WLHA 2YC1A 2N56A 4P23D 1AKJD 4D9RE 1Q1JH 5CLWA 2IH1B 1UC6A 3O3UN 5D9SA 4I2XE 1LVEA 5KOMC 4GRLC 1FSKB 1OTUD 5HHPB 4MNQA 3E6HA 2VZSA 5FYKL 3O4LD 2CR6A 4AH2B 2VXVL 3GK8H 2DQCH 4U6VH 3O3BA 4FFVC 3UPRA 3RZCB 1AQKH 3WFCL 4PRPA 1VFBB 5I2IA 5H37G 3ECBB 3AS1A 3LCYA 3VD4A 1CT8A 3PGFH 2IGFH 3O9WD 4R2GC 3UTSD 1XF1A 2R2EA 3X13A 4AL8H 3O6FA 2JCCB 3BKCL 5F1IB 2VN7A 1DQTA 5CZVL 3GMQB 1XT5A 3KYOA 5IBLC 4KTDH 3O81A 3ULVD 3RNQA 3F5WA 4PJBF 4Z0XA 4LAQH 4X7SL 4JFEB 3S34H 3IU4H 3F62A 3JWOC 3FTGA 4HWEL 4OUUB 4X7CC 4XC3L 2B2XL 5EZLB 3JXAA 4NHCL 3CLEL 5FUOL 1QG3A 2BSSB 3KS0J 1MLBA 5DJ6A 3TBTB 1FRGH 3WIHL 1H0DB 5C1MB 1A3LL 2H2SD 2VQ1B 4L29B 1E28A 3PIQB 1QSFD 1BWWA 4EXKA 5DSCB 2D4FA 1T89C 1CIUA 3MLSL 4L4JA 3BPLB 4MXWL 4M00A 4GG6E 1V3KA 1FNHA 2PW1A 2AEPH 5H94B 4ELMA 1SY6H 3WNMA 3U0PB 3U7WL 4XWOD 5IBTL 3T8XB 3RQ3A 3H42L 2DYPB 3VJ6A 2VMFA 1A3RH 3RWHB 1KPVA 2COQA 1FGVH 3HR5A 4YUEL 1ND0B 4QRRD 3MNWA 4WW2F 1RVFH 4QHUB 4JG1H 1EO7A 5DD6B 3AS3A 2WWMD 5CP3A 1DLHA 1Q1JL 1VB9A 4AJ0A 4Y2DC 3DV4B 1JF1A 3PGCA 5DJ2B 2HMID 1II4E 1HZHH 2FX8H 2VDMH 3EDEA 5FO8A 4AMKH 3U4EA 3VFRA 4YFDB 2H26A 2BY0A 4WDIA 1NFDB 4C57C 2O26U 4P49A 3GK8L 2DQCL 4H1LA 4U6VL 5EBGA 2ENSA 3NCYS 1AQKL 3CC5B 4N90D 3S98A 3PGFL 2IGFL 3NFNB 3HZVA 4M8QB 1HXYA 4AL8L 3JWDL 3IDJB 3U0TB 3LPWA 4YDIH 1O7SA 4XWGH 3EO9H 2FEEI 2AEIT 1FJ1B 4DKAA 5JXAH 2JIXD 4JN1H 4KTDL 4OCXH 1CL7H 5E8EA 1OVZA 4LAQL 4IBLT 1YC7A 4M61A 4N0FA 2XTJB 3S34L 2AK4E 3IU4L 1YN7A 5KS9A 8CGTA 3LSOB 3TYFB 1SJEB 1FRGL 3U7YH 1QRNB 1U8OA 4Y8AA 3FO9A 1TPXB 4GRWF 3UYPA 3ARVA 4RGMB 2HT2C 1OW0C 3MV8B 2GI7A 4X4MA 4YJZL 5CEXA 2AEPL 4MMZC 3VXUA 1SY6L 3KLHD 3MRQB 4MQXD 4LFHG 2E7LA 1ES0B 3SDCB 3K8KA 5KSUB 2BK8A 2VLLA 4K8RD 1A3RL 3B5GA 1J0YA 4LMQE 5C0AD 3WEXA 1FGVL 2ZWLT 2CKBA 2ITCB 2VE6A 5TH2B 1EERB 1C5DB 1RVFL 1NANI 3LKOA 4JG1L 2DMCA 4PREA 4BFEA 1FVCB 2C1PB 4MMXC 2Z31A 4G9FA 4QT5B 4LRNH 2Q8AH 3TNNB 5C0CA 3E6FB 3VXMD 2EDHA 1HZHL 4EUPA 2FX8L 2VDML 3B2VH 3GSXA 4AMKL 4NN5B 2O5XH 1OSZA 2FR4A 4WUUE 3E3QC 4XCFH 5IB2A 1XGRB 2AK1H 2PYEB 3VFSB 4ZUTA 3MRGA 1YQVH 5GGUA 5EZJA 2VXTH 4ZFZA 3IETA 3CFIC 3QCTH 1JGUH 5T1LD 4NRZA 5I1AA 3IJYA 4FFYH 1JZ4A 4MJ6A 4XZUB 4YDIL 2X4QA 1KJMB 1OAZH 4XWGL 3EO9L 4QHLA 5JXAL 4JN1L 3QDGE 3N1FC 4NYLA 4OCXL 1CL7L 1CE6B 2E9IA 2ZPKH 1BZ7A 2JTDA 2XIDA 1FC2D 1UM5H 4KKCD 1A1MB 3WJLC 3QNZA 2XWJA 1UH4A 1QEWA 1FVDB 4D0CB 4FQJH 3U7YL 5SV3A 4PGDA 3VI4E 2IPUK 5DVOA 5FAAA 1U8KB 3FOLB 2P44B 5DT1H 3VXQA 2L7UA 1IJ9A 3VI3E 3V8CA 1Z9LA 1FLTX 4IHOA 4UINH 2R1XB 4WW2B 5DD1L 5F89A 5KJRH 3WLWD 2FL5A 2OR9H 3T0AA 4NC1C 4HF5H 4XAKD 1BJ1H 4RFNB 4WRLA 4J2XA 4H25B 5E95B 3PP4H 1SYSA 5J06A 3EDDA 3MRMA 4I1NB 2FDBP 1CDBA 4PIRF 4MYWB 3O6MH 4MD5A 1WZLA 4XNYH 4Z18A 4LRNL 2Q8AL 3PF2A 3PQYE 1K2DB 3B2VL 3IB4A 1B90A 3LKNB 2O5XL 1AKJA 3UYRH 2VISA 3DUUA 5JA8B 2EKJA 5IUSA 4XCFL 5H8DA 2ZP0T 3CVHA 2AK1L 1EH9A 1UEYA 3GUTB 2BVQA 2OXHA 1LK3H 4G7YH 1YQVL 1CK0H 3PP3K 4GG6F 2VXTL 5F71A 5BV7B 5GRWA 5I15H 3O4LA 3QCTL 3CX5J 4EDWH 1JGUL 4PJ5B 3KYNB 4NQCA 4NDMB 4JY4A 3SCMD 5HGDA 3VMPA 4FFYL 2FJHA 3RZCD 4TVPE 4PJXE 2E8YA 5LGJA 3IAGC 3X11A 1AIFA 1KCSH 4PRHE 5ANMA 5LG1A 3UTSA 2VZTA 3I3EA 3LB6D 4BH7A 2XWTA 1BFOB 4KVCH 1ZLWK 4NRYB 2DWDA 2ZPKL 1H3GA 4GRWB 2GW5A 2HN7B 4WI4A 4XCCH 5IFJA 1XCTB 4UI2A 3AFLA 3DGGB 1UM5L 5B38A 1DQMH 1Q9LB 2BVOA 3QP3A 3B2UD 2AAVA 1OB1B 4FQJL 1EUUA 1A6AA 4G8GB 5HGHA 2DLFH 3W9EA 5DT1L 4M1DH 4JO4H 5DD3H 3DO7A 1BVKA 3ZDYE 4LLDA 4UINL 5EH1A 1QSFA 3TP4A 3MRBA 2DQDH 3KJ4B 2PO6C 3PDOA 2GHWB 3LKPA 5KJRL 1LK2A 4WW1B 4HF5L 4HK3J 1J0HA 4GG8A 4BK5A 1YEDA 3VFTB 1JPGA 3WO4C 3O3EA 3HG1B 1F6LL 3PP4L 2R1YA 5HYJE 1DJSA 4LLMB 1T5XA 4CDGC 2ZKHH 2DYPD 5C0JB 1U8IB 3O6ML 1B3JA 4XNYL 4LNVA 3RWIB 4QRRA 3FB5B 1INQA 4KC3B 4CVZA 1CLYH 3UYRL 1M7XA 1MREH 3SDAC 4FQIH 4PY8J 3GIVA 1G7IB 2FJGA 2XFXB 5KSAB 4C54A 1LK3L 4G7YL 5EU3A 4YLQT 5BXFB 4JFDB 3MGTA 1AGFA 1JTTA 4ODWA 3RX8A 5I15L 1ZKAA 2QQNH 1HK6A 5IB1A 4EDWL 1K4CB 1T6WA 5EOCJ 1BD2A 1ONQB 1KIQA 3CVHH 4RBPK 2I07A 5CD3B 5F9WC 1GRWA 5DHVA 1KCSL 5IB4B 4I2XB 5FB8A 2Q87A 4LHUG 3MV7E 1T83A 4KVCL 4G7VH 4F33B 5JPMB 4XCCL 4MB5A 3FHQA 1PFCA 4PGBA 3HAEA 5CIPB 1DQML 1FNGA 2XTJD 2W65B 4TPRH 1ACZA 3RBGA 4F37F 5HVHC 4JQXC 3ZHKA 4HK0B 4MJIE 1UM6H 3EFDH 5ISZE 3QA3A 4J3SA 2DLFL 2E3VA 2KH2B 4N68A 4M1DL 4JO4L 5DD3L 5C6PB 1SEBA 1QRND 1RZFH 2DQDL 4Q97A 3WNLA 3IDIA 4XMKH 4W70A 5JMRA 4IJ3C 2OQJA 3MV8D 1MAJA 3PABA 4LIQH 1EV2E 1DE4B 4OCMC 1NC4B 3SDCD 2APTA 4EN3B 3VXOB 3QDJD 1XF4B 5DMGD 2ZKHL 4ODVH 1NAMA 5IMMB 4KUCD 3OR7A 1E4XH 4GG6B 4WFGE 1HWGB 2G9HB 3I6GB 2YPKB 2Q3AA 2X4RA 4QHMA 1H3XA 3I6LE 5EU7C 3VI4F 1CLYL 1P4BH 1MREL 5I75B 4KJWC 4FQIL 5C07E 3VXMA 3P2TA 1G7LB 3T77B 3VGHA 1Q0YH 5D6CB 1G0XA 3VI3F 4C56E 1AGEA 3C2AH 5HJ3B 3PJSB 4TSCH 2QQNL 2PYED 2VAAB 4JRYB 4KV5F 3H2WA 3CVHL 1QQDB 5I74C 5D1QD 5HI3D 2IAMB 4OZFA 2A74B 3PWVA 3MCKA 5T1LA 5D2NA 2DKMA 2XG5A 1I8LC 3DXAD 3HNTH 2DTMH 4G7VL 4MDIA 7FABH 4YDJA 3B6SA 3O6FC 5FA3A 5IMKB 2N7BA 1R3JB 3OX8B 1INEH 1LO5B 4OFPA 5KZCD 4W6YB 1UQSA 4YHIA 35C8H 4TPRL 2D31B 1OF2B 3OV6A 4QRPE 1LNUB 3LZFH 3EFDL 3VRJB 3ZTNH 2MFNA 3TVMB 3U7AA 3LQMA 1WBZA 1WAAA 1RZFL 5J1AA 1GHFH 3A6OA 2AK4B 2ZUXA 1MI5E 1HQRA 2PN5A 4PJXF 4XMKL 3VXSD 1YDPA 4ZDHB 1X7QA 2HTLD 4ZFOB 4LIQL 5E2TH 1CFNA 3UJJH 2NW3A 4LCUB 1XGTB 1AJ7H 1T04B 3L7FB 4M1GH 3FT3B 3RUGA 4ODVL 1DDHA 1WBYB 1ED3B 1WEJL 3CFCH 5D8JH 1E4XL 4DOHB 3JTSA 4YBLB 3OGCB 5AD0B 3QXUA 4PRAB 2V2WB 3C87A 4Z77A 4OZ4A 1P4BL 4NQEA 4M3JA 2VLMD 1MHCA 2FRGP 2H32B 1Q0YL 1N59B 4ESKA 3ZDYF 2JKXA 5GQBA 2Y7QB 3C2AL 2IH1A 4KI1A 5FUZH 4TSCL 2HJFB 2V5TA 5B39G 4KU1A 2J5LB 5HHPA 2ADGB 5DEZA 3RVVC 3R1GL 4AH2A 4PJ5D 3N0PB 3BHBB 4WUUB 3RZCA 1VFBA 3HNTL 3ECBA 5DUBB 4M8VA 2DTML 2K9UA 4HT1H 7FABL 3QDMB 3TZVB 3KPMB 2C3HA 3QFJB 2X5PA 2JCCA 1INEL 5F1IA 3GMQA 3LN5A 3EGSB 35C8L 3KPPB 5ESAB 3LZFL 1DEDA 3ARDA 3ZTNL 2VDKH 4JFEA 2I60H 4OUUA 4QTIH 4J3TA 4FQQB 5IVZB 1IKNC 1A2YB 3QDGB 5IWLA 4X6DE 5F1KC 5EZLA 3OKDB 4WTZG 1WZMA 5BRZE 4G8GD 2BSSA 5E6IC 1GHFL 3DVIA 1EHAA 1H0DA 1L7TH 2VQ1A 4L29A 3PIQA 5CEZE 1E4JA 4P5TC 4Y19D 5DSCA 1V5JA 3GMOB 5E2TL 3UJJL 1W0VB 4HULB 1AJ7L 3DECA 3G6JB 2FB4H 4M1GL 5H94A 3L3KB 3U0PA 3HG1D 3CFCL 5D8JL 1I9RH 4RMWA 5FGCE 1AC0A 1KOAA 4M6AA 3T8XA 3VD3A 1S8DB 1RJLA 1D6EB 4R3SB 2DYPA 2FO1A 2GTWA 3RWHA 4FFZH 4RGNC 1ND0A 2YD5A 4QHUA 4Y4FB 4LFHD 1T7YA 1MJUH 5DD6A 5JW3H 1MAKA 5CD5D 2Z8RA 2ZUWA 3V0VB 3DV4A 5FUZL 1YN6B 3VDAA 3GI8H 5KSAD 4IRSB 3EYQD 4JFDD 3EOYG 3P30H 4S0TD 5ENWB 3CC5A 4LMQI 5LVEA 4HT1L 1P9MA 2LQRA 3NFNA 1ZHBB 5TPWH 4Y5XA 3SHSA 4W6XB 3O2VH 4YGVB 4PTTB 4UAOB 1FJ1A 3OSKA 4KJQC 1U91B 5JXEC 4DCQB 4PRHB 4F9LC 5SWSB 2D0FA 2VDKL 2I60L 5ALCH 3UYOD 4QTIL 5E56A 1RMFH 4IMLA 5CJXA 3L5JA 3LSOA 3O2DA 1GOGA 4U6XB 3TYFA 1SJEA 3P4MB 4JM2F 3RGVC 1L7TL 5DVMA 1QRNA 1QLRB 5D7JD 1GGYA 2KKQA 2HTKD 3GSNH 3KVQA 3JWOH 4KRNA 3P73B 5HVFB 3EDFA 3MV8A 2FB4L 5DZNA 3MRQA 4F57H 1MCSA 3X12B 1ES0A 1I9RL 1TVHA 1NC4D 5KSUA 5GISH 4EN3D 2L7JA 5KVDH 4FFZL 4OFDA 2YPLB 1OTSD 2E6PA 2ITCA 1QYGH 1C5DA 4GMSH 3VFUB 1CVSC 1MJUL 3HPLB 1FVCA 2C1PA 1HE7A 1QNZH 4QT5A 4P23C 1KTKE 3TNNA 3E6FA 3KWWA 2VL5B 2ICCA 3GI8L 1JGVH 3DX7B 3QPQD 3K80A 3D18B 5F96H 1XGRA 2MQ0A 2PYEA 3MV01 3VFSA 5JW4Q 1OTUC 4DEPB 3P30L 2EO1A 2PNDA 5DUPH 4JRYD 1EZVY 4GAGH 3RZWA 1A6UH 3TPKA 5IMOB 1UB5B 2IAMD 2VLRB 3QWRA 4Q7DA 3VRIB 2ZG3A 3O9WC 3T1FB 3GBMH 5TPWL 3AROA 4XZUA 3O2VL 1KJMA 5B39B 2APXA 2Q1EA 4IIQB 5DEFB 4GT7A 4HX1B 3RL2B 3GDBA 5L2JB 1RD6A 2XZCH 1CE6A 3ULVC 3LVEA 2EEDA 1P7QD 2IPKB 1NBYB 1PKQE 5ALCL 2YUVA 2C3XA 4WI5A 1RMFL 1A1MA 3K1DA 4MAYB 4X4YB 1P6AB 4Y89A 2Y36H 1FVDA 3L3GB 4PB9H 4C4KO 1KXQE 1Z2KA 4LU5H 1U8KA 3FOLA 3GSNL 4GXUM 1MY7A 2AK4D 3JWOL 3V5DB 1KIRB 2R1XA 2IQ9H 1LDPH 4F7EA 4F57L 5C71A 5TE6H 4GKNB 2J8UE 4GAJH 5CZKA 4FRWA 4XWOC 5HGGS 5GISL 4H25A 3RJQB 5KVDL 4Q9RH 4XVJH 5EG6C 1QYGL 4FXKB 4GMSL 1S7SB 4OZIE 3GSWB 4NBXB 2NY4B 5GJSH 5J4MA 3KLSA 1KB9K 1T0PB 4X6DF 4Y16B 1GOHA 1QNZL 4MB3A 3GMRB 3FQXA 2AW2A 1K2DA 5IEKB 3D2UB 1JGVL 3OAYH 2E6QA 1H5BC 4K71B 5F96L 2NY1B 4Y4HB 4ZQKB 5FF6B 3ALPA 2KQMA 5DUPL 4NN6B 5HYFA 2V2TB 4GAGL 1LEKA 1A6UL 2FIRT 4JAMA 5C07B 5HSFA 1DBAH 5EU5B 4LP5A 3IVKB 1NBZA 3P77B 4P2RA 4PJ5A 2QL1A 3KYNA 4A6YB 4NDMA 4JVWA 3R0MA 4WUUD 3GBML 2L4OA 4LCYB 2VNCA 1NUDA 5C9JB 1T83C 3TZVD 1JRHI 4TTGA 3QZWG 4ODUA 3QFJD 2XZCL 1TNMA 4RGOH 4NRYA 4OM0H 3RVWD 4QRQA 5CFHA 2HN7A 1R3IH 1XCTA 3B43A 4LRIA 4WHYH 1ZLUK 5JQ6H 3DGGA 3GHEH 2EDBA 4NT6B 5E08H 1Q9LA 2Y36L 4H0GA 2X4NB 1OB1A 4PB9L 3QDGD 4OKDA 4LU5L 5EN2B 4G8GA 1EFXB 1J0ZA 3FAXA 1MCRA 1XR9B 3PNWA 1QBAA 4OGYL 3SO3C 4LPTA 5KSBE 3X3GH 4YK4C 3ARSA 3MJ6A 2IQ9L 1LDPL 4MHHG 4Z7VE 2I25N 5TE6L 5I16B 3KLHC 4MQXC 4F7TB 3KXFE 4FZ8H 4P2CG 1I9IH 2Y23A 1WTLA 4BSJA 3HG1A 1MI5B 2AXHA 5I71C 4K8RC 4Q9RL 5CGYD 4XVJL 1ZE3C 4LLMA 5GJSL 4JE4B 5A2JH 1U8IA 2P42B 3EZJB 3FQTA 5A2FA 3RWIA 2CRMA 1DBBH 5LWYH 5L8JB 3FB5A 4Y4FD 4ENEC 5I19H 4HZLA 1I8KA 1G7IA 5TQ0H 3RRQA 2XFXA 5IQ7H 4HJ0C 5KSAA 4IRSD 5D1XB 3U30B 4P46D 3PQYD 3QDHA 5A16B 2ARJB 1DBAL 4NZRH 3SDXA 3LAFA 3QIUB 1K4CA 3PWUB 1ONQA 1X6NA 4R4FH 3S6CA 1WC7B 1I3GH 2NNAB 5FFLA 1S7RB 5CD3A 2CK0H 2J8HA 5TDOA 4ALAH 2BNRE 3QULB 4RA3A 2HFTA 3H7LA 4KI5D 5IB4A 1UJ3C 2EIZB 2RIKA 1RZGB 4RGOL 5B22A 4OM0L 5GSVB 4F33A 5ETUB 5JPMA 1R3IL 2W07A 4TVPD 5JQ6L 1EHNA 2F19H 5D1ZB 3VXRB 3GHEL 1YZZA 4PRHD 4KKCC 5SWSD 2W65A 5L0QB 5E08L 1L4IA 2DLTA 1YPZE 4HK0A 1QP1A 3BP5A 5DGRA 1OL0A 2CO6B 1QSVA 2JE8A 2R0ZH 5F3HB 2CDGB 3X3GL 5HY9A 4JKLA 1U92B 4AEFA 3ILQD 4X6DB 4FZ8L 3WLWC 5E7BA 1I9IL 5BRZB 1AI1H 2H2PD 5JIIA 3O4OB 4KGLA 2QHRH 1DE4A 2HJLB 2V7NB 2FX9H 1NC4A 3RY4A 4K3HA 4EN3A 3M8OH 3VXOA 1XF4A 1EK3A 2R1WB 5IMMA 3ARGC 4TQEL 1SVCP 2YPLD 1DBBL 5LWYL 4OFKA 2G9HA 2O5YH 2Y1VA 4OZHE 3ZSSA 2D0GA 3I6GA 1IL1B 2YPKA 3KAAA 5I19L 5FGCB 4JDZB 5TQ0L 5IQ7L 1G7LA 4UIKH 3T77A 4QY8B 5D6CA 3Q1SH 3TF7C 5JO5B 1GZQB 2UZXB 4UT9H 5HJ3A 3PHQB 3PJSA 1JTOA 5CINH 1K4DA 2UY6A 1JE6A 2ZCHH 1OAXH 2VAAA 4NZRL 4YE4H 2J8UF 3Q3GA 4JRYA 5FYJH 4R4FL 1QQDA 1I3GL 3SCMC 3BWAB 4HIEA 3RZCC 2WW8A 2ZOKB 2VLRD 3SN6N 5C0GA 3VGFA 1KNOA 2CK0L 4ZO8A 2I9LB 4ALAL 4ONOA 2CD0A 1OOAA 4OZIF 3ALXA 2ICES 4NO5B 4U1HB 4EEEA 5IMKA 3ME0A 3S9DB 1V3JA 3VD7A 3OX8A 1NCBH 4D0DB 1LQSR 5T3ZE 2F19L 3I2CH 2H3NA 1LMKA 2D31A 1OF2A 4AEIH 3MV7D 3MOQA 4QYOB 4Y1AE 3VRJA 1YEGH 1P5VA 3FN0H 3TVMA 4MAYD 3RPIB 1G6RB 3PHSA 2XQYK 1JWSB 2R0ZL 3JBG7 4TN9A 4R97C 1LP9F 3FQRB 4HUUB 1I7TB 3NZ8B 5ISZD 1AI1L 5DHYB 4ZFOA 2D7OA 3WLBB 3REVB 2QHRL 4MJ5B 3QXAB 4LCUA 1CE1H 1ZK9A 1XGTA 2FBJH 2FX9L 1T04A 3L7FA 3VMOA 3M8OL 4ZS7H 1WBYA 2WBJB 1ED3A 3IRPX 2FHBA 1XGQB 1W0WB 2O5YL 1MCQA 3CCHB 3OGCA 5AD0A 4PRAA 5CS7A 2V2WA 3S3SA 3MBEB 2AEQH 2J8OA 4Y16D 4LSSH 5TDNB 3G6AB 4QEGA 4UIKL 1X4XA 2H32A 4HFWB 3IXAB 3MNVB 1X5XA 1FLRH 3Q1SL 5KSBF 4ZO6A 2Y7QA 4HGMA 4DK3A 4WFGD 2NY1D 3FFCE 4UT9L 3SKJH 4Y4HD 4MDJA 5CINL 2HJFA 2ZCHL 1OAXL 4YE4L 2X05A 3I6LD 2YWZA 5FYJL 3NN8A 4NUJB 3QUXA 2XYCA 5C07D 2C7UB 3RWCA 3S96B 2ADGA 5HDBE 1RZIA 2FO4B 1XGUB 2D9CA 4K9EC 4UQ2B 3BHBA 4WUUA 4J12A 3TCLB 2CLVB 3WNNA 5EUKB 1BVZA 4X5LA 1Q94A 5E4EB 3OWEA 3QDMA 3TZVA 3TBYB 5D96B 1CFVH 1UWGH 4HIXH 3KPMA 4U2ZA 3QFJA 4IRJA 2EDNA 2VZVA 1FL5B 1NCBL 5IQ9B 3I2CL 1TZHB 5JHDA 1SJHB 2OM5A 5FDYA 3EGSA 3RIAF 3RL1B 1T1XB 3KPPA 3EYVB 2XTJC 3HR6A 5ESAA 4AEIL 4OIIH 5E9DE 3AXLA 1YEGL 3FN0L 2W1NA 3CSPA 1F11B 5HYSG 5IVZA 2P49B 4FQQA 1T21A 3QDGA 5GS0C 2VN4A 3OKDA 1DUZB 1HYSC 4M9PA 1PKQB 1TPXC 3MCLH 4QRPD 5J11C 3UAJD 2HG5B 4PJIB 4RGMC 5J7CC 3EO1A 3H9SB 5ICXB 1W0VA 1CE1L 2FBJL 3G6JA 3L3KA 4LSQH 4ZS7L 3SDCC 1MI5D 2FNBA 5DMGC 2AJYH 1WWCA 2D7MA 5DVNA 1S8DA 1D6EA 4OBRA 4R3SA 3D69B 1YPZF 4N0UB 1JHTA 2J8UB 2AEQL 3SBWA 3G5XB 4LSSL 3DARA 2FX7H 4H0HB 4Y4FA 3OHXB 1H3PH 1MCJA 1FLRL 3B9AA 4LASH 3K8LA 1U8MB 4XCYB 2DDQH 4NN5C 3V0VA 2A6DA 3SKJL 1G6VK 4XNZB 4OZIB 1YN6A 1HWHB 4IRSA 1D5ZA 5D1XD 4CW1B 4Z7WB 2GQHA 3HRPA 4RAUB 1I8MB 5D1QC 5HI3C 5AAMA 4J1UB 3QIUD 4B7LA 1TNNA 2XWBB 1MQKH 1UENA 5EIQA 1A47A 5ENWA 5ACMA 2XZQH 2SEBB 5IV2B 1PX4A 3F6IA 3IFNH 3BZ4B 1CFVL 1UWGL 1S7TB 1ZHBA 4HIXL 1BF2A 3JSSA 4OZHF 2IALB 2R2BB 4L3AA 1QFWI 3DVGA 4O51B 1K9TA 3MYJB 4YGVA 3MZTA 1TITA 4PTTA 5SX4H 1Z6JT 4OLUH 4CRPA 3UTQB 1U91A 5ID0B 4OIIL 4DCQA 3ZYJA 2WP3O 3BVNA 2OBGA 5SWSA 3SGEI 3HMXH 5DEGB 1CLOH 1U3HD 5IM7B 1PKOA 3X14B 5DGQA 4U6XA 5KVMC 2PYFB 5FHAH 3MCLL 4PD4K 1U3JA 2DM4A 1QLRA 2VKXA 4EI5B 3EJYC 3LQZB 4WW2C 3P73A 1T20B 3PWNB 5EB9A 2OCFD 5BRZD 5I1JH 1PW3A 4LSQL 1KEGH 1QR1B 3X12A 1HXMB 4NKMB 2WMPA 2AJYL 1PJ9A 5T1KA 5KSBB 1CICB 5CEZD 2R4RH 4P4RB 2XA8H 2HFGH 4P59H 4Z7VB 3BJLA 4PY8I 5FYKU 3ZKMD 5BVJB 3LEYH 3VXPB 1R3HB 1K8DB 2YPLA 4OFIA 2FX7L 3WFZA 4J3WA 4XBEH 3UJTH 4JPIB 3HPLA 1H3PL 3O0RH 1VFAB 1OHQA 4HG4K 4LASL 1A7OH 2DDQL 3OXRB 4OV6F 4S2SB 2Z0BA 3L3DB 4PYHA 3D18A 2V9QA 4KTYA 4F9PC 4OI7A 5J13B 5DS8B 5D5MB 3RBSA 2JLLA 3I02A 3TLRA 1REIA 4LCIH 4LSRH 2DLEA 5GJTH 5IFAH 5BW7C 1EX0A 1MQKL 5BJTB 4NQSB 2ZUTA 3CSBA 4WI6A 5GS1B 1KUMA 4LPUA 2XZQL 1UB5A 2VLRA 4X4XB 3VRIA 3WNKA 1X4ZA 3IFNL 1Z9MA 1GOFA 3T1FA 1ACYH 1OD9A 1YJDC 3MUHL 1U3YA 5DJ0B 2AJUH 4IIQA 1YMME 5DEFA 5I0ZA 4X99A 4OLUL 3RL2A 1NKOA 4XPFH 1WSST 5L2JA 4ZOCA 4GW4B 5FOJA 3CH8A 4I18A 5E6ZA 3MUZ1 2IPKA 1NBYA 3HMXL 5GS3A 3T09A 3FFDB 1CLOL 2AGJH 4GLRI 1H9VA 2DM7A 3UZVB 1FZMB 4Z0BH 4NOBA 3RPKA 4K7FB 3ZZ1A 3REWB 4MAYA 4X4YA 4KK9D 3ARBB 3L3GA 5FHAL 3G04B 1F2QA 2OL3H 3BGFC 5HDBF 3G9VA 2Z35B 3KJ4C 1YPZB 5EORH 3TNMB 5EZOH 1BJMA 3EJZD 3FOMB 2NQCA 4M9OA 5HYSB 5I1JL 1KEGL 2Z8WC 1KYOK 2R4RL 2XA8L 2E27H 1QFOA 1UZ8B 2HFGL 5F7NC 2NY3B 4P59L 1VADB 1W72B 3LEYL 2YD8A 1A0QH 3LKSB 4YPGB 4FXKA 4X0KB 3PWLB 4XBEL 1XIWB 3GSWA 3UJTL 5HDLA 2WQRA 3MBED 3O0RL 4Y16A 1A7OL 5L2KA 2BDNH 2LABA 3GMRA 5I1DB 5CD5C 5F70A 3WN5A 3K81A 5IEKA 3P4LA 3D2UA 3WCYA 4QOKE 1B6DA 2C3VB 3KDMB 4Y4HA 4ZQKA 1N7MH 1MLCB 1QA9B 4LCIL 4LSRL 2ZOLB 5GJTL 5IFAL 3MRPB 2V2TA 3SE3A 1NUNB 1UT9A 2CRYA 2D2OA 4JQVA 5ITFB 4Z7QE 5EU5A 3IVKA 3BZDA 4P4KB 5F1OB 4A6YA 3K8MA 3W82A 3ARXA 1PG7W 2C9AA 1ACYL 3L3JB 4LCYA 4MA1C 1UFUA 5C9JA 1NEUA 4F8TA 2AJUL 4PJAE 3OAZH 3S3JA 4XPFL 1KB5B 4HWBA 1IAOB 2CPCA 3F58H 1UA6H 2QADD 4U0RB 4N9GB 1XF5B 2EDTA 1MVUB 1YMHB 1I1AC 2AGJL 4D94A 4Z0BL 3D5OF 5DFVD 5HI4D 2NX5E 4NT6A 2X4NA 1HILB 2OL3L 4PRNB 5EN2A 1EFXA 1I9EA 4R4NC 1XR9A 5D7JC 3V7MA 1GXEA 2HTKC 2O5ZH 1TLKA 5CJOH 5EORL 2YHGA 3MUGB 4P3CH 5EZOL 4L8SB 4Y1AB 2A9MH 4Z7UE 1PEWA 2C4FT 3H9SD 4WEUD 3TJEH 5I16A 1BP3B 1HNFA 5J1TC 4F7TA 1QHPA 3DOSA 5SWZE 4Y4KD 2E27L 1A22B 3RFZC 1MI5A 2PR4H 3IKKA 3LKQB 1A0QL 4RDQG 3IU3B 1OTSC 4K94C 5E2JA 1LEGB 5GGSB 1D5BB 1KPUB 3VRLF 1GGUA 1N8ZB 2BDNL 4Z76B 4QRSB 4HH8A 4YHPB 4BQBA 3UP1A 3QPQC 5IFHH 1P84J 2YXMA 1ZLSH 1B2WH 3FO1B 1N7ML 2ZZUT 5DD5H 5D1XA 3HC0B 3TJHD 1FAKT 2G5RA 4FHBD 5GGVY 3ZT6A 5A16A 2C4FU 3CPLA 1G7JB 2Z8VC 5A3IC 3QIUA 2IAMC 3OG6B 4LLVB 5FOBB 3PWUA 1WC7A 2DMBA 1RAMA 2NNAA 5EU6B 5JOFB 1S7RA 2D3VA 4QGTA 2KBGA 5GS2D 4RDQF 1RJYB 3QULA 4MB4A 4YHNB 2EIZA 2OI9B 1RZGA 2LU4A 3W0WE 3F58L 1UA6L 2ZNXA 5GSVA 3WMSA 1NKRA 5ETUA 2CIKB 5EOTB 5IB5B 1J9CT 5D1ZA 3VXRA 1F4HA 2HVKB 3HUJB 1T2JA 2M26A 4LEOB 5EBWB 4HWBH 4G6FB 2LU3A 1NCUA 2GSGA 2XOTA 1AR2A 5KAQG 2X1OA 2O5ZL 1OP3H 5CJOL 4DAGH 1U95B 4P3CL 3O45B 4POUB 5F3HA 2CDGA 2A9ML 1UB6B 3AB0C 4KKAD 4GOSA 3PWJA 4U31A 4LSDA 4EI5D 2VXSH 1U92A 5GSRB 3TJEL 3PXHA 4PGEB 1SMAA 5BRZA 5KTEH 2BY1A 5CEYB 1F6AB 1FFPB 2PR4L 4KDWA 4DUXA 2HJLA 5L88H 2V7NA 1CICD 2VQUA 3FT2B 2F54E 4XVUD 1FQ9C 3P40A 1AC6A 3KXFD 4DFHA 4UNUA 2IANE 2DS4A 3TWCH 1IL1A 4KXZI 4UU9A 1LO4H 5KAQF 4WU5A 5IFHL 1C8PA 4JDZA 1ZLSL 5GGTH 1B2WL 1CVRA 2BY3A 3N1PC 5DD5L 3A6BH 1G9MH 5JO5A 1GZQA 1L0YA 1Y6MR 3PHQA 2EH7H 5F6IC 1U58B 3OKNB 4PJHE 1EEZB 2XV6B 4OT1H 3H9YA 3BWAA 2ZOKA 1BQUA 3D39E 1FBIH 2I9LA 4G6JH 2L0DA 1TTFA 1JPSH 4BSWB 2X9YA 1PX3A 4U1HA 2YBRB 3ARUA 3N1MC 4M4PA 3RVWC 4PJFA 1A7NH 2VQTA 3EDJA 4D0DA 3BN9D 5CLTA 2KUTA 2BNRD 3O8XB 4HWBL 2FLRT 1FE8H 2QHLA 4QYOA 4WUKH 5I9QC 1A7PH 1EGJA 3RPIA 1G6RA 5CKAA 4LLUB 4U1JB 4DAGL 1JWSA 4Z7QF 3FN9A 4O2EB 4OI9A 1H15B 4H0IA 5E1HB 2R8SH 2VXSL 1HINH 4KWUA 3OKEB 4D3CH 1MFDH 1I7TA 4HUUA 2JJTC 2E6JA 4OD3H 3WXVH 4PJAF 5KTEL 5DHYA 5CAYB 5CSZB 3WLBA 1G9NH 3DHMA 3REVA 2R23B 5AAWA 4MJ5A 4U2YA 3QXAA 5L88L 4HW6A 1NAKH 2Y06H 4YDKL 3FN3A 2NY3D 2F5AH 2WBJA 2AJSH 4UOJA 5FKPA 3SJVA 5BO1H 3MRHB 4PGZA 3UDWA 1NL0H 1W0WA 1RZKC 1WVZA 3TWCL 3CCHA 3VG9C 1XIWD 3FRPG 3WJJC 1LO4L 3MBEA 3UTTE 5ESQB 5I1HH 4MNQE 5TDNA 2YPVH 3G6AA 5GGTL 4HFWA 4ZAKD 3IXAA 2HP4A 3MNVA 3CZJA 3VA6A 3V5KB 3NCJH 3U9UB 1N0XH 3A6BL 3MUJA 4IRSC 1G9ML 5IF0B 4ERSH 4Z7UF 1O0VA 2EH7L 2VYRE 3BKMH 4HLZH 4KJYB 4P46C 3MLZH 4NUJA 4ETQB 4V1DB 4OT1L 3ES6B 1BFVH 2DIBA 2FO4A 1XGUA 1FBIL 4G6JL 4P4KD 2Q3ZA 3GGWB 4UQ2A 4L3EB 5HHNB 3TCLA 2CLVA 1JPSL 2CRIA 1SEQH 5EUKA 3SKNB 1V7NH 3TFKD 3B4NA 3RKPA 5IJKA 5I6XB 1U93A 3TBYA 1EHLH 4UB0H 3PGDB 2J2ZA 1A7NL 2HLAB 1CIDA 1FL5A 4UV7H 5IQ9A 3DUSB 4ODSH 4AIXA 4RAVB 3RL1A 3MRKB 5I1GH 3EYVA 2X70B 1FE8L 3WKMH 1AP2B 2YZ8A 1RZJC 4WUKL 1A7PL 1YMMB 3VW3H 5DA4A 5IEHB 3CMOH 2WWKO 4MVBD 5T3ZD 1DUZA 3BZFB 1PKQA 4WCYH 2R8SL 5EC2B 1HINL 4D3CL 1MFDL 1JZ8A 3UJIH 2HG5A 4P2QB 4PJIA 1EGJH 3ILQC 3FCTB 4HSQA 4Y1AD