4MYFA

Crystal structure of trypanosoma cruzi formiminoglutamase(oxidized) with mn2+2 at ph 6.0
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
298
structure length
289
Chain Sequence
b'TDDPRLLSLFSAQREEDADIVIIGFPYDEGCVRNGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDITASTLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFPGDVGVINVDSHLDVRPGTPFRQLLEESSFSGKRFVEFACQGSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGKNTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVEEYRSPRVAVYMFYHFVLGFATRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formiminoglutamase
publication title Formiminoglutamase from trypanosoma cruzi is an arginase-like manganese metalloenzyme.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 111
structure length 289
sequence length 298
ec nomenclature ec 3.5.3.8: Formimidoylglutamase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4myfA00
1GQ7A 1GQ6A 4GSVA 1T4TA 4MXRA 2EF5A 3PZLA 4HXQA 1WOHA 3F80A 3E6VA 4IE1A 4IU1A 1T4RA 1HQ5A 4IU5A 4Q3QA 1HQFA 1TA1A 4DZ4A 3NIQA 1WOIA 1P8SA 4HZEA 4MYKA 2EF4A 4HWWA 4Q40A 1TBJA 3TF3A 1WOGA 3GMZA 3E8QA 3CEVA 4RHMA 4RLAA 5HJ9A 3MFVA 3DJ8A 1TBLA 4RHJA 4IU4A 1P8MA 3THHA 1T4PA 3SKKA 4MYFA 3SJTA 1D3VA 4GSZA 1P8OA 1T5GA 4Q3UA 3LP7A 3RLAA 3SL1A 2ZAVA 3THEA 1HQHA 4IE2A 4ITYA 4MYLA 1T5FA 2AEBA 3M1RA 4IE3A 3E8ZA 1XFKA 1RLAA 1ZPEA 4Q3PA 4Q3RA 2PLLA 3KV2A 4IU0A 4Q3VA 1R1OA 3E6KA 3LHLA 3SL0A 1TBHA 3MFWA 4GSMA 1P8RA 1PQ3A 5CEVA 4FCKA 3THJA 4MYNA 4RHIA 2EIVA 1CEVA 3NIOA 3E9BA 1P8PA 1T4SA 1P8NA 4CEVA 1HQGA 4GWDA 3MMRA 4Q41A 4RHQA 4Q3SA 3TH7A 4IXVA 4RHKA 1P8QA 2A0MA 4Q42A 4I06A 1WVAA 3LP4A 1WVBA 3GN0A 2CEVA 1ZPGA 2PHAA 4G3HA 4IXUA 3MJLA 2PHOA 3NIPA 4FCIA 1HQXA 5RLAA 2RLAA 4Q3RC 4RHLA 5HJAA 4GWCA 4Q3TA
chains in the Genus database with same CATH superfamily
3MZ4A 1GQ7A 5EEIA 1GQ6A 4GSVA 1T4TA 4MXRA 5EENA 2EF5A 3PZLA 4HXQA 4BZ9A 3C10A 1WOHA 4CBYA 4QA6A 3F80A 3E6VA 5G0IA 4IE1A 4IU1A 1C3PA 1T4RA 1HQ5A 5THSA 4CBTA 2VQWG 4IU5A 4Q3QA 4ZUPA 1HQFA 3ZNRA 1TA1A 4DZ4A 3NIQA 5DC5A 5LI3A 5EFGA 1WOIA 1P8SA 1T69A 4HZEA 3Q9EA 4MYKA 3MENA 2EF4A 1C3RA 3MAXA 3Q9CA 4QA3A 4HWWA 4Q40A 4QA5A 5D1CA 1ZZ1A 5EFNA 1TBJA 4ZUQA 3TF3A 1WOGA 3SFFA 4BZ7A 3GMZA 5A2SA 5EFHA 3E8QA 3CEVA 1T64A 5EEMA 5G0JA 3Q9BA 4QA7A 4LXZA 4RHMA 2VCGA 4RLAA 5HJ9A 3MFVA 4RN0A 3DJ8A 1TBLA 4RHJA 4IU4A 5ICNB 4BZ6A 5G10A 5IWGA 1P8MA 3THHA 1T4PA 5EF8A 5THUA 3F07A 3SKKA 5D1BA 4MYFA 3SJTA 1D3VA 4GSZA 5DC7A 2VQJA 3MZ3A 1P8OA 1T5GA 4Q3UA 3LP7A 5G17A 3RLAA 2ZAVA 3SL1A 3THEA 4ZUNA 1HQHA 2VQQA 4BZ5A 4IE2A 4ITYA 4MYLA 2VQVA 1T5FA 2AEBA 3M1RA 4IE3A 1T67A 5THTA 3E8ZA 1XFKA 3EZPA 1RLAA 3F0RA 1ZPEA 4Q3PA 5EEFA 5G0XA 4RN1A 4Q3RA 2PLLA 3KV2A 4IU0A 5G3WA 4Q3VA 5G13A 4A69A 1R1OA 4QA4A 3E6KA 5EFJD 4QA0A 3LHLA 3SL0A 1TBHA 3MFWA 5DC8A 5G1AA 1ZZ3A 3MZ6A 5EFBD 4QA1A 3EZTA 4GSMA 5G1CA 5FUEA 1P8RA 1VKGA 1PQ3A 4QA2A 5CEVA 5DC6A 4FCKA 5FCWA 3THJA 4RN2A 4MYNA 4RHIA 4CQFA 5G0HA 4LY1A 2EIVA 1CEVA 5G12A 3E9BA 1ZZ0A 3NIOA 5G0YA 4BZ8A 4ZUOA 1P8PA 3MZ7A 1T4SA 1P8NA 3EWFA 5JI5A 5THVA 1HQGA 4GWDA 5D1DA 4CEVA 3MMRA 3C0ZA 4Q41A 5BWZA 4RHQA 1W22A 4Q3SA 5IX0A 3SFHA 3TH7A 2V5WA 4IXVA 4RHKA 2VQOA 1P8QA 3F06A 4ZUMA 2A0MA 3RQDA 2VQMA 1C3SA 2V5XA 4Q42A 4I06A 1WVAA 3LP4A 1WVBA 3GN0A 2CEVA 1ZPGA 2PHAA 4G3HA 5G1BA 4IXUA 4BKXB 3MJLA 2PHOA 3Q9FA 3NIPA 4FCIA 5EF7A 1HQXA 5EFKB 2RLAA 4ZURA 5G0GA 5G11A 5RLAA 3EW8A 3ZNSA 4Q3RC 4RHLA 3C0YA 5HJAA 4GWCA 4Q3TA 2GH6A 5EEKA
chains in the Genus database with same CATH topology
1GQ7A 1GQ6A 4GSVA 1T4TA 4MXRA 2EF5A 3PZLA 4HXQA 1WOHA 3F80A 3E6VA 4IE1A 4IU1A 1T4RA 1HQ5A 4IU5A 4Q3QA 1HQFA 1TA1A 4DZ4A 3NIQA 1WOIA 1P8SA 4HZEA 4MYKA 2EF4A 4HWWA 4Q40A 1TBJA 3TF3A 1WOGA 3GMZA 3E8QA 3CEVA 4RHMA 4RLAA 5HJ9A 3MFVA 3DJ8A 1TBLA 4RHJA 4IU4A 1P8MA 3THHA 1T4PA 3SKKA 4MYFA 3SJTA 1D3VA 4GSZA 1P8OA 1T5GA 4Q3UA 3LP7A 3RLAA 3SL1A 2ZAVA 3THEA 1HQHA 4IE2A 4ITYA 4MYLA 1T5FA 2AEBA 3M1RA 4IE3A 3E8ZA 1XFKA 1RLAA 1ZPEA 4Q3PA 4Q3RA 2PLLA 3KV2A 4IU0A 4Q3VA 1R1OA 3E6KA 3LHLA 3SL0A 1TBHA 3MFWA 4GSMA 1P8RA 1PQ3A 5CEVA 4FCKA 3THJA 4MYNA 4RHIA 2EIVA 1CEVA 3NIOA 3E9BA 1P8PA 1T4SA 1P8NA 4CEVA 1HQGA 4GWDA 3MMRA 4Q41A 4RHQA 4Q3SA 3TH7A 4IXVA 4RHKA 1P8QA 2A0MA 4Q42A 4I06A 1WVAA 3LP4A 1WVBA 3GN0A 2CEVA 1ZPGA 2PHAA 4G3HA 4IXUA 3MJLA 2PHOA 3NIPA 4FCIA 1HQXA 5RLAA 2RLAA 4Q3RC 4RHLA 5HJAA 4GWCA 4Q3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GQ7 A;  1GQ6 A;  4GSV A;  1T4T A;  4MXR A;  2EF5 A;  3PZL A;  4HXQ A;  1WOH A;  3F80 A;  3E6V A;  4IE1 A;  4IU1 A;  1T4R A;  1HQ5 A;  4IU5 A;  4Q3Q A;  1HQF A;  1TA1 A;  4DZ4 A;  3NIQ A;  1WOI A;  1P8S A;  4HZE A;  4MYK A;  2EF4 A;  4HWW A;  4Q40 A;  1TBJ A;  3TF3 A;  1WOG A;  3GMZ A;  3E8Q A;  3CEV A;  4RHM A;  4RLA A;  5HJ9 A;  3MFV A;  3DJ8 A;  1TBL A;  4RHJ A;  4IU4 A;  1P8M A;  3THH A;  1T4P A;  3SKK A;  4MYF A;  3SJT A;  1D3V A;  4GSZ A;  1P8O A;  1T5G A;  4Q3U A;  3LP7 A;  3RLA A;  3SL1 A;  2ZAV A;  3THE A;  1HQH A;  4IE2 A;  4ITY A;  4MYL A;  1T5F A;  2AEB A;  3M1R A;  4IE3 A;  3E8Z A;  1XFK A;  1RLA A;  1ZPE A;  4Q3P A;  4Q3R A;  2PLL A;  3KV2 A;  4IU0 A;  4Q3V A;  1R1O A;  3E6K A;  3LHL A;  3SL0 A;  1TBH A;  3MFW A;  4GSM A;  1P8R A;  1PQ3 A;  5CEV A;  4FCK A;  3THJ A;  4MYN A;  4RHI A;  2EIV A;  1CEV A;  3NIO A;  3E9B A;  1P8P A;  1T4S A;  1P8N A;  4CEV A;  1HQG A;  4GWD A;  3MMR A;  4Q41 A;  4RHQ A;  4Q3S A;  3TH7 A;  4IXV A;  4RHK A;  1P8Q A;  2A0M A;  4Q42 A;  4I06 A;  1WVA A;  3LP4 A;  1WVB A;  3GN0 A;  2CEV A;  1ZPG A;  2PHA A;  4G3H A;  4IXU A;  3MJL A;  2PHO A;  3NIP A;  4FCI A;  1HQX A;  5RLA A;  2RLA A;  4Q3R C;  4RHL A;  5HJA A;  4GWC A;  4Q3T A; 
#chains in the Genus database with same CATH topology
 3MZ4 A;  1GQ7 A;  5EEI A;  1GQ6 A;  4GSV A;  1T4T A;  4MXR A;  5EEN A;  2EF5 A;  3PZL A;  4HXQ A;  4BZ9 A;  3C10 A;  1WOH A;  4CBY A;  4QA6 A;  3F80 A;  3E6V A;  5G0I A;  4IE1 A;  4IU1 A;  1C3P A;  1T4R A;  1HQ5 A;  5THS A;  4CBT A;  2VQW G;  4IU5 A;  4Q3Q A;  4ZUP A;  1HQF A;  3ZNR A;  1TA1 A;  4DZ4 A;  3NIQ A;  5DC5 A;  5LI3 A;  5EFG A;  1WOI A;  1P8S A;  1T69 A;  4HZE A;  3Q9E A;  4MYK A;  3MEN A;  2EF4 A;  1C3R A;  3MAX A;  3Q9C A;  4QA3 A;  4HWW A;  4Q40 A;  4QA5 A;  5D1C A;  1ZZ1 A;  5EFN A;  1TBJ A;  4ZUQ A;  3TF3 A;  1WOG A;  3SFF A;  4BZ7 A;  3GMZ A;  5A2S A;  5EFH A;  3E8Q A;  3CEV A;  1T64 A;  5EEM A;  5G0J A;  3Q9B A;  4QA7 A;  4LXZ A;  4RHM A;  2VCG A;  4RLA A;  5HJ9 A;  3MFV A;  4RN0 A;  3DJ8 A;  1TBL A;  4RHJ A;  4IU4 A;  5ICN B;  4BZ6 A;  5G10 A;  5IWG A;  1P8M A;  3THH A;  1T4P A;  5EF8 A;  5THU A;  3F07 A;  3SKK A;  5D1B A;  4MYF A;  3SJT A;  1D3V A;  4GSZ A;  5DC7 A;  2VQJ A;  3MZ3 A;  1P8O A;  1T5G A;  4Q3U A;  3LP7 A;  5G17 A;  3RLA A;  2ZAV A;  3SL1 A;  3THE A;  4ZUN A;  1HQH A;  2VQQ A;  4BZ5 A;  4IE2 A;  4ITY A;  4MYL A;  2VQV A;  1T5F A;  2AEB A;  3M1R A;  4IE3 A;  1T67 A;  5THT A;  3E8Z A;  1XFK A;  3EZP A;  1RLA A;  3F0R A;  1ZPE A;  4Q3P A;  5EEF A;  5G0X A;  4RN1 A;  4Q3R A;  2PLL A;  3KV2 A;  4IU0 A;  5G3W A;  4Q3V A;  5G13 A;  4A69 A;  1R1O A;  4QA4 A;  3E6K A;  5EFJ D;  4QA0 A;  3LHL A;  3SL0 A;  1TBH A;  3MFW A;  5DC8 A;  5G1A A;  1ZZ3 A;  3MZ6 A;  5EFB D;  4QA1 A;  3EZT A;  4GSM A;  5G1C A;  5FUE A;  1P8R A;  1VKG A;  1PQ3 A;  4QA2 A;  5CEV A;  5DC6 A;  4FCK A;  5FCW A;  3THJ A;  4RN2 A;  4MYN A;  4RHI A;  4CQF A;  5G0H A;  4LY1 A;  2EIV A;  1CEV A;  5G12 A;  3E9B A;  1ZZ0 A;  3NIO A;  5G0Y A;  4BZ8 A;  4ZUO A;  1P8P A;  3MZ7 A;  1T4S A;  1P8N A;  3EWF A;  5JI5 A;  5THV A;  1HQG A;  4GWD A;  5D1D A;  4CEV A;  3MMR A;  3C0Z A;  4Q41 A;  5BWZ A;  4RHQ A;  1W22 A;  4Q3S A;  5IX0 A;  3SFH A;  3TH7 A;  2V5W A;  4IXV A;  4RHK A;  2VQO A;  1P8Q A;  3F06 A;  4ZUM A;  2A0M A;  3RQD A;  2VQM A;  1C3S A;  2V5X A;  4Q42 A;  4I06 A;  1WVA A;  3LP4 A;  1WVB A;  3GN0 A;  2CEV A;  1ZPG A;  2PHA A;  4G3H A;  5G1B A;  4IXU A;  4BKX B;  3MJL A;  2PHO A;  3Q9F A;  3NIP A;  4FCI A;  5EF7 A;  1HQX A;  5EFK B;  2RLA A;  4ZUR A;  5G0G A;  5G11 A;  5RLA A;  3EW8 A;  3ZNS A;  4Q3R C;  4RHL A;  3C0Y A;  5HJA A;  4GWC A;  4Q3T A;  2GH6 A;  5EEK A; 
#chains in the Genus database with same CATH homology
 1GQ7 A;  1GQ6 A;  4GSV A;  1T4T A;  4MXR A;  2EF5 A;  3PZL A;  4HXQ A;  1WOH A;  3F80 A;  3E6V A;  4IE1 A;  4IU1 A;  1T4R A;  1HQ5 A;  4IU5 A;  4Q3Q A;  1HQF A;  1TA1 A;  4DZ4 A;  3NIQ A;  1WOI A;  1P8S A;  4HZE A;  4MYK A;  2EF4 A;  4HWW A;  4Q40 A;  1TBJ A;  3TF3 A;  1WOG A;  3GMZ A;  3E8Q A;  3CEV A;  4RHM A;  4RLA A;  5HJ9 A;  3MFV A;  3DJ8 A;  1TBL A;  4RHJ A;  4IU4 A;  1P8M A;  3THH A;  1T4P A;  3SKK A;  4MYF A;  3SJT A;  1D3V A;  4GSZ A;  1P8O A;  1T5G A;  4Q3U A;  3LP7 A;  3RLA A;  3SL1 A;  2ZAV A;  3THE A;  1HQH A;  4IE2 A;  4ITY A;  4MYL A;  1T5F A;  2AEB A;  3M1R A;  4IE3 A;  3E8Z A;  1XFK A;  1RLA A;  1ZPE A;  4Q3P A;  4Q3R A;  2PLL A;  3KV2 A;  4IU0 A;  4Q3V A;  1R1O A;  3E6K A;  3LHL A;  3SL0 A;  1TBH A;  3MFW A;  4GSM A;  1P8R A;  1PQ3 A;  5CEV A;  4FCK A;  3THJ A;  4MYN A;  4RHI A;  2EIV A;  1CEV A;  3NIO A;  3E9B A;  1P8P A;  1T4S A;  1P8N A;  4CEV A;  1HQG A;  4GWD A;  3MMR A;  4Q41 A;  4RHQ A;  4Q3S A;  3TH7 A;  4IXV A;  4RHK A;  1P8Q A;  2A0M A;  4Q42 A;  4I06 A;  1WVA A;  3LP4 A;  1WVB A;  3GN0 A;  2CEV A;  1ZPG A;  2PHA A;  4G3H A;  4IXU A;  3MJL A;  2PHO A;  3NIP A;  4FCI A;  1HQX A;  5RLA A;  2RLA A;  4Q3R C;  4RHL A;  5HJA A;  4GWC A;  4Q3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...