4MYFA

Crystal structure of trypanosoma cruzi formiminoglutamase(oxidized) with mn2+2 at ph 6.0
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
298
structure length
289
Chain Sequence
TDDPRLLSLFSAQREEDADIVIIGFPYDEGCVRNGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDITASTLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFPGDVGVINVDSHLDVRPGTPFRQLLEESSFSGKRFVEFACQGSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGKNTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVEEYRSPRVAVYMFYHFVLGFATRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formiminoglutamase
publication title Formiminoglutamase from trypanosoma cruzi is an arginase-like manganese metalloenzyme.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 111
structure length 289
sequence length 298
ec nomenclature ec 3.5.3.8: Formimidoylglutamase.
pdb deposition date 2013-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4myfA00
3LP7A 4GSMA 4RLAA 1HQHA 1T4TA 4Q3RC 2PLLA 3THEA 1T5GA 1WVBA 1XFKA 3THJA 4G3HA 4MYKA 4RHIA 2EIVA 1P8QA 1P8NA 3CEVA 4ITYA 5CEVA 1WOGA 3SL0A 3LHLA 3SL1A 2ZAVA 1T4PA 4IU0A 1WVAA 4RHQA 1GQ6A 1WOHA 1WOIA 2EF4A 4HWWA 4Q3PA 5HJ9A 5HJAA 1HQXA 4IE3A 1T5FA 4Q3VA 1R1OA 4MYLA 5RLAA 4Q3RA 3THHA 4HZEA 4Q3UA 1TBLA 3NIPA 2EF5A 1GQ7A 1RLAA 4Q3QA 3NIOA 4Q42A 1P8RA 4IXUA 3E6KA 3F80A 3DJ8A 1D3VA 4CEVA 2RLAA 4GWCA 4DZ4A 3NIQA 4MYNA 3SKKA 4MYFA 4RHMA 1P8PA 1HQ5A 1P8OA 3GMZA 4MXRA 3TF3A 4IU1A 3E9BA 4Q3SA 2PHAA 4HXQA 4IXVA 4GWDA 4GSZA 4I06A 1ZPGA 4IU5A 1T4RA 1TBJA 2A0MA 3MFWA 1ZPEA 2PHOA 3E8ZA 1P8MA 3TH7A 4Q41A 4GSVA 1HQGA 3RLAA 4IE2A 4RHJA 3KV2A 4FCIA 2AEBA 1PQ3A 4RHLA 3SJTA 4Q40A 4RHKA 4FCKA 1TBHA 3GN0A 4IU4A 1T4SA 1HQFA 3PZLA 3M1RA 3LP4A 1TA1A 1CEVA 3MJLA 4IE1A 4Q3TA 3E6VA 1P8SA 3MFVA 3E8QA 2CEVA 3MMRA
chains in the Genus database with same CATH superfamily
4BKXB 3LP7A 4GSMA 4RLAA 5G10A 1HQHA 1T4TA 4Q3RC 5D1CA 3SFHA 3Q9EA 2PLLA 3THEA 1T5GA 5G0GA 2V5WA 1WVBA 2V5XA 1XFKA 3THJA 4G3HA 4MYKA 5EEKA 4RHIA 3F0RA 5G1CA 5BWZA 1VKGA 2EIVA 1P8QA 5G0YA 1P8NA 5EEMA 3CEVA 2VQMA 4ITYA 5G13A 5CEVA 5EENA 3F06A 1WOGA 3SL0A 3LHLA 4ZUOA 5DC6A 5G0IA 3SL1A 3Q9FA 2VQJA 2ZAVA 1C3RA 4QA7A 4QA2A 5EFHA 4A69A 1ZZ3A 1T4PA 4IU0A 1WVAA 1ZZ0A 4CBTA 3EZPA 4RHQA 1T69A 1GQ6A 1WOHA 1WOIA 2EF4A 4HWWA 4Q3PA 5D1DA 4QA0A 5EFBD 3C10A 5HJ9A 5HJAA 5EFGA 1HQXA 4IE3A 5G1BA 1T5FA 4Q3VA 1C3SA 1R1OA 4ZUMA 4CQFA 4MYLA 5RLAA 4Q3RA 3THHA 4ZUQA 1T67A 4HZEA 4Q3UA 3EW8A 1TBLA 4BZ8A 3MZ6A 3NIPA 2EF5A 1GQ7A 5G12A 1RLAA 5FUEA 5JI5A 4Q3QA 2VCGA 3NIOA 4Q42A 3SFFA 1P8RA 4QA5A 4QA1A 4IXUA 5EFJD 3E6KA 2VQWG 3F80A 5EF7A 3DJ8A 1D3VA 4CEVA 4CBYA 5G0JA 3MZ7A 2RLAA 4GWCA 4DZ4A 5IWGA 5THUA 4QA3A 3NIQA 4MYNA 3SKKA 4MYFA 5G11A 5EEIA 1T64A 5THSA 4RHMA 3C0ZA 1P8PA 5LI3A 1HQ5A 1P8OA 3GMZA 4MXRA 5EEFA 5G1AA 3ZNSA 4BZ6A 3TF3A 4RN1A 4IU1A 4BZ7A 3MZ3A 3E9BA 4ZUNA 4Q3SA 2PHAA 4HXQA 4BZ9A 4IXVA 4GWDA 4QA6A 4GSZA 4I06A 1ZPGA 4IU5A 3EZTA 5THTA 3RQDA 3ZNRA 1T4RA 1TBJA 2A0MA 3MFWA 5D1BA 1ZPEA 2PHOA 3E8ZA 1P8MA 3EWFA 1C3PA 4RN2A 4ZUPA 3TH7A 4Q41A 4RN0A 4GSVA 1HQGA 5DC8A 5EFKB 3RLAA 4IE2A 4RHJA 3KV2A 5G0HA 4FCIA 5THVA 3MENA 2AEBA 3C0YA 1PQ3A 3F07A 4RHLA 2VQVA 4Q40A 5G3WA 3SJTA 4RHKA 5EFNA 5G0XA 4FCKA 5DC7A 1TBHA 3GN0A 4IU4A 1T4SA 5G17A 1HQFA 3MZ4A 3PZLA 3M1RA 5DC5A 4ZURA 5IX0A 5ICNB 2VQOA 4LXZA 3Q9CA 2VQQA 4LY1A 5FCWA 3LP4A 1TA1A 1CEVA 3MJLA 4IE1A 4QA4A 5A2SA 4Q3TA 3MAXA 4BZ5A 3E6VA 5EF8A 1P8SA 3MFVA 3Q9BA 3E8QA 1W22A 1ZZ1A 2GH6A 2CEVA 3MMRA
chains in the Genus database with same CATH topology
3LP7A 4GSMA 4RLAA 1HQHA 1T4TA 4Q3RC 2PLLA 3THEA 1T5GA 1WVBA 1XFKA 3THJA 4G3HA 4MYKA 4RHIA 2EIVA 1P8QA 1P8NA 3CEVA 4ITYA 5CEVA 1WOGA 3SL0A 3LHLA 3SL1A 2ZAVA 1T4PA 4IU0A 1WVAA 4RHQA 1GQ6A 1WOHA 1WOIA 2EF4A 4HWWA 4Q3PA 5HJ9A 5HJAA 1HQXA 4IE3A 1T5FA 4Q3VA 1R1OA 4MYLA 5RLAA 4Q3RA 3THHA 4HZEA 4Q3UA 1TBLA 3NIPA 2EF5A 1GQ7A 1RLAA 4Q3QA 3NIOA 4Q42A 1P8RA 4IXUA 3E6KA 3F80A 3DJ8A 1D3VA 4CEVA 2RLAA 4GWCA 4DZ4A 3NIQA 4MYNA 3SKKA 4MYFA 4RHMA 1P8PA 1HQ5A 1P8OA 3GMZA 4MXRA 3TF3A 4IU1A 3E9BA 4Q3SA 2PHAA 4HXQA 4IXVA 4GWDA 4GSZA 4I06A 1ZPGA 4IU5A 1T4RA 1TBJA 2A0MA 3MFWA 1ZPEA 2PHOA 3E8ZA 1P8MA 3TH7A 4Q41A 4GSVA 1HQGA 3RLAA 4IE2A 4RHJA 3KV2A 4FCIA 2AEBA 1PQ3A 4RHLA 3SJTA 4Q40A 4RHKA 4FCKA 1TBHA 3GN0A 4IU4A 1T4SA 1HQFA 3PZLA 3M1RA 3LP4A 1TA1A 1CEVA 3MJLA 4IE1A 4Q3TA 3E6VA 1P8SA 3MFVA 3E8QA 2CEVA 3MMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP7 A;  4GSM A;  4RLA A;  1HQH A;  1T4T A;  4Q3R C;  2PLL A;  3THE A;  1T5G A;  1WVB A;  1XFK A;  3THJ A;  4G3H A;  4MYK A;  4RHI A;  2EIV A;  1P8Q A;  1P8N A;  3CEV A;  4ITY A;  5CEV A;  1WOG A;  3SL0 A;  3LHL A;  3SL1 A;  2ZAV A;  1T4P A;  4IU0 A;  1WVA A;  4RHQ A;  1GQ6 A;  1WOH A;  1WOI A;  2EF4 A;  4HWW A;  4Q3P A;  5HJ9 A;  5HJA A;  1HQX A;  4IE3 A;  1T5F A;  4Q3V A;  1R1O A;  4MYL A;  5RLA A;  4Q3R A;  3THH A;  4HZE A;  4Q3U A;  1TBL A;  3NIP A;  2EF5 A;  1GQ7 A;  1RLA A;  4Q3Q A;  3NIO A;  4Q42 A;  1P8R A;  4IXU A;  3E6K A;  3F80 A;  3DJ8 A;  1D3V A;  4CEV A;  2RLA A;  4GWC A;  4DZ4 A;  3NIQ A;  4MYN A;  3SKK A;  4MYF A;  4RHM A;  1P8P A;  1HQ5 A;  1P8O A;  3GMZ A;  4MXR A;  3TF3 A;  4IU1 A;  3E9B A;  4Q3S A;  2PHA A;  4HXQ A;  4IXV A;  4GWD A;  4GSZ A;  4I06 A;  1ZPG A;  4IU5 A;  1T4R A;  1TBJ A;  2A0M A;  3MFW A;  1ZPE A;  2PHO A;  3E8Z A;  1P8M A;  3TH7 A;  4Q41 A;  4GSV A;  1HQG A;  3RLA A;  4IE2 A;  4RHJ A;  3KV2 A;  4FCI A;  2AEB A;  1PQ3 A;  4RHL A;  3SJT A;  4Q40 A;  4RHK A;  4FCK A;  1TBH A;  3GN0 A;  4IU4 A;  1T4S A;  1HQF A;  3PZL A;  3M1R A;  3LP4 A;  1TA1 A;  1CEV A;  3MJL A;  4IE1 A;  4Q3T A;  3E6V A;  1P8S A;  3MFV A;  3E8Q A;  2CEV A;  3MMR A; 
#chains in the Genus database with same CATH topology
 4BKX B;  3LP7 A;  4GSM A;  4RLA A;  5G10 A;  1HQH A;  1T4T A;  4Q3R C;  5D1C A;  3SFH A;  3Q9E A;  2PLL A;  3THE A;  1T5G A;  5G0G A;  2V5W A;  1WVB A;  2V5X A;  1XFK A;  3THJ A;  4G3H A;  4MYK A;  5EEK A;  4RHI A;  3F0R A;  5G1C A;  5BWZ A;  1VKG A;  2EIV A;  1P8Q A;  5G0Y A;  1P8N A;  5EEM A;  3CEV A;  2VQM A;  4ITY A;  5G13 A;  5CEV A;  5EEN A;  3F06 A;  1WOG A;  3SL0 A;  3LHL A;  4ZUO A;  5DC6 A;  5G0I A;  3SL1 A;  3Q9F A;  2VQJ A;  2ZAV A;  1C3R A;  4QA7 A;  4QA2 A;  5EFH A;  4A69 A;  1ZZ3 A;  1T4P A;  4IU0 A;  1WVA A;  1ZZ0 A;  4CBT A;  3EZP A;  4RHQ A;  1T69 A;  1GQ6 A;  1WOH A;  1WOI A;  2EF4 A;  4HWW A;  4Q3P A;  5D1D A;  4QA0 A;  5EFB D;  3C10 A;  5HJ9 A;  5HJA A;  5EFG A;  1HQX A;  4IE3 A;  5G1B A;  1T5F A;  4Q3V A;  1C3S A;  1R1O A;  4ZUM A;  4CQF A;  4MYL A;  5RLA A;  4Q3R A;  3THH A;  4ZUQ A;  1T67 A;  4HZE A;  4Q3U A;  3EW8 A;  1TBL A;  4BZ8 A;  3MZ6 A;  3NIP A;  2EF5 A;  1GQ7 A;  5G12 A;  1RLA A;  5FUE A;  5JI5 A;  4Q3Q A;  2VCG A;  3NIO A;  4Q42 A;  3SFF A;  1P8R A;  4QA5 A;  4QA1 A;  4IXU A;  5EFJ D;  3E6K A;  2VQW G;  3F80 A;  5EF7 A;  3DJ8 A;  1D3V A;  4CEV A;  4CBY A;  5G0J A;  3MZ7 A;  2RLA A;  4GWC A;  4DZ4 A;  5IWG A;  5THU A;  4QA3 A;  3NIQ A;  4MYN A;  3SKK A;  4MYF A;  5G11 A;  5EEI A;  1T64 A;  5THS A;  4RHM A;  3C0Z A;  1P8P A;  5LI3 A;  1HQ5 A;  1P8O A;  3GMZ A;  4MXR A;  5EEF A;  5G1A A;  3ZNS A;  4BZ6 A;  3TF3 A;  4RN1 A;  4IU1 A;  4BZ7 A;  3MZ3 A;  3E9B A;  4ZUN A;  4Q3S A;  2PHA A;  4HXQ A;  4BZ9 A;  4IXV A;  4GWD A;  4QA6 A;  4GSZ A;  4I06 A;  1ZPG A;  4IU5 A;  3EZT A;  5THT A;  3RQD A;  3ZNR A;  1T4R A;  1TBJ A;  2A0M A;  3MFW A;  5D1B A;  1ZPE A;  2PHO A;  3E8Z A;  1P8M A;  3EWF A;  1C3P A;  4RN2 A;  4ZUP A;  3TH7 A;  4Q41 A;  4RN0 A;  4GSV A;  1HQG A;  5DC8 A;  5EFK B;  3RLA A;  4IE2 A;  4RHJ A;  3KV2 A;  5G0H A;  4FCI A;  5THV A;  3MEN A;  2AEB A;  3C0Y A;  1PQ3 A;  3F07 A;  4RHL A;  2VQV A;  4Q40 A;  5G3W A;  3SJT A;  4RHK A;  5EFN A;  5G0X A;  4FCK A;  5DC7 A;  1TBH A;  3GN0 A;  4IU4 A;  1T4S A;  5G17 A;  1HQF A;  3MZ4 A;  3PZL A;  3M1R A;  5DC5 A;  4ZUR A;  5IX0 A;  5ICN B;  2VQO A;  4LXZ A;  3Q9C A;  2VQQ A;  4LY1 A;  5FCW A;  3LP4 A;  1TA1 A;  1CEV A;  3MJL A;  4IE1 A;  4QA4 A;  5A2S A;  4Q3T A;  3MAX A;  4BZ5 A;  3E6V A;  5EF8 A;  1P8S A;  3MFV A;  3Q9B A;  3E8Q A;  1W22 A;  1ZZ1 A;  2GH6 A;  2CEV A;  3MMR A; 
#chains in the Genus database with same CATH homology
 3LP7 A;  4GSM A;  4RLA A;  1HQH A;  1T4T A;  4Q3R C;  2PLL A;  3THE A;  1T5G A;  1WVB A;  1XFK A;  3THJ A;  4G3H A;  4MYK A;  4RHI A;  2EIV A;  1P8Q A;  1P8N A;  3CEV A;  4ITY A;  5CEV A;  1WOG A;  3SL0 A;  3LHL A;  3SL1 A;  2ZAV A;  1T4P A;  4IU0 A;  1WVA A;  4RHQ A;  1GQ6 A;  1WOH A;  1WOI A;  2EF4 A;  4HWW A;  4Q3P A;  5HJ9 A;  5HJA A;  1HQX A;  4IE3 A;  1T5F A;  4Q3V A;  1R1O A;  4MYL A;  5RLA A;  4Q3R A;  3THH A;  4HZE A;  4Q3U A;  1TBL A;  3NIP A;  2EF5 A;  1GQ7 A;  1RLA A;  4Q3Q A;  3NIO A;  4Q42 A;  1P8R A;  4IXU A;  3E6K A;  3F80 A;  3DJ8 A;  1D3V A;  4CEV A;  2RLA A;  4GWC A;  4DZ4 A;  3NIQ A;  4MYN A;  3SKK A;  4MYF A;  4RHM A;  1P8P A;  1HQ5 A;  1P8O A;  3GMZ A;  4MXR A;  3TF3 A;  4IU1 A;  3E9B A;  4Q3S A;  2PHA A;  4HXQ A;  4IXV A;  4GWD A;  4GSZ A;  4I06 A;  1ZPG A;  4IU5 A;  1T4R A;  1TBJ A;  2A0M A;  3MFW A;  1ZPE A;  2PHO A;  3E8Z A;  1P8M A;  3TH7 A;  4Q41 A;  4GSV A;  1HQG A;  3RLA A;  4IE2 A;  4RHJ A;  3KV2 A;  4FCI A;  2AEB A;  1PQ3 A;  4RHL A;  3SJT A;  4Q40 A;  4RHK A;  4FCK A;  1TBH A;  3GN0 A;  4IU4 A;  1T4S A;  1HQF A;  3PZL A;  3M1R A;  3LP4 A;  1TA1 A;  1CEV A;  3MJL A;  4IE1 A;  4Q3T A;  3E6V A;  1P8S A;  3MFV A;  3E8Q A;  2CEV A;  3MMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...