4MZ1A

Crystal structure of the inosine 5'-monophosphate dehydrogenase, with a internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound p12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
380
structure length
354
Chain Sequence
b'AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inosine-5'-monophosphate dehydrogenase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Campylobacter jejuni subsp. jejuni
publication title Crystal Structure of the Inosine 5'-monophosphate Dehydrogenase, with a Internal Deletion of CBS Domain from Campylobacter jejuni complexed with inhibitor compound P12
rcsb
total genus 111
structure length 354
sequence length 380
chains with identical sequence B, C
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2013-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mz1A00
1N55A 3L67A 3R13A 3VFLA 1U5JA 3TROA 2A85A 2QUVA 2TPSA 3CEPA 3LB0A 3TQKA 3DFTA 1RQHA 3KX6A 1QMLA 3ZS4A 1DORA 4QQ3A 2ZRVA 5D33A 2GQAA 3MYOA 5AHIA 1FBAA 3GDLA 3OEXA 5LGXA 3OG3A 4MYAA 2TMDA 1O5XA 2HS8A 3A23A 1GYLA 1NFBA 4IXHA 3RMJA 3PBYA 4FHAA 1QFEA 1TJRA 1GEQA 1VJIA 3VE9A 5BOOA 4RXFA 3G1YA 4JX4A 2CLMA 1TPC1 2ZRZA 3LDVA 1XXXA 1SPQA 1JQVA 4UUIA 5I3GA 3MJYA 1TQXA 4QM1A 2E6AA 3CWOX 2Y70A 1FCBA 1IIGA 4O4VA 1OF8A 1M5WA 3W1PA 3STFA 1XC4A 2YDAA 3LTSA 2DZUA 3LI0A 2FPTA 3W74A 1OX4B 1TRDA 5AHMA 3BW4A 3O16A 3NZRA 1VYRA 2BSLA 4Y6GA 4JIQA 3HJZA 1SSDA 4HPJA 5F2GA 3LHZA 3KVJA 3ABSA 1KBIA 2DU2A 4DF0A 1MEIA 2Y63A 4LV9A 1L6WA 4X9SA 3TDFA 1JCXA 3TXZA 3EXSA 3QRHA 1HFBA 4L4LA 3W7OA 1IXPA 1GTHA 1IGSA 3UWQA 4M6QA 4PA8A 3CU2A 2JKAA 4JYFA 5KZEA 1W56A 3C2OA 3QMSA 1TJPA 2AAMA 1UUOA 4ALDA 1AK5A 3NO5A 4DPPA 4RCXA 1LORA 4GFSA 2VEIA 3ZR4A 5AHFA 4ADTA 2V2DA 4WJEA 1JRCA 3W76A 1XBVA 2YW4A 2ABAA 3W7CA 4O53A 4LV4A 4DEFA 3W7KA 5LHEA 1K7EA 1OK4A 4OBTA 3SW6A 1V7YA 5F2MA 2Y7FA 3UPBA 2P10A 4ML9A 1A5CA 3HPXA 3W1XA 3TX9A 5G1YA 4LRTA 2VENA 5D2TA 1QO2A 3M43A 2C16A 3JS3A 5FF7A 1W8SA 3I6RA 3EEGA 4MYXA 3NQMA 2TRSA 3U8GA 4POCA 4OV9A 4LRSA 1W3IA 4ZQNA 4LS2A 1OYCA 1IF2A 3UWVA 1PS9A 4WY0B 4Z1DA 3EWYA 3RLUA 1ADOA 2DJLA 2XN1A 1GVRA 3A21A 3CIWA 2E6DA 3HOJA 3QQ0A 1ZNNA 2QCEA 3NQCA 4MY9A 2JBMA 2A1YA 4Q32A 2AGKA 2H90A 4MFEA 2QCMA 4RR4A 1VPXA 3QEZA 4GUFA 3ANYA 4O17A 2YX0A 4H6KA 3HG3A 2GVJA 3NQ8A 2NX9A 1HG3A 3WK0A 1TPWA 1OVDA 3P62A 2FPVA 2DP3A 4AMAA 1PL9A 3W7MA 1F05A 4WD0A 3EX2A 3NQGA 1XL9A 4FO4A 1YPFA 3O8AA 4LUJA 3N34A 4FIRA 3P82A 4CQ8A 3NPVA 1VH7A 1E51A 3G1VA 3EWXA 2DORA 1W5MA 4KKXA 5F4SA 5U4NA 3LCXA 3R5EA 3UY8A 3W7RA 1X1ZA 3TC7A 3UZJA 1QCWA 3M44A 4NT0A 1A5SA 2NV2A 5D2XA 4Z0SA 3RU6A 1VR6A 3NQEA 2YXGA 4I7WA 4UTWC 4FNQA 3IGSA 3KRSA 5KSWA 5LNSA 4S1FA 1YXYA 1TYGA 5F1UA 5AYZA 2RKXA 4AHPA 2QR6A 1A5AA 4JEQA 2ZBTA 3EKLA 4X2RA 3N14A 3CC1A 3E49A 4FEZA 5KINA 1ZCOA 1GQNA 2QCHA 2VEMA 4N9EA 3NXFA 2RHGA 5G2WA 3K30A 2CZ5A 1TTIA 1ME8A 1DHPA 3EB2A 1AG1O 2WOQA 3TQVA 3N2MA 1YDOA 2EHHA 1FX6A 4PL2A 1P0KA 4NXKA 1XBZA 1DJQA 4TU1A 4M5PA 1SQ7A 3LHWA 2CLFA 1NVMA 2E6FA 2C14A 1X7FA 1FDZA 4E2BA 2ZZ5A 3G3MA 2WNNA 3LHYA 3MBDA 5E0KA 3W3OA 1H62A 4AWUA 1DQXA 1TMHA 3EX1A 3NZ1A 2A7PA 1IXQA 3NG3A 4NNBA 4O12A 3QPYA 1ONRA 4JDYA 3L2IA 2FTPA 1EWDA 5AB3A 4AWSA 4PEKA 1LLZA 2BWGA 1S5TA 2Y6ZA 2WKJA 1Q6OA 2YFNA 1LTDA 2CLIA 1OG0A 1Z41A 2FLIA 4I9AA 4GNJA 3M1ZA 5F4WA 1WAUA 2GVLA 3TJXA 2CU0A 3B0VC 2R91A 2OT0A 1KM1A 2ZTJA 4OHQA 1SSGA 2X1TA 5CKSA 3L5LA 3MO7A 4AXKA 3B06A 2GVGA 3HGRA 2ZA1A 4IJBA 2JGQA 3WK1A 1G4SA 2V5LA 4OU1A 2ZZ6A 4OV4A 4E0CA 1XKYA 4EIVA 2YPIA 2ZFAA 5TQLA 3QF0A 4XBSA 3IVSA 2DZPA 3O6CA 3EWBX 2V81A 2ZQ0A 3IVUA 3THQA 3G24A 2CLOA 3LRLA 1WXJA 2VFEA 4TIMA 5KTLA 4FIQA 4NU7A 4JTUA 3SFKA 2CZEA 2Y7DA 4UXDA 1BEUA 2Z6IA 3W9ZA 2PC4A 1H61A 3M5YA 2C0AA 1VYPX 4JTEA 1O94A 1IIHA 3E0IA 1H7OA 3UNDA 1G4TA 4Q33A 1JCLA 1TQJA 4UFHA 3MP3A 3LHTA 1W54A 1JCNA 1LOSA 4UTUA 3GDTA 3BGGA 4FX8A 5I3FA 3HPZA 4P61A 3NQ2A 4R33A 4OWGA 3W7JA 2FDSA 3PS7A 3O6YX 2DZWA 3I7RA 5FI8A 3NA8A 1Z48A 3Q94A 3N9RA 4N02A 1R2TA 3VCRA 1LM1A 1VHCA 3S5ZA 1XDLA 1GZGA 3TKFA 4NZJA 2QJGA 5HWMA 3EWUA 4UTLA 1LROA 1WBJA 4ONVA 3OVQA 1RR2A 3RLVA 3PG9A 3W84A 2ZA2A 1B57A 1YADA 3GXTA 1W5OA 4JXCA 1HTIA 3M6YA 4IMDA 3I7SA 1FDJA 1XBXA 1GVFA 1LBFA 3A22A 2Y61A 5G1TA 1LRTA 2TSYA 3VNDA 5U7SA 3L0GA 4NNAA 3TC6A 2OJPA 2Y89A 2B7PA 3F1QA 1A50A 4WX2A 3SSJA 4O10A 5C55A 3S0CA 1EB3A 2WO5A 1I4NA 2NV1A 3QMTA 3IVTA 3QQ1A 2GOUA 4N4QA 5F4XA 3STGA 3R8RA 3EX6A 1OYAA 1THFD 3CT7A 4IQLA 1ZHAA 3V75A 1LOQA 4TMBA 4FX6M 2BZNA 3LXAA 1QWGA 3DKJA 4UTHA 2ZZ1A 3MI3A 1H7WA 3GXPA 3UWUA 4FB7A 1UBSA 1EX5A 5L9FA 3QFEA 4N9DA 4DBDA 1ZJIA 4JY8A 3S9YA 4GC4A 3W86A 3T44A 2C15A 3FS2A 3FIGA 1KLZA 1OYBA 3H53A 1H7XA 1XUZA 2PE4A 2FB3A 1SZEA 3DFSA 2F84A 3FJ6A 3GYEA 4K7YA 4KWWA 4U28A 1SO4A 2QCFA 5D05A 3BLEA 4A22A 1OX5A 2ZRYA 3T40A 2RH9A 4EWND 2ZYFA 8TIMA 4XKYA 4NVTA 1H50A 4AEOA 1Q6LA 3U6WA 1P0NA 5D2YA 3TUUA 3QPZA 5HUPA 2A21A 1PHWA 1QAPA 2I14A 3PSWA 3C4UA 3GZ3A 3W1NA 5K4ZA 3GR8A 2Z1BA 2QKFA 2J88A 4IX0A 4UTTA 4QAIA 4WUIA 2V82A 3EX4A 4FNSA 4MOZA 1JR1A 5DXXA 1D3HA 3PBUA 4W9TA 5AHLA 3EWZA 2NZLA 3WK2A 3TW6A 5HR7A 1OFRA 2NUXA 3N73A 4UTIA 2X2GA 1KLYA 3LGEA 4UR7A 3W1LA 4IMCA 1SO6A 3NQVA 3O05A 4MJZA 4YCPA 3BLFA 3TMLA 3USBA 4AHQA 5FF0A 3PM6A 4O1BA 2EKCA 4UNKA 4A2RA 2VEKA 3GLCA 5BNKA 3EKZA 4DQWA 3WJXA 1YDVA 1YDNA 4A2SA 3UXAA 3IRDA 3G8RA 3CLMA 4ORIA 5HWNA 1JULA 2X1RA 3DU0A 4J9JA 4FNTA 4I7UA 1I45A 2P0OA 4UNLA 1QO5A 2ZZ2A 4ADSA 3C6CA 3HQ1A 1Q6QA 3GKFA 4JYDA 1NSJA 1DVJA 1B3OA 3LBCA 3BGJA 3P8IA 3GVGA 4ZMGA 2JGYA 2PRLA 1OK6A 3HO8A 1L6SA 2CLKA 3O06A 3PB0A 2GJLA 4JTJA 4LC6A 3U2OA 6TIMA 3YPIA 4LW7A 1R2SA 2ZRXA 3LCGA 1TV8A 2V0TA 3L0KA 4O52A 3ZWTA 2C18A 1OX6A 1H7NA 4GJ1A 3R2GA 3DH7A 4HSNA 3CQ0A 3LM7A 3FKKA 1B9BA 4HT3A 3NR0A 1C9DA 3NEVA 5K7JA 1G7UA 3E96A 4ADUA 1LYXA 1G67A 5A8GA 4HPXA 4NJKA 5EMUA 3M47A 3R12A 4YL2A 3S1XA 2RDWA 1K7FA 3WJWA 2NXHA 5DCEA 2E5DA 4IUOA 4LVAA 5CPMA 1F7BA 1RV8A 4UC5A 1I2PA 1OFBA 3A24A 1VLWA 2Z2UA 3W7GA 1F6KA 4UTJA 1YTEA 1S3HA 3S8HA 1PIIA 1KM6A 3SJ3A 3TK7A 3LXCA 3UYCA 1P1XA 2OCZA 5K9DA 4O50A 4MY1A 1AL8A 4GUGA 4ZVJA 4O0KA 3MMTA 2QJHA 1XFBA 1VYSX 3ZFHA 1W37A 3G1AA 1MEHA 2Q8ZA 1J5TA 1ZAJA 5D2VA 1LP6A 1VCGA 2QAPA 1KTNA 3O15A 1SO3A 4LWWA 3DXIA 4ZQOA 3I7QA 1YXCA 2Y62A 2O7SA 1J4EA 4LC8A 5D2WA 2DZSA 3W7LA 4O15A 2GJNA 3ATYA 1KFEA 3PY2A 2NUWA 4IOTA 5HNRA 1GJPA 1TPH1 1Q3NA 1W1ZA 4NX5A 3W71A 4A3UA 1F6PA 4DO5A 3LOTA 1LBMA 2Y85A 1JCJA 3L68A 4DXVA 4JTIA 2VFFA 4JNMA 3MP4A 4RLIA 4X3ZA 3VKJA 2G5WA 3TW7A 3KAOA 4N4PA 1DKWA 1MZHA 1W0MA 2I9EA 3SGZA 4CNPA 3PBWA 1FY6A 2X1SA 4K7VA 2V5BA 4JN6A 4UTMA 3L65A 1JCYA 3L0NA 1XM3A 1T0OA 4QISA 2QEZA 1LCOA 3DAQA 5C5YA 1KM4A 2QJIA 3CM4A 1I8JA 4LVBA 1MEWA 3ELFA 2QUUA 1I2OA 3PB2A 5E93A 1CX9A 3TH6A 3TSDA 4JX5A 1I2RA 3LXBA 4UTWA 1EEPA 5FF4A 3N9SA 1R46A 3HG4A 3DGRA 5CG7A 4AVFA 3LRMA 1FWSA 4RV8A 3S1WA 1KA9F 4M6VA 4QITA 4UR8A 5LNRA 4O14A 5LSMA 1L2UA 3W2UA 2ZZ4A 3EXRA 4MZ8A 4O1AA 3RF9A 2I1OA 3WK3A 3S6DA 2E77A 2W6RA 4XTDA 3SZ8A 1H51A 3G1DA 4LVDA 4WOZA 2P1FA 4YMZA 4UCGA 4XTIA 3BVJA 3PSVA 2A7NA 5BMXA 3FJLA 4LOCA 3T55A 3KXQA 1ME7A 3BLIA 1F73A 3LHVA 1O95A 1W3TA 3S1UA 3C3NA 2WJZA 1KM2A 1OFPA 1OFAA 5KMYA 2WQPA 1RQEA 2CLEA 4DO4A 3TA6A 3F4NA 3TIMA 1GWJA 5I3KA 1O60A 2H8XA 2DZTA 1UUMA 1YPIA 4Y96A 3QW3A 4CCDA 2WSRA 5AC8A 1KV5A 1D3GA 2YGYA 3THAA 3ZWSA 5K4XA 5C54A 4LVGA 4S2BA 2ZCGA 3EX3A 3GNNA 5DY3A 1CI1A 1T8XA 5FESA 2CWNA 1HL2A 5F1VA 3DI0A 4Z0JA 2EGZA 3PVFA 3A5VA 3TCEA 4QIUA 5DBUA 1VHNA 2PRMA 1K03A 1EIXA 1WV2A 5L6UA 2VEPA 3DHDA 4JIPA 3GAYA 2QF7A 3AO0A 4K37A 4O57A 3W7IA 3NQ6A 3CWNA 4K38A 3ABRA 5CZ0A 2QUTA 3W70A 4MY8A 3Q2DA 2J6XA 1TPFA 1UB3A 5G2HA 4M19A 2B0MA 4GBUA 3M9YA 4ZZ9A 2ATSA 1KTBA 3TQ0A 4O28A 4HHPA 3W22A 3ATZA 4FNPA 5AHNA 1TPDA 1ICSA 1XBYA 4K8HA 3C2FA 3KRZA 3LV6A 5FEZA 3W07A 2IQTA 1OFDA 4QJ1A 4DBEA 1GVQA 1ZAHA 2J9YA 1EP3A 3L9CA 4EF8A 3ABOA 2YFOA 4ZQMA 2YR1A 1QDSA 3KVLA 2VOMA 1DL3A 4HIBA 4WOQA 4H4IA 5G5IA 2NWRA 2HMCA 4UFLA 1GPWA 5HULA 5DCBA 1TPUA 3DFNA 4LVFA 3PUDA 3W75A 4UFMA 3LLFA 3NM1A 2NUYA 4N9CA 3B05A 4NX0A 1I2QA 1OABA 3G18A 3LCHA 1OFOA 3QW4B 1EA0A 3B03A 2X1UA 4AH7A 1O5KA 2GUUA 2RDUA 3P67A 1ICPA 5AFDA 2ISWA 2ISVA 1JJKA 3E12A 2E5CA 3PAJA 1FWRA 2V2HA 2QCCA 4JS3A 3C0JA 5K2ZA 5F2LA 1AW5A 3H54A 3M7WA 5LNVA 3S5OA 3P8JA 2XFWA 1DV7A 2FPYA 4O18A 1ML1A 1TCDA 4ZL1A 2WPBA 4RZ6A 2QDHA 1K8ZA 1SZFA 1FDYA 3GK0A 5I3IA 4MZ1A 3MHGA 4Z1BA 3O1NA 4LY8A 3DFPA 3W7PA 5LHFA 4MFDA 3M16A 3W23A 3W7QA 4ZQCA 3NM3A 1YYAA 1J2WA 3HGJA 2FB2A 3MBFA 4PODA 2PRHA 3W73A 3O6DA 1B4KA 3W88A 4NUWA 1Q45A 4C1KA 5CPLA 3SIZA 1NAL1 2OMAA 1W5QA 2C6QA 3NAVA 1YTDA 3GDKA 1Y0EA 3NL3A 4JTGA 3HB9A 2H6RA 4AF0B 1G4PA 5AN7A 3NL6A 3BG5A 1H7RA 1VGAA 5KZDA 3W1TA 4GUJA 2VFHA 2NX1A 3IEBA 4BI7A 4UTKA 2E1DA 2Q8LA 1QPQA 6ALDA 4GUHA 2HTMA 3RNDA 2QCGA 1EPXA 1WDWA 1LDCA 3GAKA 3W7DA 1AW1A 4TR9A 3W2MA 3UQNA 1OHLA 2J27A 3G0UA 3WJZA 4NJHA 3ABQA 2A5HA 5DBTA 4O13A 4YLWA 3H55A 3KRUA 3G0SA 1H60A 1JUEA 2W79A 5EPDA 4Y8FA 1K7XA 1WYIA 4XUGA 1QPNA 3DZ1A 5C2XA 1VC4A 2YSWA 2HS6A 1OJXA 3GR7A 2ALDA 4LU0A 2H3DA 3KVMA 4QNEA 4E38A 1H5YA 1VLIA 1P4CA 1X8FA 1Z44A 5D30A 1GVOA 3CTLA 4M7TA 4CCCA 4O1CA 2VXNA 3MHFA 5LNWA 4BR1A 1ZFJA 3IGXA 3L66A 3T4CA 4PCFA 3QM3A 3M5ZA 4P2VA 3FFSA 2A4AA 3EWWA 4LTSA 2A0NA 3P80A 2VELA 3MWAA 2BLEA 3NPXA 4UIOA 4K6AA 4R53A 3SECA 3GDRA 1LLWA 2LLEA 4WZHA 1S5VA 3G0XA 4O4WA 4GUIA 1WOBA 1SZNA 1AMKA 2Z0IA 3FYOA 3WJSA 1G7VA 3DFQA 1WQ5A 3I65A 4G1KA 2Y7GA 2X30A 1PCWA 5IM51 2Y88A 4HNUA 2B7NA 3NL2A 3KHJA 3P74A 4JDBA 5BRBA 3Q37A 2C19A 2ZA3A 4C1LA 4MVAA 4N2YA 3F03K 2E09A 1IXNA 3SGUA 2ISSA 3FYPA 4HNTA 2FJKA 1VQTA 4NZFA 4RZ4A 3GIYA 1DOSA 3F4WA 1BWKA 3QMRA 2G96A 4DELA 5J5DA 3C52A 1H63A 4YWIA 4UMCA 3IIVA 1QOQA 3OIXA 1ME9A 5AC7A 2EF9A 2YYTA 2AQWA 1BKSA 3IIOA 3S42A 3WFAA 2PCQA 3LCFA 1JUBA 3UXDA 4DPQA 3HGOA 1TTQA 3LERA 3GNDA 3LCWA 1WX0A 2JKEA 3TFCA 4XZ9A 4BF9A 3DKLA 5CPOA 1KTCA 5EYWA 3UD6A 1JCMP 3CB8A 1CW2A 1V5XA 5I3JA 4FXSA 3NOEA 3DBPA 1JQXA 4TMCA 3RK8A 1K8XA 5AOUA 1EWEA 1JUKA 4RX0A 2EPHA 1S5WA 1OFEA 5DLCA 4CNNA 4N6FA 3UY7A 1SO5A 2C1HA 3MW7A 4UMBA 3OHIA 2C13A 2GPTA 4HN4A 4NJGA 4WXZA 1LBLA 1FXPA 3BW3A 4R7JA 4YCOA 1EUNA 3QSRA 5CSSA 4Q4KA 5G4EA 3B8DA 3G8EA 4NQ1A 3NNTA 5K3VA 1HO1A 2R94A 3GX9A 3NQDA 3P61A 3B4UA 3TJLA 1X6UA 3B04A 1F76A 2VFIA 4OE7A 1WOAA 2CFFA 4CCEA 4L4MA 1C8VA 4IX2A 5DN1A 3TSMA 2D73A 3W7NA 4M6PA 2H8ZA 3C2EA 3M41A 4LUIA 3MP5A 1B4EA 4BI6A 5EA9A 3Q58A 3NPUA 4M7SA 3L5MA 1FWTA 2WSYA 3JR2A 5D03A 5EKYA 5FEWA 3LX9A 3BG9A 1DJNA 1KFLA 1F74A 3D0CA 4DO6A 2B7OA 3LCIA 3OVPA 4UTTC 4EOUA 1Q6RA 4ZQRA 3W72A 1SFLA 2QAFA 2WNQA 5HWJA 2WSQA 5HJLA 3HBLA 4D2JA 3STCA 4GWEA 3TFXA 5EY5A 1PE1A 3NDOA 3W85A 1KV8A 1ZY9A 1D9EA 4O8RA 3L5AA 4BWLC 3TMQA 2NWSA 1TTJA 4JGDA 1QR7A 3IIPA 1EUAA 2VC6A 1KFCA 3W1MA 1OFQA 3LHUA 4AF0A 2BX7A 5G2IA 4OT7A 4N9BA 2ZTKA 2X16A 1TPEA 3TSBA 4CQAA 3NVTA 3W87A 2CZFA 1VCFA 3IIZA 1SW7A 1DQWA 3LV5A 5DCDA 5AYXA 2OZ0A 1GVSA 1KBJA 5IBXA 3UWYA 3R89A 1NF0A 1PV8A 2V30A 4O54A 1GOXA 5EL1A 1ZENA 4BFAA 2DZXA 1A53A 2QCDA 1YLVA 4HSOA 2ZZ3A 1L6YA 3A5FA 2E5BA 1EP2A 1QOPA 1TRIA 5FF2A 1RD5A 1R47A 1HUVA 4YXGA 5CZJA 2OT1A 3G22A 4MPQA 3GXNA 4BI5A 2VFDA 1RVGA 3I68A 4CQ9A 4Y9AA 3UWZA 5AHEA 3W83A 3PULA 3SY5A 1FQ0A 2O7QA 1G6CA 1C29A 3CEUA 2FIQA 4O16A 1A5BA 4PTNA 1KFJA 5K9XA 3W2LA 4JTSA 3PF3A 1KFBA 4JYEA 4Z1CA 5TBOA 4WY0F 4HKPA 4MZYA 4E2DA 2ABBA 4TO8A 4LT9A 1FCUA 3CIXA 4ZQPA 5LZLA 1TO3A 3BG3A 3EXTA 1BTMA 2B7QA 3FLUA 4MKNA 2NX3A 4LS1A 1LOLA 1XDMA 4A29A 1W31A 3BO9A 3L21A 2WV8A 3N3MA 3VI2A 2JKPA 4JR5A 1FWNA 1MO0A 1O4UA 2FFCA 4FF7A 1ALDA 1M7OA 1LRNA 1TIMA 5SWUA 3G1XA 4OQVA 2NXIA 3SI9A 2XN0A 5D02A 3NL5A 2J24A 3B0PA 1TPB1 4OGZA 3INPA 3NQFA 3KOFA 4XQ6A 3QYQA 3NPWA 5E1QA 1WA3A 3PR2A 3LRKA 5D37A 5J5RA 4IXXA 2ATMA 1F2JA 3KFTA 4N6EA 1T96A 3HGSA 4O0ZA 3S5NA 3UZ5A 3FKRA 4FX7A 2J9ZA 1SUXA 3W1QA 4O19A 2TYSA 4QNWA 3BPWA 3PUEA 1R30A 1RQBA 4MLJA 5MHBA 1FWWA 1L9WA 4ICNA 2FQIA 2CZDA 2R8WA 4O11A 1FCVA 4FNUA 2NXGA 3IV3A 3HPSA 1MXSA 3C2RA 4NJJA 4JTLA 2WNZA 3HG5A 2BXVA 2V8ZA 2NLIA 2EAWA 2VFGA 1JVNA 4KFPA 5K9CA 2E68A 4HNVA 5LGZA 3UWWA 3NYZA 1DBTA 1GT8A 1OX4A 1XI3A 3C61A 3G1SA 3QSTA 4K8EA 4WQ6A 2E6YA 4KFOA 3IIXA 1KFKA 3TR2A 1I2NA 3LTYA 4RXGA 5H2ZA 3NQ7A 1AL7A 1RPXA 3P5YA 3NQAA 3W1RA 4RKAA 4JTKA 4UFIA 3W2KA 3LCLA 4DF2A 3W6YA 1TSIA 4RK8A 5LKYA 3QC3A 3TAKA 4BWLA 1KM0A 4CLMA 1TV5A 4WXYA 4QSHA 3TV8A 4IPJA 5DXYA 4LS0A 5H91A 1T99A 2YW3A 5D32A 4PL1A 1K02A 3QZEA 4IMGA 2KZHA 2B4GA 3BW2A 2G95A 3GB6A 4UFKA 3T7VA 2ZZ7A 4XWUA 4IMFA 4HNNA 5FEXA 3MI6A 3QJAA 1SZGA 3BK0A 3TXVA 3M5XA 5FEPA 1MSSA 2A6LA 1VCVA 3LI1A 1HO4A 3S5YA 2RDTA 4R34A 4GE8A 3PWAA 1N7KA 1U83A 1NEYA 4NJIA 4S2CA 1YTKA 2DZVA 3BV4A 5I3HA 3RFAA 5HR6A 5DELA 3SR7A 2QCLA 5BMWA 3DENA 1GG0A 4IWWA 1FUYA 4JTHA 4X22A 4WY0A 3O63A 4AHOA 3N2XA 3OBKA 4NXSA 4JICA 1NF7A 3UPWA 4MUZA 5HQEA 3MHUA 5D04C 2H3BA 3LTPA 3DHFA 2A6NA 3TE9A 4IMEA 2ZDRA 3P84A 3PG8A 2CLHA 4MLRA 3P7YA 5BW6A 3CHVA 2YYUA 2Q3RA 4CNOA 1VRDA 3LBMA 1GG1A 7TIMA 5ABTA 5D38A 1FCQA 3GDMA 3O07A 1GTEA 1ZAIA 2JK2A 2QDGA 2J9XA 1H7PA 1P5BA 1X1OA 1QPRA 4GXMA 3C8FA 2QCNA 2Q3OA 3NGJA 3C2VA 1VS1A 3W1UA 4MJMA 1RZMA 3N19B 2CLLA 1KM5A 1UASA 4PC8A 4I7VA 1QNVA 1PVNA 3DFOA 5CZTA 4MIMA 4IGHA 1VZWA 3V1PA 3W2NA 4Z08A 1AW2A 3PC0A 2QCDB 3E9AA 1H1ZA 5TIMA 1M7PA 1ZALA 2UV8G 3FEMA 2BTMA 2YCEA 1QPOA 3MUXA 2W0UA 1W5PA 1OF6A 4EF9A 5IBXC 1PHQA 5CZSA 4FNRA 4RJEA 3OA3A 1LRQA 2HSAA 3QH2A 1WBHA 3FOKA 1G69A 4JD4A 5A5WA 3STEA 2PURA 3MI2A 4JTTA 2YZRA 2R14A 5AYYA 5KZMA 4PFMA 3LLDA 3T78A 3P5ZA 1BWLA 1PCKA 5G4WA 1LZOA 3W7HA 1H1YA 4U4MA 4O1DA 4IPIA 4PH6A 3BARA 3TNOA 3WJYA 1K8YA 4JY9A 5C6MA 2OX1A 3B0UX 1UCWA 4NNCA 1W3NA 4Y90A 4K36A 1KW1A 3W1AA 2GQ8A 4KFNA 3FA5A 3W2JA 3S1VA 3CPRA 5DY2A 4ORMA 2A2IA 1FXQA 2G97A 1R2RA 5EBUA 3HIJA 3P60A 5GVJA 2RFGA 2A7RA 2GQ9A 3A9IA 2C3ZA 3AJXA 2CW6A 3E02A 1SW3A 3M5VA 3P81A 2Y7EA 3G1HA 1XCFA 1YXDA 3HG2A 5D09A 3HF3A 3PBVA 5T26A 3VE7A 1TPVA 4A21A 1TREA 3OVRA 1ICQA 2XN2A 3W7EA 3PUOA 4LNYA 2F7FA 4AWTA 1UJPA 3HMJG 1TV7A 4B5NA 4JX6A 3DI1A 4H3DA 3JRKA 4UFJA 4Z1AA 1KM3A 1N8FA 3MYPA 4KWVA 5CPNA 4XBKA 1XUUA 3TU9A 2V9DA 1TB3A 3IGUA 5F2IA 1EP1A 5CGQA 1F5ZA 2ZRWA 4AB4A 3GKAA 1G4EA 4GRSA 5HUOA 1SU5A 5CSRA 4DF1A 5AC6A 2VKZG 3C56A 4XKYB 3G3DA 3G1FA 5FF3A 5HMSA 1SR9A 4BK9A 1SW0A 1JRBA 2ZRUA 4TX9A 3TAOA 2V2CA 4RZ5A 1SFJA 1TTPA 1K3UA 4FXRA 3KVKA 1W5NA 2Z6JA 1M6JA 4AAJA 5HINA 2DJXA 3M0ZA 1Z42A 5LNUA 5KITA 4UMAA 1IXOA 4EVZA 1GYNA 4JTFA 4K39A
chains in the Genus database with same CATH superfamily
2YL9A 2PDBA 2QUVA 2TPSA 3UP8A 3TQKA 1QI0A 3DFTA 3KX6A 2V3DA 3ZS4A 4JFVA 1PDZA 4YNGA 3MYOA 3R10A 3GDLA 3OG3A 4N7QA 2HS8A 1GYLA 3IWPA 3MA8A 3CWHA 2PWFA 1QFEA 2ACSA 1GEQA 3W02A 2WC4A 5BOOA 3NUKA 1UQZA 1TQXA 4QM1A 1AJ2A 1Q63A 4NZ4A 3VKKA 2YCLA 1M5WA 3SN0A 1IEQA 2OYMA 2X1IA 1LL4A 3OA5A 1LG1A 4Q8QA 3BW4A 3O16A 2CXGA 3HJZA 1SSDA 4F2BA 2CBVA 3LHZA 4GXWA 3ABSA 4YIWA 1VFFA 2Y63A 4LV9A 1L6WA 1P6WA 3TDFA 1LJYA 3EGJA 4UWMA 4L4LA 3W7OA 1HNYA 3PWGA 2AAMA 3FSUA 4R5EA 3MUIA 1AK5A 4DPPA 3NO3A 1FH7A 3WZ0E 3M0LA 4ZTXA 4XISA 5BYWA 3W76A 3MZNA 1XBVA 4GACA 4NZ3A 3W7KA 4AYGA 5D9NA 3VIPA 1AVAA 7XIMA 4B91A 3W1XA 1GZJA 5BWFA 1KWKA 4XZHA 4LRTA 3DYOA 5H8MA 3DYMA 5FF7A 1W8SA 4MYXA 2TRSA 4OV9A 4LRSA 1VP5A 4ZQNA 4LS2A 3VUPA 1IF2A 1PS9A 1J12A 5ABFB 1UYQA 1XCXA 3RLUA 4PTWA 5FIPA 1PSCA 2HWGA 2WLYA 2VZUA 3WELA 5DRCA 1PZ0A 1EX1A 3HOJA 3QQ0A 3GNXA 2QCEA 3NQCA 1PZ1A 7ODCA 1JYVA 4P7RA 4Q32A 5M03A 4AZ6A 4MFEA 1VPXA 1MMFA 2ACRA 4K8GA 2ZVRA 3L4YA 2VYOA 3DEQA 3NQ8A 3OTRA 1OVDA 2FPVA 3CO4A 4I5UA 2EPMX 3VKBA 1HJQA 2X7WA 2HPMA 2GUYA 3OOQA 3W38A 3N34A 4CQ8A 3NPVA 3UZXA 3G1VA 1JF5A 3QHNA 3IGHX 1P43A 2NQHA 4KKXA 4AQLA 4PMRA 1BF2A 2JFEX 1BG9A 1R3YA 4FK9A 4D6IA 3M44A 4M81A 3VKAA 5LYRA 1ZGDA 4KERA 5D2XA 4A8IA 4DXXA 3RU6A 1MWOA 4W5UA 1UOKA 4UTWC 5KSWA 1W2PA 2V38A 5HOSA 5GNYA 4AHPA 2QNEA 1MUCA 1ZP4A 3FA4A 1E6NA 2WBGA 4JTDA 1ZB5A 4FEZA 1ZCOA 1GQNA 2QCHA 2VEMA 4N9EA 1VB9A 3SIMA 3T08A 4F0LA 1C91A 1JEZA 1EYEA 4W87A 1TTIA 1LT7A 1FX6A 2V6AA 2WMIA 2YZ5A 1KC7A 4PL2A 1FKWA 1P0KA 1MDLA 2NW0A 1DJQA 4TU1A 4FLQA 2X8RA 2ZZ5A 5E0KA 3MBDA 1UZ4A 3BCJA 2ZXDA 3ISIX 3R11A 4RDVA 2I5IA 1IXQA 4NNBA 1BRLB 2O4MA 4OBRA 4PMZA 4JDYA 5AB3A 1LLZA 1S5TA 2Y6ZA 1FHLA 4PCSA 1LTDA 3WCZA 2CLIA 5A2AA 3M1ZA 5F4WA 5MKGA 2CU0A 3V4BA 4G7EA 3FV9A 2OT0A 2W3ZA 4MJ4A 3HGRA 4FF5A 2ZA1A 2GJRA 4HP5A 2VX6A 4OV4A 1XKYA 4YHEA 2DZPA 4H6QA 4RPQA 2EXOA 1JZ3A 4ILSA 5T91A 1TUXA 1WPCA 1WXJA 5T9CE 4FIQA 3F4CA 1W9BM 4JTUA 4H2HA 2KX9A 3HV8A 1YW1A 3B4YA 2PC4A 3SY8A 4AUBA 2C0AA 1WNOA 4DJFC 1IWPA 2BVDA 3UNDA 1U22A 4XAYA 3UWEA 1JCNA 1KGXA 4P61A 3F7JA 3AHZA 2DIEA 2WZIA 2YXOA 4YVXA 3TYEA 3AS3A 3O6YX 3I7RA 3SURA 4YTQA 5PTDA 3S3GA 3Q94A 1R2TA 1UWRA 3S5ZA 1XDLA 3KBMA 4UZUA 3I3EA 2X0HA 4Q7BA 1C92A 2QJGA 3EWUA 4QFUA 4JFUA 3STPA 4W7UA 1WBJA 2YBUA 3OVQA 2WMHA 1EA9C 1XLJA 3GXTA 2WAGA 3CZKA 4H7ZA 1J2BA 5MKGB 1FDJA 3GIPA 2IXUA 1XBXA 2GGJA 3VIJA 4JHMA 1DIDA 3E0LA 3UYIA 3L0GA 4GI4A 2PTZA 3GU9A 3F1QA 4WX2A 4O10A 3S0CA 1EB3A 4A3RA 3QQ1A 2GOUA 5HNNA 5F4XA 5HMFA 3STGA 3M7SA 1NFGA 2HXTA 3NWRA 1XYLA 3ES7A 3CT7A 2J62A 4UR9A 1XLEA 4LANA 1F6YA 2FMOA 2XSAA 1XSIA 3IUDA 4LYPA 2BZNA 2HNEA 2RAGA 1E0UA 3QV7A 3PTMA 3QFEA 7REQB 5BU6A 4GC4A 3W86A 1M3UA 4LALA 3T44A 4PCTA 4U3AA 4ZO8A 1EF2A 4R9XA 1XUZA 2FB3A 4E8GA 2F84A 3OLIA 4KWWA 3U7VA 2QCFA 4RL3A 3SO7A 2CERA 4D6EA 3PPHA 1EGVA 3QY7A 1OX5A 2RH9A 4LYQA 1ISVA 3AAMA 3WUBA 3Q45A 3CZLA 1LUCA 1Q6LA 3LNMA 2QV4A 2VP8A 1P0NA 1WDRA 3M0XA 3QPZA 5HUPA 2A21A 2I14A 2XIBA 4H2CA 1ZSXA 1MW2A 1XPGA 4OTKA 2QKFA 1W9XA 5A6JA 1WXZA 2J88A 1B3ZA 2BGQA 3TVAA 3WMCA 4Q7IA 1G1YA 1AH4A 5DXXA 4IJRA 5AHLA 2KAUC 1A4MA 4M1RA 4RNIA 2E0PA 3RO8A 1V7AA 3BL3A 4IMCA 3W1LA 3O9NA 3BMXA 2NVCA 1OT1A 2VEKA 3GLCA 3WLIA 2J7EA 5BNKA 2I5QA 2WM0A 1E4IA 3QY6A 3WJXA 4R85A 4ATWA 5HJXA 2WYSA 4UQCA 2V5DA 4ORIA 4HA4A 3JU2A 1JULA 3IACA 2X1RA 4CU7A 3QKZA 1P48A 3GW3A 2D23A 2ZZ2A 3QV9A 4ADSA 3K8KA 3S2JA 1PDYA 1BD0A 2G37A 3WQGA 3A9BA 5HANA 4J40A 3B8IA 4WJ8A 3GVGA 2NQ9A 4H9TA 3URAA 2PRLA 3HO8A 4FOKA 3FVMA 3PJXA 3E38A 2GSJA 2C7FA 3QGAC 3ZQ9A 4KCTA 4GI9A 6REQA 4LC6A 4IQDA 1IEWA 4H19A 1R2SA 3L0KA 4O52A 1XX1A 1EH9A 3ZWTA 2YDSA 1R7AA 3UJFA 2G41A 2PMQA 4HCLA 4HSNA 1I1WA 3NYDA 3CUZA 4F0KA 3CQ0A 1B9BA 4HT3A 1C9DA 2PWVA 2TAAA 1PAMA 5K7JA 4H9ZA 4ADUA 4AWEA 4AMCA 1G67A 4V1YA 4HPXA 1NU5A 1XYBA 1N8IA 4LVAA 5CPMA 2DEPA 2PAJA 3NCOA 2ZXAA 2JEPA 3A24A 1S5NA 4PFHA 1AZ2A 3S8HA 4PYSA 3C5QA 2YDQA 3UYCA 4O50A 4MY1A 2VNCA 4ZVJA 4O0KA 4Y8EA 1EOKA 5JH2A 2BY0A 2ZUNA 2BNJA 2GK1A 6TAAA 2GL5A 3AHTA 5JMUA 1MEHA 2VZVA 5GNZA 1LP6A 3AROA 5D4YA 4TUFA 1KTNA 3VKDA 1WP6A 1QI3A 4YU1A 2Y62A 3WQPA 3ZIZA 3G2GA 5A6KA 4IPNB 3PY2A 2GSHA 5A2BA 1TPH1 3LSBA 2CEQA 1XF0A 4Q4QA 3W71A 1AJZA 3QR3A 4RNFA 4XAPA 2Y85A 1OGGA 3L68A 4X3ZA 1ZBWA 1O12A 2ZUWA 2X1SA 1KBLA 4PCPA 3QR1A 1ISWA 3F2BA 1EFZA 1E5NA 4JN6A 2R6OA 4JFTA 3SUUA 2QEZA 3EOSA 1KCLA 3AXXA 2PFHA 4KT2A 3ARQA 1JYNA 1I8JA 1PZ2A 1LLOA 5JUVA 4LVBA 3PB2A 2YCJA 3RILA 1CX9A 3TH6A 3L4UA 3UESA 1EF3A 1BHGA 1OCNA 7PTDA 2OSYA 3ZMRA 3N9SA 4DJDC 1OGBA 1DTUA 5H1WA 5CG7A 3T42A 4N42A 3DN5A 4JTCA 4DWSA 1DJXA 4QITA 2ZUUA 2VHLA 4O14A 3GC5A 3KCOA 1E0XA 3O0KA 4X0VA 2WBKA 5C70A 4O1AA 2I1OA 2ALRA 3S6DA 2E77A 4MAVA 2W6RA 4XTDA 1E6ZA 1AQHA 3WQDA 3G1DA 1EXPA 5CLTA 1XIEA 4UCGA 2A7NA 4LOCA 3URNA 1ITUA 3KXQA 1TELA 3BLIA 1E40A 1HW6A 3LHVA 3W24A 4REQB 3SQMA 1W3TA 2OVLA 2WJZA 3VC6A 2CLEA 5A69A 1MW0A 3RMEA 1X39A 3TA6A 2Z2BA 4XO6A 4Q4PA 3ARSA 2W62A 2QQ6A 3CV6A 3GG1A 3PPFA 3U3HA 1H2JA 3ZT6A 3VOHA 1QNSA 3WF3A 1GWJA 1R3RA 1O60A 1PTGA 4GC3A 1EC8A 1UUMA 4Y96A 4CCDA 2WSRA 3GXMA 3EA1A 5K4XA 1K4HA 4C6NA 1V02A 4DZHA 5EMKA 2VZSA 3AIVA 4LVGA 1V93A 2OO0A 3GNNA 3B9NA 1C9WA 2CCRA 4XX6A 4Z0JA 1UJQA 4MJ2A 4WVXA 3SQSA 2WJDA 3BLPX 4H04A 1V3IA 3VOCA 1JZ4A 2PRMA 4GD0A 3DHDA 4JIPA 3AO0A 3L12A 4BQ3A 4UQBA 4JKMA 1UOZA 3H4WA 1HL8A 4K38A 2PBOA 5CZ0A 2OKOA 4I6KA 2W4XA 3RM9A 4QG6A 1TPFA 2FFIA 1EO7A 5G2HA 4JL1A 4GBUA 4ZZ9A 3WF2A 3WUEA 2WLZA 1KTBA 2J47A 2QIWA 5JU6A 3OYXA 5AHNA 1H3GA 3LV6A 1A3XA 2IQTA 1D2KA 4QJ1A 1ONXA 4DJFD 1I0DA 2DGAA 1EP3A 3L9CA 4EF8A 4UQ9A 1QDSA 3KVLA 3II1A 3KLLA 4GY7A 3H2EA 1M41A 4EE9A 2VOMA 4JKKA 1TV2A 4GGBA 5DMNA 2NT0A 4LVFA 1H11A 2V5CA 3W75A 2Z7KA 4UFMA 3LLFA 3NM1A 2NUYA 4N9CA 1I2QA 1UR8A 2F38A 3G18A 1OFOA 1EA0A 3PJUA 2X1UA 1KR1A 1KD0A 1O5RA 4G6CA 2RDUA 5AFDA 1OIMA 2ISVA 4MGGA 1FWRA 3C0JA 5F2LA 3VFCA 1W2VA 1AW5A 3H54A 5LNVA 3DHPA 3LZ5A 2J8GA 1JFXA 2I7GA 2FPYA 4O18A 3VD5A 2GGHA 4KRTA 5AYIA 1DE6A 4MUPA 3MHGA 3O1NA 3QHOA 3BXWA 4LY8A 4X9YA 2PTDA 1OB0A 3VIMA 3DFHA 1Y65A 3M16A 1OC7A 4ZQCA 5CG0A 3RAOA 1YYAA 3HGJA 1GUVA 2PRHA 3W73A 1Q7ZA 2W63A 5C2GA 3E6EA 4W85A 4Y9OA 3W82A 5JBDA 1Q45A 5CPLA 1PB0A 2AOSA 2VGFA 3PZNA 1G4PA 3AU2A 3HPFA 3KBNA 4PTDA 3NL6A 1H7RA 3CH9A 5CEWA 4OKDA 2VFHA 3IEBA 3AICA 5BRPA 3OZOA 4UTKA 3O0FA 1V6XA 2Q8LA 4W8LA 2DV0A 1I75A 4GUHA 4JZ5A 3TLQA 1EPXA 2PWHA 4M29A 1R87A 4L9YA 4H8HA 4TR9A 3T8LA 3G0UA 4NJHA 3ABQA 5DBTA 3UCDA 3LBOA 2WZEA 1H60A 2E67A 2Q71A 1V4YA 3AFBA 4QXIA 3DZ1A 1VC4A 4O1FA 2XH7A 3GR7A 4G56A 1YKWA 1QK0A 2VM8A 3KVMA 1R9YA 1BQGA 4M7TA 3MHFA 4AY7A 1PKNA 3L66A 1DWJM 1ZS2A 1TZ7A 1AJ0A 1TJ0A 3MWAA 3RITA 5I06A 1RVKA 2XGIA 4UIOA 3SECA 3DG7A 3GDRA 1LLWA 4H9MA 4WZHA 3G0XA 4FLSA 4GUIA 1SZNA 4KGJA 4M56A 1E73M 3S9IA 2GGIA 3FYOA 1G7VA 3EZ4A 3VOJA 3DFQA 3AIBA 1WQ5A 3W29A 2Y7GA 2FZNA 2Y88A 4IUGA 5HMDA 3KHJA 1RJQA 5AC4A 1DXIA 2C19A 4A8LA 4CKQA 4MVAA 3F03K 1IXNA 1HGWA 4PB3A 1VEMA 2ISSA 5FAJA 1R9ZA 1JG9A 5J04A 3IJ7A 3MDWA 4CN4A 3AALA 1DOSA 1BWKA 4DELA 5J5DA 9XIAA 5CBJA 4YWIA 3UZYA 1U5HA 2OLAA 1ME9A 2EBNA 3AQUA 4DWSD 3OGSA 3P3BA 3WFAA 5TD4A 3RJYA 4B4FA 4EKJA 3UXDA 3KS5A 4DPQA 2D3NA 3GFZA 3LERA 3GNDA 3VGGA 1WX0A 2JKEA 4AEEA 2Z1WA 5CPOA 1KTCA 4GZEA 4AVNA 4FXSA 4LBUA 3N9KA 3W01A 1K8XA 1EWEA 1JPDX 2BY3A 4BQ2A 2QT3A 2BODX 1S5WA 1OFEA 4CNNA 4Q6JA 2VCBA 4N6FA 1KWGA 3USZA 1XIIA 2XH4A 2Y5SA 2ZE0A 5D8WA 1U1HA 2VC9A 1Z7AA 4QJ3B 1KBBA 1Q4WA 4H8UA 1OC6A 4WXZA 3CIVA 1JPIA 1FXPA 3BW3A 3E2RA 4AZCB 1V02E 2ONEA 4W86A 3QSRA 4Q4KA 5G4EA 3T1GA 3B8DA 2QVNA 2GK1B 1DP0A 2XGBA 3MKCA 3AUOA 1HO1A 3GX9A 3TJLA 3GTHA 1UD8A 1QHZA 2A3EA 3TOPA 1FWDC 3AUJA 4NILA 1YPXA 2H8ZA 3AXIA 4S38A 3AWNA 1PIFA 4AIOA 1ZJHA 4YTRA 1ZTVA 1J8VA 1TZ9A 5D03A 5FEWA 1ZRQA 1JF6A 3TP4A 2E28A 4GQQA 4PUNA 4RE2A 1Q6RA 4ZQRA 4IICA 1TA3A 3TN6A 4I9MA 2G50A 2WSQA 1RCOB 3SRFA 3KRBA 1POKA 3TFXA 2WB5A 2QZRA 4XZWA 4GY1A 4JBRA 4O8RA 4C6PA 4BWLC 3PFRA 1TTJA 1TA3B 2XVPA 3VD9A 5BROA 1EUAA 2VC6A 3GUGA 3SN1A 1HP4A 1JZ7A 3V5FA 2ZX7A 2CZFA 1VCFA 3IIZA 4IGMA 1SW7A 4KWUA 1BSIA 4D1IA 5DCDA 2Y5JA 3UETA 2PWDA 2QPXA 4WDXA 1DJHA 1LT8A 1F61A 2HNHA 4BFAA 1A53A 2ZZ3A 4NAFA 4HSOA 3VCNA 4EK7A 4IT1A 3PPCA 1EP2A 2FHFA 4AC7C 1BG4A 4LH8A 3LPOA 3O2LA 3WLQA 3ZT5A 2XDFA 3M46A 3ZLGA 3GXNA 1E4LA 2HVOA 1JCTA 4RDZA 5AHEA 3UWZA 3VGBA 2W92A 1FQ0A 3H2AA 1IQ8A 3CEUA 3V0SA 2FIQA 4QGCA 1KFJA 3W2LA 2OEKA 2HDJA 1IZCA 5TBOA 4WY0F 4E2DA 2R1LA 1V6YA 1POJA 2HISA 4ZQPA 3EXTA 4QLKA 3C8NA 1TO3A 3BTNA 4MKNA 4GPNA 2BY1A 1LOLA 2Y8VA 4PMUA 3VI2A 2JKPA 1FWNA 1L6GA 4F0RA 5SWUA 1ALDA 5HJYA 1J10A 2FZMA 2F2HA 2ON3A 3TYBA 4OGZA 3INPA 4X0NA 3PR2A 4IXXA 3H22A 3KFTA 3F5KA 3M0VA 3LMZA 1ZZMA 3HGSA 3UZ5A 3FKRA 4IG2B 1GVIA 2TYSA 4A8NA 4L65A 5FJPA 3PUEA 4MLJA 4ICNA 4GINA 2R8WA 4O11A 3UXIA 4DM2A 1NARA 2NXGA 1VJZA 2WCGA 1C93A 1MXSA 1ZBCA 1QPKA 4ZB5A 2PU0A 4JTLA 3SCOA 1WDSA 3UU0A 2V8ZA 2NLIA 1JVNA 2OZ3A 4Z2KA 4HYVA 4D1JA 4F8XA 1S38A 3K2GA 4HNVA 1EIBA 3N3TA 2DFAA 3WH6A 4PTXA 3C61A 3EOUA 5EB8A 3TLLA 3L2LA 3AS0A 1KFKA 1I2NA 3T05A 4F9DA 1JD7A 3P5YA 3W1RA 4QP0A 4RKAA 3LSCA 4JTKA 3W2KA 2BFGA 4TV6A 3L4VA 1VEOA 3C3UA 1Q4NX 3BV7A 3LGGA 1V3MA 3E2SA 1JIBA 3ZT7A 1TSIA 4XD4A 1X7IA 1LL6A 3QC3A 3E74A 2GOKA 1UD5A 4S23A 1TV5A 4QSHA 2OSWA 1XYFA 3MSDA 4IPJA 5DXYA 4LS0A 1S2TA 4PL1A 4IMGA 1F3TA 4IJCA 3MKKA 1A5NC 1FP9A 3CUXA 3TNBA 4XWUA 4HNNA 1XGEA 3MI6A 2Q09A 1J18A 3OLDA 3ZOAA 1JFHA 2RDTA 2DZBA 3GO2A 3TTSA 1N7KA 4K1WA 4EAYA 3CAQA 1YTKA 1EL3A 3GC2A 2G3FA 5I3HA 1UD4A 5HR6A 5DELA 4L64A 1Z6KA 1GG0A 2VRQA 3A3WA 4IWWA 2PDPA 5BXSA 4JTHA 3O63A 3P0WA 4JICA 4H6EA 3VX0A 1A47A 5HQEA 4J27A 2H3BA 3LTPA 3QBUA 5IDZA 1NIUA 1AD4A 2MNRA 5REQA 4HU4A 1VFMA 2YDRA 4S3AA 3PBGA 3P84A 4V1XA 4MLRA 5BW6A 2DSZA 1RA5A 3CHVA 1E9ZB 1VRDA 3PJTA 5F7UA 1PX3A 3CYJA 3AXHA 3O07A 3B8SA 1Q6CA 1ZAIA 4Y7EA 1BFNA 2J9XA 1P5BA 4IQEA 2VI0A 4QCFA 1V3LA 2FGLA 2Y24A 6REQB 2QCNA 2Q3OA 2TODA 3NGJA 2VX5A 4KEVA 1KM5A 2VC5A 4I7VA 1HJXA 1QNVA 4PRWA 4W93A 4DX3A 5CZTA 4MIMA 1CECA 3TTYA 1E3XA 3U4FA 3NZPA 2QCDB 4CUCA 1ZALA 2ZX8A 4ACZB 3K13A 2J7HA 3ZR6A 4Q8WA 5HQLA 3VZYA 1QPOA 3MUXA 4NF7A 2OG9A 5C9ZA 4GQ0A 4D6CA 4EF9A 1PHQA 5IBXC 4FNRA 3XIMA 3UERA 4CD5A 2ASHA 2HSAA 3QOKA 4J5NA 5ECVA 1BYCA 3WEMA 1G69A 4JD4A 1X38A 3STEA 2WVVB 4XAGA 3AMDA 2YZRA 1V51A 3M64A 1AQFA 3LLDA 3ZLFA 1UP3A 3WDRA 4ICCX 4C7DA 1BWLA 5G4WA 1LZOA 3W7HA 3PTKA 3KBVA 4JEJA 4GLEA 3A3HA 4PH6A 3W28A 2VWTA 1LL7A 1XLKA 2UY2A 3WJYA 1K8YA 2GDQA 3H6OA 2OX1A 4XG1A 4NNCA 3UNTA 1W3NA 4Y90A 3VGFA 3W1AA 4AD0A 4HK5A 5A8MA 2CLPA 1E9LA 3W2JA 3S1VA 5DY2A 4ORMA 2G97A 4GJJA 4HA3A 2GGEA 2XVGA 1XIJA 4B4HA 2GQ9A 3LPFA 2CW6A 5E0FA 3CK5A 2QMJA 3G1HA 4FALA 5T26A 1DIKA 4CQDA 3P6LA 5BWAA 5BZAA 1Q6EA 3WNKA 5C8BB 4CD6A 1ICQA 4LNYA 3H12A 4B3LA 3UVAA 3UEQA 4Z1AA 3M4HA 3MYPA 3VOGA 1K9DA 4KWVA 3BAYA 5CPNA 4XBKA 2EPKX 4E5TA 3TU9A 1KCXA 1TB3A 3RPMA 5FSEC 4D6JA 2WPGA 1UHVA 4WHBA 2V3EA 1VJSA 1SU5A 3TWBA 2XWEA 4DF1A 5AC6A 4ZE5A 4XKYB 4TTGA 3G1FA 1SW0A 1JRBA 5A8NA 3KWSA 3ONBA 5HAOA 3GD6A 1PJ9A 4AZ7A 2XVNA 3SCSA 1TTPA 4GNVA 4KF1A 5IHSA 3TYDA 5HINA 3PJWA 4PR4A 4B15A 2HK1A 5KITA 4EVZA 3GNOA 1N55A 1VFUA 3SM0A 4MWAE 3R13A 2W61A 3TROA 4NY2A 2A85A 5I78A 3K8MA 5BRQA 1QMLA 1QOXA 2ZRVA 3ZZ1A 5D33A 2GQAA 5AHIA 2ZVIA 2J7FA 2PF8A 1WDQA 3A23A 4G7EB 3VXGA 3KS6A 3PBYA 4GZIA 1IV8A 4NIRA 3FXYA 1WZAA 3TC3A 3VE9A 3G1YA 2RUSA 1TPC1 1SPQA 1QXLA 1YRRA 3GVVA 2DUXA 3ZR5A 1UD3A 2Z26A 1IIGA 1REQA 3S5SA 2W9MA 3W1PA 3B9AA 1ZU8A 4LXFA 2D22A 1UZ1A 1OX4B 3VGDA 3AZSA 1VYRA 3QVQA 4HPJA 3WD2A 2MUCA 4RV3A 2P8BA 3TXZA 4B2DD 4FMVA 4QRNA 4QDPA 1IXPA 1GTHA 3UWQA 4H83A 1W56A 3TTQA 3QMSA 1IGWA 1UUOA 3KP1A 3CB3A 4ALDA 1M03A 4DJEA 5CAHA 4ZXLA 1S46A 2VEIA 2E8ZA 4X2PA 2QVHA 4QEHA 1LWHA 2YW4A 2ABAA 3W7CA 1CIUA 1NH6A 4LV4A 3ARTA 5LHEA 1OK4A 4OBTA 2P10A 2PP1A 1GCYA 5JXQA 4G5DA 4F2TA 1YE6A 4KS0A 2VENA 4HJFA 1MRAA 1KGWA 2C16A 3JS3A 4UCFA 3EEGA 4CEUC 3LY0A 3FEQA 2X42A 1ZP3A 1OZMA 3UWVA 5XIMA 2XN1A 1GEHA 1XW8A 3A21A 1MXGA 1SJCA 3LD5A 1REQB 2E6DA 1ZNNA 2JBMA 2A1YA 3L7RA 4NRRA 1FFQA 2HE5A 1BLIA 1UWQA 3ANYA 4JNZA 2YX0A 1EZWA 1P0BA 2ESCA 3HG3A 3V0UA 4UNIA 2GVJA 1HG3A 1TPWA 3P62A 4AD2A 1XL9A 4FO4A 1YPFA 1SYTA 3U5UA 3HA1A 2DIKA 2YB4A 1ECQA 1US3A 4FIRA 1RCQA 1E51A 3A4XA 2E9MA 4GZJA 3EWXA 2WQDA 1US0A 6PTDA 4EP8C 3LPGA 4ERGA 2FHBA 3UY8A 3W7RA 1X1ZA 3LU2A 3N15A 1VIZA 1AH3A 2YXGA 5GJNA 3ITYA 2HBVA 4FNQA 3XINA 1PO9A 5FJIA 3LNPA 3GR4A 5LNSA 4S1FA 3LUTA 1RSCA 5F1UA 1V8EA 2ZBTA 3EKLA 3GE7A 2QULA 4X2RA 4ZOCA 3UZZA 4ACZA 3LMYA 4HK6A 5KINA 2JEQA 4UOQA 2X0SA 5CPTA 2GLKA 4AD1A 2VVSA 3N2MA 3G1RA 1A5KC 4HD5A 3U2EA 3A47A 3PANA 2H9AB 3MMDA 3AHVA 3UG3A 1XBZA 4UBPC 1V3KA 2WHLA 1SQ7A 2PODA 4L6OA 3REQA 4GHRA 1YNQA 2C14A 1FDZA 2OODA 3G3MA 2WNNA 3LHYA 1B9ZA 2GQ3A 1E1EA 2A7PA 1ONRA 3EPNA 4C6FA 4HOXA 1OEPA 2BWGA 5I07A 2OYKA 4DBUA 4ATLA 1OG0A 1Z41A 2ACUA 2FLIA 3B0VC 4S3BA 1XLAA 3MCNA 2R91A 2ZTJA 1SSGA 3K8LA 5CKSA 3MO7A 1N82A 4AXKA 4IQJA 4IJBA 2JGQA 3OBAA 3C86A 1Z69A 1EXBA 3WK1A 2V5LA 4OU1A 2ZZ6A 4EIVA 1Y5VA 2YPIA 5TQLA 3VX1A 4IIFA 3QF0A 3N18A 2JQXA 2V81A 3R25A 3GHTA 2F6KA 5AYBA 4AISA 3THQA 3G24A 1R3VA 4UQAA 3LRLA 2CZEA 2Y7DA 3QTGA 3RXZA 3APYA 2Z6IA 4U3CA 3W9ZA 1H61A 3EOLA 4Z17A 4GFIA 3E0IA 1W1VA 1VIWA 1TQJA 1CB7B 1V08A 3H70A 3MP3A 3R1ZA 1J6PA 5A1AA 2ZUVA 4UTUA 2EG6A 4FX8A 3HPZA 3NQ2A 1HJSA 4OWGA 3W7JA 1QU4A 4JNYA 2VDGA 2FDSA 3PS7A 4TXEA 3P14A 3LA4A 4Q22A 2HBXA 3OGRA 1EJWC 1GZGA 3DX5A 3CZGA 3CAKA 4NZJA 4FOJA 3HURA 4AG0A 4AZHA 1LROA 3GYCA 1RR2A 3PG9A 3TJIA 4H9VA 2GZXA 2GVEA 1UR1A 1W5OA 3M6YA 3JUGA 2Y0FA 5TF0A 4MB1A 3I7SA 1FVPA 3N4EA 1FWAC 3VNDA 2TSYA 1E43A 4NNAA 1UMYA 2Y89A 2IPFA 4K1GA 1U1JA 3IJ9A 1VFHA 5C55A 2XWDA 2P8CA 3UA4A 2D1ZA 3KLKA 2WO5A 1ONWA 1I4NA 1CGXA 2ZUMA 3IVTA 4GISA 3WDJA 3L4XA 4CQCA 1EJTC 3EX6A 3E0WA 1THFD 3TZNA 1ZBKA 5DMMA 3M0KA 4W84A 4AXNA 1MZRA 2POZA 3DKJA 4GIEA 4GYPA 3BAIA 4RPPA 3GXPA 4PTVA 1ZBVA 1EX5A 3SUSA 1JD9A 3MMUA 3VDGA 4JY8A 1WKEA 3GG0A 3GG8A 3GQYA 2CESA 2XZ7A 2DY3A 2NVDA 2PLKA 1NTHA 2J77A 2E9BA 3FS2A 3FIGA 1OYBA 3H53A 3HU7A 4QJ4B 1E72M 1XLGA 1BVWA 4AIEA 4U28A 4QBXA 1SO4A 3K46A 3AIQA 2IPJA 4DNMA 3N29A 1HKWA 3ARXA 3KE0A 8TIMA 1RK6A 4XKYA 4NVTA 1WZKA 2O56A 5D2YA 3TUUA 5DO8A 4DUOA 1QAPA 3PSWA 4C6LA 1V0NA 4LNCA 2CKSA 2GDUA 3GZ3A 4KIRA 2PP3A 2EQDA 3GR8A 2Z1BA 5C9UA 2NQ5A 5D8ZA 5E70A 3U2CA 3RGTA 1TWIA 5C9RA 4QAIA 4XD5A 4WUIA 3EX4A 4DBWA 4MOZA 3WBYA 2X2YA 3BAWA 3FNDA 1JR1A 2WVTA 3PBUA 4CVUA 2NZLA 3WK2A 1OFRA 3N6HA 3N73A 4UTIA 3BLOA 4UR7A 4ROPA 2BB0A 2X7VA 2IPWA 3NQVA 4MJZA 1QBAA 1SJBA 3MUZ1 2EKCA 4UNKA 2Z1XA 1UR9A 5DT5A 4DQWA 4P8WA 4C6BA 5HPCA 3UXAA 3IRDA 3HQOA 3DU0A 4J9JA 4FNTA 3SADA 1A5UA 4PMXA 5I0DA 2NLYA 4UNLA 1QO5A 4WJXA 1R7OA 2V63A 1NWSA 3C6CA 4F48A 3HQ1A 1V03A 1J01A 3MV01 1B3OA 1P7TA 1CENA 2VR4A 5IFPA 5HNTA 4AX7A 3CV1A 4HPNA 2JGYA 3VNJA 4P7QA 4OOUA 2CLKA 3O06A 3AWOA 3IPWA 6TIMA 2IPGA 3CZ8A 4LW7A 3UJEA 4LB3A 5M1TA 1TV8A 3OIHA 3NDZA 4HU0A 3GU2A 2E9LA 2C18A 1OX6A 1H7NA 3S83A 3DH7A 2CPUA 2GDVA 3CHEA 3NEVA 1PTDA 2V3FA 1G7UA 3EMQA 4UB9A 3R12A 5I03A 3S1XA 3MV11 1K7FA 3VMNA 1RUSA 1J0HA 9XIMA 4DWDA 2E5DA 3UF9A 1VAHA 2YA1A 4XBJA 3RG6A 2WMIB 3K4AA 3MMWA 5CC5A 4BF5A 4QSFA 5A6SA 2FKPA 1MNZA 3Q4DA 3SJ3A 4MAZA 3OO2A 2DUAA 1Z9AA 1ITQA 3ZFHA 1U1UA 3Q65A 5DMYA 4KMQA 1J5TA 3CUHA 1JXJA 4GVHA 4LEFA 3BWWA 1C8QA 3PZTA 4GH3A 2O7SA 1NWUA 1J6OA 2PDNA 2DZSA 2GJNA 3F5JA 3VM5A 2ZADA 4IOTA 1D8CA 1GJPA 1W1ZA 4BCEA 4DO5A 1JCJA 4DXVA 4MF4A 4JTIA 4E4PA 2VFFA 3WD3A 2Q01A 1E6RA 2G5WA 4MB5A 1DKWA 1MZHA 1VPYA 1W0MA 2I9EA 3QFWA 1TUFA 4K7VA 1EBGA 1JCYA 1MRQA 1T0OA 1XM3A 3RO6A 3UGVA 2QUNA 1LCOA 4U31A 4GO8A 4DI8A 2WXDM 2VEGA 1WCGA 4ES4A 3WIJA 3B9OA 1J0KA 2CYGA 3PZGA 4UTWA 4JN7A 1RJRA 1EEPA 3WUFA 2Z24A 1R46A 3HG4A 3V16A 3DGRA 4AVFA 4RV8A 3S1WA 4M6VA 1XIGA 1CEOA 1D7FA 4D6HA 4EXQA 2O4QA 3EXRA 4MZ8A 2P53A 3WK3A 2G3MA 3WLKX 3DYPA 4QTGA 2YIHA 3SZ8A 4WOZA 3FGCB 4XZLX 2P1FA 3FJLA 3T55A 1M53A 1QI4A 1OQFA 1KM2A 1OFAA 1VFOA 3BJFA 5KMYA 1EBHA 2WQPA 4AZBA 1RQEA 4D72A 2VCAA 4V33A 3A13A 3F4NA 4JIIX 5I3KA 5EMYA 1A5OC 2DZTA 3BQ6A 2VX4A 1K77A 2IUZA 3HQPA 1NP2A 1D3GA 3VNZA 2VL4A 1ZUAX 4L6HA 1TE1A 3RIKA 3EX3A 5DY3A 4HPHA 1CI1A 1T8XA 5FESA 2C0HA 2CWNA 4ZOEA 1C90A 1HL2A 5F1VA 1RA0A 3OZYA 4ERAA 5EFFA 3D3AA 3TCEA 3THUA 4GYFA 1EIXA 4QAWA 2HE8A 4O57A 4V27A 3FAWA 3W7IA 1PTAA 3CWNA 1UB3A 3OP2A 1XH0A 1R3WA 2ATSA 3TQ0A 3R94A 3IANA 1HJUA 2VR2A 3ITOA 4FNPA 2GSEA 2WKGA 4ZBCA 1TPDA 5I02A 4K8HA 3C2FA 3A12A 1UR3M 5AZ0A 2DW6A 4M1BA 5DANA 4EAMA 5C9XA 2I5GA 3SGGA 3BE7A 1DL3A 1Q7MA 4NYUA 2HMCA 1GPWA 5HULA 1U5VA 4QEEA 1CXLA 1TPUA 4Q4SA 1M01A 1W1A1 3B05A 3S6OA 2GFTA 3EKGA 3LCHA 3QW4B 4I9JA 2HV5A 4AH7A 1O5KA 2GUUA 2WVVA 2FJUB 3PAJA 4GKLA 2ISDA 3EMCA 4PMQA 3AIUA 5C2CA 1MQPA 3S5OA 2XFWA 5IDIA 1IR2A 2JIEA 1EJUC 1TCDA 2OSXA 2F9RA 2QDHA 1K8ZA 4I3GA 1IT0A 3DFPA 2WZMA 3W7PA 2I57A 5I5RA 3UG8A 3W23A 2P5NA 3SDOA 2C1IA 4P8UA 1SZRA 4JKLA 2O9RA 2OTDA 2FB2A 1QK2A 1E6XM 2W91A 3MBFA 2D0FA 1YBQA 2Q02A 3ITVA 3O6DA 3H2NA 3GHSA 4C1KA 3SIZA 1W5QA 2C6QA 3QTPA 4K3ZA 3GXIA 1Y0EA 4OJYA 3NL3A 4DJEC 1F8IA 3MCOA 4GGHA 1P7TB 2H6RA 3UCQA 3TW9A 5AN7A 1J0ZA 4R9OA 3BG5A 1VGAA 1MFVA 3W1TA 2ISFA 2DUZA 3AIWA 1JZ6A 4DRSA 1MQQA 2HTMA 3RNDA 2QCGA 4TVCA 1A3HA 1AH0A 2OZ8A 1T41A 1WUFA 1E6SM 4Q3MA 2XGZA 3L4TA 3W2MA 4IP5A 4UQEA 1Q85A 3WJZA 4L4PA 2HCVA 3MTWA 2BHUA 1TV3A 4XUGA 4QX4A 3R79A 3WLTA 5I77A 1QPNA 2NSXA 3RUBL 2UY3A 4HNCA 1GOIA 1XH1A 4LU0A 1B0IA 3SB0A 3TN5A 3VD7A 2RGLA 1HP5A 1P4CA 1X8FA 5D30A 1GVOA 4CCCA 2VXNA 2CHRA 3DERA 1UKPA 3SRKA 1ZFJA 3T4CA 3QM3A 3QGVA 4P2VA 1OCBA 3NEHA 4R7OA 2VELA 2BLEA 2VWSA 4DM1A 2WWCA 3NPXA 1VPQA 1QT1A 2ZKMX 4REQA 5HBFA 3VDBA 1S5VA 3F2CA 3ITTA 3M0JA 2AQVA 3H23A 2PDQA 3AZTA 4C5ZA 1E6QM 3WBEA 2P3ZA 5D9OA 4KESA 2E09A 3ARYA 1XD1A 4C7GA 4NZFA 3GIYA 4M8UA 2CXEA 5DMLA 3L2MA 2PDKA 1F3EA 2J13A 4L61A 3GUWA 5AC7A 2EF9A 2YYTA 4JQ4A 2AQWA 3S42A 3IIOA 1PUDA 3MSYA 1JUBA 3TYCA 3HGOA 1TTQA 1S5MA 4DWSB 4XZ9A 3N4FA 5DEZA 1SMAA 5G1MA 4HHLA 4IFKB 4IIGA 1JAEA 3QZAA 2GWGA 5I3JA 2RDXA 1VENA 3PZ9A 3NOEA 4GO9A 3DBPA 1SFTA 4TMCA 4C7FA 3RK8A 4P5UA 1Z89A 3M0IA 5LXXA 3OJGA 1DQUA 4L5ZA 1X98A 2W67A 1MUMA 3DOPA 4J35A 4ZO9A 4OUIA 3N12A 3WF0A 3R0DA 4F9JA 4WF7A 4PUKA 1PYFA 1CYGA 5LA2A 3OHIA 3WQOA 4NJGA 4FXJA 2WMFA 1Q13A 4F66A 4HOZA 4QJ5B 4Q8MA 5CSSA 4BY3A 5HPOA 3B8TA 3SUTA 4BKNA 4DIAA 1UD6A 1DIOA 3E3HA 5EMJA 3F4DA 2D2OA 3B4UA 3KTCA 4B92A 1KKRA 2VFIA 1DJWA 1WOAA 2CFFA 1FH8A 2VD9A 4IPPA 1KNWA 1XFCA 4HN8A 5DN1A 4ATDA 4M6PA 2WMGA 3R6IA 4ERIA 4LUIA 3MP5A 3WBXA 1VBRA 1XLIA 2XJ7A 3Q58A 4M7SA 1FWIC 3BH4A 2WSYA 3MUY1 3ZSTA 4ZO6A 3W53A 2JF7A 3LX9A 1DJNA 2H9AA 1GOMA 1GORA 1K70A 4NI8A 4DO6A 4B5VA 4CQBA 3LCIA 3OVPA 4UTTC 2Y1HA 5B7YA 4EOUA 1OINA 3W72A 1S2AA 2QAFA 3PNUA 4MNJA 1WE5A 3J7HA 3HBLA 4D2JA 4GWEA 3RJXA 3W6MA 2PDIA 3NDOA 7REQA 1KV8A 4FZIA 1D9EA 1ZCCA 3GHRA 2XHYA 2YLAA 1CLXA 4X63A 4E8CA 2XIQA 4I8DA 3S46A 1QR7A 3IIPA 3QQWA 3UR5A 4I90A 2D3LA 3PUGA 8XIAA 4Q8NA 2BXZA 4DYJA 3CHCA 3WEZA 2BX7A 4BQ4A 2ZTKA 3PZQA 4GVFA 2Z7GA 5JIPA 1XRTA 3W4RA 3UG4A 4DJDD 1PIGA 3VNIA 3LV5A 3ITXA 1CZ1A 4LPCA 2RGMA 5JH1A 5AYXA 2EG7A 1YHTA 2QS8A 3CPGA 4RDWA 4Z2JA 3VO0A 1PV8A 1TCMA 1WKYA 2A3CA 1KXQA 5EL1A 1ZENA 2DZXA 3GXDA 2QCDA 1YLVA 4XSMA 1L6YA 2E5BA 3KOXA 2R1NA 1XG3A 1QOPA 1TRIA 1RD5A 4S39A 5FOOA 1HUVA 3H24A 2CBIA 2OT1A 1BVZA 4DLFA 2VFDA 1RVGA 3I68A 2BHYA 4C1NA 1NDZA 2NSOA 1NFPA 4PTNA 4QG8A 1LQ2A 4JTSA 1EQPA 4JYEA 4Z1CA 3EDDA 1B54A 4HKPA 4MZYA 3LPPA 2ABBA 1UR0A 3CIXA 1DWGM 3BG3A 1UPMB 1HZYA 1BTMA 2DVUA 2B7QA 2NX3A 3IV8A 5B7ZA 3ZO9A 3KTSA 1WDPA 1AQ0A 1O1ZA 5A6AA 2WV8A 1KRMA 1V3HA 1MO0A 1UKQA 2J4GA 1UA3A 1TIMA 3PN8A 1LRNA 4JHOA 4OQVA 3SI9A 2OOFA 4JPGA 3ITCA 4FP1A 1TPB1 5JVLA 4ACYA 5AECA 3LN3A 3NQFA 1ZQ5A 5E1QA 3QYQA 4RE3A 1WA3A 1KRBC 1P6BA 1F2JA 1IZKA 1T96A 3WLPA 3A4JA 3S5NA 3GHUA 4O0ZA 5T8GA 2J9ZA 3CMJA 3W1QA 1UROA 3ECQA 1C3FA 2BG5A 3BPWA 2VTFA 1R30A 1JGIA 1NP0A 3CH0A 3N25A 1Q6FA 2CZDA 4FNUA 1GQIA 3BSHA 2J6VA 1Q7QA 4NJJA 1FHVA 3GNRA 3NOYA 3W0KA 3HG5A 1E15A 1NOFA 2EAWA 2VFGA 4W8AA 4KFPA 4HU3A 3CPUA 2R1KA 4R7WA 3DBNA 4NRSA 4DI9A 1XI3A 3G1SA 3QSTA 1QNQA 8RUCA 2E6YA 3AXKA 1UWTA 2RJGA 3RR4A 4FLOA 3LTYA 5H2ZA 4NZCA 3NQ7A 2VZOA 1GHSA 1RPXA 1UR4A 3GWQA 1DWHM 4FSAA 4XZIA 1R6WA 4DF2A 2NV9A 1QVBA 2DQWA 3K1GA 3VDCA 1KM0A 5D9MA 4CLMA 1JPHA 1ZPTA 2OPJA 1W91A 2GVYA 3B9EA 5H91A 1T99A 3RPTA 1K02A 4B9ZA 3QZEA 2KZHA 5DRIA 3GB6A 3T7VA 4US5A 1OD8A 3NVDA 3UZWA 4C6JA 4XIMA 4NZ1A 1SZGA 1TVLA 1VBHA 1XSJA 3BK0A 4HJWA 1AMYA 3WLHA 3M5XA 2JF6A 5FEPA 1MSSA 1OD0A 3AISA 1DYSA 4GE8A 1TX0A 3PWAA 2CBUA 8CGTA 4NJIA 4S2CA 1NEYA 1CB2A 2BXYA 3RFAA 2E25A 1YBQB 2QCLA 3DENA 3QV8A 2YBVA 3VD3A 1RH9A 4WY0A 4AHOA 1Q8JA 4LX4A 1Q65A 3ARPA 1FHDA 3RX3A 1GPFA 3IARA 3SRHA 1XIHA 1HVQA 2ZDRA 3P7YA 4A3QA 3CL6A 2HZGA 3MWCA 5DX7A 2Z1VA 4FA3A 3GH7A 2EO7A 1LWIA 1FCQA 3GDMA 1UR2A 1HVXA 1O5QA 4FS9A 2CLLA 4US6A 2EPNA 1UZHA 1PVNA 2PLMA 3GS6A 1S2VA 2J7CA 5FL0A 4IGHA 4AD5A 4GH1A 1VZWA 3W2NA 4BJHA 4PUEA 4ML4A 5IFTA 4Z08A 4J1OA 3AYRA 9CGTA 3MUCA 2PC8A 2J7BA 1RLDA 2BTMA 4Y9MA 4C6DA 4GYJA 2BMBA 3GH4A 3NZQA 5LIYX 3WG6A 3E5PA 2W0UA 2AKZA 1OF6A 5M3WA 4XZNX 5CJ5A 4EXAA 4RJEA 1E9IA 3RPDA 2OWCA 5A5WA 1CWYA 1MNSA 3OZPA 3WDQA 3MI2A 1KGUA 4JTTA 4PFMA 3P5ZA 3SUVA 2DW7A 3VIHA 4CD7A 1GOOA 1BKHA 3T0BA 4H1ZA 3V7PA 2FZ8A 3TNOA 2FMNA 4JY9A 3B0UX 1UCWA 3QR0A 3CYVA 4K36A 3FA5A 4QLJA 3CPRA 3AMCA 1G01A 2A2IA 4MG4A 3HIJA 3KM8A 2R24A 1R8LA 3D6NA 3E02A 2FH8A 4H7CA 1SW3A 1VBJA 3M5VA 2WNWA 2Y7EA 1IEIA 1YXDA 4F3HA 3KZPA 2Y5EA 3W7EA 1E0TA 1K4GA 2DQXA 4AWTA 2XM1A 2QV5A 4U2ZA 3JRKA 4D6GA 1N8FA 3DFYA 4V2XA 3SCQA 2V69A 1MW3A 5EBAA 7ENLA 2ZE3A 1Q6GA 2PB1A 3WBWA 3IGUA 3QHMA 3WUGA 5F2IA 3GKAA 1G4EA 1I6NA 5HUOA 5CSRA 2VRJA 2VKZG 2WJFA 3TN4A 4WIWA 3VU2A 3SCNA 5FF3A 3AYSA 4HZ7A 1IWBA 2MANA 3UA3A 4KCUA 7CGTA 1BRLA 1EGZA 2DT0A 4PZVA 1W5NA 1QHOA 4XZBA 4AAJA 3M0ZA 1Z42A 5LNUA 1TWZA 2PCEA 4UMAA 1IXOA 1FH9A 4E3TA 4JTFA 3PTDA 2ZDSA 3L67A 4IMAA 3VFLA 3VAVA 4CD4A 2JE8A 3CEPA 3CO8A 3W37A 4OZOA 2PUZA 3WFZA 3IJIA 3R0KA 4HBKA 1DORA 4QQ3A 4UOJA 2FTYA 3AS1A 5LGXA 5CH9A 1CLVA 1NFBA 4IXHA 3RMJA 4FHAA 4ZFCA 4S3FA 1TJRA 1TR1A 1VJIA 4WK9A 4JX4A 4NZ5A 3LDVA 2ZRZA 3B8VA 2ZICA 2X09A 2XH0A 1UKOA 3KCJA 4XB3A 3WH8A 3CWOX 2Y70A 3WNMA 4GJIA 1EDGA 3QC0A 4YVPA 3STFA 2CITA 3LI0A 2FPTA 1JYWA 4TOQA 1TRDA 2WC7A 3OU8A 1OCJA 3NZRA 4JIQA 4HTBA 5F2GA 1ZLPA 3KVJA 4DF0A 1A3WA 1MEIA 2Y8KA 3T2OA 3TYZA 1JCXA 3EXSA 3QRHA 2IKIA 2ADAA 5LIKX 4PA8A 1T40A 3CU2A 3MVTA 1YNPA 1Q6DA 4DZIA 1FRBA 4PE8A 3EYPA 1JPMA 1LORA 3S2LA 3ZR4A 3EBVA 1EEXA 4PTMA 4LAZA 4QS6A 4WJEA 4DVOA 1ITXA 4YJ5A 3GNPA 5AC5A 2XVKA 3EWCA 4O53A 1H0GA 3N2CA 1LG2A 1K7EA 2IKJA 1P0DA 5F2MA 2WHJA 2NT1A 3BCDA 1A5CA 1UWAA 1NWTA 3HPXA 4IM4A 1GVYA 2D0HA 3D5HA 3WY1A 4HTYA 3PWIA 4JL2A 3M43A 4R3UA 3VMOA 4G7FA 3EAUA 3I6RA 1R38A 3NQMA 3HFTA 4F0SA 3K4WA 4POCA 3B8WA 1W3IA 2QPSA 1OYCA 4Z1DA 1UC5A 1ADOA 2DJLA 3CIWA 5M17A 3CS2A 1CXKA 4V15A 5I23A 5A8OA 3D47A 5E6ZA 2AGKA 2H90A 2AKMA 4RR4A 2OLHA 3QEZA 1CTNA 1JGMA 4O17A 3EDJA 3UGRA 4H6KA 3SCRA 2UZ9A 1K9TA 2Y4SA 4HYWA 1I60A 3FHAA 3H7VA 1F05A 2Z1KA 2DZAA 3ARWA 3ANUA 3EEZA 4LUJA 8XIMA 1VH7A 3GZAA 3A4WA 3VZXA 5F4SA 4JFWA 3LCXA 1BXNA 1OGSA 2VX7A 3MKVA 3IK4A 3SSZA 3ARUA 3CL8A 4PRTA 2NV2A 4LFYA 3C0QA 4Z0SA 3NQEA 1Q5MA 3IGSA 4CEXC 1YXYA 1TR9A 5CBBA 3WENA 1TYGA 3AHXA 3O6AA 2RKXA 4TQTA 2QR6A 6XIMA 1A5AA 1M9HA 4LQ1A 4Q8TA 4E2VA 1FA2A 3GTIA 3T6CA 2QHAA 3N14A 4Y2WA 2ZUSA 4YTUA 4LYKA 1EHNA 2A3AA 4HCDA 3NXFA 1ECEA 4ECLA 4GNKB 4W7VA 2RHGA 2YL5A 2CZ5A 1ME8A 3EB2A 3MUAA 2WOQA 4KWOA 2FVLA 5EMLA 4J3SA 1KB3A 1UKTA 2JALA 1E0VA 3QKEA 4NXKA 4M5PA 2VGIA 2CLFA 1NVMA 3LHWA 3SCWA 4E2BA 1JNEA 3GVRA 3SAZA 4HMCA 4AWUA 3NZ1A 3EX1A 4HHHA 4O12A 3FDGA 1PYMA 2G4JA 2FTPA 4AWSA 4PEKA 4DY1A 2QMKA 3DG6A 3AMLA 4AD4A 3WDIA 1DHKA 1V6VA 2GVLA 9RUBA 4EWJA 4IISA 5E0CA 1N2VA 1NDYA 3VMPA 4GIYA 1KM1A 4OHQA 2X1TA 3CL7A 3MU7A 4LGXA 4GYPC 3B06A 2GVGA 3VNLA 3TYAA 4O1EA 1G4SA 2BHZA 5FJOA 2GUBA 4E0CA 2HRWA 1TJ2A 1OY0A 3MANA 2D24A 1WKDA 4XBSA 3EWBX 1UIOA 2ZQ0A 3IVUA 3TN3A 4J3TA 3ARVA 3APGA 3EPOA 4NU7A 3SFKA 5BXTA 4UXDA 4C5YA 2QDEA 3IAQA 1OBAA 3M5YA 3FN9A 3T9PA 1VYPX 1O94A 4WDWA 3N6JA 4Q8UA 4Q33A 4UFHA 3LHTA 4IFKA 1W54A 1LOSA 3QPEA 5LA0A 1GJWA 3BGGA 2J7GA 5CPQA 4AFYA 3VIKA 1JAKA 3POCA 3WD1A 3AC0A 1K9EA 4ZGYA 5FI8A 3N9RA 4N02A 1VHCA 1JXKA 1W3KA 3TKFA 3GFYA 4UTLA 1DWFM 2ZXBA 1QATA 3CBWA 3W84A 2DIJA 2ZA2A 1B57A 2EJ1A 4JXCA 3WLJA 4LEQA 4IMDA 2BDQA 3S4TA 1LBFA 3A22A 5FJRA 3SUWA 3FA3A 5G1TA 5U7SA 2PGWA 3WF4A 5FACA 1W1PA 5EU9A 3TC6A 2B7PA 1A50A 3UJ2A 5ABGA 4K2SA 2W66A 1V6TA 3VIOA 4S3JA 3R8RA 3UJSA 2V5JA 3SCTA 3E0VA 2PI6A 3ABXA 2FZBA 3OLGA 3V75A 4TMBA 3LXAA 1QWGA 4UTHA 3V3WA 1H7WA 5I24A 3I4KA 1XS2A 3PTQA 1RY8A 3TJ4A 1KO0A 1UBSA 3VOFA 5L9FA 4PULA 1CPUA 4N9DA 1X96A 1ZJIA 2OQYA 3S9YA 3E5BA 5A95A 2QIIA 3MJMA 3NSNA 3WFLA 1QWKA 1KLZA 2CBJA 3DFSA 1FWJC 2G3JA 3FJ6A 3GYEA 1SMDA 2C8NA 3RLGA 2I16A 2PDXA 4ZTYA 1XISA 1B31A 2HXUA 1JI1A 3BLEA 1S2CA 2E1WA 1XP3A 4A22A 4S3EA 3I3DA 3MO4A 5CQ1A 1TJ1A 1C8YA 2ZYFA 3LENA 1YMYA 1M7XA 3WD0A 4LAMA 3U6WA 3V18A 2NQJA 4XD3A 1PHWA 4Q4MA 3C4UA 2OKTA 3CQHA 7A3HA 3W1NA 1UKSA 4KW2A 4MMWA 4ZE4A 2BBFA 3LYEA 4E2OA 5HNUA 4QR6A 1W1IE 4M80A 5DT7A 1V77A 3KCLA 3ONCA 4FNSA 4EPDC 2AQOA 2YB1A 4PEEA 1XIDA 1D3HA 3O7UA 4C6CA 3R7MA 3TW6A 2X2GA 1KLYA 1FKXA 4FOUA 1SO6A 1PKMA 1XD0A 4YCPA 4AHQA 1H4PA 3URBA 4DZAA 4NASA 4PRRA 4L1WA 4AZ5A 4JQ2A 5IRPA 3CLMA 3OGVA 5HWNA 3VM7A 1E1FA 3EOEA 1I45A 3L23A 3VTRA 3ZYZA 2XFRA 4B5XA 3GKFA 4GQRA 4JYDA 4MNMA 4G8TA 3LBCA 5LA1A 3BGJA 3E0FA 5CC3A 3M0MA 1OK6A 4GIAA 4F40A 4HSHA 1L6SA 1VBGA 3LG3A 4HHMA 3R0UA 4JTJA 4S3KA 3YPIA 5M5DA 2ZRXA 4Z2LA 3B0XA 2V0TA 4MSSA 2R9RA 2ZUTA 3S6TA 2BOEX 3AS2A 3W26A 5DFAA 2PWGA 3LM7A 3FKKA 3NR0A 1Q2SA 1OADA 3COTA 5GQBA 4NJKA 3M47A 5ABEA 1Z32X 4HMEA 5BXPA 3T0AA 2XIJA 2CKRA 1HX0A 4LAKA 4UC5A 4H6RA 1NWRA 1OFBA 1J0JA 1VLWA 4M6UA 4PMVA 4B5SA 2GJXB 1YTEA 3FSTA 4DNHA 2YL8A 2FYMA 1PIIA 4AZGA 3LXCA 1EO5A 1P1XA 4W5ZA 5CJMA 2X05A 1ODZA 1VYSX 3WMLA 2VDHA 2Q8ZA 1RXOB 5D2VA 2FGZA 1VCGA 3BQ5A 1SO3A 1UP0A 4LWWA 4ZQOA 1YXCA 1W9UA 1J4EA 5D2WA 3FK4A 3ZVHA 4L56A 5EGRA 1CBGA 4I5RA 2G8ZA 1TE6A 1Q3NA 2XVLA 2DSUA 4MKSA 3F4VA 1F6PA 2CIPA 1N8WA 1LBMA 3R58A 3H4GA 3LS9A 3MP4A 1G94A 1RBLA 4ZODA 4RNHA 1BQCA 3KAOA 4N4PA 3VIGA 4ZEPA 1EJ7L 2P50A 3RRXA 4CNPA 3W25A 1HGYA 1FY6A 1UWUA 2V5BA 3K4DA 3L0NA 1FWFC 5E09A 1O1HA 4GCAA 4CD8A 5C5YA 1KM4A 4NYYA 4IFRA 3ZLHA 4GVIA 4H8VA 3AU6A 1FP8A 2QJIA 1UMLA 1XQLA 1W9PA 4XK2A 1H41A 1MEWA 3FXGA 3ELFA 1I2OA 1CGYA 3GTFA 3RRAA 4DUWA 3LXBA 3KZSA 2WZHA 3BGAA 4D9PA 2HK0A 5I2UA 1OCQA 2A3LA 3LRMA 1FWSA 4CNSA 4A6GA 2XSBA 1KA9F 5LNRA 1A80A 5LSMA 3QOMA 3W2UA 2ZZ4A 4GA8A 4JCMA 3RF9A 1S1PA 3M6DA 3TR9A 4LVDA 1HT6A 3LQLA 4XTIA 1NJJA 3BVJA 5BMXA 1Y7VA 1ME7A 1O95A 3CV2A 2OGYA 3PAOA 1M04A 1K9FA 2PWUA 1AZ1A 1OG6A 1SJDA 4QLLA 3VINA 3CMGA 3BICA 2GJPA 1Q8AA 1U2YA 3ZM8A 3QW3A 3N2BA 2VRKA 2PD5A 2YGYA 3CHDA 3THAA 1GKPA 4ZCWA 1CXEA 3NFUA 5C54A 4S2BA 1B90A