4MZ1A

Crystal structure of the inosine 5'-monophosphate dehydrogenase, with a internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound p12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
380
structure length
354
Chain Sequence
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Inosine 5'-monophosphate Dehydrogenase, with a Internal Deletion of CBS Domain from Campylobacter jejuni complexed with inhibitor compound P12
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Inosine-5'-monophosphate dehydrogenase
total genus 111
structure length 354
sequence length 380
chains with identical sequence B, C
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2013-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mz1A00
2I14A 2YFOA 4K7VA 4Y96A 3R13A 4R7JA 3UWYA 3UPBA 3DBPA 1UJPA 3C52A 3JRKA 1I2PA 3BW3A 4DF1A 2NX3A 3CEPA 1OF6A 3P82A 3GLCA 2CLFA 3W7OA 3M1ZA 3DI1A 1LZOA 4QJ1A 5D30A 4EF9A 3KRZA 3S9YA 5D02A 2CW6A 3DFQA 4GUIA 5HR6A 5K2ZA 1L6YA 1BTMA 3GDLA 1Q6OA 1JUEA 2FLIA 2DZPA 1T96A 2E1DA 2QAPA 2ZDRA 5A5WA 3RU6A 3OIXA 2X2GA 4IMCA 1NF7A 1XL9A 3BPWA 4LS2A 3W7JA 1OFQA 4MYAA 3DI0A 4DBDA 2PCQA 5SWUA 5LHEA 1KFKA 3E96A 1GYNA 4MZ1A 3BGGA 3M5VA 3YPIA 2JKEA 3NQDA 3IVSA 1V7YA 4LU0A 2GPTA 1XM3A 4NJJA 3BLFA 1NEYA 4ZQPA 3V75A 3W1RA 1EWDA 4L4LA 2ZBTA 3PBWA 3S5ZA 4AHPA 3STGA 3CIWA 3PG9A 5LSMA 4UMBA 2QUUA 2YW4A 1W5MA 2ZZ6A 2VFFA 4KFNA 4OBTA 3LXAA 1VJIA 3QJAA 4JTTA 3STCA 1FWTA 1P0NA 1C29A 5D2XA 1Q3NA 1XKYA 5HWMA 3FJLA 1LOSA 3QRHA 4AWSA 3N19B 2C3ZA 1C9DA 4KFPA 2PRLA 1H51A 4IMGA 3BLIA 2DP3A 3MYOA 1M6JA 1CI1A 2ZZ2A 1MZHA 3FLUA 2QCDB 3C0JA 1FWRA 3NQMA 5LNRA 1LORA 2OMAA 5EKYA 1KTNA 3TA6A 1VYPX 3NG3A 3NO5A 3TC7A 3FS2A 3LHTA 3NM3A 1HO1A 3NQ7A 1XBXA 3WJZA 2A7RA 2KZHA 1PIIA 2OX1A 4L4MA 2YXGA 4N9DA 1XUUA 5CGQA 4FNSA 5D32A 2H3DA 1YYAA 2GUUA 2CZFA 3C6CA 4ZQNA 1DV7A 1GOXA 1I4NA 3LCXA 4ADTA 2A6LA 5HINA 1ZHAA 3GYEA 3HBLA 4YMZA 1WX0A 4UMAA 2ZYFA 5IM51 1QDSA 3BO9A 5C55A 5EL1A 1TTQA 4QIUA 5CKSA 3CT7A 1DVJA 2NXGA 3GKFA 1TREA 3E0IA 5FEPA 2XN0A 3LX9A 2CWNA 3EWWA 3G22A 5I3KA 1VPXA 1K7FA 2DZSA 1FDZA 3W7IA 1AK5A 1VS1A 3CPRA 2WKJA 1KM2A 1NFBA 2ZQ0A 5FESA 5J5RA 5I3GA 1OX4A 4NUWA 2YW3A 3TH6A 4GUFA 4UR7A 1Q45A 3RMJA 5BMXA 2GVJA 2B7NA 4QNEA 2BXVA 3TSBA 4ZQOA 1X7FA 2C6QA 2NXHA 3HGOA 4JTSA 5F2MA 5HWJA 3TMLA 4IXHA 4Z0JA 2X1RA 1KM5A 1W8SA 3GNNA 3L5MA 4GE8A 3MYPA 3W2KA 4R53A 4Z1BA 2W0UA 1JRBA 3LTPA 4NX5A 4BK9A 1MEHA 4LC6A 1VHCA 1HUVA 5F4WA 2I1OA 3LLDA 2QCCA 2V82A 3FOKA 1OABA 1KM3A 2QDHA 4Q33A 1TPB1 3QMTA 3TCEA 3W2NA 4I7UA 5CZTA 3NAVA 2YPIA 3BLEA 3LI1A 4UFMA 5G1YA 1VYRA 5FF7A 2J9YA 1QO5A 1EUAA 4UMCA 1OFAA 4O17A 1YTEA 1F6KA 3PAJA 3PBVA 3PSVA 2C15A 1YLVA 5BOOA 3ZWSA 1DJQA 4A2RA 3SSJA 2ZRZA 1ZY9A 2CU0A 3GVGA 1KFJA 3CTLA 1SFLA 3EWXA 1WBHA 1WOAA 1GVSA 2OT1A 4NJGA 3PUOA 3AJXA 4IMFA 2V5BA 3U8GA 2HSAA 3DFNA 1S5VA 4LTSA 1GVOA 1XI3A 3DXIA 3WK1A 3L67A 2WSQA 2J9XA 1T0OA 3EKZA 3G1FA 2CFFA 5DCBA 1HL2A 3NL3A 4WJEA 3LHVA 5TBOA 1H63A 2V2CA 3W1LA 3M6YA 4JY8A 1QPQA 3NPWA 3W7CA 4JTHA 1YDNA 4OT7A 3G1HA 4LRTA 1QOPA 2QJGA 1JCJA 2ZA2A 3G1VA 2CLOA 2JK2A 3R89A 1FCQA 2A2IA 5E93A 1SZNA 3UWVA 4JTLA 1UCWA 3GZ3A 1ZAHA 3S5OA 2NX9A 2QKFA 4N9BA 3HG5A 3LCLA 3SFKA 2VELA 3I6RA 3LCIA 3NQVA 1OYCA 4O8RA 1TV5A 4K36A 3TFXA 5D38A 1K8YA 3M5YA 3G1SA 3IGXA 2DJLA 3UY7A 3TQ0A 5LGXA 1P5BA 1TPDA 3F03K 1R2SA 5CSRA 3Q58A 3W75A 1K03A 2ISWA 1RD5A 2PURA 3CIXA 4LVGA 4M5PA 3VKJA 2Y6ZA 3P61A 3PBYA 2E6DA 1UBSA 1ZAJA 1FWSA 1JR1A 3HG3A 3SGUA 3UXDA 3DH7A 4DXVA 3W23A 3A22A 4MY1A 2Z6JA 3NM1A 4NJIA 2E6AA 3TE9A 4PODA 4IUOA 3EXSA 5AHEA 2CZ5A 3GX9A 1VRDA 4BF9A 1FDYA 3DKJA 3MI6A 1TIMA 1ME8A 4O18A 3M7WA 3SW6A 3N3MA 1S5TA 3L5AA 4EWND 3DENA 1H60A 1TSIA 4I9AA 3BW2A 5AHNA 4JTGA 3NNTA 4WXYA 3CWNA 3QPZA 3P8IA 2RDUA 2A0NA 2PRMA 4UTWC 3IEBA 3NQ6A 5G2IA 3B0UX 3W7EA 1U83A 5DLCA 1PS9A 4WXZA 4MFDA 4JTIA 3C61A 4K6AA 4YLWA 2ZA1A 4ML9A 1C8VA 4LVBA 5K3VA 1NF0A 3HB9A 1KBIA 1KM6A 1B9BA 2UV8G 4H6KA 4HNNA 3TROA 1XDMA 5CPMA 1LROA 2D73A 3OG3A 4OWGA 3MP4A 4HNTA 3W2LA 3RK8A 1KTBA 2Y7DA 3IIXA 3EX2A 1JCXA 1W3NA 3G1DA 3TUUA 2DU2A 4UFIA 1EP1A 1EUNA 5EPDA 3DZ1A 1W5QA 3SI9A 3QF0A 1TPUA 3TU9A 2VEMA 1BEUA 3T55A 3A23A 4X22A 2CLLA 5FF3A 1KFEA 4ORIA 3TNOA 5HJLA 1UASA 1H50A 4AWTA 4NU7A 3SECA 4NNAA 3EXTA 2DZXA 1VYSX 1XUZA 1W5NA 1TPFA 2V5LA 2B7PA 1GVFA 2Y63A 1XDLA 1GJPA 4UFKA 3CC1A 3N9SA 3GDRA 1AW2A 3W7PA 1TV8A 2JKPA 3L0NA 4N2YA 3O6YX 3T40A 4Z1DA 1Q6RA 1KV8A 2HS6A 2W79A 5K7JA 1SQ7A 3FEMA 2V30A 2GQAA 1DQWA 4JS3A 3TXZA 4LVAA 3C2RA 1F7BA 1VGAA 3KXQA 1RV8A 1JJKA 1R30A 4O4VA 2PC4A 1OFDA 3CU2A 3W22A 3H53A 3IVUA 1TPH1 3RLVA 3CB8A 4ICNA 1ZJIA 3IGSA 1TPEA 3T44A 4ALDA 4XTIA 3MP3A 1N55A 3JR2A 3NQ2A 1OFOA 2NUXA 3ABSA 1DL3A 1Z41A 2CZDA 5CSSA 3UZJA 1WA3A 4ADUA 4UTTC 4PTNA 1LOQA 3ELFA 1WV2A 3ABQA 4RJEA 4O1DA 4FNRA 4NX0A 1JUBA 1RVGA 3DFTA 4GC4A 3BGJA 4IX0A 4N02A 1QOQA 3VE7A 4X3ZA 3HPSA 4KFOA 5AYYA 1WBJA 1FXQA 1SZEA 3GAKA 4A21A 3IV3A 2PRHA 3DGRA 4IX2A 4WZHA 2NX1A 4PA8A 3W9ZA 3UYCA 4FHAA 1HFBA 3FFSA 5D37A 1W3TA 4ZL1A 2NUYA 2ISSA 5G1TA 5LGZA 2YGYA 4LV9A 1VCFA 1TPC1 2BX7A 1MXSA 1LM1A 5DBUA 4S2BA 2XFWA 5CZJA 1D9EA 5BMWA 3DU0A 4MZ8A 3GKAA 3P62A 3GDMA 2J27A 1H61A 4AH7A 4MUZA 5HNRA 1KA9F 3ATZA 3PF3A 5KINA 4TO8A 5G4EA 3W1AA 3E12A 4N6EA 1I2NA 4PH6A 4QISA 3QC3A 2J88A 5AC8A 3TKFA 3TW7A 1VZWA 2RFGA 4ZQCA 1A5AA 4MZYA 3RLUA 1ICQA 1GQNA 3W87A 3USBA 4K39A 3G24A 4DEFA 1X1ZA 4I7WA 3L21A 3BV4A 2ZCGA 4DELA 3IRDA 3BK0A 4UXDA 2Z6IA 3DFPA 2YSWA 3UXAA 1TCDA 3EEGA 3H54A 2G96A 3N9RA 3STFA 1R2TA 1X6UA 4FNUA 2DZUA 5D05A 4ZVJA 3LV6A 4MPQA 4E38A 1OX5A 1O4UA 3M47A 4DO5A 3M5XA 3QMSA 3ZFHA 2WQPA 1FDJA 1WOBA 2OJPA 3PULA 3W07A 5F4SA 1H7PA 4MFEA 2Y85A 1EA0A 1TJPA 3QFEA 1JQVA 5LNSA 3OA3A 4O13A 3HJZA 1G4PA 4TIMA 3B4UA 3G18A 1D3HA 5CPNA 3N34A 2QCHA 3VCRA 1YDVA 4R33A 2C19A 2Z2UA 3IIOA 4AAJA 4TU1A 4A22A 4JGDA 1PV8A 4PL2A 4WOZA 2C1HA 4RK8A 3KVKA 2V9DA 5D09A 4AHQA 4UTLA 5D2TA 1I2RA 1I2QA 4R34A 3A9IA 3ABRA 4IJBA 3QSRA 4O53A 2WPBA 5L9FA 2NXIA 4JTUA 4DPQA 1TRDA 2H6RA 2C13A 4TR9A 3W7MA 2YZRA 3W76A 1Q6QA 2VKZG 5FF0A 1VLWA 1LRTA 1XFBA 3G0UA 3NOEA 3MHGA 1TYGA 1SFJA 2Q3OA 1AL7A 1GWJA 4Z08A 2RH9A 2CLIA 1K8ZA 4IXXA 4AWUA 5HR7A 1ZCOA 4WX2A 5AN7A 1HO4A 3LGEA 3STEA 2Y61A 1EIXA 3M9YA 4AF0B 2E5DA 3LCFA 1VH7A 1LLZA 3MHUA 1SO5A 1XBZA 5DCDA 4JY9A 4HPJA 1SZGA 3WJWA 2WV8A 1RPXA 2Y89A 4JR5A 2O7QA 3FKRA 3LB0A 3M16A 5E0KA 5I3FA 1UB3A 5I3JA 3OVRA 3UD6A 1G4TA 2QR6A 2A7NA 2TMDA 3W7QA 4TMCA 1Q6LA 5F2GA 4UTIA 5E1QA 5DY3A 2JGQA 1LLWA 1QNVA 3UY8A 4N4PA 3LBCA 5FI8A 3DFOA 3W1TA 1EX5A 1Z44A 4GBUA 4ZMGA 2G5WA 4FF7A 1LBLA 3P5ZA 3LLFA 4JXCA 3SJ3A 1FUYA 1TTIA 3KHJA 3W1XA 3JS3A 5U4NA 1O5XA 2P10A 3WK0A 4PFMA 3O05A 3C8FA 5I3HA 1SW3A 2E6YA 3B04A 2J24A 1EWEA 3PR2A 2NV1A 1U5JA 1LCOA 4Y8FA 2IQTA 2QJIA 4GUHA 1K7EA 3B03A 3DHDA 3LXBA 4XKYA 1LRNA 5H91A 1O95A 1D3GA 2QEZA 3C56A 4GNJA 1UUOA 6TIMA 1O94A 4XUGA 3G0SA 1WDWA 2Q3RA 3LRMA 3HF3A 2ZFAA 4POCA 4JYDA 2FPVA 2ISVA 5D33A 1K3UA 1F76A 2WJZA 2C14A 1ZFJA 4RR4A 3G0XA 5KMYA 3P81A 2GQ9A 1GVRA 2ALDA 2VEKA 3O63A 4DO4A 1LBMA 3MW7A 1A50A 3NL6A 4O1BA 3NZRA 4M7TA 2ZZ5A 4JN6A 4AMAA 2V81A 4DO6A 2ZRVA 3L65A 3PG8A 1DOSA 3W1NA 4JTEA 2H3BA 5KTLA 3WJXA 5F2IA 4PEKA 3NQ8A 2ZTKA 5LKYA 1TTPA 5EYWA 5AOUA 3A5VA 1SO6A 4O0ZA 5DXXA 3W7RA 4O0KA 1DORA 3LI0A 3TXVA 5I3IA 3N2XA 2E68A 3R8RA 1IXOA 1FWNA 3W83A 1XCFA 3MWAA 3NL5A 1EP2A 2ZZ4A 2FIQA 1KV5A 1MEIA 3LHWA 3QW4B 1JCYA 4O1AA 4BR1A 4WY0F 4BWLC 4NXSA 1PHQA 2ZZ1A 4LUJA 1VQTA 5CZ0A 1H7XA 2EKCA 1GVQA 3MMTA 2QDGA 3DFSA 4AVFA 3K30A 1R47A 4RLIA 2E77A 3SY5A 3TC6A 2NUWA 3DHFA 3TJLA 1KM1A 5D2VA 2CLKA 4O10A 5F4XA 3O6DA 2ZA3A 3KFTA 2RKXA 4A29A 3FYPA 1YPFA 4Q4KA 3OEXA 1TB3A 3TIMA 2WNNA 1P4CA 1TMHA 1OFEA 1B3OA 3CM4A 4O57A 4XWUA 4OGZA 5HQEA 1W56A 4CQ8A 2YDAA 3TFCA 4K8EA 4M19A 3W2MA 3A5FA 2WOQA 4O28A 4AB4A 4MJZA 4LY8A 4FEZA 3BG3A 1L6SA 4Y90A 3LV5A 2X16A 1AMKA 5C5YA 4UTUA 3MO7A 1PHWA 4YWIA 4QITA 1GTHA 1WXJA 5EBUA 4MY9A 3UWQA 4OHQA 5K4XA 4HSOA 3CLMA 2JBMA 3CHVA 4NQ1A 4TMBA 1BWKA 5J5DA 3MJYA 4TX9A 2OZ0A 4DF2A 4IPIA 4RCXA 3FA5A 2A5HA 3TQVA 5EY5A 1F2JA 2QJHA 3LBMA 2AGKA 3HQ1A 3NR0A 2QUTA 1TPWA 3ANYA 2E09A 3UWWA 2P1FA 3P74A 3HPZA 2DZVA 4NXKA 3W88A 2R8WA 5LNWA 3TX9A 3A21A 1FXPA 2B7OA 3W7GA 1T8XA 4AXKA 4NJHA 2X1SA 2TRSA 3C2VA 1JRCA 3M5ZA 4AEOA 3PM6A 1LRQA 3MI3A 3D0CA 3S1UA 2A6NA 4IMDA 5BNKA 3W74A 1N7KA 2A21A 1XXXA 3EX6A 1THFD 3EXRA 1VC4A 1M7PA 2NLIA 2EF9A 1SR9A 2VOMA 1ADOA 5AHMA 4BWLA 1FWWA 1GTEA 5KZMA 4GJ1A 4Y9AA 4AF0A 3TV8A 4KWWA 1TJRA 1W1ZA 3TMQA 1W54A 3NYZA 1N8FA 3W7KA 1KW1A 3VI2A 5K9XA 3L2IA 2C18A 3VNDA 3C2OA 3CEUA 2NWRA 1YDOA 2QAFA 2VFEA 1W5PA 3NXFA 3O8AA 5HWNA 2VFGA 1R46A 4LVDA 1AW1A 2HS8A 3QMRA 1JQXA 4LW7A 3IIZA 3TSMA 1H5YA 4WQ6A 3T7VA 3ZWTA 3PBUA 3TDFA 4K8HA 4EVZA 1KM4A 3EWBX 2OT0A 3NPVA 5K4ZA 3O15A 4CNOA 4UNLA 3WK3A 1K02A 1OFBA 2AQWA 5F1VA 4N6FA 3IVTA 1T99A 1PCKA 2GQ8A 1E51A 3W6YA 4XKYB 1NSJA 1W3IA 4GRSA 1TQJA 1J2WA 3HG2A 2ZTJA 1YTDA 2C16A 2QCLA 1QFEA 2QCMA 1MO0A 4MKNA 4D2JA 3W84A 5KITA 1DHPA 4OU1A 3LTSA 4X9SA 3W1QA 2ZRXA 1FCUA 5D2YA 1OG0A 2DJXA 3GR8A 5D04C 1EPXA 4QQ3A 1S5WA 3B06A 5K9CA 4HIBA 2Q8LA 4UNKA 3S6DA 3U6WA 3PSWA 1Z42A 2H8ZA 3S5YA 5AB3A 1SO4A 1W37A 3OHIA 1ME7A 1OHLA 4LNYA 2J9ZA 1O5KA 3QYQA 4BI7A 1BKSA 2VEIA 5EMUA 2JKAA 3NA8A 5MHBA 1B4EA 3NL2A 1V5XA 3R2GA 2CLMA 2E6FA 2ZRUA 3BARA 3HIJA 1H62A 3E9AA 4JNMA 4O16A 4Z1AA 1J4EA 5TIMA 5BRBA 2WSYA 3GK0A 3MP5A 4RZ5A 2Q8ZA 5ABTA 3WK2A 2G97A 1FCBA 4OV9A 2QUVA 1AG1O 1J5TA 1P1XA 2VFHA 1KLYA 1IIGA 3W70A 4MIMA 1IGSA 1OK4A 1A5SA 2QCDA 3M0ZA 4LOCA 4NNBA 2A1YA 3LCGA 3G3DA 5K9DA 1QCWA 1SU5A 3EB2A 1GZGA 4UFLA 4CLMA 1GG1A 1I8JA 3KVLA 3I68A 4FX7A 1OVDA 3TAOA 3BW4A 2H8XA 3S0CA 3TR2A 5HUOA 4ORMA 3FYOA 2NV2A 4EIVA 3DKLA 4JTFA 1GPWA 3LCHA 2AAMA 3ZS4A 3B8DA 5F2LA 2CZEA 4MJMA 2WNQA 3THQA 3S8HA 4K7YA 3G8EA 3L9CA 1KTCA 1O60A 1SZFA 2YR1A 1R2RA 3I7QA 3W1UA 3OVPA 1ZAIA 3W7LA 1IXQA 1SO3A 4WUIA 3DAQA 1SSDA 5LHFA 4YXGA 4H3DA 4MLRA 1OYAA 2V2HA 3KRUA 3F4NA 3WJSA 1W5OA 3GB6A 4M6PA 3EKLA 1VLIA 4FO4A 3Q94A 4KWVA 4RKAA 2RDWA 5CZSA 2XN2A 4PCFA 4RXFA 2B4GA 4HNVA 2Y62A 1OX4B 3O6CA 5HULA 3HGSA 2GJLA 1SW7A 3PUDA 1KM0A 1KLZA 5DCEA 1IXNA 5DN1A 2OCZA 4RXGA 4U28A 3SR7A 1ALDA 4BI6A 2X1TA 1ZNNA 3M44A 4X2RA 3I7SA 2R94A 1KFLA 4WY0B 1NVMA 2I9EA 4GXMA 4EOUA 1H1ZA 2Y7GA 4N9EA 3BG5A 4YCOA 4XZ9A 2DORA 2E5BA 3I7RA 3GAYA 1SUXA 3TW6A 2BTMA 5FF4A 1B4KA 2QCEA 3LDVA 3UQNA 3S42A 1LYXA 1YPIA 1WQ5A 3QQ0A 3W86A 5A8GA 1OK6A 1QR7A 3G8RA 4Q32A 2Y7EA 4XBSA 3TSDA 3P60A 2Y70A 3W2JA 1SSGA 4RZ4A 3TJXA 2GOUA 3KOFA 1VHNA 1A5CA 2ABAA 1X8FA 1S3HA 2GVGA 3VFLA 5HUPA 1PCWA 3HO8A 2FPYA 5G2HA 1SPQA 5AHFA 1JCMP 1WYIA 4ONVA 5DXYA 4M7SA 4HNUA 3QM3A 3UPWA 3QW3A 1TRIA 4UTMA 1G6CA 2FQIA 1QWGA 5CPOA 1M5WA 2Z1BA 4UTJA 3LOTA 1YADA 3WFAA 4ADSA 4K38A 5IBXC 1K7XA 1M7OA 1FX6A 1X1OA 1TTJA 3U2OA 2PE4A 4E2BA 5C54A 3L0KA 1ML1A 2BLEA 2FFCA 2TYSA 4M6VA 4JDBA 5IBXA 3FJ6A 3W1PA 3WJYA 2HTMA 4ZZ9A 1QPNA 1GT8A 4UIOA 2V0TA 3F4WA 3MBFA 1RQHA 4HKPA 3OBKA 4XQ6A 2VFIA 4JX6A 3HG4A 2ZRWA 4E0CA 4JD4A 1YXDA 5AHLA 4WD0A 1MEWA 3AO0A 4FXSA 1ICSA 4GFSA 2VENA 3NPXA 5G4WA 5AYXA 4JIPA 1QMLA 3FKKA 3NZ1A 2FB3A 4IMEA 5KZDA 4FNTA 2YX0A 1MSSA 2Z0IA 3L68A 1YTKA 2O7SA 3LCWA 3KAOA 2W6RA 1I2OA 2X1UA 1L2UA 1K8XA 2WNZA 3N14A 4HHPA 4GUGA 4NJKA 4UR8A 1RQEA 4LS1A 1W31A 4UFJA 2FPTA 4FX6M 3W7DA 1BWLA 4UUIA 5CPLA 1CX9A 3R12A 3Q2DA 2YYUA 2JGYA 3EWUA 1Y0EA 1TPVA 4LS0A 2DZWA 4O54A 3LHUA 1G67A 2VXNA 5EA9A 2G95A 5CG7A 3ATYA 2B0MA 3NQFA 3UZ5A 3EX1A 4JYEA 3BG9A 5C2XA 3P5YA 2EHHA 1RR2A 1YXCA 4MOZA 3S5NA 5C6MA 1DJNA 1DBTA 4NZFA 2ZRYA 2QCFA 3S1WA 3VE9A 2XN1A 1LTDA 5GVJA 3S1VA 1F5ZA 3NQAA 4OV4A 4UTTA 1B57A 7TIMA 3CWOX 4FIQA 4FB7A 5AFDA 4FX8A 2DZTA 3PC0A 1G7UA 4K37A 3L66A 3I65A 2QCGA 5G2WA 2TPSA 4A2SA 3IGUA 3QQ1A 1JVNA 2EAWA 4CCDA 1JCLA 5D03A 4NZJA 3O06A 4MLJA 2EGZA 3UWUA 4FXRA 2GJNA 1LBFA 4P61A 4O1CA 3GDKA 3R5EA 2RDTA 4JTJA 4LRSA 3NGJA 4DQWA 2WSRA 5KZEA 3IIVA 3F1QA 2ZZ7A 4YL2A 1F73A 3W7NA 3ABOA 1KBJA 4OE7A 1TQXA 1ONRA 4M6QA 3EX4A 3KVJA 3KVMA 2ABBA 3LERA 4HPXA 5D2WA 2HMCA 2X30A 3KRSA 4RX0A 4CCCA 4JX4A 1QAPA 3NDOA 3W2UA 4DBEA 3HPXA 3GXPA 4WOQA 4JICA 4S1FA 3HGJA 4OQVA 3RFAA 3OVQA 4N9CA 1P0KA 2ATMA 5HMSA 1H7OA 5H2ZA 3TK7A 2R91A 4ZQMA 3PB2A 3G1YA 2FJKA 2F84A 2CLHA 4IQLA 4DF0A 4O14A 3M41A 1PE1A 4IOTA 2NWSA 2QCNA 3N2MA 1H7RA 2TSYA 4B5NA 4XBKA 1FY6A 3LM7A 3PY2A 4FNPA 4MVAA 3G1AA 4MY8A 4W9TA 3TAKA 1RQBA 1TV7A 1ZALA 4CQ9A 4BFAA 1QO2A 3E49A 3FIGA 4RV8A 5T26A 5F1UA 1NAL1 1LDCA 2Y88A 2VC6A 3SZ8A 3UNDA 2V2DA 5DBTA 4KKXA 4LT9A 4JX5A 4MYXA 3T78A 4NT0A 3LTYA 3EX3A 1I45A 4CQAA 4S2CA 2C0AA 5LZLA 4O52A 5AHIA 3B0PA 4LC8A 1OFRA 4E2DA 4FIRA 4BI5A 3LXCA 2YCEA 5FEXA 1GEQA 1G7VA 2V8ZA 4UC5A 3ZR4A 4O11A 1KFBA 4XTDA 2NZLA 2YFNA 4DPPA 3GIYA 2E5CA 3W7HA 3PS7A 1PVNA 3S1XA 4GWEA 2BWGA 2ATSA 3L5LA 2LLEA 4PC8A 5AC6A 1DKWA 2VFDA 3BVJA 2J6XA 5L6UA 3EWYA 3C2FA 3RF9A 1PL9A 1EP3A 4NVTA 3M43A 1ZENA 1ICPA 4LWWA 3THAA 1HG3A 1XBVA 2VEPA 3QZEA 4O4WA 1JCNA 3E02A 2A85A 4UCGA 3GXNA 4CNNA 1OJXA 3O16A 4HN4A 4Z1CA 4I7VA 2YYTA 3G3MA 4IGHA 4QNWA 1DQXA 3W73A 3RNDA 2GVLA 3INPA 4O50A 5KSWA 1A5BA 5LNUA 1VCVA 2WO5A 1OF8A 3W1MA 2CLEA 3PUEA 2FB2A 4YCPA 4C1KA 3QPYA 3LHYA 2A4AA 1RZMA 1UUMA 4QSHA 1OX6A 3TQKA 1Z48A 4O12A 1G4EA 3G1XA 4U4MA 1F05A 4CNPA 1G69A 4AHOA 1IXPA 3O07A 4JEQA 3LRKA 4NNCA 1AW5A 2FDSA 4JTKA 4WY0A 3B05A 4JYFA 1VR6A 4Y6GA 2H90A 4IPJA 1G4SA 1XBYA 1CW2A 1JUKA 3GNDA 4CCEA 5TQLA 3PB0A 1HTIA 5FF2A 2R14A 3N73A 4PL1A 1SW0A 3NPUA 3QSTA 4H4IA 1F6PA 1VCGA 4IWWA 4JDYA 3P67A 4UTHA 1IF2A 1QPOA 2BSLA 2Y7FA 4LVFA 3C2EA 1LOLA 5AC7A 1GYLA 2FTPA 5U7SA 4A3UA 3GDTA 4P2VA 5AYZA 1WAUA 1FBAA 1YXYA 3NQEA 3C3NA 5FEZA 3MBDA 3HGRA 4GUJA 4Z0SA 4HSNA 4UFHA 3KX6A 3HMJG 3P80A 3W3OA 1EEPA 4C1LA 2BZNA 4UTKA 4O15A 1L9WA 3L0GA 2P0OA 4JIQA 2F7FA 1W0MA 3QH2A 4O19A 3A24A 3Q37A 2RHGA 5G5IA 3W71A 3O1NA 1JULA 4FNQA 1H7WA 1QPRA 3V1PA 1FQ0A 1H7NA 3QEZA 3NVTA 3NQCA 3T4CA 4ZQRA 2EPHA 4N4QA 3GXTA 1OFPA 1IIHA 2QF7A 4RZ6A 1FCVA 1OYBA 4EF8A 3LRLA 3SIZA 3PVFA 4UTWA 3C4UA 4HT3A 3CQ0A 1H1YA 3PWAA 1TO3A 2A7PA 5DY2A 1A53A 1AL8A 3W72A 3P8JA 1KFCA 2B7QA 3UWZA 1L6WA 3H55A 4LUIA 5BW6A 3LHZA 6ALDA 1XC4A 4J9JA 3IIPA 1F74A 4G1KA 3GR7A 4LV4A 8TIMA 5LNVA 3HOJA 3MUXA 5DELA 1ME9A 3MI2A 3NQGA 3B0VC 4QM1A 3P7YA 3W85A 2ZZ3A 3NEVA 1EB3A 3MHFA 5FEWA 3SGZA 4QAIA 1GG0A 3EWZA 3P84A 1LP6A
chains in the Genus database with same CATH superfamily
3AFBA 2PZ0A 1W32A 3R13A 3DYMA 1UJPA 1KR1A 3JRKA 3WD4A 3WBXA 3SN0A 5DANA 2P3ZA 2NX3A 4GGHA 3AZRA 4JTAA 1OB0A 2QJMA 3P82A 3SAZA 3UXIA 4DBSA 3K1GA 5D02A 2PDKA 4MB1A 4GUIA 3GDLA 1O7AA 3FN9A 4EPBC 4PRTA 4GQRA 5EMMA 5A5WA 2ZDRA 2D3NA 4HTYA 4M80A 1BVWA 2NQ5A 3FYYA 1OT1A 4TUFA 4TV5A 3W38A 1OFQA 1N82A 4MYAA 2PCQA 3CZ8A 3UG5A 2XH7A 5LHEA 4MZ1A 2GVYA 3BGGA 3NQDA 3WUGA 4YNGA 3VNYA 2HWGA 4Z42C 4AHPA 3IS4A 1BGGA 3STGA 2WBGA 3LS9A 5A8PA 2QUUA 5FCZA 1EZ2A 3QJAA 5M3WA 3IACA 4XD6A 1XKYA 3GVVA 3N19B 2J8FA 4PMQA 2DFAA 3KOWA 3N6JA 1G01A 2EQDA 3MYOA 1CI1A 1B5TA 1U30A 4K1WA 2CZVA 1TMQA 4BZYA 4FLQA 1XD1A 5A6TC 4KEVA 4D6DA 4IIEA 4EXAA 2OMAA 5EKYA 4HQVA 2BASA 4G7EA 3AWOA 2BOGX 2QYGA 3NO5A 3RHGA 3NQ7A 4XZLX 5HBFA 1UR2A 1R87A 2X09A 2KZHA 4D6GA 4HCLA 4NASA 3TZFA 2OX1A 3IK4A 4J7RA 4L4MA 1SR0A 5CGQA 4FNSA 5D32A 2H3DA 1YYAA 5BYWA 3VC6A 4DLMA 1DV7A 5A3HA 1I4NA 1DTUA 2OOGA 1BAGA 3CV1A 5HINA 1WX0A 1QDSA 1VJZA 5EL1A 1TTQA 4M82A 1SJCA 3VNMA 5FIPA 1TREA 3E0IA 5FEPA 4AZBA 5AC5A 3AIEA 4BF7A 3WLHA 4F0KA 3H4WA 4BQ3A 4NI3A 4AIOA 2WKJA 2ZQ0A 5I3GA 3OLIA 2DY3A 3TH6A 1GEHA 4GUFA 3RMJA 2BXVA 2C79A 2C6QA 2NXHA 4JTSA 1TVNA 1L6FA 3R1ZA 3H22A 1J12A 3FDGA 4Z0JA 2X1RA 1W8SA 3MYPA 1GHSA 2D2OA 4BK9A 2FGBA 2BXYA 3WD3A 9RUBA 4IPPA 2I5QA 4AC7C 2V82A 3FOKA 1U33A 3T4WA 1OABA 3TR9A 2XGIA 1TPB1 3QMTA 4Q33A 4IUGA 4I7UA 3LI1A 2NVDA 3MSDA 1VYRA 4UMCA 3WQCA 1YTEA 2Y4SA 1F6KA 3PAJA 1VFLA 3PBVA 3JUGA 4NZ3A 1W9BM 3WQEA 2C15A 3M46A 3GNRA 4WIWA 3SSJA 1FH7A 4D6CA 5JU6A 3V0TA 4PZVA 1UC5A 1WBHA 1WOAA 1L6GA 3PUOA 5CGMA 4I9JA 1V6TA 1MNSA 2V5BA 3DFNA 1XI3A 4KGJA 3T8QA 4WGXA 4AY8A 5DCBA 1NARA 1HL2A 3CQHA 1HKWA 1JZ6A 3NL3A 3QLLA 3RRAA 2QQ6A 2V2CA 5I78A 1OCBA 6REQA 4MAZA 4LRTA 5A6LA 1QOPA 2ZX9A 2QJGA 3G1VA 1XRTA 2JK2A 3R89A 3B4YA 3KZPA 5E93A 2PTYA 5BRPA 3PJTA 4JTLA 4S3DA 5FOOA 5DRCA 3HG5A 3QPEA 3SFKA 3I6RA 1OYCA 4O8RA 2WZIA 5HQLA 1PX3A 3AS0A 1DWFM 2WM1A 1KGWA 3TQ0A 1AD4A 4QDPA 1M9HA 3WENA 2PMQA 1R2SA 1NOFA 4ZCWA 2ODOA 1FWFC 3I6TA 4DZ5A 3RR4A 2PWUA 3VKJA 5I23A 3P61A 4KIEA 1FWSA 1JR1A 3VDGA 3I3DA 3W23A 4MY1A 1EZWA 3EXSA 2P76A 2CZ5A 2VGIA 1WUFA 3A6OA 1VRDA 3AS1A 4L1WA 3MI6A 1ME8A 2E1WA 4HA4A 3G6LA 2WCSA 3N3MA 4H9XA 2OO0A 4GY0A 1XLGA 1VEPA 3L12A 1UPMB 4H7VA 1NH6A 4I9AA 2OQLA 5AHNA 3NNTA 4WXYA 4ZO8A 1S2WA 3P8IA 3OIHA 1UD2A 2OO6A 2A0NA 3WNMA 3BWWA 2WAGA 3EB4A 3W7EA 5JH1A 1BD0A 2O0TA 4WXZA 5DT7A 3TA9A 1XW8A 2UZ9A 4JFVA 4W86A 2WNWA 4Q4MA 4ML9A 5CXPA 1DJYA 4U33A 2UBPC 1NF0A 2UV8G 1EDGA 4F2UA 3S2JA 1XDMA 2GFTA 2J7EA 4HNTA 1AJ2A 3W2LA 4D6JA 5KETA 2Y7DA 3IIXA 3EX2A 1S3TC 3G1DA 3S9IA 1EUNA 2C71A 3DZ1A 4C60A 3H23A 3KW3A 1TPUA 1EGZA 5FSEC 1HJWA 5CC5A 3HZ3A 1IE7C 3A23A 3ZO9A 2ZUWA 1KFEA 4NY2A 5ABGA 3CYJA 1HKJA 4EKJA 3TEVA 1JNEA 1EJUC 4NNAA 1R3QA 3SECA 3EXTA 1VYSX 1W5NA 1GVFA 3BV7A 2DUAA 4UFKA 1AW2A 1MQRA 2Q01A 1QK0A 2OSXA 3T40A 1F6YA 3W7PA 1KV8A 2HS6A 2PBGA 2VWSA 3PPHA 3NVDA 1I1XA 4MGGA 1FWCC 3K46A 1DQWA 4W7WA 3S46A 4LVAA 1R7AA 2Z1KA 1F7BA 3KBMA 1VGAA 2QMKA 1DJZA 1DWGM 2F8QA 3KWSA 2I7GA 4B9ZA 3CU2A 3IVUA 1BXBA 3EEZA 2CC0A 4RNJA 3MV01 1Y7VA 5M03A 3IGSA 4LUYA 3BC9A 4XTIA 3LG3A 3JR2A 1W91A 1OFOA 5MKGB 2NUXA 3OLDA 3ABSA 3ITLA 3WNNA 1Z41A 5CSSA 4TTGA 3WBEA 3BH4A 2PTWA 3ABXA 3UBPC 1J01A 1WV2A 4W84A 4H41A 3GTIA 5JH2A 4N02A 1GVYA 3FJNA 1QOQA 1UMLA 3WELA 1Q63A 4QCFA 4J28A 4B4HA 1FXQA 1JPHA 3IV3A 2PRHA 2XGZA 3FFSA 3GQYA 1YBQB 3IAPA 1LF1A 5G1TA 2YGYA 3JZEA 4LV9A 1EL3A 1MXSA 3GXFA 3AIUA 5JUVA 2QGYA 2CBIA 5H8PA 4ZOAA 3AXKA 4DLFA 4ZA0A 3NUKA 3GKAA 5E5CA 1A3XA 4US5D 2AL2B 4AMCA 4Y9PA 1A5LC 4CUCA 1R38A 1JAEA 4E8DA 1KA9F 3PF3A 4LUSB 1XH2A 4TO8A 1QW9A 4QISA 4HYWA 5AC8A 3TW7A 4FF5A 5BXSA 2RFGA 1XQLA 3UYIA 1KXTA 4JTQA 3RLUA 4QP0A 3AALA 2PTDA 3MZNA 4DEFA 4DELA 4BS0A 3AHYA 3DFPA 3SUTA 4HA1A 1UH3A 2YSWA 1HGYA 4JCMA 3EEGA 2EEXA 3H54A 1X6UA 2YCLA 3D6NA 3GUWA 1KFWA 3WNKA 1XFCA 4ACZB 4LXFA 1OX5A 4EAYA 2C0HA 1B9ZA 3M47A 3R8GA 1PZ3A 3M5XA 3LN3A 4V1XA 2WQPA 1FFQA 5FSDC 1PDZA 1H7PA 3USZA 1EA0A 3QFEA 1JQVA 4P5UA 2YA1A 4ZFCA 4Q4SA 3VOFA 4O13A 4TIMA 4C6QA 3OP2A 1J0ZA 1WDQA 3TOYA 3DN5A 3UJFA 3ARXA 2GSEA 3GC4A 3IIOA 4QFUA 3BOLA 2OU4A 1QW8A 3IUIA 3AMDA 4HU0A 2C1HA 3KVKA 3VA8A 4L4OA 1Q6CA 4AHQA 1I2QA 1E9YB 4ZBCA 2W61A 2WPBA 4JTUA 4X60A 3NFUA 4DPQA 4PBGA 2YBUA 3W7MA 3W76A 1LRTA 1EA9C 1UHVA 4PUNA 2BY3A 2X05A 1GOQA 1TYGA 1SFJA 2Q3OA 2PP0A 3MSYA 1XIHA 2DQXA 4YS1A 5AN7A 1H3GA 3KLKA 4EAMA 3WBYA 4AF0B 3LCFA 1VH7A 5CBBA 4M1BA 1XBZA 2D24A 5BU9A 5T8GA 2VDHA 1E55A 5HATA 1F9CA 1I6NA 4MDPA 5CEWA 1UD3A 2X8RA 3T6CA 5I3JA 3OVRA 3UD6A 2GYIA 1G4TA 2QR6A 2A7NA 1Q6LA 5F2GA 3GHTA 2JGQA 1XHGA 1QNVA 3UY8A 3CO8A 4N4PA 5FI8A 2UY2A 3QZ6A 4JQAA 5E6YA 2ON3A 3C5QA 3PBMA 3QY8A 4FF7A 1Z3NA 3N2BA 1LBLA 3WLPA 1SVDA 1FUYA 2MNRA 1HJUA 4NRSA 3W1XA 2NV9A 2QMJA 1MYRA 4WDTA 5U4NA 1O5XA 1CCWB 2P10A 3UFYA 2WHKA 3UGVA 5HPOA 1SW3A 1KBLA 3K8KA 1C3FA 1EWEA 3PR2A 2NV1A 2CCRA 4GIYA 8A3HA 2BVTA 3PFRA 2QJIA 5F7UA 1K7EA 1ZBCA 3B03A 3DHDA 4JPGA 5H91A 3PFMA 2FJUB 2E25A 3GG1A 1UUOA 2WZHA 2RJHA 4XUGA 1WDWA 2Q3RA 1IGWA 3HF3A 4POCA 2ISVA 5D33A 2NVAA 1F76A 3LYEA 3VMOA 1XYBA 5KMYA 1CIUA 4AZIA 2NW0A 2Z25A 4H00A 4HPNA 3URNA 2VEKA 1A50A 3NL6A 4O1BA 2ZZ5A 1V7AA 5JBFA 1ZTVA 2PP3A 3VILA 4LGXA 4XAPA 4ZB2A 5A2BA 3L4XA 3H21A 4Q8OA 5EYWA 2DT0A 5HANA 3NZPA 1SO6A 5DMYA 3W7RA 1JDEA 5HPCA 4GGBA 1KXQA 2IKJA 4YTRA 2E68A 3LENA 2PGWA 4KQNA 4B90A 4H8NA 1XKJA 4ZO9A 3LHWA 3WBAA 4O1AA 4BWLC 1T7LA 2VGFA 1JDDA 1QRQA 1ZUAX 4NXSA 4PB4A 3N2OA 5CZ0A 1M7XA 2ESCA 2WHMA 3B9AA 1JD9A 4AVFA 1Q6GA 3WLKX 4GC3A 2OWCA 3TC6A 2XWEA 3ORWA 1E1EA 4GVGA 5F4XA 3WDRA 1FHUA 1TUXA 9XIAA 1UR9A 1A5NC 4A29A 4B5SA 2X1IA 1LWJA 4M8UA 3TIMA 4AD0A 1XYAA 1P4CA 4ZFMA 2HXUA 3HQOA 4MSSA 3CM4A 3N2CA 4OGZA 4CQBA 1NY1A 4CQ8A 1TCMA 4RUBA 3A5FA 4AB4A 4MJ2A 4V27A 5C5YA 3MO7A 5B80A 3UF9A 4GY7A 4OHQA 5J5DA 3OBEA 3MJYA 4RCXA 3A3XA 3GFYA 1WPCA 2HJPA 1U1UA 4I9TA 4N7QA 1F2JA 2QJHA 4MB5A 2XSBA 4NRRA 1JDFA 2EPNA 2E09A 2P1FA 3RCNA 2VZSA 3RAOA 3HPZA 1G5AA 2PDLA 3L4VA 4GOAA 3MANA 3W88A 4C6BA 1J0KA 4QRNA 2YIHA 3EOLA 1RK6A 2CNCA 3W7GA 1QBAA 3GR4A 3UJSA 2TRSA 1TE1A 2E3ZA 4WKAA 1AQ0A 3OOQA 5GJMA 1XGEA 4J27A 3PM6A 5HOSA 3UG3A 4KETA 3BSMA 3BOXA 1THFD 4W8AA 1S2VA 2ICSA 3F2DA 1EQPA 3R7MA 1GTEA 5KZMA 1EYWA 3PJWA 4C6PA 2B31A 2Y8UA 3VKDA 4ZEPA 1W1ZA 3TMQA 1W54A 4FSAA 2WC7A 3M0KA 1X6LA 2PLKA 3LPOA 3IJ8A 3CEUA 1XIBA 4W8BA 3RUBL 4C65A 3GTXA 2XM1A 4QJ5B 4WDUA 1DHKA 4A8RA 4DYEA 3BZGA 4LW7A 4H1ZA 1GUVA 1H5YA 3TSMA 2ZX6A 3CYVA 3T7VA 4XBJA 1PKYA 4K8HA 1B1YA 5ABFB 2NT0A 4IGSA 2OT0A 5K4ZA 1EX1A 3DC8A 3NJ3A 8XIMA 4UNLA 3HURA 1RCOB 3WK3A 3AS2A 1GVEA 3VUPA 5F1VA 1VP5A 1QI3A 1E6XM 1E5JA 1E51A 4Q8MA 3IJLA 2J74A 1YW1A 2ZTJA 3R0KA 4B3LA 4D2JA 4UQBA 2QIIA 1T8QA 3ITYA 1S39A 1OG0A 3VFCA 3H7RA 1HJXA 2VX6A 3BCJA 5BWAA 5A6BA 5K9CA 4CQCA 3CQIA 3WFZA 2Q8LA 4GX9A 3U6WA 4PUKA 3CUFA 2QNEA 5AB3A 4LAKA 4G8TA 3F4CA 3OHIA 2PP1A 1OHLA 4BI7A 1BKSA 1M53A 1RBLA 3PZOA 1W1TA 1EH9A 3NA8A 5MHBA 4GY1A 2GUYA 3VNKA 3NL2A 2CLMA 3AI0A 3W25A 4U5IA 2YDQA 2ZRUA 1KB3A 1N2VA 3HIJA 3E9AA 2X0HA 4PMOA 5TIMA 2WSYA 1EEXA 3GK0A 2PAJA 4UCFA 1UQZA 1FCBA 2G3IA 5TD4A 1JF5A 1J5TA 4AZCB 1KLYA 4Q8NA 1IIGA 3W70A 1IGSA 1A5SA 3C0SA 4NNBA 3LCGA 3G3DA 1SU5A 1K6WA 3REQA 1LL6A 4WSJA 1QWKA 3GU9A 1I8JA 4FX7A 5LYRA 1CEOA 3TR2A 5HUOA 2WM0A 3FYOA 3KM8A 4JTFA 5HJYA 1GPWA 1UR1A 3LCHA 3ZS4A 2CZEA 4MJMA 2WNQA 4NAFB 3G8EA 3L9CA 1KTCA 1I60A 3MUIA 2VURA 3DERA 3W7LA 4H7ZA 1SSDA 3HPAA 5E9XA 5REQB 4HJFA 1PWLA 3RM9A 3KRUA 2QV4A 4AD5A 1E4MM 4FO4A 3FA3A 2PB1A 4IL0A 2RDWA 2DGAA 2WQDA 4X9YA 4HNVA 1OX4B 3WNLA 3WLNA 2E9MA 1R0MA 1KM0A 5DCEA 5DN1A 2GJXB 4CN6A 4F66A 4U28A 5CG0A 4BI6A 1X7IA 1ZNNA 3M44A 2D1ZA 4HHMA 4WY0B 1J0HA 1M03A 2G3NA 3BG5A 4DZIA 2ACSA 4GX8A 3UZYA 4F9JA 2E5BA 3GAYA 2JFEX 5A6MA 1E1CA 2BFGA 1B4KA 2BS9A 2QCEA 3WQWA 3UQNA 3QGVA 5I3DA 2PDFA 1LYXA 2JEQA 3E2RA 4JIRA 2EKGA 5D9NA 3W86A 2G37A 5C2CA 1ESWA 2PDGA 4A3YA 4NYUA 2EG7A 4DHGA 3L2MA 3PWIA 3C8NA 3SURA 4AZCA 2CBUA 1X8FA 3VFLA 2L5HA 2FPYA 1REQB 2WYSA 3HFTA 4HSHA 5AHFA 4ONVA 4UR9A 3QM3A 1TRIA 4UTMA 3K13A 4E4PA 4HMCA 4BCEA 1UUQA 4YU1A 4W8LA 3LOTA 4ADSA 2O4MA 2PE4A 1E6ZA 1Q65A 4E2BA 3ID7A 1ML1A 3NOYA 5A8NA 3MBFA 1RQHA 3IV8A 4HKPA 4XQ6A 2PSNA 3DYOA 6A3HA 2ZRWA 2ZKMX 4TQTA 2INEA 1YHTA 3N12A 3VVGA 9XIMA 4AY7A 4GFSA 1KRBC 3NZ1A 4W87A 3WD2A 2WMJA 4C5ZA 4H9VA 3DDMA 4HCHA 1MSSA 2Z0IA 3NEHA 3L68A 3DEQA 4PR4A 3WCZA 1I2OA 3IJ6A 2X1UA 2R1NA 1CB7B 1V0MA 4G6CA 1JXKA 3GTFA 5EU9A 1QI2A 1HVQA 4GK8A 4GG9A 3M0HA 3IWPA 1NJJA 3W7DA 2G50A 4C6JA 2X42A 2Q09A 4UUIA 1FWAC 2OB3A 1UG6A 2VTFA 3TW9A 4HB7A 1MWOA 2DZWA 1T40A 3AYSA 1OY0A 2G95A 2HVMA 3WQDA 3TWAA 1V0KA 2B0MA 1KKOA 1SFTA 3O3RA 2WVVA 3WQ5A 2FKPA 3P5YA 1NWUA 1RR2A 2IMRA 1YXCA 3S5NA 4L9XA 5CJ5A 4NZFA 1BGAA 2ISDA 2TODA 4E6MA 5C9ZA 1ZBKA 2GGIA 3VE9A 1LTDA 1ZP3A 3V3WA 4FAMA 4UTTA 1UIPA 3CWOX 4FB7A 5AFDA 3PC0A 2XFRA 1JVNA 1KNWA 4LBRA 1HL9A 4TXEA 3O06A 4M6UA 4MLJA 3UWUA 1V02E 1H4PA 4O1CA 4WJ8A 1C93A 1KWKA 2YL9A 3F1QA 2ZZ7A 1F73A 2HVOA 2Z29A 3ABOA 2D20A 1ONRA 1EO5A 4GCAA 3KVMA 2HMCA 4JX4A 3N4AA 4RE0A 1XC6A 2DPEA 3RILA 4WOQA 4JICA 1BYAA 3RFAA 1P0KA 2J7DA 1XGZA 1DWIM 2PLCA 4I6VA 5H2ZA 3W02A 1ONEA 4ZQMA 1OGGA 5D8ZA 3H2OA 3CASA 3GHUA 1ISXA 1Q2RA 2HVNA 2V63A 2WJFA 4RE3A 4J3UA 5E6ZA 2WHJA 5IFPA 4KEMA 4WVXA 3LM7A 3O0KA 3PY2A 5C7HA 4FNPA 4MVAA 2EO7A 4XAZA 1ONWA 1TV7A 2BGNE 4CQ9A 1QO2A 1HVXA 4RV8A 5T26A 1UH2A 4Q7BA 3UJRA 2AGTA 3BLOA 4IP7A 1XLFA 1O12A 3SZ8A 3W29A 4A3QA 1EJRC 5BXTA 3T78A 3M6DA 1VENA 5AYIA 3EX3A 1I45A 4CQAA 2R1MA 4HTBA 4HOWA 5D9PA 1OFRA 3AWNA 1GEQA 1TIWA 1KGUA 1OD0A 3MZ2A 1EDQA 4QROA 4CGTA 3GIYA 5IFTA 1LLOA 1ZBVA 3VGEA 3ENLA 5B7YA 1PVNA 4PMYA 1DIDA 4NP7A 4PCPA 4F9DA 2BWGA 1KCZA 1KRAC 4P8XA 3L5LA 3BMVA 2LLEA 4K2SA 2WB5A 3BANA 4CEXC 2X40A 3M43A 4D1JA 2A79A 1ZENA 2QS8A 1ICPA 1OIMA 1TR9A 3ES8A 2VEPA 4BJHA 3ZXWA 3GXNA 3MSRA 3EA3A 4MTVA 4I7VA 1D7FA 3S5SA 4PTXA 1F3XA 4UQDA 4AXNA 4ZO7A 3RNDA 2GVLA 1RK5A 1V8EA 1GJWA 1OF8A 1CGYA 3W81A 3C3UA 4YCPA 1RJQA 1DJXA 4H9MA 4DI8A 2OZ8A 3T2OA 1S5MA 3VIOA 3RM4A 4RE2A 4CNPA 1G69A 3QFWA 1UROA 3WMBA 4JEQA 2VQUA 3LRKA 1J0YA 1AW5A 3TYCA 2PWEA 3U2CA 3K2GA 4IPJA 5FJUA 4DUOA 3VX1A 4PTVA 5I03A 4CCEA 4BY3A 5FF2A 4ACYA 2SFPA 1E6QM 1K4GA 3QSTA 2BP1A 4G9PA 3V1HA 4DM1A 1ZCCA 4F48A 1RCQA 2VJXA 2BSLA 2Y7FA 3C2EA 1GONA 3M0LA 3BCFA 1XP3A 1X39A 3B8UA 1GYLA 1OGSA 4U5KA 4M81A 2HK1A 3T8LA 4HN8A 1Q66A 3EOOA 3EDKA 5FEZA 2XIIA 4GUJA 3ANUA 4B15A 1VFSA 1EEPA 4KRZA 4M24A 2XM2A 3B97A 2DIJA 4O15A 2G4JA 4LYRA 3VABA 4O19A 4YIWA 1XH0A 5DRIA 4FNQA 1H7WA 2BY0A 4PFHA 1R3TA 1XV8A 3LQLA 4GO8A 3FW6A 4G1NA 2YB4A 4NAEB 5CGTA 3WDJA 2FMOA 1NDVA 2ZXBA 3VAVA 1KBBA 4C6CA 3S4TA 2VZVA 3FVDA 4HT3A 3H2EA 2A7PA 1A53A 1V6VA 3P8JA 5IXEA 3UWZA 1L6WA 3H55A 1FTXA 4DWSD 2OWWA 3LHZA 2Z1XA 3IIPA 3CL7A 3GR7A 4DYKA 1G9HA 4I8YA 3MUXA 1SJBA 4D8ZA 5D9MA 3NQGA 3B0VC 1CECA 1EB3A 3MHFA 1PKMA 3SGZA 4Y9NA 3HMCA 4AWEA 5LXEA 2V5DA 2ACUA 2RDXA 3N25A 5EFFA 4Y96A 4R7JA 3FCPA 3H70A 3BW3A 1LT7A 4J3ZA 4A4AA 1HP4A 4DF1A 1AQHA 4GLEA 3CEPA 1UD6A 1OF6A 1QTWA 3U5YA 1V3IA 3R6IA 2VX5A 3EWCA 5I07A 4D8LA 2AL2A 1TX2A 1EDTA 3VIJA 3DI1A 5IOBA 4YYFA 1PEZA 3VTRA 1V3KA 7CGTA 1H11A 5HMDA 1XYFA 1WE5A 4QDWA 1W9DM 3EDEA 5AZ0A 1SZRA 1JUEA 2FLIA 2DZPA 2XIJA 1ECQA 2OGYA 3KDNA 2X2GA 1NF7A 5H1WA 3BPWA 2VGGA 2V3EA 4IIBA 3DI0A 4L1GA 4KH2A 3UPMA 1CXEA 4NIRA 4DZAA 4ENLA 3APGA 1EJ7L 1XM3A 4MDOA 4HHHA 4ZQPA 3R25A 4MWAE 1ITCA 2ZBTA 3PBWA 3WO8A 4IIDA 1XLIA 5I79A 4KFNA 4OBTA 2WMGA 4JTTA 3STCA 4A05A 1FWTA 1UH4A 3GU2A 1Q3NA 3CZJA 3WDHA 1QHPA 5FA5A 1MUMA 1BVNP 1C9DA 2QV5A 4AEFA 3U0HA 1ECEA 1F07A 2DP3A 4WF7A 1POJA 2QCDB 3C0JA 1UA3A 4FALA 4GD0A 3TYEA 1ZJHA 1TA3B 3SCNA 2OX4A 4L64A 5GQBA 2BGQA 2J6VA 1JYNA 2PD5A 1VYPX 3WBWA 3FS2A 5C9WA 3NM3A 4QTGA 2MANA 3K8LA 4AZGA 5I00A 1ZBWA 2V5KA 1XUUA 5ABHA 1DXIA 3RGTA 2CZFA 1GOKA 3VC5A 4ZQNA 1BF6A 1XRFA 1S2CA 3LGGA 1UA7A 2Q8XA 2I56A 4JOMA 4CD4A 4YMZA 1WO2A 2OEJA 3NZGA 4DJDC 1JIBA 4UQAA 2IKGA 2W67A 4LUTB 2NXGA 4Z17A 1T5AA 4LALA 4J35A 4IHCA 5C2GA 4JL1A 2XN0A 3G22A 5I3KA 1VPXA 3EGJA 1D3CA 4IJCA 3CPRA 1KM2A 1NFBA 1QI5A 5FESA 4NUWA 5CQ1A 2GVJA 1BRLA 2WWDA 4ZQOA 1P6BA 5HWJA 4IXHA 4I8DA 3W28A 3GNNA 4H9TA 3KL3A 4IPLA 4Z1BA 2DSWA 1JRBA 4J3TA 4LC6A 3GVQA 5F4WA 5C9UA 2D2JA 4ZODA 3UP8A 2WSPA 1VEOA 7XIMA 3FK4A 3DX5A 2J47A 1OCNA 4INFA 3NAVA 2VCBA 2YPIA 1CBGA 3BLEA 3MCOA 2G41A 1OFAA 2JIEA 1MQQA 2RUSA 1UKQA 3E1F1 4XZWA 2XZ9A 2VL4A 4D6HA 3ALGA 4LANA 5BOOA 1ZJBA 1ZL1A 1DP0A 2GGEA 2ZRZA 4LQ1A 3L4YA 4UQCA 1ZY9A 4URIA 3CTLA 1SFLA 1UWUA 4EK7A 4Z2KA 1QJWA 4EANA 3H7UA 4A8IA 3TONA 6PTDA 1XX1A 3T81A 3OBAA 3AHXA 1S5VA 2QLYA 3DXIA 3ONBA 1OBAA 3UG8A 3WK1A 2J9XA 3G1FA 3EA2A 4WJEA 5KZ6A 3SADA 3M07A 3M6YA 4JY8A 4CD6A 4OT7A 2ZA2A 4AFYA 5DMMA 3FV9A 3N6HA 3GZ3A 1ZAHA 3H7VA 1IEXA 2GDVA 2NX9A 2WK2A 4YVPA 3LCLA 3ITVA 3LCIA 4K36A 1NTHA 4RNIA 3TFXA 4IIHA 1K8YA 3BXWA 2C1IA 2DJLA 2AL1A 3VCNA 2PDYA 3W75A 1ZZMA 2DQWA 4Q4QA 5M1TA 3E2QA 5HAOA 3VX0A 4B91A 2E6DA 3BCDA 4R27A 3UXDA 4HHLA 1OT2A 3NM1A 4RDWA 3CUHA 2E6AA 4PODA 3AYRA 3GX9A 3J7HA 1GQKA 4GZ7A 1O66A 2G3MA 5LIUX 1U1JA 3M7WA 1Q13A 3DFYA 4EWND 3DENA 2D0GA 4C6IA 2DT3A 3TTSA 2OQHA 1C7TA 2X7WA 3BW2A 1RAKA 3QPZA 1CT5A 2Y5JA 2GK1A 5G2IA 2V6AA 1U83A 3F5KA 3ITXA 1PS9A 3U4AA 3C61A 5DX7A 4YLWA 2ZUVA 1KBIA 4OZOA 1IZCA 2YCIX 3CV7A 1GOWA 4HNNA 1IT7A 5CSYA 2VR5A 5CPMA 2D73A 1A0CA 3TQPA 1A3HA 3MP4A 2IPWA 4WEVX 4E3VA 1VRXA 4MWAD 2AKZA 3W00A 1JCXA 2ACRA 2J7GA 3TUUA 4UFIA 2O9RA 2BY2A 1B30A 3DESA 3VKKA 2DSZA 3WLRA 3SI9A 2BDQA 3CAWA 3QF0A 4RPQA 2CBVA 2VEMA 3T55A 3RXZA 2ZC8A 4X22A 2CLLA 4XG1A 4RNFA 4ORIA 3TNOA 1BXCA 2O56A 1UASA 5HJLA 4GPNA 4NU7A 1XUZA 2V5LA 2B7PA 2Y63A 1LQAA 4QG6A 1GJPA 4MM1A 3W26A 1TV8A 2JKPA 1B90A 3O6YX 1Q6RA 4JKLA 3A3HA 4C7DA 3WLQA 3UCQA 1SQ7A 1GOMA 3EZ4A 1ENUA 1ZS2A 1QUMA 2PDNA 3OO2A 2GUBA 4OKDA 3OGSA 3KXQA 1RV8A 1UPPA 1EF2A 1R30A 1OFDA 1JG9A 1PZ1A 3SCQA 1A49A 3WF4A 3H53A 4AZHA 3U4FA 4V15A 2XVGA 4C7FA 3CZLA 5CSUA 2D22A 4AVOA 3EOUA 3T44A 1W3JA 1O5RA 3GWQA 5CLWA 2CZDA 3H12A 1XLBA 4PTNA 3KE0A 3ABQA 1UBPC 3T07A 3TN4A 4NX0A 4DXKA 3BGJA 2CPUA 3SRDA 2CETA 4S3KA 5DFAA 3VD9A 2WXDM 3CS2A 2OOFA 4A21A 4IX2A 2NX1A 2WVUA 2Z00A 3UYCA 2ASHA 3OGVA 4FHAA 3CHDA 1W3TA 2REQA 3GW0A 2NUYA 3S3GA 5LGZA 4DBUA 4J2MA 1VCFA 2BX7A 2E67A 4S2BA 4B3ZA 1PKNA 1ZSXA 3WMSA 3P62A 3KTSA 2J27A 4L6DA 4AH7A 1EF3A 5HXMA 5HNRA 3ARWA 3ATZA 1QNSA 3W1AA 3THCA 4N6EA 1KR0A 1XLMA 4NYYA 2OZTA 3TKFA 1VZWA 4WK9A 4ZQCA 1A5AA 1XLAA 1GQNA 4XD5A 5A6JA 5E09A 3GXIA 4K39A 3L21A 3BV4A 2ZCGA 3BK0A 3DYPA 4PMNA 1JGIA 1TCDA 4ROPA 3H2FA 2G96A 1R2TA 4FNUA 1AD1A 3FVMA 4AZ5A 2WBKA 3V18A 3R4IA 1Z9AA 4DO5A 4P7RA 3ZFHA 1Q7QA 3EWDA 3PULA 3GNOA 5F4SA 4MFEA 2Y85A 2PDQA 4ICMA 3A9BA 3E0VA 3BDKA 3R79A 4US6A 3D3AA 3HJZA 1V0LA 3MSGA 3OZOA 3VKAA 1Q4WA 1TJ0A 5REQA 3N34A 4XK2A 3M0MA 1RBAA 1W9UA 3CPUA 4R33A 2C19A 2Z2UA 4AAJA 3KUMA 4A22A 3WH7A 2BVWA 3OHMB 4B2DD 4WSKA 4B9YA 1R7OA 3CPGA 1I2RA 3R58A 1QK2A 3A9IA 4IJBA 3M64A 3OVGA 2J62A 3QSRA 3E74A 1TRDA 4AQLA 1FWDC 4GQ0A 1XYZA 4DJEC 4GACA 3VUSA 3ARQA 1XFBA 3G0UA 3VZZA 3G2GA 3U9IA 1AL7A 2RH9A 1KCXA 1K8ZA 4IXXA 5FAGA 1RVKA 1EOKA 2DSKA 4AWUA 2GQ3A 1X1NA 3LGEA 4IQJA 4R3UA 1EBHA 3WH6A 3MHUA 4B4FA 1JZ5A 2YXXA 3WQGA 4JY9A 2Z7GA 2WV8A 5DF0A 3O0FA 1RPXA 1XIDA 3FGCA 1RA0A 2O7QA 5G4HC 3GIQA 4GQBA 3HTWA 3POCA 4B5XA 1O1HA 1W1B1 4TMCA 4FK9A 4UTIA 5E1QA 3MDUA 1LLWA 5FD0A 5CBIA 3C2YA 1Q2SA 1XLHA 1QHOA 3KBSA 1EX5A 3CZEA 4M0XA 3WH8A 3P5ZA 4JXCA 4D72A 1TTIA 3AUJA 2WJDA 3U7BA 4F4RA 3P93A 4DY1A 3VD5A 1R3SA 1FWIC 3VDHA 4PFMA 5I3HA 2E8ZA 4UB9A 2E8YA 2UWFA 3BJFA 1LCOA 4Y8FA 4GUHA 5A6KA 2BB0A 3LXBA 1CENA 4XKYA 3AXXA 1O95A 3RO6A 2CWXA 3C56A 4GNJA 3COTA 3G0SA 1WXYA 3LRMA 3L7RA 2FPVA 1JZ2A 1W3KA 3CB3A 2WMIB 2W27A 1ZFJA 3G0XA 4REQB 2GQ9A 4K68A 1AH4A 3O63A 4DO4A 1HKVA 4CNSA 4J3XA 1TWSA 4GQGA 3N1AA 4M51A 1NELA 5A1AA 2H3BA 2VX4A 3P6LA 3WJXA 4JIHA 1TUFA 5F2IA 5CBJA 1TTPA 4JHMA 3RMEA 2IKHA 2CERA 2PODA 3OZYA 2P50A 3ZVHA 3N2XA 4F0RA 3R8RA 3W83A 3MWAA 3WLMA 2ALRA 1GORA 2GOKA 1FFRA 2J78A 1PHQA 4PUWA 1TWWA 4LUJA 2EKCA 3F2CA 2E7FA 2ZX5A 3HV9A 4GH3A 3K30A 4R9XA 3UCDA 4RLIA 4AZ7A 2E77A 1XLDA 3DHFA 1KM1A 5D2VA 4Q8TA 3WQVA 2E9BA 3E5PA 1WB0A 4PTMA 2WNNA 4O57A 1TZ7A 1JL8A 3TFCA 4GMEA 2WOQA 4MJZA 1XYMA 4KT2A 1NWRA 4LY8A 3T09A 4Y90A 3FSTA 2FH6A 2FDMA 1DIOA 5EBUA 1P7TB 5K4XA 1ADSA 2JBMA 1Q5MA 2XVPA 4TMBA 3QV9A 4S38A 5CH9A 2A5HA 3LBMA 2AQOA 2EXOA 3GS6A 4MNMA 1TPWA 1TJ2A 4GIEA 3UWWA 3UVAA 1NWSA 3BL3A 1VD6A 3A13A 3A3WA 5LNWA 1AH0A 1HKIA 4F0MA 3TNBA 2CEQA 1E40A 2DZBA 1U5VA 3GHRA 2VCCA 1JRCA 1V0NA 1QVBA 3QR0A 4KESA 4OBSA 2Z1WA 4IMDA 5BNKA 3W74A 2A3EA 4GI4A 3BAWA 2QVHA 1XXXA 3EXRA 1VC4A 2VOMA 1ADOA 1FWWA 1PX4A 1A5OC 3UZZA 4GJ1A 1RA5A 1BQGA 3PBGA 4S3GA 3NYZA 1N8FA 4GCXA 1XICA 1Z8AA 4B5VA 4K8GA 3L2IA 3WNOA 2C18A 3VNDA 2YL6A 1TFVA 3IUHA 2NWRA 3B8IA 3NXFA 5HWNA 3AU6A 4L4PA 4MAVA 2CXGA 2RGMA 2W66A 9CGTA 4JTRA 4Q7IA 3KOZA 3ZWTA 3PBUA 4EVZA 3WD1A 1OSEA 1ISYA 1VBRA 1XCWA 3NPVA 3O15A 4Y8EA 1JZ8A 1BYCA 3APTA 4CNOA 3AIBA 3I10A 1ONXA 2AQWA 1KQZA 3IVTA 1TZZA 4KCVA 2OKTA 2WVSA 3BE7A 3VGGA 2QZRA 3S2LA 1NSJA 4M1RA 1HXJA 4PN2A 2DZAA 2C16A 2QCLA 1EXPA 1HIZA 1DHPA 4OU1A 4PYSA 4X9SA 3OB8A 2ZRXA 3BLDA 1FCUA 5D2YA 2XHYA 3D5HA 2HQAA 2DJXA 3GR8A 4DM2A 1EPXA 4DZHA 4W4QA 3B06A 1XDJA 4HIBA 3S6DA 2JF7A 3WQFA 3PSWA 2H8ZA 2HEJA 3JU2A 2INZA 3OJGA 4S3CA 1YPXA 1L8PA 1NQKA 2J9ZA 1O5KA 1OG6A 1HJQA 1RJRA 4EPKA 4HMEA 3R2GA 1RLDA 5AYBA 3RIKA 1TVLA 4O16A 4Z1AA 3URQA 4GBDA 2XVKA 2FTYA 5BRBA 4A3RA 1JYVA 3VIMA 2G3JA 2Q8ZA 4AD3A 3GVWA 4FPSA 1P6CA 4KRUA 3BLKA 3DG6A 3RX4A 4P7QA 1AZ1A 5E70A 5TNVA 2PWGA 1JEZA 4UFLA 1DXFA 2IS7A 4ERAA 3Q65A 4AIUA 3ICJA 2H8XA 3S0CA 4ORMA 4QJ4B 2JIWA 2NV2A 3DKLA 4HJWA 1TX0A 2JALA 3B8DA 5CPQA 1SZFA 4HZ6A 3W1UA 1ZAIA 1SO3A 4WKHA 4WUIA 3DAQA 4ERGA 1LWHA 1GVIA 3ME3A 4MMWA 1P0BA 1OYAA 2V2HA 2XYLA 3ZOAA 1JZ7A 1MRQA 1W5OA 2OEKA 4M6PA 3EKLA 1VLIA 3SCTA 3Q94A 2MUCA 1FHDA 2HRWA 4RXFA 5A6BD 3MQTA 2JF6A 2Y62A 3SB0A 1PJ9A 1FVPA 3PUDA 2GVEA 2OLSA 3AJ7A 4RXGA 3WUEA 4UOJA 2CBJA 3ONCA 1O5QA 1PAMA 1EJSC 4NSBA 2X1TA 1OINA 3I4KA 3G1RA 4X2RA 2R94A 1D7KA 2I9EA 4IFKB 1XSKA 4N9EA 3OLEA 4ZSTA 3FDKA 1E71M 1CGWA 4R5EA 3TW6A 4HA0A 2TAAA 3MKCA 5DMLA 4DBWA 3S42A 1YPIA 3N15A 3QQ0A 5A8GA 3T08A 3RO8A 4DX3A 1WKEA 3W2JA 4PGLA 4R7WA 3MMDA 3KOFA 4W7UA 2PEVA 1E9ZB 3VPLA 4PE8A 2PDUA 3E5BA 1WYIA 1KO0A 5DXYA 3R94A 4HNUA 1IWAA 1JGMA 1RH9A 4Q8VA 2PD9A 4UTFA 3V35A 3MY9A 2Z1BA 1YADA 4GIRA 2YJQA 3MA8A 4ZTYA 2OLAA 4TVUA 4YVVA 2W3ZA 5C54A 1KWGA 4Q7NA 2BLEA 1NOWA 2HTMA 1RD6A 4UIOA 2E0PA 3F4WA 4I5XA 3IAQA 2VFIA 2OSYA 3HG4A 2ZIDA 1YXDA 5AHLA 4WD0A 3AO0A 3B3DA 4FXSA 4YN5A 2VENA 3UR5A 1ISZA 1UP2A 4IMEA 4FNTA 4Q6JA 1TA3A 1XLCA 1O1ZA 3KCLA 3HFYA 1YTKA 4L1XA 2PDWA 3DHUA 3CUJA 3CUZA 4HHPA 4NJKA 4UR8A 1RQEA 3SY8A 1CGUA 3BAJA 2CHOA 3W37A 4DJEA 2R1LA 2CHNA 1XIJA 1PZ0A 3NCOA 1VF8A 5CPLA 1CX9A 1XPGA 1B31A 1V3JA 2J66A 5HK4A 1TPVA 3THDA 5JBEA 2VXNA 5EA9A 3W0KA 1R3YA 2YZ5A 2ZUUA 4XO6A 1VFUA 4KWSA 1X97A 3EX1A 3GNXA 3BG9A 4J5NA 1KKRA 5LIWX 1TWIA 1DJNA 2ZRYA 3S1WA 3R11A 2XN1A 2AAAA 5CZKA 3WIJA 3VGFA 4PTWA 4FIQA 2PF8A 4OOUA 3L66A 4GYKA 3UGRA 2QCGA 1MXDA 4A2SA 4QEHA 4B5UA 4EXQA 4CN4A 3KDOA 2Y5SA 1MRAA 1OZQA 3PUGA 1DJHA 1AODA 2Y0FA 3GDKA 4D6FA 2RDTA 3CT2A 4JTJA 4LRSA 4DQWA 2WSRA 1QXLA 4YL2A 4EX4A 3W7NA 1PDYA 1QNQA 4MNKA 2Y8VA 1TQXA 3N9KA 3MUZ1 3DHPA 3KVJA 3N17A 5D2WA 1WDDA 4RX0A 4CCCA 1B0IA 3VD3A 4DBEA 3VIFA 3HPXA 3GH5A 1A5MC 3OVQA 3T05A 1H7OA 2C8NA 3PB2A 5I02A 3G1YA 2BGSA 2GGJA 4GVIA 2CLHA 2VDIA 1F4AA 1PE1A 3BSHA 1BXNA 4PMUA 4IOTA 5EFDA 3LEPA 2QCNA 4Z2GA 2J8GA 3N2MA 1H7RA 2TSYA 2QXWA 4XBKA 4C91A 3G1AA 1Q7ZA 1J0JA 4BFAA 4B2DA 1QI4A 1UD8A 1ZRQA 2Y88A 4XSLA 5D4YA 1QNOA 3U2EA 4KKXA 4JX5A 2EPOA 2FTWA 1E43A 3WMLA 1B3VA 4S2CA 2C0AA 1R3WA 4O52A 4LC8A 3QC0A 2YCEA 3URBA 2XH4A 5FEXA 5ECUA 3B9OA 2PPGA 3F4VA 1KFBA 1JF6A 1TE6A 3U7VA 3RCMA 1JPMA 1LT8A 4OOZA 1R9YA 2YFNA 2QVNA 4DPPA 2E5CA 3SN1A 3W7HA 1UOKA 2YCKX 1NM9A 3S1XA 3KZSA 3GSMA 1DKWA 2VFDA 2IUZA 2AKMA 3BVJA 4LF2A 3AIWA 5L6UA 1PL9A 1EP3A 6XIMA 4NVTA 1TV3A 1V51A 4LWWA 1PYMA 1XIIA 3UU0A 3QZEA 4O4WA 1XBVA 1JCNA 2ACQA 3E02A 2A85A 4UOZA 4GABA 4CNNA 1OJXA 4LUSA 4AD4A 4Z1CA 3WQOA 4NI8A 2YYTA 1MUCA 3G3MA 4S3FA 4IGHA 3W73A 4D6EA 3LU2A 5KSWA 3WN6A 4IGMA 5LNUA 2WO5A 5HMFA 3K1DA 2Y2WA 2FB2A 3PUEA 3SQMA 4C1KA 3QPYA 4IPNB 3QGAC 3PTDA 2A4AA 3REQB 1FWBC 4BEUA 1QASA 3OQ8A 4PMJA 3T1GA 4AHOA 2D2HA 1XR2A 3O07A 1KD0A 2F2KA 5LXXA 3CK5A 3U48A 4JTKA 2GGHA 4WY0A 1GQLA 3V0UA 4Y6GA 4FLRA 2H90A 1G4SA 1XBYA 4KS0A 2X7VA 3GNDA 3LQGA 3NTYA 5TQLA 3PB0A 3VK5A 4PL1A 2PC8A 1SW0A 1L0PA 3NPUA 3VMNA 4GXPA 1NP0A 4IWWA 1FKWA 3P67A 1AZ2A 5I09A 2I17A 4Q4PA 4UTHA 2BOEX 4MF4A 3GZAA 4C6MA 4LVFA 2XDFA 4IH3A 2XVLA 5J04A 1ZP4A 1Q7MA 5XINA 4RW3A 4P2VA 3WYZA 3Q67A 4O8AA 1FBAA 3C3NA 3GW3A 3PNZA 4U2ZA 4Z0SA 4DWSA 1REQA 3W3OA 2J8TA 5DMNA 4C1LA 1MW2A 1L9WA 3CL8A 1E0WA 2IW0A 5G5IA 3O1NA 5BWFA 3V1PA 3CLWA 3VKCA 1Z69A 3QEZA 3NVTA 2EPHA 1MQPA 4N4QA 1A3WA 4P7OA 1OFPA 5GPRA 2J7HA 2ZE3A 4B5TA 1KQYA 3PTQA 4KF1A 1OYBA 4EF8A 3SIZA 4AUBA 3PVFA 2G0WA 3E3HA 3MMWA 1AL8A 3BURA 2OFJA 3ARYA 2V5CA 5BW6A 3PTMA 3A4AA 1F74A 4GA8A 1K9DA 5LNVA 3HOJA 3L4ZA 2R6OA 1ME9A 4C90A 4QM1A 3W85A 3NEVA 4WDWA 5FEWA 3AXIA 3EWZA 4D1IA 3P84A 1LP6A 2I14A 2YFOA 3QXBA 1DXEA 5EGRA 4Q8PA 2DIKA 2CESA 7TAAA 2PFHA 3FXGA 3U5UA 3GLCA 2CLFA 3W7OA 3M1ZA 3GFXA 3VNIA 4EF9A 3KEHA 4XZMX 2CW6A 4UZUA 2W92A 5K2ZA 1L6YA 2VQTA 3N4EA 1BTMA 2PTXA 4H83A 1MW1A 1PPIA 2WVVB 2DV0A 1BHGA 3PZMA 1F3WA 1T96A 3F5JA 2QAPA 4IMCA 4QE1A 3UERA 2F38A 4LS2A 3W7JA 3UXLA 2J7BA 5SWUA 3E96A 2QUMA 1S38A 3KHDA 2EBNA 1ZU8A 3S9ZA 4NJJA 4YWSA 1Q6EA 1LWIA 1H5VA 2QULA 3V75A 1GW1A 4C1NA 4L6OA 3N29A 4L4LA 3S5ZA 2YBVA 6TAAA 2VYOA 3CIWA 1R5YA 2CHRA 2YW4A 3NDYA 2VFFA 5LA1A 2R82A 2E4TA 1P0NA 1C29A 5D2XA 3QRHA 3PNUA 4AWSA 3L23A 4H6QA 1T41A 3PN8A 4LFYA 4KFPA 3WF0A 2PRLA 4DAFA 1H51A 4IMGA 3LPFA 1CGVA 2PWHA 3WF3A 2OR2A 2ZZ2A 3O6AA 1MZHA 3FLUA 3XIMA 1TKKA 3BLPX 3WMCA 4MNLA 2DSUA 2DEPA 3TA6A 3V7PA 2KAUC 1HO1A 3WH9A 1E9IA 4LJ3A 1XBXA 3KBVA 5C9RA 2Z1VA 1PIIA 4QE5A 2YXGA 4N9DA 1RXOB 2EJAA 3OG2A 2VWTA 2XSAA 3W27A 4DO7A 2XWDA 3VINA 3AHVA 1J6OA 1FWEC 3OODA 4HP5A 3LCXA 3A4WA 3PZUA 4ADTA 3AOFA 1ZHAA 4UQ9A 2PDJA 4UMAA 2ZYFA 5IM51 3TYZA 3VM5A 2PDBA 4HNLA 2ZX7A 1VFMA 3UJ2A 1DE5A 4QS5A 1P0EA 3LX9A 3BMWA 5I06A 5H8UA 2YA2A 4NKCA 3BOFA 1NIUA 3W7IA 2F6XA 5J5RA 2YW3A 4O1FA 4RDZA 3SCUA 5BMXA 2B7NA 4QNEA 1X7FA 3AIVA 3TMLA 3S2MA 1BSLA 3RRXA 1KM5A 1EJTC 4GE8A 1V6WA 3W2KA 3GVRA 4KCWA 1WKYA 3SCOA 4LH8A 4PB3A 5C9XA 2Z1SA 2D2GA 4GKTA 1MEHA 2YBTA 1HUVA 2VO5A 3RPTA 4S3AA 3APYA 2I9UA 4I90A 1EFZA 3SO7A 3WLOA 5HDRA 3MKVA 2QDHA 3AAMA 3W2NA 1EJWC 5CZTA 1Y5XA 5G1YA 2PS2A 3KTXA 4O17A 2RJGA 3QBUA 1VB9A 3TYUA 1XSIA 3EPNA 4BQ4A 3GVGA 2CU0A 1KFJA 3F4DA 1J93A 3EWXA 4OVXA 1GVSA 3VMPA 4NJGA 5JBDA 4IMFA 4LTSA 5BXPA 4GKLA 2WSQA 1CXHA 3EMCA 5ABFA 3GG7A 1FOBA 4CQDA 3S1GA 4W7VA 1LUCA 3SUSA 3VGHA 3CMGA 1IEIA 1CGTA 2HZGA 5HMEA 3W1LA 1QPQA 3A12A 3W7CA 5FAJA 1S1PA 4A8LA 3PJXA 6ENLA 3V5FA 1HZYA 2CLOA 2PU0A 2A2IA 3B8WA 1SZNA 2BVDA 3UWVA 2QKFA 4N9BA 3M0IA 4AYSA 5BXRA 1XRSA 1BVZA 3AZTA 1FP9A 5D38A 3K5XA 3IGXA 3UY7A 3HV8A 4JQ4A 5LGXA 3F03K 2ISWA 4F2TA 2ZXDA 3GM8A 2IPJA 2YDSA 3CIXA 3ARVA 4M5PA 4L9ZA 3PBYA 1DWHM 1UBSA 1ZAJA 1RCXB 4XAYA 3SGUA 1JCTA 3DH7A 3A22A 3CNYA 4EPEC 2Z6JA 3TE9A 1GKPA 3VD4A 2XTKA 4C6NA 4JN7A 2EPMX 4BF9A 1FDYA 3H2AA 4O18A 3MC5A 1UJQA 1S5TA 2EPKX 3QV6A 4JKMA 4ECLA 1TSIA 1VEMA 3SCPA 2WMFA 3CWNA 4H9YA 1Q6DA 2RDUA 2PRMA 2VEGA 3IEBA 3II1A 4LB4A 3B0UX 1FWGC 3VCCA 5JXQA 3QHOA 1CLVA 1H1NA 3WUBA 2VRJA 4K6AA 2DW7A 4LVBA 1WCGA 1VBJA 3EDFA 1KM6A 1C8XA 3MCNA 2WVTA 3TROA 3CUGA 3EDJA 2WANA 4XAGA 2PLMA 1IHIA 3WSUA 1KTBA 3MDWA 5BZAA 1LUCB 1W3NA 5FJRA 4ASTA 1TELA 3O2LA 4NAFA 1EP1A 5EPDA 2CIPA 3UEQA 3VIHA 1RLCL 2ZVRA 3GXDA 3JVAA 4GYPA 1W6TA 1U5HA 3TU9A 4XVEA 3GIPA 4L65A 5FF3A 2RGLA 3S47A 1OEPA 1NFPA 1Q8JA 4AX7A 4AWTA 2DZXA 3EKGA 3SSZA 1TPFA 5C7VA 5FJIA 3D46A 1XDLA 1VPQA 3K4AA 3CC1A 3N9SA 3GDRA 1EIBA 1YIXA 3L0NA 4I6KA 4Z1DA 4PMVA 3JZUA 2J7FA 1XLKA 2GQAA 2ZADA 1FH8A 3TXZA 4OFCA 3SRFA 2OYKA 4LNCA 3H4GA 1JJKA 5E0FA 2BHZA 4Q3MA 3W22A 1TPH1 3RLVA 3CB8A 3I3BA 5FJTA 1UC4A 1TPEA 1K6AA 3SGGA 1VAHA 1OQFA 1YNYA 4YTUA 3UZJA 2OVLA 3VNLA 1F4HA 4AIEA 4ADUA 4UTTC 1WZAA 4L5ZA 4DUWA 5A2CA 3PAOA 4QLJA 1IEQA 3BAYA 4FNRA 2ZWYA 1BLIA 1JUBA 3DFTA 4CD5A 4IX0A 4DVOA 3VE7A 3SDOA 2R24A 5CPTA 3NDZA 4KFOA 1UZ1A 2WKGA 2OXNA 3WX7A 3DGRA 4WZHA 3AISA 5D37A 1PB0A 4ZL1A 2ISSA 2EG6A 2OELA 5HNTA 2VUNA 5DBUA 1LM1A 3CV2A 1E9LA 2PBOA 3E0LA 3CQKA 1MW3A 1PTGA 2GSJA 5CZJA 1D9EA 1GOOA 3ZJ8A 1HT6A 3VOIA 1NDYA 2OGJA 2DVUA 2Z26A 1CXLA 2V38A 5KINA 5G4EA 1F3TA 3GUGA 2EJ1A 4PH6A 1I2NA 3GBEA 4IICA 1B3WA 1UWAA 1FWHC 4MZYA 4ZXOA 3WL1A 1RHCA 1PSCA 1EJXC 3USBA 3SCSA 2W62A 4RPPA 4QEEA 1X1ZA 4H19A 4I7WA 4UXDA 2VC5A 5AKQA 1G0CA 4CNUA 1U22A 1C9WA 1SGJA 3N9RA 1BRLB 1E4LA 2DZUA 2QGHA 3P0WA 4GQQA 4ZVJA 4MPQA 3B0XA 1L2QA 4E38A 3VYLA 3E2SA 1KCLA 3IARA 3GE7A 4XZNX 4QE4A 4UQEA 1FDJA 2QJJA 1ISVA 1K4HA 4GI6A 3VNZA 3CUIA 1X96A 3KLLA 4LYKA 3OA3A 1JFXA 1K9FA 4JQ1A 1G4PA 2V5JA 2VUYA 2NQHA 1US2A 4OECA 3B4UA 3G18A 1D3HA 5G1MA 4W93A 5CPNA 1RSCA 2QCHA 3VCRA 4CVUA 4TU1A 1DPMA 2ZUMA 1PV8A 5CC3A 5D09A 3VIKA 4KWUA 1XD0A 2NXIA 4GNVA 3PANA 4LEFA 5I0DA 4TR9A 4EE9A 7A3HA 2WPGA 3ES7A 1W9XA 2DSVA 2FZ9A 4KEZA 1QU4A 3LY0A 5FF0A 4ML4A 4BHYA 3MHGA 4MPKA 8RUCA 4Z08A 1CXKA 4CCZA 1DIKA 4Y7EA 5T9BG 1ZCOA 4NZ4A 1CLKA 1PKLA 1UYQA 2P8CA 2UY5A 1KC7A 3GO2A 1EIXA 3PWGA 4MWAC 1E6NA 1D8CA 1WNOA 4GIAA 4XVDA 3GRIA 4JR5A 3AUOA 3OZPA 3M16A 1UB3A 4HMDA 3S83A 4OUEA 1ITUA 2OKOA 2TMDA 3CHFA 3W7QA 3RG6A 3MWCA 3TYDA 4S23A 1TV4A 2X41A 4TVDA 5BOEA 3W1TA 1Z44A 4ZMGA 2G5WA 1R3RA 2BBFA 4AISA 2DT2A 3D47A 3SJ3A 3KHJA 3JS3A 3W82A 2PF0A 1DJGA 3NYDA 3O05A 3N11A 5CC7A 2E6YA 2BOFX 3B04A 4LF1A 1XH1A 4YVXA 3VZXA 1XLJA 1SM9A 4BKNA 2XH2A 3LUTA 1JDAA 1J10A 4RE4A 2OSWA 2NQLA 1LRNA 1D3GA 5IHSA 1DWAM 3IJIA 6TIMA 4ICCX 1J18A 5T91A 3WDIA 4E5TA 3B40A 1K3UA 2C14A 4GINA 4C6OA 3UG4A 3P81A 1GVRA 1NP2A 1LBMA 4M7TA 4JN6A 2A3BA 4W88A 2V81A 3MV11 4DO6A 2ZRVA 3L65A 4MHBA 4E4FA 1UOZA 1SYTA 3PG8A 1DOSA 1V93A 3W1NA 4JTEA 1SJDA 3P14A 5I77A 4PEKA 3N04A 2OWXA 1WP6A 4O0ZA 5DXXA 3T9PA 1ITQA 1VIWA 4O0KA 1DORA 1UKTA 3ZSSA 2I16A 3HQNA 4MADA 5C71A 1NU5A 2W63A 1IXOA 3CL6A 1XCFA 3NL5A 1EP2A 1R9ZA 2OODA 2FIQA 1KV5A 1MEIA 4XKMA 3QW4B 4JKKA 1JCYA 2POZA 2QDEA 2F61A 4YHEA 2A3LA 2ZZ1A 4F0HA 2O4QA 3LK6A 1H7XA 3AS3A 1EBGA 2Y1HA 3ZLHA 1CLXA 2V68A 2FZMA 3AQUA 4H9ZA 1YE4A 4GO9A 2W4XA 1S1RA 2AOSA 3TJLA 5I2UA 1BQCA 4ZOEA 4ZE4A 1VBHA 4DUVA 2ZA3A 3KFTA 1Q85A 2RKXA 3W24A 3FYPA 1YPFA 3W53A 2GJXA 4N42A 8CGTA 3LZ3A 2BY1A 2VZUA 4Z2JA 1OFEA 1B3OA 3UJEA 4XZHA 3SN4A 4KPLA 3FA4A 2NLYA 5HQEA 3UA3A 1W56A 2OTDA 1IWPA 3QR3A 4K8EA 1TR1A 5E0CA 3SUWA 4HZ7A 2Q6ZA 1V03A 3LM3A 2X16A 3LV5A 1AMKA 4GNKB 1XLLA 2QPXA 4YWIA 3LNMA 1WXJA 4MY9A 3UWQA 3CUXA 4IG2A 5A94A 2ZDSA 4F8XA 3CHVA 1GZJA 4NF7A 2OZ0A 2O9PA 4DF2A 4HA3A