4MZ1A

Crystal structure of the inosine 5'-monophosphate dehydrogenase, with a internal deletion of cbs domain from campylobacter jejuni complexed with inhibitor compound p12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
380
structure length
354
Chain Sequence
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSKEYPDANKDNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGVPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHEAPNYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Inosine 5'-monophosphate Dehydrogenase, with a Internal Deletion of CBS Domain from Campylobacter jejuni complexed with inhibitor compound P12
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Inosine-5'-monophosphate dehydrogenase
total genus 111
structure length 354
sequence length 380
chains with identical sequence B, C
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2013-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4mz1A00
1H1YA 5AHLA 1M7OA 1L9WA 2BZNA 3N2XA 4FB7A 3MMTA 5HMSA 3Q37A 4I9AA 1TPB1 2NV1A 3G8EA 4ZQCA 2CLLA 5D09A 4DO6A 1EWEA 1RVGA 3DAQA 3P67A 5U4NA 2F84A 2NV2A 5AOUA 4XUGA 5G2IA 2B7QA 2CLHA 3L9CA 3G0XA 3B06A 1IF2A 3IVUA 3VCRA 4XKYB 3DHFA 4DO4A 2DZUA 4S1FA 4JX4A 3QPYA 3NZRA 3WK1A 4UTLA 1F6KA 2NWRA 1KFLA 4LVAA 1QNVA 3G8RA 1OX5A 3W7KA 1C9DA 4UFJA 4BR1A 4PC8A 2Z2UA 2C1HA 3QRHA 4WQ6A 1KM0A 2R8WA 1PIIA 3IIOA 4P61A 5FF7A 1TV5A 3M43A 1LRQA 3PSVA 3W71A 3ELFA 1LZOA 1UASA 1YXYA 2H3BA 3MHUA 5BMXA 3W83A 3GDTA 3QW4B 4DPQA 1LP6A 5AHMA 2OT0A 3LXBA 1GQNA 1XBVA 2V82A 3O6YX 3P82A 4IWWA 3GX9A 5CSRA 2HS6A 2QJIA 2ATMA 3TJXA 4CNNA 2J9ZA 2QF7A 4AWTA 4O4VA 1IXNA 1OFEA 3LTSA 4ORIA 3CU2A 3TC7A 4HNNA 3TC6A 3UWWA 3LCFA 4ZQMA 4E2DA 2A6NA 3ABRA 2J88A 2J6XA 2ZTKA 1HL2A 4GC4A 3E9AA 4MY9A 3KXQA 1P5BA 1KV8A 3PBYA 4AVFA 1YXDA 5K4ZA 1TCDA 4KWWA 3MP5A 3W7OA 1W56A 1ZFJA 1FWTA 1MO0A 2VFHA 1GVSA 3P84A 4LNYA 3W2JA 3W2MA 2QDGA 3NQ7A 2RDUA 3BV4A 3KX6A 2H8ZA 3UZJA 1I45A 3OHIA 1K8YA 3CIXA 4OE7A 4LS0A 1FCBA 2FPVA 3W73A 4Q4KA 5LNRA 3FLUA 1J4EA 3W72A 2E1DA 1YXCA 2Y61A 4YMZA 1JCXA 1W0MA 4O10A 1THFD 3NZ1A 2ZDRA 3M5VA 5CG7A 4LUJA 4TO8A 2EPHA 3C2EA 3PUOA 3O8AA 1R2TA 1X7FA 3WK2A 3TMLA 3RNDA 4K36A 3NPXA 2ZRYA 5G2WA 3TX9A 4QIUA 2QAFA 1ZAIA 3TFXA 1FUYA 5EMUA 3P62A 1OFPA 3OEXA 3STEA 3QPZA 3U8GA 3JS3A 2E6AA 1XUUA 3L65A 4LW7A 4E0CA 4DQWA 1XDLA 2YPIA 3FKKA 1PCKA 1H50A 1K7FA 2PCQA 4HPJA 1T99A 4PA8A 3P61A 3GB6A 3BLEA 3P60A 3GLCA 3KVJA 3PB2A 4O8RA 2NXIA 5HJLA 1PHQA 4JEQA 3F1QA 1WA3A 3W7JA 1UJPA 4BI6A 1XUZA 3DFTA 3FJLA 3HPZA 4K7YA 4TU1A 4ONVA 2YYTA 3W1UA 1YTDA 3KRSA 2J9YA 3UPWA 1K3UA 3W84A 3HGOA 2YFOA 3MUXA 1NAL1 2PURA 3GVGA 3LLFA 1S5VA 1JCYA 5L9FA 1OYAA 4IXXA 1FWWA 4AEOA 1A50A 3TSDA 1BTMA 1RQHA 3KAOA 2X30A 2VFFA 3LHYA 3RU6A 2O7SA 2DP3A 3GIYA 1G7VA 1OX4A 3GDKA 1ML1A 1TMHA 3L66A 4IPIA 2ZRWA 4NU7A 2CZ5A 4O57A 2A0NA 1J2WA 1SZFA 1Z41A 5CPNA 4XBSA 3OVQA 3W86A 4LS1A 4O16A 1H7XA 2Y88A 2RDWA 3W2NA 5D03A 4Z0SA 1DJQA 5EKYA 3LX9A 4PFMA 1KFKA 1H51A 1F76A 1Q3NA 1L6SA 2ZZ2A 4OHQA 3EKZA 3E96A 3DGRA 1VYRA 4Q32A 4JTTA 5DBUA 1H5YA 2UV8G 3W2UA 1ZAHA 2WO5A 3O6DA 3GKAA 1I2NA 4TX9A 2YDAA 4ADSA 5HULA 5LZLA 3A5VA 1SO4A 3AJXA 1FX6A 3P74A 5L6UA 3G1DA 1V5XA 1ME8A 3T7VA 2H90A 1I2RA 4LV9A 2YGYA 3O07A 1QAPA 1K7XA 3THAA 4K8EA 4LVBA 2WV8A 4ML9A 3ZFHA 3PB0A 4Z1BA 2OJPA 3LCIA 7TIMA 3SIZA 4GRSA 3B05A 1VZWA 1W1ZA 1FWRA 2C14A 4X2RA 1EX5A 2ABAA 1Z48A 3L0KA 1BKSA 3QEZA 4CQ8A 5D2VA 2PRMA 3W7RA 3FS2A 4GXMA 5EY5A 1NF7A 4FHAA 5AHEA 2GVJA 1OFAA 1SR9A 5LGZA 5D2TA 3WK3A 1WOBA 3HG4A 2VFDA 1LYXA 1IIHA 5CKSA 3VNDA 4IJBA 2C3ZA 3BVJA 2R94A 2FLIA 4IPJA 4UFHA 4N4PA 2A1YA 1A5BA 4QM1A 4IX2A 2P0OA 4MLRA 4AB4A 3BG3A 1WV2A 1R30A 1QO2A 1KLYA 3NG3A 4GJ1A 3L0NA 2GUUA 1TTPA 1DBTA 2Z1BA 4IMGA 3NOEA 4LOCA 4XQ6A 4NZJA 1JCJA 4Z1DA 3I68A 3R12A 2C15A 5D2XA 1HO1A 2VENA 1TPH1 4JTSA 3TAOA 3Q58A 4DF0A 2RFGA 3PUDA 5SWUA 3N2MA 1I2OA 1KM2A 3NQVA 4ZMGA 1FQ0A 3HJZA 1EWDA 1LLWA 5TIMA 5AFDA 2CLKA 4LVGA 2R14A 3GNNA 1JJKA 3P5ZA 5AYYA 4MOZA 3S42A 4RZ6A 5EA9A 4DEFA 1GZGA 5HUOA 1G4TA 3OVPA 1IXOA 2E5BA 5E1QA 4MUZA 5C5YA 2Y89A 3OIXA 5D37A 1SZNA 4N9BA 3TK7A 3CTLA 5KMYA 1JR1A 1LROA 5DY2A 3PULA 2YR1A 2RDTA 3GR8A 6TIMA 4RJEA 1OHLA 2Q3OA 2E09A 4MKNA 1FDYA 3W1AA 2WOQA 2G5WA 2I1OA 3PAJA 5IBXC 2VEMA 2EGZA 5F1UA 4EVZA 3TW6A 1WXJA 1JVNA 1P1XA 4OGZA 3LCWA 1E51A 3EX2A 2H8XA 3DI1A 4GWEA 3W07A 1KM6A 1LDCA 2Y70A 2PRLA 1SSGA 4BFAA 5C6MA 1SQ7A 3MI3A 4MLJA 2QCGA 3P81A 3MP4A 4O19A 4LRTA 3RF9A 3U6WA 4FNQA 4AWUA 4N6EA 4PL2A 3L5MA 3DFPA 3NL5A 4NJKA 2ZCGA 3LGEA 5T26A 3STCA 4BF9A 2NZLA 1B3OA 1GYLA 3CQ0A 4HNUA 3TV8A 4UTTA 4DPPA 3QM3A 5F2IA 3IIPA 3WJYA 5CZSA 4H3DA 3N34A 1K02A 4LVDA 4HPXA 4Y8FA 4AF0B 2LLEA 2QJHA 3G1VA 1C8VA 3FIGA 4LUIA 4KFNA 3K30A 2V2DA 4LS2A 3IVTA 1KFBA 1QOPA 3E0IA 1PHWA 1TQJA 5DELA 1O5KA 3C56A 4XTIA 1LOSA 4FF7A 4AF0A 4Y6GA 3TSBA 3L5AA 4TR9A 3CEPA 1DJNA 1YDOA 3NYZA 3W9ZA 4JIQA 1PVNA 1S5TA 3EX4A 1P0NA 2C19A 4R53A 2OZ0A 1KW1A 3DU0A 4KFPA 3M0ZA 3HMJG 4HHPA 2VFGA 3TQVA 4LC6A 5LHFA 4TMBA 4JIPA 1LOQA 1YADA 3LDVA 1JCMP 3STGA 4Y9AA 3M16A 3QJAA 1N55A 1X8FA 1F05A 4WY0A 3H54A 1V7YA 4UFIA 4CCCA 5FF2A 4WZHA 1F2JA 4O53A 3PVFA 1XL9A 4CQ9A 3QF0A 3RFAA 4XZ9A 1WDWA 3L0GA 1B4KA 2NUXA 4RLIA 3LHTA 5FEWA 3SJ3A 3A22A 1XC4A 2TMDA 3IIXA 3QMTA 4KWVA 2W79A 5ABTA 2GQAA 2RH9A 4AHPA 3E49A 1R46A 3MYPA 5HWJA 3TW7A 5D30A 3WJWA 4UUIA 3KVLA 4GFSA 4DBDA 1TPEA 2CZEA 4LRSA 3G3MA 1AMKA 1DOSA 4TIMA 4O18A 4HN4A 2DORA 3C2VA 4NJIA 3BW2A 1WX0A 1T96A 1AL8A 4MY1A 2EF9A 1ZHAA 2KZHA 1JUEA 1YPIA 2ISWA 3O16A 3QYQA 3W7DA 3IGXA 1KA9F 4IMFA 4GUHA 3QSTA 4YLWA 3FA5A 1YDNA 3QH2A 3NL3A 3QMRA 2BWGA 2ATSA 3LERA 4G1KA 3G0SA 4K39A 4QQ3A 3SSJA 3PWAA 4AH7A 1QMLA 3T40A 4UXDA 1B9BA 3DKLA 2Z6JA 4XWUA 1R47A 1Q6QA 5LKYA 4QNEA 1H62A 1FWSA 4X22A 4O1AA 1VR6A 1TTIA 3ABQA 2FQIA 3ABSA 4FNSA 2ZZ6A 1G7UA 4KKXA 1AL7A 4M5PA 1HTIA 1O95A 4R7JA 1VCVA 1O94A 1W3NA 3TDFA 1OYCA 4M6VA 4JYDA 3C2OA 5BOOA 1CW2A 2P1FA 3LV5A 1F73A 3LCHA 4JYFA 3PBVA 5J5RA 3RLUA 2VC6A 5F4XA 3PR2A 3V75A 3MHFA 3W23A 4WD0A 2GQ8A 5CSSA 1Y0EA 4WXYA 3UWUA 5DN1A 1MEHA 4ZQPA 2ZA1A 3TMQA 1OFBA 3HGRA 4LY8A 3NR0A 5KTLA 3WJZA 4PH6A 1UUOA 1B4EA 4N9DA 1LCOA 2V8ZA 5U7SA 1D9EA 1VHNA 3DENA 2CLIA 4PEKA 4LVFA 4JTHA 1JULA 4EWND 3IVSA 5KZMA 1GT8A 1VCFA 1QPOA 4JICA 3W7HA 3G1YA 3W3OA 1GYNA 3LCGA 1W5OA 4MYXA 2CU0A 3DFNA 1R2RA 3EKLA 1OK6A 1MEIA 4ZQOA 4O4WA 2QCCA 3W1QA 2V2HA 3NQEA 1XI3A 5AHFA 2ZZ4A 3LHWA 3SR7A 4L4LA 2I14A 3T4CA 5AYXA 3UNDA 1IGSA 1KM5A 1TSIA 3NDOA 3HGSA 5D04C 2AQWA 4CQAA 5EPDA 3LRLA 4O15A 3N19B 4A29A 3IEBA 3W75A 1TTQA 2BLEA 4U28A 2NUWA 1TQXA 2GVLA 5KSWA 3A24A 1KFJA 3A23A 2EKCA 3W6YA 3P7YA 5K7JA 1EUAA 4JXCA 2JK2A 2QEZA 4JD4A 3S5OA 1KFCA 3M7WA 3NL6A 3LBCA 3BW3A 4HNTA 4ICNA 3N9RA 1Q6OA 1JCNA 3EWUA 3LHVA 1LORA 1PV8A 3NPWA 4NXSA 4IX0A 1W5NA 5D2YA 3ATZA 3NQFA 1QPRA 3O06A 3ANYA 3QMSA 1OF6A 4NNCA 1L6WA 1OX4B 4H6KA 4RR4A 4JYEA 3W70A 1SO3A 2H6RA 3EWYA 5BNKA 3WK0A 4XTDA 3BG9A 5HWNA 1F74A 4EF8A 3P8JA 4UMBA 1XBZA 2ZYFA 4Z1CA 1TJRA 2B7PA 5A5WA 1LLZA 3FYPA 3WJSA 1VLWA 2A7RA 3BW4A 2VFEA 4LTSA 1JUKA 1G4SA 2AAMA 2C6QA 4K38A 5CZ0A 2TRSA 3NQ6A 3HPXA 4H4IA 5KZDA 4NQ1A 4WY0B 4NT0A 3M6YA 3LLDA 1SFLA 5AN7A 5DXXA 4JDYA 3G22A 2XN1A 3U2OA 3V1PA 1VH7A 2TSYA 2X2GA 3W1LA 1XM3A 1X6UA 1J5TA 1DVJA 1OFRA 2A85A 5HUPA 1S3HA 4NNAA 2OT1A 3OG3A 1FCUA 3SW6A 1FXQA 1AG1O 3VE7A 4A2SA 1OF8A 1TTJA 1OFDA 3LHUA 2V2CA 1EEPA 1GWJA 3FYOA 3TKFA 3W7QA 2ISSA 3LB0A 3S9YA 2CWNA 1OFQA 3FFSA 5AYZA 5AC6A 2V5BA 1KTCA 4IXHA 3A5FA 1GVQA 2I9EA 1G69A 2QCEA 4JY9A 4A2RA 3AO0A 2WSYA 3O05A 3G24A 3M41A 3BK0A 3EWXA 1KBJA 3T55A 3TFCA 3GXNA 4QSHA 3ZWSA 4AMAA 2WKJA 5K2ZA 1ZY9A 1K8ZA 3EXTA 4WXZA 2Y6ZA 3L67A 3W7LA 1EUNA 5AC8A 4R33A 5F2GA 2DZTA 4NJHA 3VKJA 3G3DA 4MFEA 4JTUA 3G1XA 1Q6LA 2V9DA 1H63A 4FX7A 4N2YA 4UTKA 4UNLA 3B8DA 1F5ZA 4UTMA 1YLVA 4I7WA 1RPXA 2JKPA 1NF0A 2OMAA 4ADTA 1K7EA 5LGXA 4WX2A 4E38A 3NQGA 5DXYA 4ADUA 2X16A 5CGQA 3G1HA 3HGJA 8TIMA 1OJXA 4RX0A 5C55A 1KM1A 3F03K 2ZA2A 1I4NA 3W1MA 3NM1A 4M6PA 1TPDA 5C2XA 2XFWA 1L2UA 4FX8A 3BARA 3LOTA 2ZFAA 5BW6A 1YYAA 2V81A 4N9EA 2XN0A 4AHQA 4JX5A 4B5NA 3STFA 5G4WA 2E6DA 4QISA 3TR2A 1KTBA 3NA8A 4BI5A 4DBEA 4RK8A 2CZFA 4IUOA 1MEWA 2A2IA 5D33A 5D02A 3TSMA 3QQ1A 3R5EA 2QCMA 3H53A 3MW7A 3NAVA 1NEYA 4GE8A 3MYOA 4NUWA 3N14A 1K03A 4MFDA 1W31A 5HR7A 4YXGA 3GDLA 5F4WA 4AAJA 2Q3RA 2V0TA 4FNPA 3W2KA 2A7NA 1VC4A 3TAKA 5HR6A 3UQNA 5G2HA 4U4MA 1XDMA 3PUEA 3O6CA 3DHDA 4Y96A 1QWGA 4M6QA 2OX1A 3PS7A 3PG9A 2Y85A 3DFQA 4EOUA 3W2LA 4NJJA 4LT9A 3NPUA 5FI8A 2ZA3A 1VPXA 1ICPA 1SZEA 4XKYA 3LV6A 3MBDA 4MYAA 4NNBA 4OT7A 5TBOA 5CZTA 3CLMA 2GOUA 1VJIA 4HSNA 3NO5A 4YL2A 1H7OA 1GJPA 1VYPX 4C1LA 2A7PA 5E0KA 3M1ZA 3B0PA 4IMDA 1LRTA 3R89A 3UYCA 4WOQA 2P10A 5E93A 3EWBX 1G4PA 2VXNA 5A8GA 4JNMA 1ZCOA 2QAPA 4O0KA 3SFKA 3MO7A 1FDZA 1GVRA 2RKXA 5BRBA 5KINA 6ALDA 1TV8A 4OU1A 3W74A 1R2SA 4MPQA 5D32A 1ZENA 3WJXA 3PBWA 4JGDA 1GG0A 1SO6A 5GVJA 1VRDA 3B03A 4FEZA 1WBJA 3VFLA 3T44A 2WPBA 1JUBA 4JTJA 4M19A 3GAKA 4EIVA 2VFIA 1A5AA 4K6AA 1LRNA 3INPA 5IM51 3NEVA 2PC4A 2CZDA 3O1NA 3JRKA 2E77A 4MJMA 2YZRA 4LV4A 2Y62A 5LNUA 2WSQA 4X9SA 3B0UX 1TRDA 4UMAA 1A5SA 3L2IA 4UFLA 2X1RA 3QQ0A 2NX1A 4UC5A 2HS8A 5HWMA 3UWYA 3GDRA 1EPXA 5DCDA 2B4GA 1XFBA 3R8RA 4FX6M 3USBA 2O7QA 3DFSA 1XXXA 3HB9A 4IQLA 1GTEA 2ZRUA 2WJZA 4DO5A 3NXFA 1YTEA 4FXSA 3IGSA 3Q2DA 1FY6A 3KFTA 1WBHA 1I8JA 1TJPA 4WJEA 2GPTA 3OVRA 1EP2A 3THQA 5F2LA 3I7SA 5DLCA 1OYBA 4ZQRA 1RD5A 3BO9A 1ZJIA 1VYSX 3SGZA 3WFAA 3S1WA 4KFOA 4CCEA 1TYGA 4O1CA 4CNPA 2YX0A 5I3HA 4FNRA 4OWGA 2B7NA 4UTWA 1OABA 1QPQA 3BLIA 2ISVA 3JR2A 3MI6A 2A6LA 5LHEA 5K9XA 2J9XA 5LNWA 1H7RA 1BWKA 1ZNNA 1BEUA 1TRIA 3A21A 3KHJA 3TCEA 3S5ZA 1RV8A 2ZZ3A 1ALDA 3DH7A 5G1YA 3QW3A 2FB3A 4I7VA 5DCEA 2WQPA 3TIMA 3QC3A 1GPWA 4LC8A 1M5WA 1WAUA 3L21A 2NUYA 5D05A 1AW5A 1VQTA 2DZXA 1WOAA 2WNZA 1ADOA 3CWNA 1W3IA 3F4NA 4JN6A 4YCOA 2C16A 1XKYA 5DBTA 1EP1A 4AXKA 3EX6A 4P2VA 1LBLA 4MIMA 3I7RA 3EX1A 1ICSA 1TPFA 5K3VA 3HG5A 3MHGA 4DF1A 4PTNA 4IMCA 2G95A 1Q6RA 1TPC1 4M7SA 3UZ5A 3T78A 1TV7A 1GEQA 3LTPA 3ZR4A 2GJLA 2QCHA 2WSRA 4FIQA 3M5ZA 5IBXA 3EB2A 2V30A 1BWLA 2IQTA 3HG2A 2W0UA 3W1NA 2J27A 3SZ8A 1H7NA 4WY0F 2QR6A 3B0VC 1HG3A 4ALDA 3RLVA 2QUVA 3GXTA 3TQKA 4ZVJA 1RZMA 1ONRA 3NQ2A 5LSMA 1GTHA 4AWSA 4K37A 3FEMA 4O13A 1H61A 5HNRA 1KFEA 4UTHA 1IIGA 3E12A 2R91A 3DI0A 2NXGA 5F1VA 3IV3A 4DF2A 3KOFA 3CEUA 2ZBTA 3R13A 4CLMA 3SECA 1IXQA 2FJKA 4K8HA 1G6CA 3G1SA 4MZYA 2B0MA 4UTTC 2RHGA 3M9YA 3TXZA 3W7IA 3M47A 4N4QA 5LNVA 3UD6A 3VE9A 1DQXA 1XCFA 2VEPA 5G4EA 2NX9A 3CIWA 3M44A 4JS3A 4FXRA 4A21A 1C29A 2ZRVA 2EHHA 2F7FA 3TJLA 1A53A 1D3HA 3LM7A 4JTLA 2HSAA 3EXRA 1D3GA 4DELA 3I65A 5I3GA 5I3FA 1SFJA 4L4MA 4S2CA 3G18A 1LBMA 2VELA 3NQ8A 4UNKA 3NPVA 3TQ0A 4ZQNA 1FCVA 3PM6A 1O4UA 4RXFA 1T0OA 3UWZA 1KBIA 1IXPA 1KM4A 2QUUA 3NM3A 2GJNA 2G96A 1G67A 4I7UA 3NQAA 4O12A 2ZTJA 1VS1A 5HINA 4ORMA 1P4CA 1ME9A 1SW7A 1U83A 2DZWA 3W1PA 4X3ZA 4UTWC 2OCZA 4AHOA 4PODA 3S6DA 3MJYA 3L68A 2QCNA 2X1SA 4FNUA 1M6JA 4DXVA 1UB3A 5EBUA 3SY5A 3OBKA 3CPRA 3NVTA 1AW2A 3I7QA 1JRCA 2J24A 3TE9A 4HKPA 2GVGA 5I3IA 5TQLA 4UIOA 4UTUA 1RQBA 2DZSA 1SW3A 5DCBA 1RR2A 4QNWA 4A3UA 1CI1A 2X1TA 3BPWA 1JQVA 2E5DA 2DZVA 4GNJA 2WNNA 4E2BA 4N02A 4JTKA 4PL1A 2BX7A 2DJLA 3GDMA 5BMWA 4RXGA 4HT3A 4TMCA 3KRUA 2QCDB 2WNQA 3R2GA 2C13A 4GUGA 1A5CA 1NFBA 1PL9A 4PCFA 3YPIA 3C6CA 3W7EA 1Z44A 2ZRZA 4UFKA 4CCDA 2JKAA 2NLIA 4BI7A 3M5XA 5C54A 3S1UA 4UTJA 5AHNA 1FWNA 1ME7A 1TPUA 4BWLA 2D73A 4NX0A 3W87A 3EWWA 4UMCA 4Z1AA 3A9IA 4RZ4A 4O11A 4UR7A 2JGYA 2BXVA 4O14A 1OFOA 3C8FA 3O15A 2FPYA 1WQ5A 2YCEA 3TNOA 1X1ZA 3IIZA 1F6PA 2YXGA 1H1ZA 1I2PA 3CM4A 1LOLA 3D0CA 1W5QA 1VGAA 4O1DA 3W1RA 2CFFA 4IGHA 2CLOA 1TREA 1GVOA 3UXDA 1DV7A 4UR8A 4O54A 3HPSA 2QCDA 5FESA 2C18A 2Y7FA 2GQ9A 3NQDA 5EYWA 3VI2A 3TA6A 3ABOA 1SW0A 2JGQA 4FNTA 3W7PA 2CW6A 3PSWA 3LCXA 3IGUA 3EX3A 2FPTA 2Q8ZA 2E68A 2FB2A 3BGJA 4MZ8A 1KV5A 1QOQA 5LNSA 5I3JA 4GUFA 1VLIA 3H55A 3UWVA 1W54A 3ATYA 1OVDA 1CX9A 4BK9A 5D2WA 2FTPA 5I3KA 2YFNA 1PCWA 2VOMA 3QFEA 2BTMA 4JTIA 4O50A 3HO8A 4RZ5A 1Q45A 1YPFA 2YYUA 4WUIA 4JY8A 1G4EA 3M5YA 3TXVA 3HG3A 4IOTA 1OK4A 5DY3A 1TPWA 4IMEA 3UPBA 3BGGA 3W1TA 5KITA 1RQEA 4NXKA 1KLZA 4A22A 1I2QA 4POCA 1W37A 2DZPA 3C61A 2YSWA 3F4WA 3PY2A 2Y7GA 4QAIA 1QO5A 1JCLA 4C1KA 3GYEA 3ZWTA 3KVKA 4GBUA 3PBUA 4NX5A 4Z0JA 2A4AA 3UY7A 5KZEA 5FEXA 1L6YA 3LXCA 2ZZ5A 3S5NA 2NX3A 1P0KA 2B7OA 2X1UA 3W7MA 1K8XA 5FEPA 1W3TA 2V5LA 1SO5A 2A5HA 2JBMA 3NQMA 4GUIA 1GG1A 3DFOA 4O1BA 3S5YA 3UWQA 1DQWA 1LBFA 1OX6A 1YTKA 3GNDA 2VEKA 3GAYA 2ZZ1A 4MY8A 3GKFA 1S5WA 3QZEA 5G5IA 2JKEA 2DU2A 4YWIA 1ZALA 2A21A 1FCQA 2W6RA 3G0UA 3IIVA 3HQ1A 3LI0A 4JTGA 1QR7A 3PF3A 4HIBA 3I6RA 3SI9A 2ZRXA 1OG0A 3GK0A 4O17A 4NJGA 3LXAA 3LBMA 4QITA 1EIXA 2QJGA 5FF0A 1TB3A 5F2MA 3B4UA 4XBKA 5H2ZA 3NL2A 1QDSA 3RMJA 4OBTA 5F4SA 3CC1A 1DL3A 3CB8A 3IRDA 5D38A 3FJ6A 4M7TA 1AW1A 5FEZA 1N8FA 1QCWA 5FF3A 1XBXA 1QPNA 3BG5A 4UTIA 1SUXA 2Q8LA 4JX6A 3TROA 3W7GA 3PG8A 2VKZG 2YW3A 3GXPA 5MHBA 2ALDA 2EAWA 3S0CA 4JR5A 3TU9A 2H3DA 3HOJA 3W22A 3HIJA 5HQEA 3KVMA 1F7BA 1X1OA 5FF4A 3W85A 2Y7DA 1U5JA 4OQVA 3LI1A 2VEIA 4UCGA 2YW4A 1DORA 2CLEA 5CZJA 1FXPA 2HTMA 3C4UA 5EL1A 5G1TA 4N9CA 3G1FA 4ZL1A 4HNVA 4BWLC 2TYSA 2FIQA 1H7WA 4MZ1A 4UFMA 1JRBA 3EEGA 3OA3A 3CHVA 3GR7A 4NVTA 4MJZA 4O28A 4RV8A 1YDVA 3W88A 3UXAA 1NSJA 3DKJA 3BLFA 2XN2A 2DJXA 3Q94A 4S2BA 1W8SA 3MP3A 1FDJA 3DZ1A 2CLMA 3CWOX 2QCLA 2E5CA 1Z42A 1SZGA 1UUMA 4GUJA 1O5XA 3DBPA 1XBYA 5CPOA 4FO4A 2C0AA 1W5MA 3P80A 1H60A 1MXSA 4W9TA 3LHZA 3P5YA 1HO4A 3N3MA 5K9DA 1B57A 4LWWA 4ZZ9A 3LRMA 4J9JA 4N6FA 2E6FA 5CPMA 1HFBA 1GVFA 1DKWA 2ZZ7A 3EWZA 2PRHA 3EXSA 2QKFA 2TPSA 4Y90A 3L5LA 1EA0A 3ZS4A 3O63A 1KM3A 2Z0IA 1VHCA 3C3NA 3E02A 3MBFA 3C2FA 3NQCA 3HF3A 3LRKA 3C2RA 1HUVA 3W7NA 3TUUA 3QSRA 4MVAA 3FKRA 4Z08A 1H7PA 2G97A 1NVMA 5J5DA 4LU0A 4YCPA 1MZHA 1EB3A 4WOZA 4FIRA 4JTFA 4OV9A 4K7VA 1UCWA 3W76A 3MWAA 2ZQ0A 2QUTA 3G1AA 4JTEA 1T8XA 3SGUA 1ICQA 1SPQA 1JQXA 2ABBA 3LTYA 3LCLA 1M7PA 2Z6IA 1SSDA 5AHIA 3PC0A 5CPLA 3W7CA 5AC7A 4R34A 1WYIA 2NWSA 3FOKA 2Y7EA 3HBLA 3DXIA 4Q33A 2BSLA 2CLFA 3W1XA 2PE4A 3CT7A 3N73A 1PE1A 1MSSA 5K4XA 1N7KA 3S1VA 3S1XA 4D2JA 1UBSA 2Y63A 2QCFA 4RCXA 4JDBA 3MI2A 3S8HA 1AK5A 2FDSA 1O60A 4RKAA 3B04A 3C0JA 3GZ3A 1W5PA 3NNTA 4HSOA 1ZAJA 5H91A 5K9CA 4QJ1A 1QFEA 4CNOA 3RK8A 1TPVA 3TH6A 3KRZA 3N9SA 4O52A 2NXHA 2HMCA 1TIMA 2QDHA 2FFCA 3P8IA 4NZFA 1LTDA 1DHPA 4EF9A 1PS9A 1SU5A 1VCGA 1EP3A 2AGKA 4O0ZA 1KTNA 4OV4A 2E6YA 1GOXA 3C52A 3NGJA 1LM1A 3UY8A 1FBAA 1TO3A 5AB3A
chains in the Genus database with same CATH superfamily
2XIQA 2Y8VA 1L9WA 3GNOA 4FB7A 1TPB1 1HN1A 3G8EA 3CV2A 1EWEA 4F0RA 1UWSA 5M03A 2F84A 3VGDA 1HJVA 3L9CA 2VURA 3KTXA 4GVIA 4HK6A 3O0FA 1IF2A 4DO4A 2WC7A 2DZUA 4S1FA 1REQB 2OLSA 1UZDA 2GDUA 3CMFA 4UTLA 1R7OA 5I23A 1J93A 3KWXA 1TV2A 1OX5A 3W7KA 4UFJA 1CBGA 2C1HA 4XISA 3OU8A 4WQ6A 3BSMA 1OSEA 1L8PA 2XH4A 2JEQA 3GU1A 1TR9A 2XJ7A 4ZO8A 1OQFA 4FSAA 3MCOA 1TV5A 4DLFA 2ZWZA 2ICSA 4MMWA 3Q67A 1LZOA 1UASA 2UY3A 1O68A 4QEEA 3PNUA 5AHMA 3ONCA 1J0JA 1K1DA 3TP4A 2I56A 2FHCA 3OA5A 3BANA 2AL2A 1IQ8A 2ATMA 2J7EA 3S2NA 3ITTA 2DIJA 1JPDX 5BOFA 5CBIA 3IPWA 3MJMA 4ATDA 4AWTA 1FFRA 1IXNA 1HXJA 4I9TA 5IDZA 3CU2A 3JVAA 1JNEA 2QPXA 3VCNA 4L6HA 2J6XA 5ENLA 3E9AA 1U5HA 1KV8A 3PBYA 1B54A 1ZS2A 3MS8A 1TCDA 4KWWA 1L2QA 3XIMA 1MW3A 2YKKA 1FWTA 1MO0A 2O56A 5C9XA 2NVAA 4MWAA 4X9YA 4UQCA 5MKGA 3LD5A 2F38A 3KX6A 1I45A 3BICA 3AUOA 2Z7KA 1UC5A 1Z8AA 4OE7A 4KIEA 2VZTA 4IF2A 2WXDM 4AZ7A 1LL6A 5LNRA 4W8BA 3KTSA 3FLUA 1RY8A 4HZ8A 1J4EA 4MNLA 5E9XA 3EPOA 2CYGA 1CLVA 1DJXA 4JKMA 5EFDA 1W0MA 4WKHA 4XK2A 3ITGA 1TZZA 1VFHA 4HA3A 4UQEA 4M81A 4BQ4A 4LUJA 1Q4WA 3IARA 3XISA 4EE9A 3PUOA 2GSJA 3UCCA 1BLIA 3NPXA 4P5UA 1XIIA 4DAFA 2P76A 4G1NA 3N1AA 4A8NA 3QPZA 2OVLA 3WDQA 1XUUA 1XDLA 1J6PA 3BLOA 3UW6A 4MDPA 4M1BA 2XVPA 3P60A 3GLCA 4ROPA 3PB2A 4O8RA 2NXIA 5HJLA 1E3XA 1E6NA 3F1QA 1U1UA 2HEJA 4XSLA 5C0QA 3DFTA 3FJLA 3OGRA 5JMUA 3CASA 4OOUA 3KRSA 2O9RA 3WLMA 4HJFA 2YFOA 4DUXA 1NAL1 3AHXA 3S47A 3GVGA 3OZYA 1FWFC 4FS9A 1D3CA 1BTMA 1RQHA 3LHYA 1UJQA 3AYVA 3VVGA 3B4YA 3RU6A 3KDNA 2YIHA 4US6A 3AYSA 1G7VA 4ZOEA 4PCPA 4KMQA 2ZRWA 2CZ5A 3GUWA 1Z41A 1GGOA 1SZFA 4R9OA 4KW2A 4LS1A 3W2NA 3DBNA 5D03A 4Z0SA 3WZ0E 3IGHX 4PFMA 4FK9A 1FWDC 5J04A 1PWMA 2ZZ2A 1O1ZA 2IPGA 3E96A 3MTWA 4C6PA 4QRNA 3NYDA 3KL0A 1H5YA 2WO5A 1Q63A 4M29A 2YDAA 3F5KA 2P88A 5LZLA 2Z2AA 4NZCA 4GCAA 1SO4A 3ZZ1A 4H7CA 3F4DA 1ME8A 4IZGA 3PHAA 4OFCA 4NYYA 4NSBA 1QAPA 3CHFA 3VD3A 2O9TA 2D69A 3HA1A 4QSFA 3KL5A 1K7XA 1NJJA 6A3HA 4HNLA 4TUFA 1F07A 3UR5A 3AZRA 7TIMA 2EXOA 3VM5A 3B05A 1VZWA 3BGAA 1FWRA 1QBAA 4HBKA 3QEZA 4CQ8A 2XPKA 5D2VA 2PRMA 2DUXA 1JPIA 4OUIA 4B3KA 2TAAA 5AHEA 5LGZA 3I10A 5TD4A 1IEWA 3TCSA 3HG4A 4AIEA 1KWKA 1A3HA 2OTDA 3BVJA 3U0HA 1U30A 4IPJA 1CGTA 2WK2A 1A5BA 4QM1A 3PZVA 1H49A 3BG3A 1DJIA 4B5VA 4XQ6A 4ACYA 3WH5A 1E6RA 3FY1A 3I68A 1TPH1 5G4HC 5IXEA 3TAOA 4JTQA 4DF0A 4WVXA 1I2OA 3WQ4A 3DUGA 3HJZA 3UP8A 1LLWA 1XG3A 1GOIA 3GNNA 3CPUA 5HJXA 4CVWA 4MOZA 4RZ6A 2X7WA 3W81A 5HUOA 4XZBA 2ZX9A 1IXOA 3PUGA 2E7FA 2BOGX 2NQHA 4MUZA 1MW2A 2Y89A 1SZNA 3S6TA 2GDVA 3C0LA 6TIMA 4RJEA 1BHGA 3D3AA 4HPNA 5HK4A 3R43A 2CHNA 2I1OA 3V16A 2VEMA 5IBXC 3V0SA 1PIGA 2AKZA 4EVZA 4CN1A 2ZUVA 3APYA 3C2YA 3BV7A 3N13A 4AZHA 4GWEA 3W07A 1KM6A 1LDCA 2Y70A 2PB1A 2PRLA 5C6MA 4DYEA 1A5NC 3P81A 3MP4A 2PC8A 5PTDA 3DX5A 4N6EA 1V6VA 3APGA 1E70M 3DFPA 4CN4A 3ZJ6A 4NJKA 5B7YA 1MRQA 4RNHA 4UOQA 5CLTA 1B3OA 3CB3A 4HK7A 3VYLA 3E2VA 5A94A 1D8WA 3IIPA 3WJYA 3CS2A 4H3DA 3OP2A 4LVDA 4AF0B 2G4FA 5C2CA 3E0FA 3K30A 1U5VA 2V2DA 4CEXC 4LS2A 5HNTA 2WM1A 1KFBA 3VIGA 1PHWA 2X42A 4AZCB 3WH6A 4XAZA 1NTHA 1UR4A 1O5KA 2V5KA 1LOSA 3AU2A 4FF7A 1E40A 4G5DA 4Y6GA 3CEPA 1A0CA 1YDOA 2ZUNA 4C7GA 4PULA 1P0NA 2C19A 5AZ1A 4HTYA 3WF1A 4R53A 3M0ZA 1H0IA 4LC6A 3ZLGA 4JIPA 1LOQA 3ZLHA 2WLZA 1JCMP 3STGA 3I3EA 4Y9AA 1FHDA 1BG4A 1X8FA 4DBSA 4ICCX 2ZE3A 2VD9A 3FDGA 4UFIA 2Z7GA 4OVXA 4OJYA 3ARPA 1I60A 1ZQ5A 3BL3A 4CQ9A 3QF0A 3RFAA 4DB7A 3L0GA 3KOYA 4RLIA 5J8LA 1K8CA 1RLDA 1XC4A 2E28A 4QDMA 3OO2A 3UF9A 4AZIA 2XSXA 5CPQA 4AX7A 3VIJA 2PPGA 3MYPA 3VD4A 3VA8A 4IIEA 4UUIA 3CO8A 4GFSA 1XLHA 1HJQA 3C2VA 3ITCA 1T96A 1AL8A 4JCMA 3MUY1 1KBLA 1XQKA 3KLLA 3ARQA 1YPIA 1D7FA 3ECQA 3UA3A 5ABFB 1V6YA 1YDNA 4Q4QA 3WMCA 4BKNA 3LERA 4G1KA 1NWUA 1R6WA 2IXVA 2OFJA 1R47A 1Q6QA 1FWSA 2GVYA 2OYLA 1MW1A 3ABQA 8RUCA 1AL7A 3E0VA 3VMPA 1NY1A 1HTIA 3VZXA 3WL0A 1WZMA 4AZBA 2W61A 2Z25A 3C2OA 3TYZA 1CW2A 2P1FA 1F73A 1TX0A 4B9ZA 3LCHA 4JYFA 5J5RA 3RLUA 2VC6A 5F4XA 3PR2A 3V75A 3W23A 1WNOA 4HA0A 2GQ8A 4WXYA 1FWCC 3AS1A 2ANUA 2D0HA 3CHCA 1OC7A 4O8AA 3FGCB 3NR0A 3WQOA 1TE1A 2I9UA 3GNXA 1B4EA 4N9DA 5U7SA 5D9NA 1MI3A 4LBUA 5I79A 2UY2A 2YCIX 4DAIA 4DX3A 1JAEA 4EXAA 2Z1VA 1B5TA 4EWND 3IVSA 4PRWA 3T81A 2JQXA 1GYNA 3LCGA 3LUTA 4MPKA 2IPJA 3FAWA 3H2NA 3W1QA 2V2HA 2WWDA 2Y0FA 3NQEA 2Z1WA 3WMBA 2OGYA 5AECA 1UKTA 3RAOA 3WEZA 3H2CA 1TSIA 1GPFA 3RCNA 2AQWA 4CQAA 7REQA 2B81A 3LRLA 4MNJA 1UBPC 3R6IA 4IMAA 4HGXA 3KBJA 1TTQA 4NF7A 4U28A 1TQXA 2WYSA 3A24A 2EKCA 3VZYA 3K4WA 3M64A 1TJ2A 4L6OA 3MA8A 2VQUA 3IACA 4D8ZA 3M7WA 1J12A 1Q6OA 1JCNA 1PV8A 1PSCA 1ZB5A 3UJEA 2BHZA 3ATZA 3NQFA 3ZIZA 3TC3A 1VFTA 4K68A 1GVIA 3LZ5A 2XIMA 2VGBA 3DG6A 1L0PA 4J27A 1L6WA 4H6KA 2MUCA 4RR4A 3RU8X 3AIBA 3L4VA 4JTDA 3VK5A 4IUGA 2V3EA 4L80A 2YJQA 4RL3A 3TYCA 3NDZA 1TZ7A 3AROA 3N11A 1AMYA 1UD6A 3TLLA 3K2GA 2YL8A 3VOFA 3VKAA 3WQEA 3P8JA 2HROA 1FWIC 3QHNA 4JTRA 1LLZA 4I9JA 1VBGA 3FYPA 3ERPA 4HVXA 5EMMA 1V79A 1KXQA 4INFA 2EEXA 3E5BA 2VFEA 2A3HA 2C6QA 2AAMA 1KRCC 4A8RA 4EXQA 3GHRA 3MUZ1 4TOQA 4WDXA 4LAUA 1VAHA 3TQPA 2HVNA 1NQ6A 4WY0B 3DDMA 1UWQA 1CXHA 1BFNA 3G22A 4XVEA 1AD1A 1IWPA 3ANVA 3NSNA 1Q5MA 2X2GA 1X6UA 1DE5A 1XLCA 3IUDA 1TIWA 5C7HA 1S3HA 3I6TA 2YCKX 4H9ZA 4PTWA 1UUQA 4DLMA 1OF8A 1V6UA 2VM8A 1EEPA 4IHCA 3TKFA 3ZSTA 2ISSA 2ESCA 2OO0A 1OFQA 2V5BA 4P8XA 1DWJM 3N2OA 2I9EA 2F6KA 3VZZA 4AY8A 2QCEA 3BAJA 1CWYA 4DWSB 4F8XA 4A2RA 1M1BA 3BK0A 3T55A 3TFCA 3GXNA 5EGRA 4UZSA 5D8ZA 3BAWA 3EXTA 1K8ZA 2R1NA 1K9DA 2YBTA 5A2AA 2KAUC 3WIJA 4RDVA 3G3DA 2OSXA 3G1XA 1KWGA 2VWTA 2E4TA 4N2YA 3BSHA 3UXIA 5ECVA 2XVGA 4ADTA 4Q4PA 2IKIA 3OQEA 5LGXA 5E6YA 1KB3A 4X60A 4E38A 2X16A 5CGQA 2PP1A 1X6LA 8TIMA 1U1HA 4RX0A 4W8AA 2ZX5A 3VD9A 3F03K 1I4NA 3W1MA 4WDUA 2XFWA 4NI8A 1UR9A 4GBDA 4EP8C 1QRQA 4WK9A 2ZFAA 3M0JA 5BW6A 1NDYA 2HDJA 2V81A 2VC9A 4HQVA 4X61A 1VBHA 1UKQA 2XN0A 1AH3A 1RBLA 4JX5A 1CXFA 3V5FA 1KTBA 2V38A 5A6BD 1CXIA 3WKZA 7ENLA 1MEWA 1ITQA 3R5EA 2XZ7A 2BG5A 3AU6A 1TCMA 3H53A 4Z1YA 1WP6A 4HA4A 2VC7A 3GFYA 3H4XA 2FZNA 2YDRA 3N14A 1K03A 1XISA 4AAJA 1EH9A 3ZMRA 1V02A 1EC8A 3N25A 2A7NA 4TVCA 1VC4A 1R3TA 4ML4A 4CVUA 3U9IA 4RDWA 1ENUA 4JQ4A 4M6QA 3CH9A 1OCJA 4Z2LA 4NJJA 3W4RA 2DW7A 3TTQA 4ECLA 4GQBA 3FCPA 5TBOA 4NNBA 1AD4A 1HZYA 5ECUA 5LXEA 4MM1A 1ZRQA 3KBVA 3EWDA 3DIPA 4YL2A 1GJPA 1VYPX 2PDUA 1TJ1A 4AIOA 1XIGA 3KEHA 5C8BB 3B0PA 4IMDA 4WOQA 2P10A 4AWEA 4QQUA 5A8GA 1ZCOA 3GG7A 3B0YA 1XYAA 2QAPA 3POHA 4O0KA 3E0LA 1VPYA 4GXPA 4OU1A 1PKMA 3G1RA 3STPA 4A3YA 4JGDA 2UBPC 3WH7A 1DHKA 5GVJA 3GTXA 1XJBA 4DXKA 4JTJA 4M19A 1OG6A 2AQOA 2HJPA 1R3WA 1CGUA 4E2OA 4EIVA 2VFIA 3SUVA 4JEJA 1E4NA 1AFSA 3PBGA 2WJEA 3DHPA 4E5TA 2PC4A 3O1NA 4U10A 4LV4A 5BCAA 3WDJA 2Y62A 3AJ7A 1R9YA 2XH2A 2VR2A 1TRDA 4E8DA 5HWMA 4B3ZA 3QGVA 2B4GA 5DCDA 1XFBA 4BF7A 4DWDA 3HB9A 2G50A 2ZRUA 5I2UA 2NQLA 4HYRA 1E1CB 1YTEA 3NWRA 1EEXA 2D3NA 2WVVB 3KFTA 1WBHA 5IHRA 2GPTA 4MKSA 1RCOB 2G3JA 4F40A 3THQA 1Y8BA 5F2LA 4QG9A 4YPJA 1OYBA 1ZJIA 3KCOA 4NG3A 5AB3A 3GVWA 2VHLA 3JZEA 4MAZA 2F2KA 4GXWA 3UERA 4FNRA 4OWGA 2B7NA 5GQBA 3I6EA 5KZ6A 3UJ2A 1CPUA 5LHEA 2G3MA 1H7RA 3VIOA 1BWKA 3CAWA 4CU6A 3TCEA 4L5ZA 3B8UA 3FDKA 1V3MA 2ZZ3A 1TFVA 3GR4A 2BY0A 2ZUUA 4LC8A 4GX8A 2BVYA 1BYDA 1WOAA 1ADOA 3I4KA 2GGJA 4JN6A 2GGEA 4KEVA 1HQTA 4LB4A 4J2PA 4P2VA 2HV5A 3VUSA 1A4LA 3B9AA 1ICSA 3DEQA 4WR3A 1HJUA 2OEJA 5K3VA 4IG2A 3AALA 2WVSA 3G5EA 4DF1A 4IMCA 3O9NA 3ZT6A 1CGYA 1V6TA 2ZC1A 1RK5A 3M0MA 2VWSA 1MNZA 2Y5EA 4GCXA 5HPCA 4GZIA 3KP0A 3M5ZA 5IBXA 1W3KA 1VIWA 2V30A 1BWLA 2IQTA 3GVRA 3HG2A 4GNVA 3W1NA 2J27A 2QR6A 1HG3A 3BQ6A 1EL3A 4ZVJA 3UVAA 3MUAA 4KGJA 1JD9A 4XIMA 3SCRA 3LMZA 3KOZA 2WCSA 3SIMA 3U5YA 5HNRA 4UTHA 3B9EA 2XSAA 1GOMA 2P0IA 3KOFA 4PRTA 5BXSA 2ZBTA 3R13A 3IK4A 1OCNA 2CC0A 3VIHA 1IGWA 4S3CA 3F5JA 4UWMA 4K8HA 1QATA 1C7SA 1RBOB 2RHGA 2VO5A 2REQB 3V35A 4D71A 3M47A 1B3VA 2VQTA 3MMUA 4N4QA 3UD6A 1QHZA 4DI8A 4P7RA 3VGEA 4DO7A 2JF6A 4JS3A 2OLHA 1DWHM 3S46A 1S2VA 2IKJA 4JTLA 4RW5A 2GZXA 1D3GA 4LALA 4DELA 3CPGA 4HHLA 4AD5A 4V1XA 5C2GA 1LBMA 1GKRA 2VELA 2D1ZA 1KD0A 4FOJA 1FCVA 4G7EB 2PU0A 5I09A 1QOXA 2Q8XA 2QUUA 2D0FA 5IFTA 3PZNA 2Y1HA 3AAMA 2G96A 4E4PA 3ZVIA 3NQAA 4YTUA 4O12A 2ZTJA 4P7LA 5GJMA 2H9AA 4AIBA 2PA6A 3H24A 4AX6A 1ME9A 1SW7A 1AJZA 4H1ZA 2ZUMA 4LCRA 4UTWC 4PODA 3T2PA 3S5SA 5XIAA 5EBUA 5HPOA 3SUUA 3I7QA 5BOEA 2XIOA 1JRCA 2J24A 3DG7A 3WBYA 2C91A 3SUWA 1ODZA 4L4OA 4UIOA 2DY3A 1SW3A 3RO8A 1RR2A 1XYBA 1CI1A 3T6CA 4HZMA 4E2BA 3FW6A 1J9YA 1SZRA 2FMNA 4LUTB 1XYLA 4HT3A 5I02A 3UCDA 3R2GA 5TNVA 2C13A 1XIMA 4HMCA 1TX2A 4EPDC 2B31A 3YPIA 4IQDA 4AY1A 2NLIA 1JDFA 4I6KA 1FWNA 4BWLA 2D73A 3W87A 2QUNA 1UROA 3ZR5A 1FP8A 4M1RA 4LPCA 4DBWA 3O15A 2WZTA 2YCEA 1RBAA 1F6PA 1H1ZA 2IQDA 3CXOA 1MUCA 2HVOA 1DE6A 4V2XA 2BFGA 4GJJA 3W1RA 2VUNA 1J01A 1MWOA 3HPSA 9RUBA 1XSJA 1V3JA 4KCWA 1BXCA 2Y7FA 3VABA 5EYWA 1DP0A 1PTGA 3VO0A 4NZ5A 4AYGA 2YL9A 4BA0A 3WEOA 2FPTA 3AQUA 4ZOAA 2Q8ZA 3BGJA 4MZ8A 2YB4A 1QOQA 4Q22A 1QI4A 4IGNA 3WLPA 4RNJA 1AQ0A 1XGZA 5I3KA 2YFNA 1PCWA 2BV9A 2VOMA 2F61A 3F2CA 4JTIA 3AHZA 4A4AA 1YPFA 1M41A 4EANA 4OIFA 3WQGA 1E4IA 3M5YA 3HG3A 1OK4A 5A6KA 3W1TA 3R94A 4YHEA 1I2QA 1KR0A 1EJSC 3ZT7A 4POCA 1W37A 8XIAA 1P0BA 1UPMB 2YSWA 4XBJA 3UNTA 3PY2A 1SJAA 1XLJA 3GYEA 4F2TA 1Q6GA 4GBUA 3BMXA 5JBDA 4ZO9A 4Z0JA 2PDJA 2A4AA 1PTDA 3UY7A 5FEXA 3LXCA 2ZZ5A 3RX2A 1VIZA 3ZJKA 1P0KA 3W28A 5FEPA 1D8CA 1JZ6A 2V5LA 3MUCA 3T0BA 3CZ8A 3NQMA 3UWQA 1MXDA 4DJFA 1LBFA 1AQFA 3GNDA 1YTKA 4H8UA 2ZZ1A 4MY8A 1R3RA 5G5IA 4Q8VA 2JKEA 3RMEA 2Z00A 2W6RA 1DYSA 4A3RA 1QR7A 3CJPA 4GYFA 3I6RA 4CQBA 4ZE5A 1QU4A 1PEZA 1EIXA 2QJGA 1RLCL 2PDWA 2Y4SA 2DZAA 1C8QA 4HSHA 1WXZA 3R8GA 5D38A 1DL3A 1W9PA 1ISYA 3LS9A 1QCWA 4PTMA 4UTIA 2VDHA 5DMYA 3DYMA 3PZMA 3AZSA 1WAWA 2PAJA 4KGLA 2BHUA 5A95A 4KWUA 1YNPA 5H8PA 5CC5A 3IJIA 2WBGA 2H3DA 4E2VA 3HOJA 3AS0A 4HOWA 2P50A 2HNEA 3KVMA 4C5YA 3IJ9A 3MU7A 2OO6A 1YX1A 3LI1A 1F8MA 4XZWA 5E6ZA 2DIEA 4AZ6A 2HTMA 4N9CA 3G1FA 4HNVA 2PTXA 3KBMA 5AYBA 1XIEA 1UQYA 4NVTA 1UP3A 4O28A 4RV8A 1YDVA 3W88A 2CHOA 1UWRA 4IG2B 6TAAA 3RO6A 5JXQA 3BLFA 4Q3MA 1UR0A 3CQHA 2INFA 3DZ1A 2QCLA 4ZO6A 1XPYA 2NLYA 4FO4A 1DXIA 3ITYA 1YRRA 3H2MA 3NZPA 3ITLA 2QIWA 1HO4A 5GNYA 5K9DA 4ZZ9A 2E6FA 1JYVA 1HFBA 1GVFA 3K1DA 2ZZ7A 2TPSA 4JQ2A 2P8BA 5DT5A 2QIIA 1V02E 3ZS4A 3GO2A 3O63A 3UXLA 1KM3A 1H4PA 4AZ5A 1HJWA 3HF3A 3TUUA 5HANA 4Z08A 1H7PA 4F0SA 1J0IA 4ZSUA 4WOZA 1IT8A 2WQDA 1XG4A 3ES7A 3SM0A 2WKGA 2CXGA 4F9DA 1T8XA 3SGUA 3UG5A 1HNYA 2ABBA 3Q65A 2Z6IA 1I1XA 5AC7A 3UESA 2VEFA 3HBLA 3DESA 4R3UA 3F4VA 2VX5A 4Q33A 2DGAA 2GVEA 5A8OA 3GFXA 1RSCA 2VRQA 1MSSA 5K4XA 1N7KA 1XLLA 3SY1A 4GACA 2DT2A 3VKDA 4D6HA 1VB9A 2C7FA 3RG6A 3S8HA 1AK5A 2FDSA 4CU7A 3AXIA 3C0JA 2VYOA 1W5PA 2WZIA 5T9CE 4HSOA 2HK0A 1X98A 4QJ1A 3WNMA 3KRZA 5CC7A 2PZ0A 3OJGA 1TIMA 3P8IA 1KCKA 1Z3NA 1WKDA 2XZ9A 5H6HA 2QMKA 4EF9A 4XB3A 1VCGA 2AGKA 4EXBA 1ELSA 2J78A 1KTNA 4OV4A 3ARXA 2PEVA 1EPVA 4Q4RA 4DJED 1TO3A 3E0WA 5BU6A 5AHLA 3TN3A 1M7OA 2NVDA 3PJWA 2ZVIA 1M65A 4UCFA 1EOKA 4I9AA 2NV1A 4ZQCA 2CLLA 3VINA 3NCOA 3DAQA 5AOUA 1JYXA 4S3DA 3SRDA 1S2UA 2D23A 1WUFA 4CNTA 2H9AB 3QHMA 1LWHA 1XCWA 5JQ9A 2NWRA 1A0EA 3WMSA 3RJXA 2C71A 2J7GA 1I75A 3VIKA 3UEQA 4RE3A 1QNVA 3THUA 3W82A 3KRBA 3QRHA 1JYWA 1XYMA 1PIIA 4UZUA 4P61A 3RITA 5FF7A 1LRQA 3NSXA 3PSVA 3ELFA 1TG7A 4RNIA 4H8VA 2NV9A 3EA1A 4IIHA 3MHUA 4ERGA 3R25A 9XIAA 3GDTA 3QW4B 4IGMA 3BAYA 5C70A 3LXBA 2IXUA 1GQNA 1XBVA 3GWQA 4GO9A 1T40A 1GZJA 1B3YA 1BGGA 4IWWA 3GX9A 5CSRA 2QJIA 3TJXA 1BTCA 1Q6EA 1EJVC 3VM7A 3SCVA 3ZJ7A 1P6CA 4FF5A 3VMNA 1UH4A 1OFEA 4FA3A 4ORIA 3Q45A 4HNNA 3TC6A 4EX4A 2CPUA 1BXBA 3VOCA 3B9NA 3LCFA 1BVWA 3WQVA 2ZTKA 4GQRA 3U4AA 4MY9A 3HFTA 5K4ZA 1W56A 1VFSA 3RRAA 4PMVA 3N4FA 5XIMA 3P84A 3W2JA 1EBGA 2QDGA 2XHYA 4HU0A 2CBIA 2RDUA 2OEKA 2H8ZA 5AY7A 3CIXA 3R0UA 1O12A 4YU1A 3S4TA 3RDKA 2VZOA 4IP7A 1XIHA 3T4WA 1T5AA 2P8CA 4HCLA 3ARVA 2W92A 2PI6A 2E1DA 1QNRA 2Y61A 1BF2A 1JCXA 3LM3A 4O10A 3WNPA 3PTDA 4E3VA 2PZNA 2EPHA 2AMXA 3NO3A 1I6NA 1MUWA 4KWSA 1E0TA 1X7FA 3TMLA 4K36A 2Y2WA 5G2WA 1VENA 2QAFA 1ZAIA 5EMUA 4YVXA 1V93A 4I5UA 2XSBA 4HMDA 1JZ5A 2E6AA 4DQWA 4GH1A 3FKKA 1SFSA 3GTIA 2PGFA 3P61A 4AG0A 3GB6A 3BLEA 5JH2A 3U7VA 5JIWA 2SFPA 4GY1A 4JEQA 1EXPA 1RCQA 2YZ5A 2HZGA 1XUZA 5FOOA 1C93A 2BB0A 1XLIA 2G4JA 1V6XA 3B3DA 3W84A 2R1PA 3MUXA 4JN7A 2PURA 3LLFA 3CH0A 1JCYA 2PWHA 1UKSA 2ACQA 4GZJA 3KAOA 4GH3A 2X30A 1K4HA 2PODA 4AVNA 4CD5A 3FSUA 2PDMA 2BY2A 2HXTA 1M03A 1J5SA 2DP3A 3GDKA 4U33A 1ML1A 4RV3A 4TV5A 4O57A 3R0KA 3B8TA 1ZGDA 4ZTXA 1XLBA 2RDWA 2PDQA 2WVTA 2J25A 1F76A 3FVDA 5BXPA 3UR7A 4LGXA 3U7BA 4IFOA 1OBAA 2GGGA 1HL8A 2OWCA 3W2UA 1RHCA 1I2NA 1WCGA 3EDEA 3GNPA 3AJXA 3U2EA 1XH0A 2I57A 3JU2A 2PMQA 2H90A 4LV9A 4ATLA 1M53A 2YGYA 3QV9A 2RDXA 4A8IA 1ECQA 2QNEA 3THAA 4HCHA 3H7UA 3ZFHA 3PB0A 2O92A 2PDIA 4GRSA 1W1ZA 4RNFA 2C14A 2ABAA 1Z48A 3XINA 3L0KA 3VFCA 1J0YA 1I9CB 5EY5A 1ZJHA 3L4UA 2ZADA 3WK3A 3NVDA 3ZM8A 1R9XA 1LYXA 5CKSA 2GDQA 4IJBA 3VDBA 1V4YA 3ABXA 1XIDA 3MO4A 2A1YA 3R1ZA 3UETA 4IX2A 2P0OA 4ZE4A 4YIWA 4AB4A 3GNRA 4QROA 4K8GA 4MG4A 2A79A 1JCJA 4Z1DA 3WD0A 5D2XA 3Q58A 2FJUB 4L1WA 1EGVA 1FQ0A 3CZLA 1EWDA 4PSRA 1JJKA 4H9XA 5AYYA 4U2ZA 3V7PA 1EF3A 4B15A 5EA9A 4TV6A 3LK6A 4DEFA 3L23A 1JF6A 3KE0A 2DSZA 5D37A 3TK7A 5ABFA 4GQGA 4J3SA 3EYPA 4H9YA 1OHLA 2DUZA 1FDYA 3PFMA 3W1AA 1W2VA 2XYLA 4GC3A 4QE4A 1JVNA 1QJWA 1WUEA 4OGZA 2PD9A 3L2LA 4LAMA 3HTWA 3EX2A 4GYPA 3SUSA 2H8XA 2WBKA 4CCZA 1ZUAX 3E1F1 3AYTA 4BFAA 4DZ5A 3MI3A 1VFMA 2QCGA 1Q8AA 3HM7A 1DIDA 3U6WA 2DT0A 4J3ZA 4AWUA 3RIKA 3L5MA 1GJUA 1E9LA 2YA2A 3V0UA 3NL5A 4KCTA 3LGEA 5T26A 4A8LA 2ACRA 4K1WA 1W1PA 3CV6A 4IL0A 3VX0A 4H41A 5GJPA 3S2JA 1E1FA 2OSYA 3CUIA 1TWIA 5I0DA 4UTTA 4FXFA 4KRUA 4QLLA 1ISZA 3SQLA 3N34A 1K02A 3MVIA 1YPXA 4Y8FA 2LLEA 2QJHA 3OGSA 1ODUA 4LUIA 1XLEA 1UWTA 2FH6A 3CYJA 1M01A 1TUFA 3BURA 4GQQA 3AXHA 4Q8UA 4Q7IA 1A5LC 4DUOA 3NYZA 3W9ZA 2GK1A 2QV5A 1HJSA 4U3AA 2OZ0A 1KW1A 3O6AA 4DM2A 4PMJA 2HE8A 2ZC8A 3LDVA 2ON3A 2WHKA 3QJAA 1O1HA 5FL1A 3H54A 1MYRA 1E6SM 4JCLA 3QYSA 2PWDA 4H00A 4HYVA 4XZ9A 3PNZA 1QNSA 3UG4A 2J8GA 3SJ3A 1TE6A 2TMDA 1KRBC 1XHGA 1NOWA 4LY4A 5ABTA 2GQAA 3S6OA 2XIJA 3M07A 2RH9A 4AHPA 1GYMA 2RJGA 3A4WA 2QJNA 3TW7A 1GORA 4GI9A 3R10A 2CZEA 3GXFA 3G3MA 2AMGA 1DOSA 1LQAA 4O18A 1ZLPA 5FJUA 4M6UA 4HN4A 2DORA 1XSIA 4JPGA 4MY1A 2QT3A 2KZHA 1JUEA 1EC9A 3VC6A 1E56A 3E5PA 3IGXA 1KA9F 4N7QA 1TV3A 3QSTA 1UH3A 1CDGA 2DDXA 3FA5A 3N2BA 3QH2A 3SY8A 2OQHA 3WUGA 4QQ3A 3SSJA 3PWAA 2BHYA 3NIYA 4UXDA 4XG1A 3DKLA 1HGWA 1EZWA 1RUSA 4QNEA 4UOZA 3E38A 4X22A 4DJDC 1VR6A 3GFZA 5I3DA 4FNSA 3CUJA 1T6MA 3WBXA 4M5PA 2VZSA 4WDTA 5B7ZA 5BOOA 2XH7A 3LV5A 5REQA 2PDFA 3UG8A 2O4MA 1RPKA 4WD0A 1HIZA 5CSSA 1Y0EA 4QCFA 2OQYA 1KO0A 4NAFA 4ZQPA 1FHVA 2G8ZA 3AZTA 1OFBA 4GO8A 3HGRA 5A2CA 2OZ3A 3CZGA 3W6LA 1UOZA 1UUOA 3NO1A 2V8ZA 2XFFA 3VIPA 4I9MA 1D9EA 3OIHA 2VCBA 2CLIA 4PEKA 1GZ1A 3KDOA 1JULA 1HGYA 5KZMA 4JAWA 1GT8A 4JICA 3W7HA 4O0QA 3W3OA 4MYXA 1RK6A 1OIFA 1MEIA 3WLNA 4XD3A 4O4WA 1B90A 5IHSA 5AHFA 3FGCA 2ZZ4A 3T4CA 2I14A 2PTDA 1NDWA 2JEPA 2OELA 2PTZA 2OYMA 1EX1A 3W53A 1KM5A 1R3QA 4CQCA 3HGSA 5D04C 7XIMA 2QJMA 4O15A 1GONA 1YBQB 1OY0A 5BWFA 4A29A 3WELA 4D8LA 4H9TA 1EO7A 3GS6A 2GVLA 2W91A 3N3TA 1KFJA 4JHOA 1PZ3A 2IW0A 4JXCA 3S5OA 3LBCA 4ICNA 3N9RA 1SMAA 3S9ZA 3NPWA 1W3HA 4XV0A 1AZ1A 1QPRA 1PUDA 1ZPTA 3BZJA 2ISFA 5G1MA 2X40A 4NNCA 3QGAC 4P8WA 3W70A 3T1GA 1JZ8A 4NZ3A 6CGTA 1BXNA 1SO3A 2E25A 2H6RA 2EJ1A 5BNKA 1C91A 3BG9A 4GK8A 1CGVA 3WBEA 4B90A 3GC2A 4EACA 4GOAA 3LLXA 3WJSA 4WKFA 1VLWA 3CAQA 3K5XA 4G8TA 2QYGA 1CENA 4C60A 1HKKA 3U57A 1JUKA 2A3EA 2VMFA 3WQ8A 1VFLA 1JL8A 2Q01A 1Q6DA 5CZ0A 5C71A 2WHLA 3HPXA 3TLQA 2VP8A 4AVOA 4NQ1A 3M6YA 1SFLA 2WZHA 5AN7A 3L12A 3VU2A 4JDYA 2XN1A 4E8GA 2EPOA 3W6MA 3W1LA 1DVJA 5HUPA 2WJFA 3OG3A 4CU8A 5TAOA 1FXQA 1AG1O 2IPFA 2UWFA 3IUHA 4A2SA 1OFDA 1CIUA 3ABZA 3LHUA 3UXKA 5F7UA 2V2CA 2BOEX 3FYOA 3WH8A 4WRHA 3W7QA 3S9YA 2DFAA 4FI4A 5AYZA 4W4QA 1KTCA 4AZCA 1NELA 3M0KA 4NAEB 2JIWA 3EA2A 4B92A 2IUZA 2OU4A 3F5LA 5C9RA 4RE0A 2WSYA 3ARWA 3G24A 1XPGA 1U22A 5K2ZA 4WHBA 2OQLA 4ZFMA 3OVGA 2DT1A 1EUNA 4R33A 4NJHA 4E4FA 1AH0A 3VIFA 3A4XA 3LGGA 3T8QA 1EJUC 3REQB 4UNLA 3I4EA 4UTMA 4MWAB 4JKKA 4GKLA 1J18A 1RPXA 3NJ3A 1K7EA 1ISVA 1KXHA 3GM8A 4FMVA 5DXYA 1PX8A 2J8TA 1AZ2A 3WBAA 1F6YA 1MQQA 3NM1A 1TPDA 3H22A 3LMYA 2PDCA 1UMYA 1ZL1A 3BARA 1DTNA 3LOTA 4C5ZA 4F2UA 5CSUA 5A1AA 2HPMA 4M51A 1CT5A 4N9EA 4B5NA 4H9UA 4I8YA 2QS8A 2I17A 5G4WA 2YCLB 3NA8A 1M3UA 3AICA 3QQ1A 5FJIA 2QHAA 4HD5A 3T9PA 4JNYA 1O6IA 3MW7A 4DHGA 4U31A 3COTA 2EPNA 2ZVRA 3AHTA 3H26A 3S2LA 1T41A 3GDLA 4GIEA 2V0TA 1TMQA 1ZJBA 4FNPA 1EDQA 1YQ2A 2OYKA 3TAKA 3UQNA 4EPEC 1Q8JA 1P6BA 3O6CA 2D20A 4Y96A 3FNDA 3BE7A 4C6QA 3PG9A 4LT9A 1VPXA 2WB5A 2NQJA 2DUAA 4MYAA 1PPIA 2GOUA 1EOMA 1VJIA 2VEGA 3NO5A 4IIFA 5E0KA 1OZQA 1PYMA 1G0CA 1GCYA 3KZSA 3C5QA 3PAOA 4JKLA 2X0YA 1G4PA 1VFFA 2VXNA 4JNMA 2FVKA 3VPLA 1GVRA 1AH4A 5BRBA 3CUHA 4PMQA 6ALDA 1TV8A 4GG9A 1R2SA 3WJXA 3BJSA 3PBWA 3M0IA 3MSDA 4GKTA 2QDDA 1GG0A 5I77A 1VRDA 1XSKA 5FJPA 3B03A 4FEZA 1WBJA 3MCNA 1JUBA 4IPNB 3S1GA 3V18A 3CO4A 1YNYA 2RGLA 1A5AA 3SSZA 4CQDA 4Z2IA 3INPA 4GY7A 4AD4A 4PE8A 2E77A 4MJMA 3BDKA 4X9SA 1NOFA 3UJSA 2PP3A 3B0UX 4UMAA 1A5SA 1XIBA 3L2IA 2X1RA 1TUXA 3KHDA 4LUYA 1DJYA 3W27A 4DWSD 3GDRA 3PZOA 4LEQA 4D6IA 1OINA 1XC6A 1AVAA 2CNCA 4DO5A 3GHUA 4BEQA 4FXSA 3IGSA 2VVSA 3QZAA 1FY6A 3D6NA 4WJXA 4WJEA 4P8UA 2NQZA 3EGJA 1OCBA 3A12A 5M17A 2VI0A 3N2TA 4ZQRA 1XRTA 1H11A 1VYSX 3URBA 4CCEA 1EJRC 1TYGA 3UFYA 4MUPA 1DJGA 5A8MA 4CNPA 5I3HA 4PCTA 3UR2A 1QPQA 3BLIA 4HB7A 4W86A 4J2MA 3JR2A 1PDZA 3CT2A 5K9XA 5LNWA 4W7WA 4PSPA 2J66A 1FVPA 4LYRA 4S3EA 3W25A 1V7AA 3KL3A 1UA7A 1RV8A 4PTVA 2V3DA 5G1YA 1Q2SA 3QW3A 1MDRA 4IISA 3QC3A 1IWBA 3NOYA 1Q66A 4D6DA 4M82A 1VBUA 1VQTA 2DZXA 3GU9A 3N17A 2VGFA 3F4NA 3B0XA 2GJPA 2Q02A 1XKYA 5DBTA 1EP1A 5FSDC 4UR9A 1C7TA 1LUCA 2CEQA 1LBLA 4MIMA 3I7RA 1IEXA 2NT1A 1S3TC 4F3HA 1P0EA 1OZMA 1V77A 4MJ4A 2C8NA 2XGBA 4DNHA 1Q6RA 2GSHA 1PJ9A 2WSKA 4C7FA 4PBFA 3M4HA 4PYSA 2QCHA 1HL9A 1GJWA 5ABGA 3IWPA 3TZFA 5JBEA 1H7NA 3B0VC 3QV7A 3RLVA 4IFKB 2QUVA 3GXTA 3RRXA 1AJ0A 3L4TA 4B16A 2ZXAA 3PBMA 3WLOA 4PMOA 1KBKA 3NQ2A 1LG1A 1F3EA 1Q7MA 4ICMA 3T8LA 4ZXLA 1IIGA 1IZJA 1QW7A 1IZCA 3RPMA 4K1GA 5A8NA 4QJ5B 5F1VA 1CXEA 5CSYA 2GWNA 1R9ZA 2XFRA 2F9RA 2FJKA 3MKVA 1UIPA 1DPMA 4MZYA 2B0MA 2VRJA 4A6GA 3M9YA 3V5CA 3TXZA 4PEEA 5LNVA 5HAOA 1WDDA 5G4EA 2NX9A 2X2YA 9XIMA 2ODOA 1F3TA 3SCPA 4GABA 3SCOA 3GH5A 4A21A 5AVHA 2F7FA 3TJLA 2L5HA 1D3HA 2WM0A 4OKDA 2HSAA 1E73M 3UJFA 3I65A 5I3GA 3TZNA 4S2CA 3G18A 5AKQA 2J8FA 3NQ8A 4UNKA 4Y2WA 2BXZA 3NPVA 3TQ0A 2GQ3A 3T07A 1UPPA 4FXJA 3UWZA 3RM8A 1KM4A 4NL1A 4DJFC 2HQAA 2GJNA 1A4MA 3A3XA 3A13A 2QVNA 3ZLFA 1CZ1A 3E6EA 4LQ1A 3SN1A 4QDPA 1J0HA 1PX4A 4ORMA 1ADDA 5DF0A 1US2A 2I5GA 4L64A 4M56A 2D2HA 3UGRA 3VMOA 3S6DA 3WN6A 3MJYA 3L68A 5EMKA 1UB3A 3D5HA 3OBKA 3CPRA 3NVTA 1K77A 1DEDA 3FXGA 3TE9A 4BEUA 1DQUA 1FA2A 2BVTA 1RA0A 5TQLA 4QGCA 2DZSA 3AOFA 4PCSA 5DCBA 3B97A 1OGSA 4GIRA 1WZLA 2E5DA 2DZVA 2WSPA 1NOUA 4J4KA 4JTKA 1MNSA 2DJLA 1NH6A 1JFXA 3KRUA 2WNQA 4KRZA 1JNDA 2VZVA 1NFBA 1PL9A 4D6EA 4PUKA 3B8VA 3ARYA 2WW5A 2WMGA 4UFKA 2JKAA 3S1UA 4UTJA 1TPUA 3EWWA 4LBRA 1NDVA 3IRSA 3T0AA 3P2VA 1WKEA 2J6VA 3H12A 4O11A 5CJ5A 1Y5XA 2BXVA 3QV8A 4O14A 4TX8A 2Y8KA 1OFOA 2FPYA 3FSTA 1VF8A 1I2PA 3CM4A 3D0CA 1K9TA 1W5QA 4L6DA 4O1DA 1UH2A 3VNIA 1TREA 2R6OA 3UXDA 4UR8A 3K4AA 4GMEA 1RJQA 3NQDA 2GQ9A 1WE5A 4QX4A 3W7PA 2V6AA 3LCXA 2V67A 3IGUA 2FB2A 5LNSA 1P1MA 3W26A 3H55A 2OWWA 3ATYA 4CEUC 4YTRA 4WGXA 5HNNA 3BH4A 3AMLA 3G6LA 1NQKA 4C6MA 4DZAA 3QFEA 2BTMA 4AD2A 4O50A 3H2FA 4J3VA 3W02A 3GH4A 2W9MA 2YYUA 3U4FA 1EHNA 2QW5A 4QS5A 1TPWA 1HP5A 3UPBA 3WLJA 4EPKA 1TA3A 4NXKA 1KLZA 4LUSB 5BYWA 1A5MC 5A3HA 2DZPA 3C61A 3LPOA 3LYEA 4ZCWA 2Y7GA 2NQ5A 3AIEA 3LNMA 7A3HA 2OG9A 3B8SA 4PUNA 4Q8NA 4EK7A 1L6YA 2Z27A 1V8EA 1IR2A 1NFGA 2WVUA 3CLWA 4U5KA 3H6OA 1J10A 1SM9A 3CYVA 2QJJA 4MAVA 1VP5A 4L65A 2JBMA 1TWDA 6XIAA 3KW3A 4DWSC 1OX6A 3WH9A 5T8GA 2VEKA 2GFTA 1S5WA 3GKFA 3R0DA 3QOMA 4MJ2A 4IQJA 3CZEA 1VFOA 1V0MA 2DU2A 4HOXA 3G0UA 4HIBA 3SI9A 2BY1A 2ZRXA 1KRMA 2V3FA 3QY8A 1B31A 3H70A 3OGVA 4QTGA 5FF0A 3WF3A 1TB3A 5F2MA 1V3LA 5H2ZA 3CAKA 3NTYA 3NL2A 4OBTA 4PR4A 1DWGM 4NZ4A 1POJA 4M7TA 2ZX8A 1Y7VA 3BG5A 4AYSA 1SUXA 2Q8LA 3U3HA 4JX6A 1UWIA 5A6AA 3USZA 3W7GA 1OC6A 4NHVA 4XVDA 4HU4A 3GXPA 3AISA 5HDRA 4DNMA 4ZTYA 3LBOA 1A5UA 3W22A 5HQEA 2FZ8A 1JZ3A 5FF4A 3AMGA 4IFKA 3KM8A 3MV01 3PTMA 2VEIA 4XZMX 5D8WA 2CLEA 3C4UA 2VC5A 3E2QA 1PZ2A 3ITVA 1XF0A 5BXRA 1JRBA 3EEGA 3OA3A 3CHVA 4MJZA 1DIOA 4FLQA 3KTCA 1JI1A 3UXAA 1NSJA 3A64A 3VNMA 4B2DA 2XN2A 2DJXA 3Q94A 3G6MA 3J7HA 3MP3A 2CLMA 1NIUA 2WMJA 1Z42A 4KEZA 2VRKA 1Q4NX 1O5XA 3KOXA 3LQLA 1WDPA 1XBYA 5CPOA 2C0AA 4PB4A 1H60A 1SR0A 3QN3A 3LHZA 4LUSA 4CD6A 1B57A 1QW9A 3GQYA 4J9JA 4N6FA 1CB7B 1LQ0A 4EKJA 3KLKA 3SRFA 5CPMA 1DKWA 3WLTA 2PRHA 3MBFA 3NQCA 1R3SA 3C2RA 4J40A 3W7NA 4W87A 4J3WA 3CBWA 4CGTA 4PTXA 1XLMA 2G97A 1IE7C 3LN3A 3OZMA 4JTFA 4OV9A 4K7VA 3WYZA 1UZ4A 4JTEA 1XLFA 1ICQA 5JUVA 1SPQA 4BQ3A 1JQXA 3IUIA 1SSDA 5CPLA 3DC8A 2NWSA 3FOKA 2Y7EA 3KCLA 3DXIA 4E6MA 5H1WA 4FR6A 3VNKA 4A3HA 3GTHA 2XVKA 3VOGA 3S1VA 1JI2A 3TYBA 3VNJA 1UBSA 2QCFA 5DMMA 3EB4A 1N8IA 2UY4A 3WNNA 4JDBA 4EPBC 3MT1A 1O60A 4RKAA 4LANA 3WQDA 3B04A 3NNTA 4JIEA 3QKEA 2Y5SA 5H91A 3WO8A 4Q7NA 1V3KA 1TPVA 3TH6A 1OEPA 2GUYA 4O52A 4ZOCA 1IT0A 1IYXA 4NZFA 4OTKA 1DHPA 1KNWA 4LYKA 1QXLA 1EP3A 2YOCA 4O0ZA 1SFTA 1E6PA 2E6YA 1M7JA 2FZDA 1GOXA 1HVQA 1LM1A 3UY8A 1H1YA 4XX6A 1GNXA 2BZNA 3WENA 6XIMA 3FAXA 1RXOB 4R7WA 4DO6A 1W9DM 4C6BA 1QVBA 1ZJAA 2D0GA 4FOKA 3P67A 5U4NA 3L4ZA 4XD6A 5LA1A 3T2QA 5G2IA 3G0XA 4Z2GA 3B06A 3M0VA 3VCRA 1A3WA 3WG6A 3DHFA 2PWEA 3WUEA 3VOHA 3QPYA 2VUYA 4Q8MA 2GJRA 1B3WA 5CH9A 3JUGA 4LVAA 5CGMA 3G8RA 1H3GA 4BR1A 5HJYA 3WNLA 4PC8A 3AFBA 1ONWA 2R8WA 2JE8A 3IIOA 3MQTA 2WHMA 1XLGA 5AYIA 3F7JA 4C6JA 1DWAM 4LYQA 3T42A 3W71A 2C79A 4V1YA 2EJAA 2EPMX 2R24A 3ENLA 1YXYA 2BGSA 2H3BA 3CQKA 1W1YA 4L9ZA 3W83A 1YNQA 4PMZA 1J96A 4XAFA 1MZRA 1WB0A 1GUVA 2OT0A 3PFRA 5FL0A 2CXEA 2V82A 3A4AA 3IK2A 4HYWA 2HS6A 2YCLA 2CHRA 4CNNA 1C90A 3DYOA 2QF7A 5ABEA 3H7RA 3NSMA 2PGRA 1GVEA 1MQPA 2XM1A 1OC5A 5FIPA 3CIVA 2A6NA 3ABRA 3RHGA 4DZIA 4H7VA 4HCDA 6ENLA 5TF0A 4GC4A 2PDXA 1BPLB 1US0A 1F3WA 3KXQA 1P5BA 4AVFA 1H0GA 1YXDA 5FD0A 4NZ1A 1ZFJA 5DFAA 4GD0A 2PDHA 1GVSA 4LNYA 3W2MA 3MMWA 4BCEA 1OGGA 3NQ7A 3BV4A 1D2KA 1KXTA 1K8YA 2PUZA 3QQWA 4PUWA 3AIRA 4LS0A 3AUJA 1UG6A 1JGMA 1G1YA 3QY6A 1K6WA 1YXCA 4GINA 3IJQA 1THFD 1H09A 2VZUA 3ZSSA 3NZ1A 3M5VA 2V5JA 5CG7A 5KEZA 4NAEA 3C2EA 1TWSA 5BU9A 3EOUA 5DMNA 5GJNA 3WK2A 4MF4A 3RNDA 3OPSA 1LUCB 1GHRA 5BXTA 2ZRYA 2BGNE 1RVKA 4QIUA 4G7FA 1FUYA 3P62A 3OEXA 3STEA 3UBPC 1GQLA 4A05A 1WDSA 1YHTA 2CBUA 2HNHA 3PN8A 2PCQA 4HPJA 1T99A 3QV6A 4PA8A 1KR1A 1L6GA 3KVJA 1PHQA 3OLIA 1B3XA 1WA3A 4PB5A 4C1NA 1JZ2A 1UJPA 3ME3A 1KGXA 3VTRA 2J74A 1YTDA 3U2CA 1Z69A 3HQPA 2J9YA 1K3UA 3VOIA 3HGOA 5L9FA 3TEVA 3OODA 4IXXA 2F2HA 3TSDA 2HE5A 4MHBA 3QLLA 2FGBA 3P0XA 4LH8A 4UTFA 3TTSA 3IJ8A 4CD8A 4IJRA 2YA0A 1TMHA 1H1NA 3CL7A 4MDOA 2WAGA 4KF1A 4JQ1A 3OVQA 4XBSA 1PKYA 3D46A 4GYJA 4O16A 1BRLB 1H7XA 2FTWA 2Y88A 1Z32X 1P0DA 1DJQA 1PYFA 1RALA 1W17A 1KFKA 3L4YA 1L6SA 4JFUA 4OHQA 3DGRA 1OD8A 4FOUA 1VYRA 4U3CA 4Q32A 3APTA 1TVNA 4H6EA 3KCJA 3WF2A 3O6DA 3GKAA 3WQFA 3GG1A 3GVVA 1NDZA 4TX9A 2VTFA 3GIPA 3S3GA 3A5VA 1YBQA 1E4MM 2DH3A 1Z9AA 3P74A 5L6UA 3G1DA 3QXBA 4C6EA 3T7VA 3TYAA 3O07A 2ZXDA 1UD5A 3WLIA 2OGJA 4K8EA 4QAWA 2WV8A 4ML9A 1EGMA 4Z1BA 3LA4A 4LCSA 3LCIA 3SIZA 1OT1A 5FJTA 4RUBA 4X2RA 3NURA 5FA5A 1VRXA 3OB8A 3R11A 3GBEA 4FHAA 3MSRA 1KGWA 2GVJA 1OFAA 1WKFA 1SR9A 5D2TA 3AXXA 1WOBA 1B9ZA 4RPPA 1IIHA 3BJFA 7PTDA 2R94A 1FKWA 2VX4A 3EB3A 4UFHA 3CAVA 4N4PA 3W0KA 1EFZA 3GVQA 2A3CA 4P7NA 4MLRA 3RN6A 2X09A 3L4WA 1BYBA 1R30A 4PUUA 1G94A 2WCAA 2GUUA 1DBTA 5EFFA 4IMGA 2PGEA 3NOEA 2GUBA 1EA9C 4NZJA 4MB3A 1J0KA 1PKLA 2C15A 3R12A 4PTDA 1HO1A 1DJHA 1S1RA 5SWUA 1EZ2A 2A3AA 1KM2A 4ZMGA 4QJ3B 1IR1A 5TIMA 3THCA 4LVGA 1XQLA 3SUTA 3MKKA 3S42A 4KT2A 1JPKA 1GZGA 1ZP3A 3OVPA 4I90A 2XDFA 3MSYA 3OIXA 4N9BA 3CTLA 5A6MA 5DY2A 4FALA 3EMZA 2YR1A 3GR8A 4NKCA 3V3WA 4Q4SA 2Q3OA 3HPAA 4MKNA 2GYIA 2X7VA 1OD0A 1DXFA 1X6NA 5CBJA 3D47A 3PAJA 2EGZA 4LCQA 4LAZA 3TW6A 1BYAA 3O7UA 2A3LA 4ES4A 1SSGA 1JCTA 1SQ7A 1B1YA 1XINA 2GJXB 4MLJA 4QLJA 5LIUX 4LRTA 1ISXA 4FNQA 2BGQA 3REQA 3STCA 3BCJA 3DN5A 4HTBA 1W3JA 2PU1A 3GXDA 4BF9A 3G77A 1B2YA 4FLSA 1GYLA 3CQ0A 3RX4A 3K46A 2PDNA 3TV8A 2GK1B 4DPPA 4DI9A 2GGIA 3QM3A 4C90A 2VJXA 1FFQA 5CZSA 4HPXA 2WPGA 1C8VA 3FIGA 2QDEA 3WF4A 4KFNA 3LGDA 1VJZA 4IT1A 2E8YA 1XV8A 1GVYA 5FJOA 2IMRA 1QOPA 1TQJA 5DELA 1XLAA 2P3EA 2ZICA 3C56A 4XTIA 3FEQA 2ZKMX 3TSBA 5CG0A 1VD6A 2OB3A 1S5TA 3BCDA 3WCZA 2V3GA 3ALFA 4HNCA 4KFPA 4HHPA 2VFGA 3TQVA 5LHFA 4TMBA 4NYUA 4BQ5A 1R8LA 1YADA 3PTQA 2ACSA 1CB2A 3M16A 3QLDA 4B5WA 3TYUA 3KS6A 1LT8A 2DVTA 5I03A 1F2JA 1HKIA 3PVFA 3AMDA 4HZ6A 3CUFA 4XKMA 1B4KA 3BLPX 1H2JA 1FHLA 4Z2KA 3A22A 3KBNA 3IIXA 2W79A 1CLKA 1UIOA 2BY3A 4C6OA 1V0LA 1LL7A 3TW9A 1YE4A 5D30A 1W9VA 3WJWA 4LRSA 5I78A 4TIMA 3OOQA 4NJIA 3WLHA 4IL2A 1WX0A 1HKVA 1ZHAA 4Q8OA 3O16A 3W7DA 4L1GA 3WSUA 4GUHA 3UZYA 3RLGA 3TN6A 4ZENA 4E4UA 3SCNA 3E2RA 2DT3A 4IIBA 3G0SA 4K39A 4AH7A 4H7ZA 3T40A 1UZHA 2P5NA 3TWAA 1B9BA 4XWUA 4FLRA 5LKYA 4GGHA 1B3ZA 1XLDA 5XINA 3QR1A 1JDDA 4LJ3A 3GZAA 2ZZ6A 1O95A 4R7JA 1P7TB 1VCVA 3LNPA 1FWHC 1OYCA 4B5UA 4NP7A 1PIFA 3HV8A 3UVIA 3KBWA 3MHFA 4IM4A 3UWUA 2X0HA 4XSMA 5DN1A 1JZ4A 1MEHA 4JBRA 4LEFA 2HPIA 1LJYA 1PO9A 4HP5A 4LY8A 2UZ9A 5KTLA 3WJZA 4PH6A 4GY0A 4GISA 1RD6A 4LVFA 5KETA 1RJRA 4V28A 1VCFA 1QPOA 3VDHA 3G1YA 2PDLA 1R2RA 1RP8A 3EKLA 1OK6A 2PS2A 3PZTA 5IRPA 1Y5WA 1E3ZA 1EDGA 3LHWA 3SR7A 5AYXA 3SDOA 3PZQA 4AFYA 4NAFB 1IZKA 3NDOA 3AS2A 1KQYA 4MGGA 5EPDA 4H04A 5REQB 4OZOA 1Q6FA 3IEBA 2O9OA 2O0TA 1FWGC 2Y24A 3ISIX 4MWAE 2NUWA 5A2BA 2BDQA 3W6YA 3P7YA 3NGFA 5K7JA 2XIIA 1EUAA 2JK2A 1U1JA 4JD4A 3NL6A 3BW3A 3ORWA 2IQ0A 3EWUA 3LHVA 1LORA 4NXSA 4JFVA 4BS0A 3CNYA 4UNIA 2CZVA 3O06A 1T8QA 4G9PA 3ANYA 2PLMA 4IQEA 1VEMA 3QMSA 4J35A 1OF6A 1OX4B 3NEHA 4JYEA 1HW6A 5HA7A 4W7VA 1FKXA 4XTDA 5HWNA 5A6LA 1F74A 4EF8A 5BZAA 5HMEA 4Z1CA 4KCVA 2CKSA 5A5WA 3L4XA 4ASTA 4XAGA 1EO5A 1JAKA 3GTFA 3LPFA 2Z26A 4F0HA 4WF7A 2A7RA 5GNZA 4HMNA 4Q8TA 1N8WA 4K38A 3TJ4A 2TRSA 5D9OA 3NQ6A 2PF0A 3PTKA 2ONEA 2WMIA 4GLEA 2XVLA 1KCZA 1MUMA 4Q6JA 2W62A 3LLDA 1UQZA 3A3WA 2VL4A 2XGIA 1VH7A 1FP9A 1XM3A 1OFRA 2A85A 1XW8A 1FCUA 1NWTA 3SW6A 3MWCA 4AC7C 1PBGA 3LB0A 2DW6A 3FFSA 5AC6A 4H01A 4PFHA 1EJ7L 1JDEA 4YTTA 4QS6A 1Z89A 3M41A 4ATWA 3EWXA 1KBJA 2MANA 4AMAA 2WZEA 3MC5A 2WMKA 4PMNA 3SCUA 4JHZA 4WXZA 3L67A 5F2GA 1TJ0A 4MFEA 1Q6LA 1AUSL 1H63A 4FX7A 2BASA 2ZOXA 1YLVA 2JKPA 1XRFA 2Q09A 1NF0A 4WX2A 3ANUA 1FH8A 3FXYA 2FDMA 3URAA 2PWUA 3VDGA 1OJXA 2FZ9A 5C55A 4J1OA 2ZA2A 2ZWYA 1JGIA 1GOWA 2XU2A 4AQLA 1E4LA