4MZBA

Crystal strucutre of grx1 from plasmodium falciparum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
b'EAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMANIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution crystal structure of glutaredoxin 1 from Plasmodium falciparum and comparison with other glutaredoxins.
pubmed doi rcsb
molecule keywords Glutaredoxin
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 34
structure length 106
sequence length 106
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4mzbA00
1RK4A 2HFDA 1Z7PA 2BJXA 3D6IA 1X5EA 3M9JA 1A2JA 3IDVA 3HXSA 2AAWA 3FZ9A 5F07A 2PERA 1GTUA 3VPTA 4ZL8A 2NBSA 3CTFA 3F0IA 1B4QA 2N5FA 3I9V2 4N11A 2ZUPA 3LQ7A 2X64A 1SU9A 4I97A 1JZDA 3W8SA 4HUAA 5GSSA 1ACVA 3BD2A 1X5DA 2VCXA 2F9SA 2IJYA 4IELA 2YZUA 22GSA 1K0BA 5CRHA 2LRTA 4YQVA 3M3MA 1F3AA 1XCCA 2YOIA 4K0GA 3GYKA 2VOCA 2PUKC 5D96A 5G30A 4TKYA 4PUAA 3KH7A 1DBYA 3RHBA 1TI3A 2YP6A 2LJAA 4POLA 1M7TA 3HVVA 2XPEA 1A23A 5ELAA 1OE8A 3FEUA 4O5RA 2HLSA 1WP0A 1SENA 5KN1A 3WGXA 1M2AA 1SL1B 2GLRA 4TXOB 2A2RA 5A5KA 5A4VA 3IPZA 5B8AA 3P7XA 3FZ4A 2K6VA 3HVXA 4GSNA 4MABA 4GXZA 1AQVA 3KXOA 1O8WA 2WDUA 3KZQA 4ECJA 3C71A 2KUCA 4NAXA 1A8YA 3UOMA 2L5OA 2O8VB 3ME8A 2DMMA 4ZL9A 3ZYWA 2H72A 5J4UA 3CMIA 4ULXA 2R37A 3ZMLA 2VCQA 3DGQA 3LFLA 2X8CA 2R2JA 2DJ3A 4QL7A 2LJRA 2C80A 2HSHA 1I5GA 4MLYA 3R2QA 1M2BA 3GRXA 3IOSA 1TK8B 1XBSA 3UEMA 1ZOFA 4L5OA 2F8AA 1TJDA 1O6JA 4POKA 5IMDA 1MDIA 1TRUA 4NMUA 2V6KA 1F9MA 2A4VA 1BQ7A 2BMXA 3D0ZA 1PKWA 3BJ5A 1K0CA 1UA5A 3HHVA 1YQ1A 4WBRD 1TRSA 1U3IA 2E2GA 2B5XA 1PN9A 4DEJA 5ID2A 5ECIB 1C72A 2ALBA 4TOPA 4F9ZA 1OKDA 5CAXA 2H66A 5C00A 3EE2A 2GGTA 3KTLA 5COHA 4IQAA 4WKWA 4G2EA 5CO3A 4IVFA 4KB3A 4YAVA 2DJKA 4K6XA 1X9MB 1EGOA 4EVMA 5JWOB 1V40A 3IK7A 4BPYA 3M9KA 7GSSA 2M72A 2V2GA 3F6DA 3VFIA 5D9TA 2HRNA 3M0FA 5DCGA 2IMEA 2MBTA 3ZFLA 3IHQA 2EIRA 3GSSA 4NWYA 1HD2A 3BCKA 1XPVA 3PINA 2H01A 4H86A 2LV3A 3ZIVA 4TVEA 1GLQA 2Z9SA 3H79A 3U5RE 3K8NA 3MSZA 2WZ9A 2ZNMA 2OBKA 4HU9A 2VIMA 5B6NA 4GF0A 4OWYA 4CHSA 1O7UA 4J56E 3GX0A 2PU9C 2JSYA 3D21A 5C04A 3L9SA 4WETA 2MZCA 4GQFA 5IM9A 3KH9A 5G2ZA 5E59A 2IMDA 2GSSA 1QQ2A 2WB9A 1OC8A 5F8BA 5DQSA 1SK2A 3LYKA 2X8GA 3HVSA 3HY2A 4HJMA 2L4CA 2PVOC 4YAPA 2RM5A 1WJKA 4MDCA 5G5EA 2DIYA 1X5CA 3KM6A 1ST9A 1T1VA 5CREA 1F37A 4ZBAA 4X0XA 4FO5A 3Q19A 2VLVA 5CP1A 3O76A 5AN1A 4ECIA 3EVIA 5ECPB 1JLVA 4KDUA 3PGTA 3TCOA 4I2TA 2K8VA 3LXZA 1ZYEA 1MD3A 2GS3A 2OKAA 2F51A 3DYRA 5J5NA 1TRWA 3L9VA 3RBTA 4RQXA 2H1AA 3FZ5A 3P2AA 3ZTLA 3ME7A 2B5EA 1EV4A 2CA8A 2C0FA 1K0AA 1IYIA 2YN1A 2YV9A 5FWGA 1PMTA 2REMA 4HS1A 5D9VA 2FWEA 4IP6A 4ML1A 2E2MA 1XZOA 2L6DA 2OBIA 3QMXA 3LSZA 2M80A 3QFAC 5ECMB 1F6MC 3TKQA 3EWLA 2DMLA 1PD21 2IFQA 3QPMA 2LSTA 4ML6A 3HJPA 2IMIA 2C0DA 1YZXA 4L0WA 1GSDA 4AJ6A 5D9WA 3DXBA 1QFNA 3Q18A 2MMZA 5D73A 1PA3A 4N0ZA 3GURA 2CZ2A 3TOUA 3UMAA 1TTZA 1S3AA 4MH2A 3DWVA 4KA0A 3TUEA 1ZGNA 4X1UA 2MYGA 2LJKA 1K3OA 3V1WA 2YCDA 2FCHA 4Q5NA 5GSTA 4NV2A 3NOFA 3FW2A 2NVLA 5G1KA 2EC4A 2FWGA 2OE3A 3ZREA 1Y6EA 5D93A 5JCUA 1FHEA 5D9XA 3GTUB 2EIQA 1THOA 3WT2A 1TK5B 2CX3A 1MEKA 4PURA 4X43A 1XFLA 4PNFA 4LL1B 3HJOA 1YEPA 1M9AA 4IJIA 2LQQA 1U88A 4OO5A 1YDKA 1SD8A 2PMTA 4JRRA 1DE2A 1GP1A 3LG6A 2FY6A 1ILOA 4MJEA 4QQ7A 2AV4A 2GDRA 2RUFA 4FYCA 2OADA 5ECKB 1JZWA 2L5LA 3M1GA 2CZ3A 1KBNA 2FLSA 3JCML 2VD0A 4JR4A 2H6YA 1YF1A 1EOGA 3C7MA 4Q5QA 3PH9A 4O32A 4NV5A 3EMXA 4TRXA 1E2YA 1TDIA 3TRXA 1J0FA 3IXRA 1AIUA 3GKKA 4MF6A 1WE0A 1SJZA 4L5LA 4IHUA 3GMFA 4IKHA 3WD6A 2H0HA 5HR3A 1W4VA 3HCZA 1GRXA 4XHMA 4O7HA 1V58A 2ON7A 1K3LA 5IMAA 2IMFA 2N5BA 1X0RA 3L9UA 1KTEA 3L78A 3A5WA 20GSA 5LCZA 1Q98A 3QR6A 3C8EA 2B7JA 1DE1A 5JCWA 4F03A 1K0DA 4POMA 2JZRA 3DIEA 4DSQA 4TR0A 4KCAA 2VUPA 4V2MA 1G7EA 2VD1A 4ZB9A 4EO3A 5B6MA 1S3CA 17GSA 2HNLA 5AIVA 2L57A 1FVJA 3DMLA 14GSA 2JZSA 5DJLA 1FVKA 1XOAA 4LLRA 5HQPA 2GQLA 3TKPA 3TKRA 3EURA 5DAKA 2N5AA 2C3TA 2YNXA 4FYBA 4IP1A 4OO4A 1VF3A 4XTSA 2CVKA 4FH8A 3H1NA 1PSQA 4RI6A 1BJXA 6GSVA 4EDYA 2WGRA 1X9SB 1QMVA 4HZ2A 4MCUA 1V9WA 1BAYA 1M0UA 4G9HA 2I81A 3FK8A 2RUEA 5IMZA 4N10A 4YQUA 4DSSA 2HXKA 18GSA 1G7OA 1EOHA 2AHEA 2CAQA 3NZNA 3US3A 3FKFA 1Z5YE 1A24A 2CVBA 3MAKA 3CBUA 1FB6A 4N30A 2C1YA 3W6GA 4EXJA 4OCEA 2G0FA 3GKNA 5ABRA 1EGRA 4KGIA 6GSXA 5AIXA 3SBCA 4PQHA 4RI7A 1BYEA 3TJGA 1J08A 1OC9A 4Q5FA 3MDKA 3D4MA 5LD0A 3U6VA 2YWIA 2PBJA 3LXTA 5FT3A 3DD3A 4MF5A 1R4WA 2BTOT 1T7PB 2O7KA 4MZCA 4HEA2 1HNBA 1JZRA 2OACA 3WGEA 2C4JA 4KX4A 5H5RA 1TU8A 1QK8A 2FA8A 4NPBA 5IPHA 2X99A 2E7PA 3CRUA 4IW9A 3G7IA 3S9FA 1SL0B 3J7Yb 3TDGA 5A4WA 5G31A 3ZL5A 5JCGA 2DJ0A 3UJ1A 4TR1A 4ZILA 2GQKA 1JFUA 1AQWA 1SK0A 3KMOA 4YH2A 4IN0A 13GSA 1NHYA 3APSA 3HKRA 5DJMA 3E0UA 3G7JA 2XHFA 1X9WB 1GNWA 5INYA 1EZKA 1EP7A 2GQMA 1ZL9A 2FWFA 1AUCA 2CAIA 2VLUA 4N0VA 4MZBA 5HFKA 1SL2B 8GSSA 2ON5A 1YJ6A 5CNWA 2B7KA 2C0GA 2H75A 3GA4A 1N2AA 5CRWA 2ZCTA 2WULA 1TP9A 5EVOA 3PR8A 2QC7A 4MZWA 3TJFA 3ISOA 1R7HA 1FB0A 1PX6A 4POBA 4KE3A 4GLTA 4MP4A 3ZVJA 12GSA 1YKCA 2VCZA 4GWRA 4F0BA 5J41A 5ID2B 5HFIA 3FYGA 1ERWA 3GKMA 5J9BA 4BL7A 1GUHA 4MH3A 2V1MA 2MMNA 2A2SA 1RW1A 4EDZA 3F4SA 2YWNA 5EL8A 1GSYA 3CXGA 1TOFA 4OCFA 2L4QA 2GZPA 1OE7A 2WRTA 2LNTA 1A8LA 2GT6A 3P8WA 4G19A 3VWVA 3NIVA 3KD0A 4EF0A 1O85A 3G9BA 4GSSA 4K7IA 1Z6MA 4AGSA 4JU5A 2HZFA 5ECLB 3BBYA 2V6OA 4AJ7A 3IA1A 4WXTA 2C8UA 2HSYA 4AJ8A 1K0MA 2CX4A 1HNAA 1A0FA 4ECBA 3A2VA 3MNGA 4BWSA 5D8IA 1B9XC 2V41A 4D73A 3L4NA 5IO0A 2FHEA 3VLNA 3HA9A 4NHWA 2PGTA 2FNOA 2JL4A 4XRAA 3QAVA 4ZIJA 1ZZYA 3GH6A 3TKSA 1YEXA 1NW2A 3APOA 3I69A 4I8BA 2GVPA 3P90A 2GZZA 4HI7A 1PX7A 3VWUA 1A2MA 3C1SA 2VLTA 1ERTA 2PPTA 4KH7A 5HFGA 3GV1A 3F9UA 2M46A 2OE1A 2VCTA 3TJKA 1A2LA 1GNEA 4HJ2A 4G10A 1JHBA 2H8LA 5IMVA 4GTUA 2YV7A 2YANA 2L59A 1V2AA 4OFTA 4HQSA 1DUGA 4ECCA 4F0CA 3TKSC 3DVWA 4EC0A 1ZMAA 5HR2A 1XIYA 3KIJA 1ZYQB 5GAND 1QUWA 3QFBC 2J23A 1U87A 2DJJA 4HU7A 1URMA 3ERGA 5ECSA 1PGTA 4ZB6A 1W89A 4KDXA 4XS6A 4MPGA 4F82A 5JWRB 1YKAA 1XW5A 1GTIA 4ZL7A 2AUVA 1AXDA 4BVXA 5IMFA 1O73A 2LNSA 2GTUA 3ZZXA 5ECOB 5G1LA 1FOVA 2IFQB 3ZITA 3QAWA 4ISDA 2H6XA 5HR1A 1AQXA 4LL4B 2CQ9A 3LJRA 1G6WA 3I6AA 4KCEA 2K18A 4XS4A 3TRPA 5ELGA 4AF2A 1XWBA 4ZBDA 2HZEB 3MWHA 3AY8A 3LGCA 2XC2A 2QSIA 3E9JB 4OD7A 1TXXA 19GSA 2LQOA 1V98A 2QGVA 1FW1A 4ID0A 6GSTA 5H5SA 3QAGA 5B8BA 2FD3A 2PN8A 1NM3A 5GAPD 4MA9A 2HRFA 4IJ3A 3WT1A 5DVBA 3GNJA 4I5QA 2DJ2A 3TKSE 1Z3EA 3EU4A 3IC4A 4TXVA 1GTBA 4IS0A 3A2XA 1Z9HA 1VRSD 2VM1A 1FO5A 1NSWA 1PL1A 4O92A 3UARA 2LTKA 1QXHA 1T4ZA 4YQMA 2H0GA 2H70A 3FR9A 3GIXA 3GKXA 3FZAA 4WEYA 2D2ZA 4FIWA 4MJAA 1R5AA 1TK0B 2H1GA 1OYJA 1BG5A 2AYTA 4PQIA 6GSSA 3UBLA 2NTOA 4V1Ap 4BVYA 2VO4A 4ILFA 1QGVA 4TR4A 1PL2A 1XVWA 2LKUA 2R5GA 3F3RA 1Y25A 2H1DA 3ZLPA 5A4UA 2GZYA 2FWHA 2LS5A 4MJBA 1GH2A 4K1FA 2L6CA 3RHCA 1VF4A 1EEJA 2C3QA 3H93A 2KLXA 2WS2A 3ZIJA 3L0HA 3TGZA 1SJIA 1T4YA 3H4KA 2C0EA 1THXA 4WBJA 2B5YA 3BOAA 4JBBA 2VL2C 3VWWA 4MJCA 2OJLA 1GSFA 2IMKA 3GSTA 1GSSA 4HQZA 2HI7A 5DALB 5J9CA 4CW9A 3QDNA 3FHKA 1VF1A 1B9YC 3Q6OA 4GSTA 2YZHA 1GTAA 2YWOA 5IMCA 1R5PA 1TI1A 4KDYA 3HYPA 3F6FA 1CQHA 3BCIA 4LA1A 3O3TA 2CT6A 2JSZA 4ACSA 1F2EA 3RAZA 6GSWA 3ZFBA 4ZXGA 3EU3A 2DLXA 4TXOA 2LRCA 3EYTA 1EEMA 3IAM2 3EC3A 2G2QA 1AAZA 2NPBA 1UVZA 1LBKA 4FYUA 2E0QA 2H30A 5J3RA 2EIOA 4F2IA 4ZB8A 4XIHA 2AB6A 2DBCA 5KN0A 4ZBBA 3VI7A 2H73A 4EL1A 3LEFA 2OE0A 1EV9A 1FG4A 1WOUA 2DIZA 2DSAA 3F3QA 3TRQA 1F3BA 2CV4A 1Z6NA 3KEBA 3LORA 1XW9A 3TOTA 3UAPA 4PUFC 5ECRB 2VL3A 4E8HA 4GCIA 1EWXA 4JZQA 2VM2A 1B48A 3D4TA 2YWMA 4GRFA 2H1BA 3W8JA 1XWKA 1T3BA 2HYXA 2RLIA 4E8EA 3KTBA 5DAKB 3CTGA 2IIYA 2O89A 1ERVA 4WF5A 5CRGA 5KEJA 4XCSA 1HNCA 1K0OA 5IO2A 4OFNA 3H8QA 2P31A 1M9BA 3IBHA 5F06A 3G7YA 3GFKA 2LRNA 5CRDA 3KMNA 1XWGA 1XWAA 5F05A 2B1LA 4JR6A 2FA4A 2MMOA 3QD9A 3ERFA 1SD9A 4DSSB 4KW6A 3TJJA 4QL9A 2JZTA 3UL3A 3GH9A 1XVQA 3IRAA 3ERWA 1GUMA 3O6TA 1NHOA 2H19A 3GHAA 5IOWA 3IV4A 1VGLA 1U6TA 1T00A 4EUYA 5EPFA 2WFCA 2GT5A 1GL8A 2LEGA 1OC9B 1CQGA 1YF0A 3RPPA 3CRTA 2IWTA 3N5OA 4K0NA 4OMVA 1WMJA 1OKTA 1K3YA 2H71A 4BA7A 9GSSA 1GSUA 2R3XA 2O85A 3IAS2 2I9HA 2B3SA 3D22A 3Q74A 4MK3A 1T8EB 11GSA 4KUNA 2WJUA 4JEDA 1WRYA 2I1UA 3FY7A 2XPDA 3TJBA 4K8MA 3IK9A 4IQ1A 1XXUA 2XBQA 5ECQB 4XRDA 3A3TA 4V1Ag 4TR1B 1MD4A 2DJ1A 4KSOA 5AISA 3C1RA 1PRXA 3CYNA 1O8XA 1USBA 4K7NA 1FAAA 2YJHA 2RM6A 4Z7XA 1O81A 1SKSB 4KNDA 5JWQB 1KEBA 3HZ4A 2NDOA 2QKEA 1Q4JA 1LJRA 1ZCPA 2JU5A 1E6BA 2B6MA 4JE1A 3UIWA 4LMWA 3HD5A 1HYUA 1GULA 4DSRA 2WCIA 4WR4A 5F0GA 2KP2A 1G0TA 4J2FA 1UC7A 1BX9A 4J57E 1AW9A 5DDLA 1GSEA 6GSUA 2PVQA 1A0RP 3RDWA 2I4AA 1IYHA 3GX8A 3GUSA 4HDEA 4P3YB 1H75A 3KP8A 2GSRA 3N9JA 1TU7A 2K8SA 1H4OA 3VK9A 3KGKA 1WPIA 5GZZB 1Z7RA 4HZ4A 1GUKA 3TB2A 1S3DA 4WF4A 3UBKA 2ES7A 3VPQA 2IL3A 4OFMA 3GN3A 2H6ZA 4I6XA 4NHZA 4K2DA 3J7Yk 1JZOA 3HJMA 2H76A 1MDJA 4PQ1A 4IBPA 4MPFA 3F8UA 2R4VA 1SK1A 5ECHB 1M2DA 2R6KA 2XBIA 2JADA 4DVCA 4XS1A 5LNKe 1SJ6A 4D73B 2RIIA 2F3MA 5DCHA 1B8XA 2LUSA 2VAFA 3HZ8A 1ON4A 3F63A 5DBQA 1VF2A 5KN2A 1KNGA 16GSA 1XWCA 5B7CA 5E4WA 2J9HA 5ENUA 1PQNA 2GSTA 5CYYA 1OC3A 1OVNA 2GSQA 3C73A 1SKRB 1SYRA 2I3YA 2AJQB 4PXOA 4IGJA 3ZRDA 4BWQA 2KHPA 4EE0A 3E3EA 3IE3A 4PNGA 1WIKA 1YY7A 4PGTA 2YJ7A 2B1KA 1XOBA 3FRCA 1ABAA 2VCWA 3KCMA 3GTUA 1EP8A 2VCVA 1TW9A 4V2LA 3WGDA 1AC1A 3F4TA 1HQOA 2H74A 2HT9A 3KJYA 5KN3A 2K9FA 4HOJA 2HZEA 2C3NA 5IQYA 4RQRA 1ML6A 2JACA 5ECNB 3I43A 3CSJA 5L71A 3HDCA 3EMPA 3SWLA 3DKSA 3VI5A 3D5JA 3LYPA 2CVDA 3VURA 1MDKA 3OR5A 2TRXA 2V32A 3DRNA 2P5RA 3RPNA 2KP1A 5G5FA 3F4RA 4TN8A 3M8NA 3CSIA 1ERUA 3QCPA 1G6YA 2TIRA 2H0IA 2VL9A 1TRVA 4L8EA 3A2WA 2FGXA 3GL3A 4CDOA 3ED3A 5IPGA 3IR4A 1GSQA 1GWCA 4LMVA 3DEXA 3ZVJD 1M99A 2FUG2 2P5QA 3KP9A 1XW6A 2X8HA 5IOXA 4K7OA 4EKZA 4GQCA 1R26A 4V2NA 5DQYA 4Q5RA 2DC5A 4KAEA 4PX1A 4TW5A 2VL2A 4TR3A 5IIZA 1TKDB 1RQMA 4XS4B 3CSHA 1LU4A 3GL5A 5AGYA 3UVHA 5FHIA 3WYWA 5EY6A 2HE3A 4L0UA 2MBSA 1U3AA 1K0NA 3VWXA 1JLWA 1MTCA 10GSA 2YPMA 2OA7A 2P0GA 1UN2A 5DALA 1BEDA 4MF7A 2KOKA 2O87A 3QOUA 1SYXA 1OAZA 4I2UA 1SKWB 1PKZA 2F8FA 3DVXA 1N8JA 3LWAA 1GLPA 3ZMKA 4KSMA 1DSBA 3EINA 1V57A 3APQA 4RUVA 2IN3A 3FR6A 1WWJA 2IPAA 4NXIA 3FR3A 1I9DA 3UVTA 2TRCP 6GSYA 4K9ZA 1B4PA 4MMMA 5HR0A 5H5QA 2MMAA 4WR5A 1J9BA 2PWJA
chains in the Genus database with same CATH superfamily
1RK4A 2HFDA 1Z7PA 2BJXA 3D6IA 1X5EA 3M9JA 1A2JA 3IDVA 3HXSA 2AAWA 3FZ9A 5F07A 2PERA 1GTUA 3VPTA 4ZL8A 2NBSA 3CTFA 3F0IA 1B4QA 2N5FA 3I9V2 4N11A 2ZUPA 3LQ7A 2X64A 1SU9A 4I97A 1JZDA 3W8SA 4HUAA 5GSSA 1ACVA 3BD2A 1X5DA 2VCXA 2F9SA 2IJYA 3IC8A 4IELA 2YZUA 22GSA 1K0BA 5CRHA 2LRTA 4YQVA 3M3MA 1F3AA 1XCCA 2YOIA 4K0GA 3GYKA 2VOCA 2PUKC 5D96A 5G30A 4TKYA 4PUAA 3KH7A 1DBYA 3RHBA 1TI3A 2YP6A 2LJAA 4POLA 1M7TA 3HVVA 2XPEA 1A23A 5ELAA 1OE8A 3FEUA 4O5RA 2HLSA 1WP0A 1SENA 5KN1A 4O5UA 3WGXA 1M2AA 1SL1B 2GLRA 4TXOB 2A2RA 5A5KA 5A4VA 3IPZA 5B8AA 3P7XA 3FZ4A 2K6VA 3HVXA 4GSNA 4MABA 2HRKA 4GXZA 1AQVA 3KXOA 1O8WA 2WDUA 3KZQA 4ECJA 3C71A 2KUCA 4NAXA 1A8YA 3UOMA 2L5OA 2O8VB 3ME8A 2DMMA 4ZL9A 3ZYWA 2H72A 5J4UA 3CMIA 4ULXA 2R37A 3ZMLA 2VCQA 3DGQA 3LFLA 2X8CA 2R2JA 2DJ3A 4QL7A 2LJRA 2C80A 2HSHA 1I5GA 4MLYA 3R2QA 1M2BA 3GRXA 3IOSA 1TK8B 1XBSA 3UEMA 1ZOFA 4L5OA 2F8AA 1TJDA 2X49A 1O6JA 4POKA 5IMDA 1MDIA 1TRUA 4NMUA 2V6KA 1F9MA 2A4VA 2QA2A 1BQ7A 2BMXA 3D0ZA 1PKWA 3BJ5A 1K0CA 1UA5A 3HHVA 1YQ1A 4WBRD 1TRSA 1U3IA 2E2GA 2B5XA 1PN9A 4DEJA 5ID2A 5ECIB 1C72A 1PN0A 2ALBA 4TOPA 4F9ZA 1OKDA 5CAXA 2H66A 5C00A 3EE2A 2GGTA 3KTLA 5COHA 4IQAA 4WKWA 4G2EA 5CO3A 4IVFA 4KB3A 4YAVA 2DJKA 4K6XA 1X9MB 1EGOA 4EVMA 5JWOB 1V40A 3IK7A 4BPYA 3M9KA 7GSSA 2M72A 2V2GA 3F6DA 3VFIA 5D9TA 2HRNA 3M0FA 5DCGA 2IMEA 2MBTA 3ZFLA 3IHQA 2EIRA 3GSSA 4NWYA 1HD2A 3BCKA 1XPVA 3PINA 2H01A 4H86A 2LV3A 3ZIVA 4TVEA 1GLQA 2Z9SA 3H79A 3U5RE 3K8NA 3MSZA 2WZ9A 2ZNMA 2OBKA 4HU9A 2VIMA 5B6NA 4GF0A 4OWYA 4CHSA 1O7UA 4J56E 3GX0A 2PU9C 2JSYA 3D21A 5C04A 3L9SA 4WETA 2MZCA 4GQFA 5IM9A 3KH9A 5G2ZA 5E59A 2IMDA 2GSSA 1QQ2A 2WB9A 1OC8A 5F8BA 5DQSA 1SK2A 3LYKA 2X8GA 3HVSA 3HY2A 4HJMA 2L4CA 2PVOC 4YAPA 2RM5A 1WJKA 4MDCA 4G0LA 5G5EA 3MIXA 2DIYA 1X5CA 3KM6A 1ST9A 1T1VA 5CREA 1F37A 4ZBAA 4X0XA 4FO5A 3Q19A 2VLVA 5CP1A 3O76A 5AN1A 4ECIA 3EVIA 5ECPB 1JLVA 4KDUA 3PGTA 3TCOA 4I2TA 2K8VA 3LXZA 1ZYEA 1MD3A 2GS3A 2OKAA 2F51A 3DYRA 4Z2RA 5J5NA 4CY8A 1TRWA 3L9VA 3RBTA 4RQXA 2H1AA 3FZ5A 3P2AA 3ZTLA 3ME7A 2B5EA 1EV4A 2CA8A 2C0FA 1K0AA 4O5QA 1IYIA 2YN1A 2YV9A 5FWGA 1PMTA 2REMA 4HS1A 5D9VA 2FWEA 4IP6A 4ML1A 2E2MA 1XZOA 2L6DA 2OBIA 3QMXA 3LSZA 2M80A 3QFAC 5ECMB 1F6MC 3TKQA 3EWLA 2DMLA 1PD21 2IFQA 3QPMA 2LSTA 4ML6A 3HJPA 2IMIA 2C0DA 1YZXA 4L0WA 1GSDA 4AJ6A 5D9WA 3DXBA 1QFNA 3Q18A 2MMZA 5D73A 1PA3A 4N0ZA 3GURA 2CZ2A 3TOUA 3UMAA 1TTZA 1S3AA 4MH2A 3DWVA 4KA0A 3TUEA 1ZGNA 4X1UA 2MYGA 2LJKA 1K3OA 3V1WA 2YCDA 2FCHA 4Q5NA 5GSTA 4NV2A 3NOFA 3FW2A 2NVLA 5G1KA 2EC4A 2FWGA 1FOHA 2OE3A 3ZREA 1Y6EA 2HRAA 5D93A 5JCUA 1FHEA 5D9XA 3GTUB 2X4AA 2EIQA 1THOA 3WT2A 1TK5B 2CX3A 1MEKA 4PURA 4X43A 1XFLA 4PNFA 4LL1B 3HJOA 4BVXB 1YEPA 1M9AA 4IJIA 2LQQA 1U88A 4OO5A 1YDKA 1SD8A 2PMTA 4JRRA 1DE2A 1GP1A 3LG6A 2FY6A 1ILOA 4MJEA 4QQ7A 2AV4A 2GDRA 2RUFA 4FYCA 2OADA 5ECKB 1JZWA 2L5LA 3M1GA 4Z2TA 2CZ3A 1KBNA 2FLSA 3JCML 2VD0A 4JR4A 4HSCX 2H6YA 1YF1A 1EOGA 3C7MA 4Q5QA 3PH9A 4O32A 4NV5A 3EMXA 4TRXA 1E2YA 1TDIA 3TRXA 1J0FA 3IXRA 1AIUA 3GKKA 4MF6A 1WE0A 1SJZA 4L5LA 4EIPA 4IHUA 3GMFA 4IKHA 3WD6A 2H0HA 5HR3A 1W4VA 3HCZA 1GRXA 4XHMA 4O7HA 1V58A 2ON7A 1K3LA 5IMAA 2IMFA 2N5BA 1X0RA 3L9UA 1KTEA 3L78A 3A5WA 20GSA 5LCZA 1Q98A 3QR6A 3C8EA 2B7JA 1DE1A 5JCWA 4F03A 1K0DA 4POMA 2JZRA 3DIEA 4DSQA 4TR0A 4KCAA 2VUPA 4V2MA 1G7EA 2VD1A 4ZB9A 1PFOA 4EO3A 5B6MA 1S3CA 17GSA 2HNLA 5AIVA 2L57A 1FVJA 3DMLA 14GSA 2JZSA 3A5IA 5DJLA 1FVKA 1XOAA 4LLRA 5HQPA 2GQLA 3TKPA 3TKRA 3EURA 5DAKA 2N5AA 2C3TA 2YNXA 4FYBA 4IP1A 4OO4A 1VF3A 4YKGA 4XTSA 2CVKA 4FH8A 3H1NA 1PSQA 4RI6A 1BJXA 6GSVA 4EDYA 2WGRA 1X9SB 1QMVA 4HZ2A 4MCUA 1V9WA 1BAYA 1M0UA 4G9HA 2I81A 3FK8A 2RUEA 5IMZA 4N10A 4YQUA 4DSSA 2HXKA 18GSA 1G7OA 1EOHA 2AHEA 2CAQA 4BIKA 3NZNA 3US3A 3FKFA 1Z5YE 1A24A 2CVBA 3MAKA 3CBUA 1FB6A 4N30A 2C1YA 3W6GA 4EXJA 4OCEA 2G0FA 3GKNA 5ABRA 1EGRA 4KGIA 6GSXA 5AIXA 3SBCA 4PQHA 4RI7A 1BYEA 3TJGA 1J08A 1OC9A 4G0IA 4Q5FA 3MDKA 3D4MA 5LD0A 3U6VA 2YWIA 2PBJA 3LXTA 5FT3A 3DD3A 4MF5A 1R4WA 2BTOT 1T7PB 2O7KA 4MZCA 4HEA2 1HNBA 1JZRA 2OACA 3WGEA 2C4JA 4KX4A 5H5RA 1TU8A 1QK8A 2FA8A 4NPBA 5IPHA 2X99A 2E7PA 3CRUA 4IW9A 3G7IA 3S9FA 1SL0B 3J7Yb 3TDGA 5A4WA 5G31A 3ZL5A 4CY6A 4K2XA 5JCGA 2DJ0A 3UJ1A 4TR1A 4ZILA 2GQKA 1JFUA 1AQWA 1SK0A 3KMOA 4YH2A 4IN0A 13GSA 1NHYA 3APSA 3HKRA 5DJMA 3E0UA 3G7JA 2XHFA 1X9WB 1GNWA 5INYA 1EZKA 1EP7A 2GQMA 1ZL9A 2FWFA 1AUCA 2CAIA 2VLUA 4N0VA 4MZBA 5HFKA 1SL2B 8GSSA 2ON5A 1YJ6A 5CNWA 2B7KA 2C0GA 2H75A 3GA4A 1N2AA 5CRWA 2ZCTA 2WULA 1TP9A 5EVOA 3PR8A 2QC7A 4MZWA 3TJFA 3ISOA 1R7HA 1FB0A 1PX6A 4POBA 4KE3A 4GLTA 4MP4A 3ZVJA 12GSA 1YKCA 2VCZA 4GWRA 4F0BA 5J41A 5ID2B 4MNNA 5HFIA 3FYGA 1ERWA 3GKMA 5J9BA 4BL7A 1GUHA 4MH3A 2V1MA 2MMNA 2A2SA 1RW1A 4EDZA 3F4SA 2YWNA 5EL8A 1GSYA 3CXGA 1TOFA 4OCFA 3IHGA 2L4QA 2GZPA 1OE7A 2WRTA 2LNTA 1A8LA 2GT6A 1M3IA 3P8WA 4G19A 3VWVA 3NIVA 3KD0A 4K5RA 4EF0A 1O85A 3G9BA 4GSSA 4K7IA 1Z6MA 4AGSA 4JU5A 2HZFA 5ECLB 3BBYA 2R0PA 2V6OA 4AJ7A 3IA1A 4WXTA 2C8UA 2HSYA 4AJ8A 1K0MA 2CX4A 1HNAA 1A0FA 4ECBA 3A2VA 3MNGA 4BWSA 5D8IA 1B9XC 2V41A 4D73A 3L4NA 5IO0A 2FHEA 3VLNA 3HA9A 4NHWA 2PGTA 2FNOA 2JL4A 4XRAA 3QAVA 4ZIJA 1ZZYA 3GH6A 3TKSA 1YEXA 1NW2A 3APOA 3I69A 4I8BA 2GVPA 3P90A 2GZZA 4X4JA 4HI7A 1PX7A 3VWUA 1A2MA 3C1SA 2VLTA 1ERTA 2PPTA 4KH7A 5HFGA 3GV1A 3F9UA 2M46A 2OE1A 2VCTA 3TJKA 1A2LA 1GNEA 4HJ2A 4G10A 1JHBA 2H8LA 5IMVA 4GTUA 2YV7A 2YANA 4KF9A 2L59A 1V2AA 4OFTA 4HQSA 1DUGA 4ECCA 4F0CA 3TKSC 3DVWA 4EC0A 1ZMAA 5HR2A 1XIYA 3KIJA 1ZYQB 5GAND 1QUWA 3QFBC 2J23A 1U87A 2DJJA 4HU7A 1URMA 3ERGA 5ECSA 1PGTA 4ZB6A 1W89A 4KDXA 3CQFA 4XS6A 4MPGA 4F82A 5JWRB 1YKAA 1XW5A 1GTIA 4ZL7A 2DKHA 2AUVA 1AXDA 4BVXA 4YKFA 5KOXA 5IMFA 1O73A 2LNSA 2GTUA 3ZZXA 5ECOB 5G1LA 1FOVA 2IFQB 3ZITA 3QAWA 4ISDA 2H6XA 5HR1A 1AQXA 4LL4B 2CQ9A 3LJRA 1G6WA 3I6AA 4KCEA 2K18A 4XS4A 3TRPA 5ELGA 4AF2A 1XWBA 4ZBDA 2HZEB 3MWHA 2HSMA 3AY8A 3LGCA 2XC2A 2QSIA 3E9JB 4OD7A 1TXXA 19GSA 2LQOA 1V98A 2QGVA 1FW1A 4ID0A 6GSTA 5H5SA 3QAGA 5B8BA 2FD3A 2PN8A 1NM3A 5GAPD 4MA9A 2HRFA 4IJ3A 3WT1A 5DVBA 3GNJA 4I5QA 2DJ2A 3TKSE 1Z3EA 3EU4A 3IC4A 4TXVA 1GTBA 4IS0A 1ZYPA 3A2XA 1Z9HA 1VRSD 2VM1A 1FO5A 1NSWA 1PL1A 4O92A 4K5SA 3UARA 2LTKA 1QXHA 1T4ZA 4YQMA 2H0GA 2H70A 3FR9A 3GIXA 3GKXA 3FZAA 4WEYA 2D2ZA 4FIWA 4MJAA 1R5AA 1TK0B 2H1GA 1OYJA 1BG5A 2AYTA 3EPTA 4PQIA 6GSSA 3UBLA 2NTOA 4V1Ap 4BVYA 2VO4A 4ILFA 1QGVA 4TR4A 1PL2A 1XVWA 2LKUA 2R5GA 3F3RA 1Y25A 2H1DA 3PPUA 3ZLPA 5A4UA 2GZYA 2FWHA 2LS5A 4MJBA 1GH2A 4K1FA 2L6CA 3RHCA 1VF4A 1EEJA 2C3QA 3H93A 2KLXA 2WS2A 3ZIJA 3L0HA 3TGZA 1SJIA 1T4YA 3H4KA 2C0EA 1THXA 4WBJA 2B5YA 3BOAA 4JBBA 2VL2C 3VWWA 4MJCA 2A2PA 2OJLA 1GSFA 2IMKA 3GSTA 1GSSA 4HQZA 2HI7A 5DALB 5J9CA 4CW9A 3QDNA 3FHKA 1VF1A 1B9YC 3Q6OA 4GSTA 2YZHA 1GTAA 2YWOA 5IMCA 1R5PA 1TI1A 4KDYA 3HYPA 3F6FA 1CQHA 3BCIA 4LA1A 3O3TA 2CT6A 2JSZA 4ACSA 1F2EA 3RAZA 6GSWA 3ZFBA 4ZXGA 3EU3A 2DLXA 4TXOA 2LRCA 3EYTA 1EEMA 3IAM2 3EC3A 2G2QA 1AAZA 2NPBA 1UVZA 1LBKA 4FYUA 2E0QA 2H30A 5J3RA 2EIOA 4F2IA 4ZB8A 4XIHA 2AB6A 2DBCA 5KN0A 4ZBBA 3VI7A 2H73A 4FQUA 4EL1A 3LEFA 2OE0A 1EV9A 1FG4A 1WOUA 2DIZA 2DSAA 3F3QA 4ICYA 3TRQA 1F3BA 2CV4A 1Z6NA 3KEBA 3LORA 1XW9A 3TOTA 3UAPA 4PUFC 5ECRB 2VL3A 4E8HA 4GCIA 1EWXA 1XG8A 4JZQA 2VM2A 1B48A 3D4TA 2YWMA 4GRFA 2H1BA 3W8JA 1XWKA 1T3BA 2HYXA 2RLIA 4E8EA 3KTBA 5DAKB 3CTGA 2IIYA 2O89A 1ERVA 4WF5A 5CRGA 5KEJA 4XCSA 1HNCA 1K0OA 5IO2A 4OFNA 3H8QA 2P31A 1M9BA 3IBHA 5F06A 3G7YA 3GFKA 2LRNA 5CRDA 3KMNA 1XWGA 1XWAA 5F05A 2B1LA 4JR6A 2FA4A 2MMOA 2QA1A 3QD9A 5BMUA 3ERFA 1SD9A 4DSSB 4KW6A 3TJJA 4QL9A 2JZTA 3UL3A 3GH9A 1XVQA 3IRAA 3ERWA 1GUMA 3O6TA 1NHOA 2H19A 3GHAA 5IOWA 3IV4A 1VGLA 1U6TA 1T00A 4EUYA 5EPFA 2WFCA 2GT5A 1GL8A 2LEGA 1OC9B 1CQGA 1YF0A 3RPPA 3CRTA 2IWTA 3N5OA 4K0NA 4OMVA 1WMJA 1OKTA 1K3YA 2H71A 4BA7A 9GSSA 1GSUA 2R3XA 2O85A 3IAS2 2I9HA 2B3SA 3D22A 3Q74A 4MK3A 1T8EB 11GSA 2DKIA 4KUNA 2WJUA 4JEDA 1WRYA 2I1UA 3FY7A 2XPDA 3TJBA 4K8MA 3IK9A 4IQ1A 1XXUA 2XBQA 5ECQB 4XRDA 3A3TA 4V1Ag 4TR1B 1MD4A 2DJ1A 4KSOA 5AISA 3C1RA 1PRXA 3CYNA 1O8XA 1USBA 4K7NA 1FAAA 2YJHA 2RM6A 3HVNA 3LW9A 4Z7XA 1O81A 1SKSB 4KNDA 5JWQB 1KEBA 3HZ4A 2NDOA 2QKEA 1Q4JA 1LJRA 1ZCPA 2JU5A 1E6BA 2B6MA 4JE1A 3UIWA 4USSA 4LMWA 3HD5A 1HYUA 1GULA 4DSRA 2WCIA 4WR4A 5F0GA 2KP2A 1G0TA 4J2FA 1UC7A 1BX9A 4J57E 1AW9A 5DDLA 1GSEA 6GSUA 2PVQA 3FMWA 1A0RP 3RDWA 2I4AA 1IYHA 3GX8A 3GUSA 4HDEA 4P3YB 4BL7B 1H75A 3KP8A 2GSRA 3N9JA 1TU7A 2K8SA 1H4OA 3VK9A 3KGKA 1WPIA 5GZZB 1Z7RA 4HZ4A 1GUKA 3TB2A 1S3DA 4WF4A 5BRTA 3UBKA 2ES7A 3VPQA 2IL3A 4OFMA 3GN3A 3MYDA 2H6ZA 4I6XA 4NHZA 4K2DA 3J7Yk 1JZOA 3HJMA 2H76A 1MDJA 4PQ1A 4IBPA 4MPFA 3F8UA 2R4VA 1SK1A 5ECHB 1M2DA 2R6KA 2XBIA 2JADA 4DVCA 1ZYNA 5KOWA 4XS1A 5LNKe 1SJ6A 4D73B 2RIIA 2F3MA 5DCHA 1B8XA 2LUSA 2VAFA 3HZ8A 1ON4A 3F63A 5DBQA 1VF2A 5KN2A 1KNGA 16GSA 1XWCA 5B7CA 5E4WA 2J9HA 5ENUA 1PQNA 1M3JA 2GSTA 2R0GA 5CYYA 1OC3A 1OVNA 2GSQA 3C73A 1SKRB 1SYRA 2I3YA 2AJQB 4PXOA 4IGJA 3ZRDA 4BWQA 2KHPA 4EE0A 3E3EA 3IE3A 4PNGA 1WIKA 1YY7A 4PGTA 2YJ7A 2B1KA 1XOBA 3FRCA 1ABAA 2VCWA 3KCMA 3GTUA 1EP8A 2VCVA 1TW9A 3R3EA 4V2LA 3WGDA 1AC1A 3F4TA 1HQOA 2H74A 2HT9A 3KJYA 5KN3A 2UZ8A 2K9FA 4HOJA 2HZEA 2C3NA 5IQYA 4RQRA 1ML6A 2JACA 5ECNB 3I43A 4Z2UA 3CSJA 5L71A 3HDCA 3EMPA 3SWLA 3DKSA 3VI5A 3D5JA 3LYPA 4G0KA 1S3RA 2CVDA 3VURA 1MDKA 3OR5A 2TRXA 2V32A 3DRNA 2P5RA 3RPNA 2KP1A 5G5FA 3F4RA 4TN8A 3M8NA 3CSIA 1ERUA 3QCPA 1G6YA 2TIRA 2H0IA 2VL9A 1TRVA 4L8EA 3A2WA 2FGXA 3GL3A 4CDOA 3ED3A 5IPGA 3IR4A 1GSQA 1GWCA 4LMVA 3DEXA 3ZVJD 1M99A 2FUG2 2P5QA 3KP9A 1XW6A 2X8HA 5IOXA 4K7OA 4EKZA 4GQCA 1R26A 4V2NA 5DQYA 4Q5RA 2DC5A 4KAEA 4PX1A 4TW5A 2VL2A 4TR3A 5IIZA 1TKDB 1RQMA 4XS4B 3CSHA 1LU4A 3GL5A 5AGYA 3UVHA 5FHIA 3WYWA 5EY6A 2HE3A 4L0UA 2MBSA 1U3AA 1K0NA 3VWXA 1JLWA 1MTCA 10GSA 2YPMA 2OA7A 2P0GA 1UN2A 5DALA 1BEDA 4MF7A 2KOKA 2O87A 3QOUA 1SYXA 2A4HA 1OAZA 4I2UA 1SKWB 1PKZA 2F8FA 3DVXA 1N8JA 3LWAA 1GLPA 2R0CA 3ZMKA 4KSMA 4A5PA 1DSBA 3EINA 1V57A 3APQA 4RUVA 4EIQA 2IN3A 4PTSA 3FR6A 1WWJA 2IPAA 4NXIA 3FR3A 1I9DA 3UVTA 2TRCP 6GSYA 4K9ZA 1B4PA 4MMMA 5HR0A 5H5QA 2MMAA 4WR5A 1J9BA 2PWJA 4BVYB
chains in the Genus database with same CATH topology
1RK4A 2HFDA 1Z7PA 2BJXA 3D6IA 1X5EA 3M9JA 1A2JA 3IDVA 3HXSA 2AAWA 3FZ9A 5F07A 2PERA 1GTUA 3VPTA 4ZL8A 2NBSA 3CTFA 3F0IA 1B4QA 2N5FA 3I9V2 4N11A 2ZUPA 3LQ7A 2X64A 1SU9A 4I97A 1JZDA 3W8SA 4HUAA 5GSSA 1ACVA 3BD2A 1X5DA 2VCXA 2F9SA 2IJYA 3IC8A 4IELA 2YZUA 22GSA 1K0BA 5CRHA 2LRTA 4YQVA 3M3MA 1F3AA 1XCCA 2YOIA 4K0GA 3GYKA 2VOCA 2PUKC 5D96A 5G30A 4TKYA 4PUAA 3KH7A 1DBYA 3RHBA 1TI3A 2YP6A 2LJAA 4POLA 1M7TA 3HVVA 2XPEA 1A23A 5ELAA 1OE8A 3FEUA 4O5RA 2HLSA 1WP0A 1SENA 5KN1A 4O5UA 3WGXA 1M2AA 1SL1B 2GLRA 4TXOB 2A2RA 5A5KA 5A4VA 3IPZA 5B8AA 3P7XA 3FZ4A 2K6VA 3HVXA 4GSNA 4MABA 2HRKA 4GXZA 1AQVA 3KXOA 1O8WA 2WDUA 3KZQA 4ECJA 3C71A 2KUCA 4NAXA 1A8YA 3UOMA 2L5OA 2O8VB 3ME8A 2DMMA 4ZL9A 3ZYWA 2H72A 5J4UA 3CMIA 4ULXA 2R37A 3ZMLA 2VCQA 3DGQA 3LFLA 2X8CA 2R2JA 2DJ3A 4QL7A 2LJRA 2C80A 2HSHA 1I5GA 4MLYA 3R2QA 1M2BA 3GRXA 3IOSA 1TK8B 1XBSA 3UEMA 1ZOFA 4L5OA 2F8AA 1TJDA 2X49A 1O6JA 4POKA 5IMDA 1MDIA 1TRUA 4NMUA 2V6KA 1F9MA 2A4VA 2QA2A 1BQ7A 2BMXA 3D0ZA 1PKWA 3BJ5A 1K0CA 1UA5A 3HHVA 1YQ1A 4WBRD 1TRSA 1U3IA 2E2GA 2B5XA 1PN9A 4DEJA 5ID2A 5ECIB 1C72A 1PN0A 2ALBA 4TOPA 4F9ZA 1OKDA 5CAXA 2H66A 5C00A 3EE2A 2GGTA 3KTLA 5COHA 4IQAA 4WKWA 4G2EA 5CO3A 4IVFA 4KB3A 4YAVA 2DJKA 4K6XA 1X9MB 1EGOA 4EVMA 5JWOB 1V40A 3IK7A 4BPYA 3M9KA 7GSSA 2M72A 2V2GA 3F6DA 3VFIA 5D9TA 2HRNA 3M0FA 5DCGA 2IMEA 2MBTA 3ZFLA 3IHQA 2EIRA 3GSSA 4NWYA 1HD2A 3BCKA 1XPVA 3PINA 2H01A 4H86A 2LV3A 3ZIVA 4TVEA 1GLQA 2Z9SA 3H79A 3U5RE 3K8NA 3MSZA 2WZ9A 2ZNMA 2OBKA 4HU9A 2VIMA 5B6NA 4GF0A 4OWYA 4CHSA 1O7UA 4J56E 3GX0A 2PU9C 2JSYA 3D21A 5C04A 3L9SA 4WETA 2MZCA 4GQFA 5IM9A 3KH9A 5G2ZA 5E59A 2IMDA 2GSSA 1QQ2A 2WB9A 1OC8A 5F8BA 5DQSA 1SK2A 3LYKA 2X8GA 3HVSA 3HY2A 4HJMA 2L4CA 2PVOC 4YAPA 2RM5A 1WJKA 4MDCA 4G0LA 5G5EA 3MIXA 2DIYA 1X5CA 3KM6A 1ST9A 1T1VA 5CREA 1F37A 4ZBAA 4X0XA 4FO5A 3Q19A 2VLVA 5CP1A 3O76A 5AN1A 4ECIA 3EVIA 5ECPB 1JLVA 4KDUA 3PGTA 3TCOA 4I2TA 2K8VA 3LXZA 1ZYEA 1MD3A 2GS3A 2OKAA 2F51A 3DYRA 4Z2RA 5J5NA 4CY8A 1TRWA 3L9VA 3RBTA 4RQXA 2H1AA 3FZ5A 3P2AA 3ZTLA 3ME7A 2B5EA 1EV4A 2CA8A 2C0FA 1K0AA 4O5QA 1IYIA 2YN1A 2YV9A 5FWGA 1PMTA 2REMA 4HS1A 5D9VA 2FWEA 4IP6A 4ML1A 2E2MA 1XZOA 2L6DA 2OBIA 3QMXA 3LSZA 2M80A 3QFAC 5ECMB 1F6MC 3TKQA 3EWLA 2DMLA 1PD21 2IFQA 3QPMA 2LSTA 4ML6A 3HJPA 2IMIA 2C0DA 1YZXA 4L0WA 1GSDA 4AJ6A 5D9WA 3DXBA 1QFNA 3Q18A 2MMZA 5D73A 1PA3A 4N0ZA 3GURA 2CZ2A 3TOUA 3UMAA 1TTZA 1S3AA 4MH2A 3DWVA 4KA0A 3TUEA 1ZGNA 4X1UA 2MYGA 2LJKA 1K3OA 3V1WA 2YCDA 2FCHA 4Q5NA 5GSTA 4NV2A 3NOFA 3FW2A 2NVLA 5G1KA 2EC4A 2FWGA 1FOHA 2OE3A 3ZREA 1Y6EA 2HRAA 5D93A 5JCUA 1FHEA 5D9XA 3GTUB 2X4AA 2EIQA 1THOA 3WT2A 1TK5B 2CX3A 1MEKA 4PURA 4X43A 1XFLA 4PNFA 4LL1B 3HJOA 4BVXB 1YEPA 1M9AA 4IJIA 2LQQA 1U88A 4OO5A 1YDKA 1SD8A 2PMTA 4JRRA 1DE2A 1GP1A 3LG6A 2FY6A 1ILOA 4MJEA 4QQ7A 2AV4A 2GDRA 2RUFA 4FYCA 2OADA 5ECKB 1JZWA 2L5LA 3M1GA 4Z2TA 2CZ3A 1KBNA 2FLSA 3JCML 2VD0A 4JR4A 2H6YA 1YF1A 1EOGA 3C7MA 4Q5QA 3PH9A 4O32A 4NV5A 3EMXA 4TRXA 1E2YA 1TDIA 3TRXA 1J0FA 3IXRA 1AIUA 3GKKA 4MF6A 1WE0A 1SJZA 4L5LA 4EIPA 4IHUA 3GMFA 4IKHA 3WD6A 2H0HA 5HR3A 1W4VA 3HCZA 1GRXA 4XHMA 4O7HA 1V58A 2ON7A 1K3LA 5IMAA 2IMFA 2N5BA 1X0RA 3L9UA 1KTEA 3L78A 3A5WA 20GSA 5LCZA 1Q98A 3QR6A 3C8EA 2B7JA 1DE1A 5JCWA 4F03A 1K0DA 4POMA 2JZRA 3DIEA 4DSQA 4TR0A 4KCAA 2VUPA 4V2MA 1G7EA 2VD1A 4ZB9A 4EO3A 5B6MA 1S3CA 17GSA 2HNLA 5AIVA 2L57A 1FVJA 3DMLA 14GSA 2JZSA 3A5IA 5DJLA 1FVKA 1XOAA 4LLRA 5HQPA 2GQLA 3TKPA 3TKRA 3EURA 5DAKA 2N5AA 2C3TA 2YNXA 4FYBA 4IP1A 4OO4A 1VF3A 4YKGA 4XTSA 2CVKA 4FH8A 3H1NA 1PSQA 4RI6A 1BJXA 6GSVA 4EDYA 2WGRA 1X9SB 1QMVA 4HZ2A 4MCUA 1V9WA 1BAYA 1M0UA 4G9HA 2I81A 3FK8A 2RUEA 5IMZA 4N10A 4YQUA 4DSSA 2HXKA 18GSA 1G7OA 1EOHA 2AHEA 2CAQA 3NZNA 3US3A 3FKFA 1Z5YE 1A24A 2CVBA 3MAKA 3CBUA 1FB6A 4N30A 2C1YA 3W6GA 4EXJA 4OCEA 2G0FA 3GKNA 5ABRA 1EGRA 4KGIA 6GSXA 5AIXA 3SBCA 4PQHA 4RI7A 1BYEA 3TJGA 1J08A 1OC9A 4G0IA 4Q5FA 3MDKA 3D4MA 5LD0A 3U6VA 2YWIA 2PBJA 3LXTA 5FT3A 3DD3A 4MF5A 1R4WA 2BTOT 1T7PB 2O7KA 4MZCA 4HEA2 1HNBA 1JZRA 2OACA 3WGEA 2C4JA 4KX4A 5H5RA 1TU8A 1QK8A 2FA8A 4NPBA 5IPHA 2X99A 2E7PA 3CRUA 4IW9A 3G7IA 3S9FA 1SL0B 3J7Yb 3TDGA 5A4WA 5G31A 3ZL5A 4CY6A 4K2XA 5JCGA 2DJ0A 3UJ1A 4TR1A 4ZILA 2GQKA 1JFUA 1AQWA 1SK0A 3KMOA 4YH2A 4IN0A 13GSA 1NHYA 3APSA 3HKRA 5DJMA 3E0UA 3G7JA 2XHFA 1X9WB 1GNWA 5INYA 1EZKA 1EP7A 2GQMA 1ZL9A 2FWFA 1AUCA 2CAIA 2VLUA 4N0VA 4MZBA 5HFKA 1SL2B 8GSSA 2ON5A 1YJ6A 5CNWA 2B7KA 2C0GA 2H75A 3GA4A 1N2AA 5CRWA 2ZCTA 2WULA 1TP9A 5EVOA 3PR8A 2QC7A 4MZWA 3TJFA 3ISOA 1R7HA 1FB0A 1PX6A 4POBA 4KE3A 4GLTA 4MP4A 3ZVJA 12GSA 1YKCA 2VCZA 4GWRA 4F0BA 5J41A 5ID2B 4MNNA 5HFIA 3FYGA 1ERWA 3GKMA 5J9BA 4BL7A 1GUHA 4MH3A 2V1MA 2MMNA 2A2SA 1RW1A 4EDZA 3F4SA 2YWNA 5EL8A 1GSYA 3CXGA 1TOFA 4OCFA 3IHGA 2L4QA 2GZPA 1OE7A 2WRTA 2LNTA 1A8LA 2GT6A 3P8WA 4G19A 3VWVA 3NIVA 3KD0A 4K5RA 4EF0A 1O85A 3G9BA 4GSSA 4K7IA 1Z6MA 4AGSA 4JU5A 2HZFA 5ECLB 3BBYA 2R0PA 2V6OA 4AJ7A 3IA1A 4WXTA 2C8UA 2HSYA 4AJ8A 1K0MA 2CX4A 1HNAA 1A0FA 4ECBA 3A2VA 3MNGA 4BWSA 5D8IA 1B9XC 2V41A 4D73A 3L4NA 5IO0A 2FHEA 3VLNA 3HA9A 4NHWA 2PGTA 2FNOA 2JL4A 4XRAA 3QAVA 4ZIJA 1ZZYA 3GH6A 3TKSA 1YEXA 1NW2A 3APOA 3I69A 4I8BA 2GVPA 3P90A 2GZZA 4X4JA 4HI7A 1PX7A 3VWUA 1A2MA 3C1SA 2VLTA 1ERTA 2PPTA 4KH7A 5HFGA 3GV1A 3F9UA 2M46A 2OE1A 2VCTA 3TJKA 1A2LA 1GNEA 4HJ2A 4G10A 1JHBA 2H8LA 5IMVA 4GTUA 2YV7A 2YANA 4KF9A 2L59A 1V2AA 4OFTA 4HQSA 1DUGA 4ECCA 4F0CA 3TKSC 3DVWA 4EC0A 1ZMAA 5HR2A 1XIYA 3KIJA 1ZYQB 5GAND 1QUWA 3QFBC 2J23A 1U87A 2DJJA 4HU7A 1URMA 3ERGA 5ECSA 1PGTA 4ZB6A 1W89A 4KDXA 4XS6A 4MPGA 4F82A 5JWRB 1YKAA 1XW5A 1GTIA 4ZL7A 2DKHA 2AUVA 1AXDA 4BVXA 4YKFA 5KOXA 5IMFA 1O73A 2LNSA 2GTUA 3ZZXA 5ECOB 5G1LA 1FOVA 2IFQB 3ZITA 3QAWA 4ISDA 2H6XA 5HR1A 1AQXA 4LL4B 2CQ9A 3LJRA 1G6WA 3I6AA 4KCEA 2K18A 4XS4A 3TRPA 5ELGA 4AF2A 1XWBA 4ZBDA 2HZEB 3MWHA 2HSMA 3AY8A 3LGCA 2XC2A 2QSIA 3E9JB 4OD7A 1TXXA 19GSA 2LQOA 1V98A 2QGVA 1FW1A 4ID0A 6GSTA 5H5SA 3QAGA 5B8BA 2FD3A 2PN8A 1NM3A 5GAPD 4MA9A 2HRFA 4IJ3A 3WT1A 5DVBA 3GNJA 4I5QA 2DJ2A 3TKSE 1Z3EA 3EU4A 3IC4A 4TXVA 1GTBA 4IS0A 1ZYPA 3A2XA 1Z9HA 1VRSD 2VM1A 1FO5A 1NSWA 1PL1A 4O92A 4K5SA 3UARA 2LTKA 1QXHA 1T4ZA 4YQMA 2H0GA 2H70A 3FR9A 3GIXA 3GKXA 3FZAA 4WEYA 2D2ZA 4FIWA 4MJAA 1R5AA 1TK0B 2H1GA 1OYJA 1BG5A 2AYTA 3EPTA 4PQIA 6GSSA 3UBLA 2NTOA 4V1Ap 4BVYA 2VO4A 4ILFA 1QGVA 4TR4A 1PL2A 1XVWA 2LKUA 2R5GA 3F3RA 1Y25A 2H1DA 3PPUA 3ZLPA 5A4UA 2GZYA 2FWHA 2LS5A 4MJBA 1GH2A 4K1FA 2L6CA 3RHCA 1VF4A 1EEJA 2C3QA 3H93A 2KLXA 2WS2A 3ZIJA 3L0HA 3TGZA 1SJIA 1T4YA 3H4KA 2C0EA 1THXA 4WBJA 2B5YA 3BOAA 4JBBA 2VL2C 3VWWA 4MJCA 2A2PA 2OJLA 1GSFA 2IMKA 3GSTA 1GSSA 4HQZA 2HI7A 5DALB 5J9CA 4CW9A 3QDNA 3FHKA 1VF1A 1B9YC 3Q6OA 4GSTA 2YZHA 1GTAA 2YWOA 5IMCA 1R5PA 1TI1A 4KDYA 3HYPA 3F6FA 1CQHA 3BCIA 4LA1A 3O3TA 2CT6A 2JSZA 4ACSA 1F2EA 3RAZA 6GSWA 3ZFBA 4ZXGA 3EU3A 2DLXA 4TXOA 2LRCA 3EYTA 1EEMA 3IAM2 3EC3A 2G2QA 1AAZA 2NPBA 1UVZA 1LBKA 4FYUA 2E0QA 2H30A 5J3RA 2EIOA 4F2IA 4ZB8A 4XIHA 2AB6A 2DBCA 5KN0A 4ZBBA 3VI7A 2H73A 4FQUA 4EL1A 3LEFA 2OE0A 1EV9A 1FG4A 1WOUA 2DIZA 2DSAA 3F3QA 4ICYA 3TRQA 1F3BA 2CV4A 1Z6NA 3KEBA 3LORA 1XW9A 3TOTA 3UAPA 4PUFC 5ECRB 2VL3A 4E8HA 4GCIA 1EWXA 4JZQA 2VM2A 1B48A 3D4TA 2YWMA 4GRFA 2H1BA 3W8JA 1XWKA 1T3BA 2HYXA 2RLIA 4E8EA 3KTBA 5DAKB 3CTGA 2IIYA 2O89A 1ERVA 4WF5A 5CRGA 5KEJA 4XCSA 1HNCA 1K0OA 5IO2A 4OFNA 3H8QA 2P31A 1M9BA 3IBHA 5F06A 3G7YA 3GFKA 2LRNA 5CRDA 3KMNA 1XWGA 1XWAA 5F05A 2B1LA 4JR6A 2FA4A 2MMOA 2QA1A 3QD9A 5BMUA 3ERFA 1SD9A 4DSSB 4KW6A 3TJJA 4QL9A 2JZTA 3UL3A 3GH9A 1XVQA 3IRAA 3ERWA 1GUMA 3O6TA 1NHOA 2H19A 3GHAA 5IOWA 3IV4A 1VGLA 1U6TA 1T00A 4EUYA 5EPFA 2WFCA 2GT5A 1GL8A 2LEGA 1OC9B 1CQGA 1YF0A 3RPPA 3CRTA 2IWTA 3N5OA 4K0NA 4OMVA 1WMJA 1OKTA 1K3YA 2H71A 4BA7A 9GSSA 1GSUA 2R3XA 2O85A 3IAS2 2I9HA 2B3SA 3D22A 3Q74A 4MK3A 1T8EB 11GSA 2DKIA 4KUNA 2WJUA 4JEDA 1WRYA 2I1UA 3FY7A 2XPDA 3TJBA 4K8MA 3IK9A 4IQ1A 1XXUA 2XBQA 5ECQB 4XRDA 3A3TA 4V1Ag 4TR1B 1MD4A 2DJ1A 4KSOA 5AISA 3C1RA 1PRXA 3CYNA 1O8XA 1USBA 4K7NA 1FAAA 2YJHA 2RM6A 3LW9A 4Z7XA 1O81A 1SKSB 4KNDA 5JWQB 1KEBA 3HZ4A 2NDOA 2QKEA 1Q4JA 1LJRA 1ZCPA 2JU5A 1E6BA 2B6MA 4JE1A 3UIWA 4USSA 4LMWA 3HD5A 1HYUA 1GULA 4DSRA 2WCIA 4WR4A 5F0GA 2KP2A 1G0TA 4J2FA 1UC7A 1BX9A 4J57E 1AW9A 5DDLA 1GSEA 6GSUA 2PVQA 3FMWA 1A0RP 3RDWA 2I4AA 1IYHA 3GX8A 3GUSA 4HDEA 4P3YB 4BL7B 1H75A 3KP8A 2GSRA 3N9JA 1TU7A 2K8SA 1H4OA 3VK9A 3KGKA 1WPIA 5GZZB 1Z7RA 4HZ4A 1GUKA 3TB2A 1S3DA 4WF4A 5BRTA 3UBKA 2ES7A 3VPQA 2IL3A 4OFMA 3GN3A 3MYDA 2H6ZA 4I6XA 4NHZA 4K2DA 3J7Yk 1JZOA 3HJMA 2H76A 1MDJA 4PQ1A 4IBPA 4MPFA 3F8UA 2R4VA 1SK1A 5ECHB 1M2DA 2R6KA 2XBIA 2JADA 4DVCA 1ZYNA 5KOWA 4XS1A 5LNKe 1SJ6A 4D73B 2RIIA 2F3MA 5DCHA 1B8XA 2LUSA 2VAFA 3HZ8A 1ON4A 3F63A 5DBQA 1VF2A 5KN2A 1KNGA 16GSA 1XWCA 5B7CA 5E4WA 2J9HA 5ENUA 1PQNA 2GSTA 5CYYA 2R0GA 1OC3A 1OVNA 2GSQA 3C73A 1SKRB 1SYRA 2I3YA 2AJQB 4PXOA 4IGJA 3ZRDA 4BWQA 2KHPA 4EE0A 3E3EA 3IE3A 4PNGA 1WIKA 1YY7A 4PGTA 2YJ7A 2B1KA 1XOBA 3FRCA 1ABAA 2VCWA 3KCMA 3GTUA 1EP8A 2VCVA 1TW9A 3R3EA 4V2LA 3WGDA 1AC1A 3F4TA 1HQOA 2H74A 2HT9A 3KJYA 5KN3A 2UZ8A 2K9FA 4HOJA 2HZEA 2C3NA 5IQYA 4RQRA 1ML6A 2JACA 5ECNB 3I43A 4Z2UA 3CSJA 5L71A 3HDCA 3EMPA 3SWLA 3DKSA 3VI5A 3D5JA 3LYPA 4G0KA 2CVDA 3VURA 1MDKA 3OR5A 2TRXA 2V32A 3DRNA 2P5RA 3RPNA 2KP1A 5G5FA 3F4RA 4TN8A 3M8NA 3CSIA 1ERUA 3QCPA 1G6YA 2TIRA 2H0IA 2VL9A 1TRVA 4L8EA 3A2WA 2FGXA 3GL3A 4CDOA 3ED3A 5IPGA 3IR4A 1GSQA 1GWCA 4LMVA 3DEXA 3ZVJD 1M99A 2FUG2 2P5QA 3KP9A 1XW6A 2X8HA 5IOXA 4K7OA 4EKZA 4GQCA 1R26A 4V2NA 5DQYA 4Q5RA 2DC5A 4KAEA 4PX1A 4TW5A 2VL2A 4TR3A 5IIZA 1TKDB 1RQMA 4XS4B 3CSHA 1LU4A 3GL5A 5AGYA 3UVHA 5FHIA 3WYWA 5EY6A 2HE3A 4L0UA 2MBSA 1U3AA 1K0NA 3VWXA 1JLWA 1MTCA 10GSA 2YPMA 2OA7A 2P0GA 1UN2A 5DALA 1BEDA 4MF7A 2KOKA 2O87A 3QOUA 1SYXA 2A4HA 1OAZA 4I2UA 1SKWB 1PKZA 2F8FA 3DVXA 1N8JA 3LWAA 1GLPA 2R0CA 3ZMKA 4KSMA 4A5PA 1DSBA 3EINA 1V57A 3APQA 4RUVA 4EIQA 2IN3A 4PTSA 3FR6A 1WWJA 2IPAA 4NXIA 3FR3A 1I9DA 3UVTA 2TRCP 6GSYA 4K9ZA 1B4PA 4MMMA 5HR0A 5H5QA 2MMAA 4WR5A 1J9BA 2PWJA 4BVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK4 A;  2HFD A;  1Z7P A;  2BJX A;  3D6I A;  1X5E A;  3M9J A;  1A2J A;  3IDV A;  3HXS A;  2AAW A;  3FZ9 A;  5F07 A;  2PER A;  1GTU A;  3VPT A;  4ZL8 A;  2NBS A;  3CTF A;  3F0I A;  1B4Q A;  2N5F A;  3I9V 2;  4N11 A;  2ZUP A;  3LQ7 A;  2X64 A;  1SU9 A;  4I97 A;  1JZD A;  3W8S A;  4HUA A;  5GSS A;  1ACV A;  3BD2 A;  1X5D A;  2VCX A;  2F9S A;  2IJY A;  4IEL A;  2YZU A;  22GS A;  1K0B A;  5CRH A;  2LRT A;  4YQV A;  3M3M A;  1F3A A;  1XCC A;  2YOI A;  4K0G A;  3GYK A;  2VOC A;  2PUK C;  5D96 A;  5G30 A;  4TKY A;  4PUA A;  3KH7 A;  1DBY A;  3RHB A;  1TI3 A;  2YP6 A;  2LJA A;  4POL A;  1M7T A;  3HVV A;  2XPE A;  1A23 A;  5ELA A;  1OE8 A;  3FEU A;  4O5R A;  2HLS A;  1WP0 A;  1SEN A;  5KN1 A;  3WGX A;  1M2A A;  1SL1 B;  2GLR A;  4TXO B;  2A2R A;  5A5K A;  5A4V A;  3IPZ A;  5B8A A;  3P7X A;  3FZ4 A;  2K6V A;  3HVX A;  4GSN A;  4MAB A;  4GXZ A;  1AQV A;  3KXO A;  1O8W A;  2WDU A;  3KZQ A;  4ECJ A;  3C71 A;  2KUC A;  4NAX A;  1A8Y A;  3UOM A;  2L5O A;  2O8V B;  3ME8 A;  2DMM A;  4ZL9 A;  3ZYW A;  2H72 A;  5J4U A;  3CMI A;  4ULX A;  2R37 A;  3ZML A;  2VCQ A;  3DGQ A;  3LFL A;  2X8C A;  2R2J A;  2DJ3 A;  4QL7 A;  2LJR A;  2C80 A;  2HSH A;  1I5G A;  4MLY A;  3R2Q A;  1M2B A;  3GRX A;  3IOS A;  1TK8 B;  1XBS A;  3UEM A;  1ZOF A;  4L5O A;  2F8A A;  1TJD A;  1O6J A;  4POK A;  5IMD A;  1MDI A;  1TRU A;  4NMU A;  2V6K A;  1F9M A;  2A4V A;  1BQ7 A;  2BMX A;  3D0Z A;  1PKW A;  3BJ5 A;  1K0C A;  1UA5 A;  3HHV A;  1YQ1 A;  4WBR D;  1TRS A;  1U3I A;  2E2G A;  2B5X A;  1PN9 A;  4DEJ A;  5ID2 A;  5ECI B;  1C72 A;  2ALB A;  4TOP A;  4F9Z A;  1OKD A;  5CAX A;  2H66 A;  5C00 A;  3EE2 A;  2GGT A;  3KTL A;  5COH A;  4IQA A;  4WKW A;  4G2E A;  5CO3 A;  4IVF A;  4KB3 A;  4YAV A;  2DJK A;  4K6X A;  1X9M B;  1EGO A;  4EVM A;  5JWO B;  1V40 A;  3IK7 A;  4BPY A;  3M9K A;  7GSS A;  2M72 A;  2V2G A;  3F6D A;  3VFI A;  5D9T A;  2HRN A;  3M0F A;  5DCG A;  2IME A;  2MBT A;  3ZFL A;  3IHQ A;  2EIR A;  3GSS A;  4NWY A;  1HD2 A;  3BCK A;  1XPV A;  3PIN A;  2H01 A;  4H86 A;  2LV3 A;  3ZIV A;  4TVE A;  1GLQ A;  2Z9S A;  3H79 A;  3U5R E;  3K8N A;  3MSZ A;  2WZ9 A;  2ZNM A;  2OBK A;  4HU9 A;  2VIM A;  5B6N A;  4GF0 A;  4OWY A;  4CHS A;  1O7U A;  4J56 E;  3GX0 A;  2PU9 C;  2JSY A;  3D21 A;  5C04 A;  3L9S A;  4WET A;  2MZC A;  4GQF A;  5IM9 A;  3KH9 A;  5G2Z A;  5E59 A;  2IMD A;  2GSS A;  1QQ2 A;  2WB9 A;  1OC8 A;  5F8B A;  5DQS A;  1SK2 A;  3LYK A;  2X8G A;  3HVS A;  3HY2 A;  4HJM A;  2L4C A;  2PVO C;  4YAP A;  2RM5 A;  1WJK A;  4MDC A;  5G5E A;  2DIY A;  1X5C A;  3KM6 A;  1ST9 A;  1T1V A;  5CRE A;  1F37 A;  4ZBA A;  4X0X A;  4FO5 A;  3Q19 A;  2VLV A;  5CP1 A;  3O76 A;  5AN1 A;  4ECI A;  3EVI A;  5ECP B;  1JLV A;  4KDU A;  3PGT A;  3TCO A;  4I2T A;  2K8V A;  3LXZ A;  1ZYE A;  1MD3 A;  2GS3 A;  2OKA A;  2F51 A;  3DYR A;  5J5N A;  1TRW A;  3L9V A;  3RBT A;  4RQX A;  2H1A A;  3FZ5 A;  3P2A A;  3ZTL A;  3ME7 A;  2B5E A;  1EV4 A;  2CA8 A;  2C0F A;  1K0A A;  1IYI A;  2YN1 A;  2YV9 A;  5FWG A;  1PMT A;  2REM A;  4HS1 A;  5D9V A;  2FWE A;  4IP6 A;  4ML1 A;  2E2M A;  1XZO A;  2L6D A;  2OBI A;  3QMX A;  3LSZ A;  2M80 A;  3QFA C;  5ECM B;  1F6M C;  3TKQ A;  3EWL A;  2DML A;  1PD2 1;  2IFQ A;  3QPM A;  2LST A;  4ML6 A;  3HJP A;  2IMI A;  2C0D A;  1YZX A;  4L0W A;  1GSD A;  4AJ6 A;  5D9W A;  3DXB A;  1QFN A;  3Q18 A;  2MMZ A;  5D73 A;  1PA3 A;  4N0Z A;  3GUR A;  2CZ2 A;  3TOU A;  3UMA A;  1TTZ A;  1S3A A;  4MH2 A;  3DWV A;  4KA0 A;  3TUE A;  1ZGN A;  4X1U A;  2MYG A;  2LJK A;  1K3O A;  3V1W A;  2YCD A;  2FCH A;  4Q5N A;  5GST A;  4NV2 A;  3NOF A;  3FW2 A;  2NVL A;  5G1K A;  2EC4 A;  2FWG A;  2OE3 A;  3ZRE A;  1Y6E A;  5D93 A;  5JCU A;  1FHE A;  5D9X A;  3GTU B;  2EIQ A;  1THO A;  3WT2 A;  1TK5 B;  2CX3 A;  1MEK A;  4PUR A;  4X43 A;  1XFL A;  4PNF A;  4LL1 B;  3HJO A;  1YEP A;  1M9A A;  4IJI A;  2LQQ A;  1U88 A;  4OO5 A;  1YDK A;  1SD8 A;  2PMT A;  4JRR A;  1DE2 A;  1GP1 A;  3LG6 A;  2FY6 A;  1ILO A;  4MJE A;  4QQ7 A;  2AV4 A;  2GDR A;  2RUF A;  4FYC A;  2OAD A;  5ECK B;  1JZW A;  2L5L A;  3M1G A;  2CZ3 A;  1KBN A;  2FLS A;  3JCM L;  2VD0 A;  4JR4 A;  2H6Y A;  1YF1 A;  1EOG A;  3C7M A;  4Q5Q A;  3PH9 A;  4O32 A;  4NV5 A;  3EMX A;  4TRX A;  1E2Y A;  1TDI A;  3TRX A;  1J0F A;  3IXR A;  1AIU A;  3GKK A;  4MF6 A;  1WE0 A;  1SJZ A;  4L5L A;  4IHU A;  3GMF A;  4IKH A;  3WD6 A;  2H0H A;  5HR3 A;  1W4V A;  3HCZ A;  1GRX A;  4XHM A;  4O7H A;  1V58 A;  2ON7 A;  1K3L A;  5IMA A;  2IMF A;  2N5B A;  1X0R A;  3L9U A;  1KTE A;  3L78 A;  3A5W A;  20GS A;  5LCZ A;  1Q98 A;  3QR6 A;  3C8E A;  2B7J A;  1DE1 A;  5JCW A;  4F03 A;  1K0D A;  4POM A;  2JZR A;  3DIE A;  4DSQ A;  4TR0 A;  4KCA A;  2VUP A;  4V2M A;  1G7E A;  2VD1 A;  4ZB9 A;  4EO3 A;  5B6M A;  1S3C A;  17GS A;  2HNL A;  5AIV A;  2L57 A;  1FVJ A;  3DML A;  14GS A;  2JZS A;  5DJL A;  1FVK A;  1XOA A;  4LLR A;  5HQP A;  2GQL A;  3TKP A;  3TKR A;  3EUR A;  5DAK A;  2N5A A;  2C3T A;  2YNX A;  4FYB A;  4IP1 A;  4OO4 A;  1VF3 A;  4XTS A;  2CVK A;  4FH8 A;  3H1N A;  1PSQ A;  4RI6 A;  1BJX A;  6GSV A;  4EDY A;  2WGR A;  1X9S B;  1QMV A;  4HZ2 A;  4MCU A;  1V9W A;  1BAY A;  1M0U A;  4G9H A;  2I81 A;  3FK8 A;  2RUE A;  5IMZ A;  4N10 A;  4YQU A;  4DSS A;  2HXK A;  18GS A;  1G7O A;  1EOH A;  2AHE A;  2CAQ A;  3NZN A;  3US3 A;  3FKF A;  1Z5Y E;  1A24 A;  2CVB A;  3MAK A;  3CBU A;  1FB6 A;  4N30 A;  2C1Y A;  3W6G A;  4EXJ A;  4OCE A;  2G0F A;  3GKN A;  5ABR A;  1EGR A;  4KGI A;  6GSX A;  5AIX A;  3SBC A;  4PQH A;  4RI7 A;  1BYE A;  3TJG A;  1J08 A;  1OC9 A;  4Q5F A;  3MDK A;  3D4M A;  5LD0 A;  3U6V A;  2YWI A;  2PBJ A;  3LXT A;  5FT3 A;  3DD3 A;  4MF5 A;  1R4W A;  2BTO T;  1T7P B;  2O7K A;  4MZC A;  4HEA 2;  1HNB A;  1JZR A;  2OAC A;  3WGE A;  2C4J A;  4KX4 A;  5H5R A;  1TU8 A;  1QK8 A;  2FA8 A;  4NPB A;  5IPH A;  2X99 A;  2E7P A;  3CRU A;  4IW9 A;  3G7I A;  3S9F A;  1SL0 B;  3J7Y b;  3TDG A;  5A4W A;  5G31 A;  3ZL5 A;  5JCG A;  2DJ0 A;  3UJ1 A;  4TR1 A;  4ZIL A;  2GQK A;  1JFU A;  1AQW A;  1SK0 A;  3KMO A;  4YH2 A;  4IN0 A;  13GS A;  1NHY A;  3APS A;  3HKR A;  5DJM A;  3E0U A;  3G7J A;  2XHF A;  1X9W B;  1GNW A;  5INY A;  1EZK A;  1EP7 A;  2GQM A;  1ZL9 A;  2FWF A;  1AUC A;  2CAI A;  2VLU A;  4N0V A;  4MZB A;  5HFK A;  1SL2 B;  8GSS A;  2ON5 A;  1YJ6 A;  5CNW A;  2B7K A;  2C0G A;  2H75 A;  3GA4 A;  1N2A A;  5CRW A;  2ZCT A;  2WUL A;  1TP9 A;  5EVO A;  3PR8 A;  2QC7 A;  4MZW A;  3TJF A;  3ISO A;  1R7H A;  1FB0 A;  1PX6 A;  4POB A;  4KE3 A;  4GLT A;  4MP4 A;  3ZVJ A;  12GS A;  1YKC A;  2VCZ A;  4GWR A;  4F0B A;  5J41 A;  5ID2 B;  5HFI A;  3FYG A;  1ERW A;  3GKM A;  5J9B A;  4BL7 A;  1GUH A;  4MH3 A;  2V1M A;  2MMN A;  2A2S A;  1RW1 A;  4EDZ A;  3F4S A;  2YWN A;  5EL8 A;  1GSY A;  3CXG A;  1TOF A;  4OCF A;  2L4Q A;  2GZP A;  1OE7 A;  2WRT A;  2LNT A;  1A8L A;  2GT6 A;  3P8W A;  4G19 A;  3VWV A;  3NIV A;  3KD0 A;  4EF0 A;  1O85 A;  3G9B A;  4GSS A;  4K7I A;  1Z6M A;  4AGS A;  4JU5 A;  2HZF A;  5ECL B;  3BBY A;  2V6O A;  4AJ7 A;  3IA1 A;  4WXT A;  2C8U A;  2HSY A;  4AJ8 A;  1K0M A;  2CX4 A;  1HNA A;  1A0F A;  4ECB A;  3A2V A;  3MNG A;  4BWS A;  5D8I A;  1B9X C;  2V41 A;  4D73 A;  3L4N A;  5IO0 A;  2FHE A;  3VLN A;  3HA9 A;  4NHW A;  2PGT A;  2FNO A;  2JL4 A;  4XRA A;  3QAV A;  4ZIJ A;  1ZZY A;  3GH6 A;  3TKS A;  1YEX A;  1NW2 A;  3APO A;  3I69 A;  4I8B A;  2GVP A;  3P90 A;  2GZZ A;  4HI7 A;  1PX7 A;  3VWU A;  1A2M A;  3C1S A;  2VLT A;  1ERT A;  2PPT A;  4KH7 A;  5HFG A;  3GV1 A;  3F9U A;  2M46 A;  2OE1 A;  2VCT A;  3TJK A;  1A2L A;  1GNE A;  4HJ2 A;  4G10 A;  1JHB A;  2H8L A;  5IMV A;  4GTU A;  2YV7 A;  2YAN A;  2L59 A;  1V2A A;  4OFT A;  4HQS A;  1DUG A;  4ECC A;  4F0C A;  3TKS C;  3DVW A;  4EC0 A;  1ZMA A;  5HR2 A;  1XIY A;  3KIJ A;  1ZYQ B;  5GAN D;  1QUW A;  3QFB C;  2J23 A;  1U87 A;  2DJJ A;  4HU7 A;  1URM A;  3ERG A;  5ECS A;  1PGT A;  4ZB6 A;  1W89 A;  4KDX A;  4XS6 A;  4MPG A;  4F82 A;  5JWR B;  1YKA A;  1XW5 A;  1GTI A;  4ZL7 A;  2AUV A;  1AXD A;  4BVX A;  5IMF A;  1O73 A;  2LNS A;  2GTU A;  3ZZX A;  5ECO B;  5G1L A;  1FOV A;  2IFQ B;  3ZIT A;  3QAW A;  4ISD A;  2H6X A;  5HR1 A;  1AQX A;  4LL4 B;  2CQ9 A;  3LJR A;  1G6W A;  3I6A A;  4KCE A;  2K18 A;  4XS4 A;  3TRP A;  5ELG A;  4AF2 A;  1XWB A;  4ZBD A;  2HZE B;  3MWH A;  3AY8 A;  3LGC A;  2XC2 A;  2QSI A;  3E9J B;  4OD7 A;  1TXX A;  19GS A;  2LQO A;  1V98 A;  2QGV A;  1FW1 A;  4ID0 A;  6GST A;  5H5S A;  3QAG A;  5B8B A;  2FD3 A;  2PN8 A;  1NM3 A;  5GAP D;  4MA9 A;  2HRF A;  4IJ3 A;  3WT1 A;  5DVB A;  3GNJ A;  4I5Q A;  2DJ2 A;  3TKS E;  1Z3E A;  3EU4 A;  3IC4 A;  4TXV A;  1GTB A;  4IS0 A;  3A2X A;  1Z9H A;  1VRS D;  2VM1 A;  1FO5 A;  1NSW A;  1PL1 A;  4O92 A;  3UAR A;  2LTK A;  1QXH A;  1T4Z A;  4YQM A;  2H0G A;  2H70 A;  3FR9 A;  3GIX A;  3GKX A;  3FZA A;  4WEY A;  2D2Z A;  4FIW A;  4MJA A;  1R5A A;  1TK0 B;  2H1G A;  1OYJ A;  1BG5 A;  2AYT A;  4PQI A;  6GSS A;  3UBL A;  2NTO A;  4V1A p;  4BVY A;  2VO4 A;  4ILF A;  1QGV A;  4TR4 A;  1PL2 A;  1XVW A;  2LKU A;  2R5G A;  3F3R A;  1Y25 A;  2H1D A;  3ZLP A;  5A4U A;  2GZY A;  2FWH A;  2LS5 A;  4MJB A;  1GH2 A;  4K1F A;  2L6C A;  3RHC A;  1VF4 A;  1EEJ A;  2C3Q A;  3H93 A;  2KLX A;  2WS2 A;  3ZIJ A;  3L0H A;  3TGZ A;  1SJI A;  1T4Y A;  3H4K A;  2C0E A;  1THX A;  4WBJ A;  2B5Y A;  3BOA A;  4JBB A;  2VL2 C;  3VWW A;  4MJC A;  2OJL A;  1GSF A;  2IMK A;  3GST A;  1GSS A;  4HQZ A;  2HI7 A;  5DAL B;  5J9C A;  4CW9 A;  3QDN A;  3FHK A;  1VF1 A;  1B9Y C;  3Q6O A;  4GST A;  2YZH A;  1GTA A;  2YWO A;  5IMC A;  1R5P A;  1TI1 A;  4KDY A;  3HYP A;  3F6F A;  1CQH A;  3BCI A;  4LA1 A;  3O3T A;  2CT6 A;  2JSZ A;  4ACS A;  1F2E A;  3RAZ A;  6GSW A;  3ZFB A;  4ZXG A;  3EU3 A;  2DLX A;  4TXO A;  2LRC A;  3EYT A;  1EEM A;  3IAM 2;  3EC3 A;  2G2Q A;  1AAZ A;  2NPB A;  1UVZ A;  1LBK A;  4FYU A;  2E0Q A;  2H30 A;  5J3R A;  2EIO A;  4F2I A;  4ZB8 A;  4XIH A;  2AB6 A;  2DBC A;  5KN0 A;  4ZBB A;  3VI7 A;  2H73 A;  4EL1 A;  3LEF A;  2OE0 A;  1EV9 A;  1FG4 A;  1WOU A;  2DIZ A;  2DSA A;  3F3Q A;  3TRQ A;  1F3B A;  2CV4 A;  1Z6N A;  3KEB A;  3LOR A;  1XW9 A;  3TOT A;  3UAP A;  4PUF C;  5ECR B;  2VL3 A;  4E8H A;  4GCI A;  1EWX A;  4JZQ A;  2VM2 A;  1B48 A;  3D4T A;  2YWM A;  4GRF A;  2H1B A;  3W8J A;  1XWK A;  1T3B A;  2HYX A;  2RLI A;  4E8E A;  3KTB A;  5DAK B;  3CTG A;  2IIY A;  2O89 A;  1ERV A;  4WF5 A;  5CRG A;  5KEJ A;  4XCS A;  1HNC A;  1K0O A;  5IO2 A;  4OFN A;  3H8Q A;  2P31 A;  1M9B A;  3IBH A;  5F06 A;  3G7Y A;  3GFK A;  2LRN A;  5CRD A;  3KMN A;  1XWG A;  1XWA A;  5F05 A;  2B1L A;  4JR6 A;  2FA4 A;  2MMO A;  3QD9 A;  3ERF A;  1SD9 A;  4DSS B;  4KW6 A;  3TJJ A;  4QL9 A;  2JZT A;  3UL3 A;  3GH9 A;  1XVQ A;  3IRA A;  3ERW A;  1GUM A;  3O6T A;  1NHO A;  2H19 A;  3GHA A;  5IOW A;  3IV4 A;  1VGL A;  1U6T A;  1T00 A;  4EUY A;  5EPF A;  2WFC A;  2GT5 A;  1GL8 A;  2LEG A;  1OC9 B;  1CQG A;  1YF0 A;  3RPP A;  3CRT A;  2IWT A;  3N5O A;  4K0N A;  4OMV A;  1WMJ A;  1OKT A;  1K3Y A;  2H71 A;  4BA7 A;  9GSS A;  1GSU A;  2R3X A;  2O85 A;  3IAS 2;  2I9H A;  2B3S A;  3D22 A;  3Q74 A;  4MK3 A;  1T8E B;  11GS A;  4KUN A;  2WJU A;  4JED A;  1WRY A;  2I1U A;  3FY7 A;  2XPD A;  3TJB A;  4K8M A;  3IK9 A;  4IQ1 A;  1XXU A;  2XBQ A;  5ECQ B;  4XRD A;  3A3T A;  4V1A g;  4TR1 B;  1MD4 A;  2DJ1 A;  4KSO A;  5AIS A;  3C1R A;  1PRX A;  3CYN A;  1O8X A;  1USB A;  4K7N A;  1FAA A;  2YJH A;  2RM6 A;  4Z7X A;  1O81 A;  1SKS B;  4KND A;  5JWQ B;  1KEB A;  3HZ4 A;  2NDO A;  2QKE A;  1Q4J A;  1LJR A;  1ZCP A;  2JU5 A;  1E6B A;  2B6M A;  4JE1 A;  3UIW A;  4LMW A;  3HD5 A;  1HYU A;  1GUL A;  4DSR A;  2WCI A;  4WR4 A;  5F0G A;  2KP2 A;  1G0T A;  4J2F A;  1UC7 A;  1BX9 A;  4J57 E;  1AW9 A;  5DDL A;  1GSE A;  6GSU A;  2PVQ A;  1A0R P;  3RDW A;  2I4A A;  1IYH A;  3GX8 A;  3GUS A;  4HDE A;  4P3Y B;  1H75 A;  3KP8 A;  2GSR A;  3N9J A;  1TU7 A;  2K8S A;  1H4O A;  3VK9 A;  3KGK A;  1WPI A;  5GZZ B;  1Z7R A;  4HZ4 A;  1GUK A;  3TB2 A;  1S3D A;  4WF4 A;  3UBK A;  2ES7 A;  3VPQ A;  2IL3 A;  4OFM A;  3GN3 A;  2H6Z A;  4I6X A;  4NHZ A;  4K2D A;  3J7Y k;  1JZO A;  3HJM A;  2H76 A;  1MDJ A;  4PQ1 A;  4IBP A;  4MPF A;  3F8U A;  2R4V A;  1SK1 A;  5ECH B;  1M2D A;  2R6K A;  2XBI A;  2JAD A;  4DVC A;  4XS1 A;  5LNK e;  1SJ6 A;  4D73 B;  2RII A;  2F3M A;  5DCH A;  1B8X A;  2LUS A;  2VAF A;  3HZ8 A;  1ON4 A;  3F63 A;  5DBQ A;  1VF2 A;  5KN2 A;  1KNG A;  16GS A;  1XWC A;  5B7C A;  5E4W A;  2J9H A;  5ENU A;  1PQN A;  2GST A;  5CYY A;  1OC3 A;  1OVN A;  2GSQ A;  3C73 A;  1SKR B;  1SYR A;  2I3Y A;  2AJQ B;  4PXO A;  4IGJ A;  3ZRD A;  4BWQ A;  2KHP A;  4EE0 A;  3E3E A;  3IE3 A;  4PNG A;  1WIK A;  1YY7 A;  4PGT A;  2YJ7 A;  2B1K A;  1XOB A;  3FRC A;  1ABA A;  2VCW A;  3KCM A;  3GTU A;  1EP8 A;  2VCV A;  1TW9 A;  4V2L A;  3WGD A;  1AC1 A;  3F4T A;  1HQO A;  2H74 A;  2HT9 A;  3KJY A;  5KN3 A;  2K9F A;  4HOJ A;  2HZE A;  2C3N A;  5IQY A;  4RQR A;  1ML6 A;  2JAC A;  5ECN B;  3I43 A;  3CSJ A;  5L71 A;  3HDC A;  3EMP A;  3SWL A;  3DKS A;  3VI5 A;  3D5J A;  3LYP A;  2CVD A;  3VUR A;  1MDK A;  3OR5 A;  2TRX A;  2V32 A;  3DRN A;  2P5R A;  3RPN A;  2KP1 A;  5G5F A;  3F4R A;  4TN8 A;  3M8N A;  3CSI A;  1ERU A;  3QCP A;  1G6Y A;  2TIR A;  2H0I A;  2VL9 A;  1TRV A;  4L8E A;  3A2W A;  2FGX A;  3GL3 A;  4CDO A;  3ED3 A;  5IPG A;  3IR4 A;  1GSQ A;  1GWC A;  4LMV A;  3DEX A;  3ZVJ D;  1M99 A;  2FUG 2;  2P5Q A;  3KP9 A;  1XW6 A;  2X8H A;  5IOX A;  4K7O A;  4EKZ A;  4GQC A;  1R26 A;  4V2N A;  5DQY A;  4Q5R A;  2DC5 A;  4KAE A;  4PX1 A;  4TW5 A;  2VL2 A;  4TR3 A;  5IIZ A;  1TKD B;  1RQM A;  4XS4 B;  3CSH A;  1LU4 A;  3GL5 A;  5AGY A;  3UVH A;  5FHI A;  3WYW A;  5EY6 A;  2HE3 A;  4L0U A;  2MBS A;  1U3A A;  1K0N A;  3VWX A;  1JLW A;  1MTC A;  10GS A;  2YPM A;  2OA7 A;  2P0G A;  1UN2 A;  5DAL A;  1BED A;  4MF7 A;  2KOK A;  2O87 A;  3QOU A;  1SYX A;  1OAZ A;  4I2U A;  1SKW B;  1PKZ A;  2F8F A;  3DVX A;  1N8J A;  3LWA A;  1GLP A;  3ZMK A;  4KSM A;  1DSB A;  3EIN A;  1V57 A;  3APQ A;  4RUV A;  2IN3 A;  3FR6 A;  1WWJ A;  2IPA A;  4NXI A;  3FR3 A;  1I9D A;  3UVT A;  2TRC P;  6GSY A;  4K9Z A;  1B4P A;  4MMM A;  5HR0 A;  5H5Q A;  2MMA A;  4WR5 A;  1J9B A;  2PWJ A; 
#chains in the Genus database with same CATH topology
 1RK4 A;  2HFD A;  1Z7P A;  2BJX A;  3D6I A;  1X5E A;  3M9J A;  1A2J A;  3IDV A;  3HXS A;  2AAW A;  3FZ9 A;  5F07 A;  2PER A;  1GTU A;  3VPT A;  4ZL8 A;  2NBS A;  3CTF A;  3F0I A;  1B4Q A;  2N5F A;  3I9V 2;  4N11 A;  2ZUP A;  3LQ7 A;  2X64 A;  1SU9 A;  4I97 A;  1JZD A;  3W8S A;  4HUA A;  5GSS A;  1ACV A;  3BD2 A;  1X5D A;  2VCX A;  2F9S A;  2IJY A;  3IC8 A;  4IEL A;  2YZU A;  22GS A;  1K0B A;  5CRH A;  2LRT A;  4YQV A;  3M3M A;  1F3A A;  1XCC A;  2YOI A;  4K0G A;  3GYK A;  2VOC A;  2PUK C;  5D96 A;  5G30 A;  4TKY A;  4PUA A;  3KH7 A;  1DBY A;  3RHB A;  1TI3 A;  2YP6 A;  2LJA A;  4POL A;  1M7T A;  3HVV A;  2XPE A;  1A23 A;  5ELA A;  1OE8 A;  3FEU A;  4O5R A;  2HLS A;  1WP0 A;  1SEN A;  5KN1 A;  4O5U A;  3WGX A;  1M2A A;  1SL1 B;  2GLR A;  4TXO B;  2A2R A;  5A5K A;  5A4V A;  3IPZ A;  5B8A A;  3P7X A;  3FZ4 A;  2K6V A;  3HVX A;  4GSN A;  4MAB A;  2HRK A;  4GXZ A;  1AQV A;  3KXO A;  1O8W A;  2WDU A;  3KZQ A;  4ECJ A;  3C71 A;  2KUC A;  4NAX A;  1A8Y A;  3UOM A;  2L5O A;  2O8V B;  3ME8 A;  2DMM A;  4ZL9 A;  3ZYW A;  2H72 A;  5J4U A;  3CMI A;  4ULX A;  2R37 A;  3ZML A;  2VCQ A;  3DGQ A;  3LFL A;  2X8C A;  2R2J A;  2DJ3 A;  4QL7 A;  2LJR A;  2C80 A;  2HSH A;  1I5G A;  4MLY A;  3R2Q A;  1M2B A;  3GRX A;  3IOS A;  1TK8 B;  1XBS A;  3UEM A;  1ZOF A;  4L5O A;  2F8A A;  1TJD A;  2X49 A;  1O6J A;  4POK A;  5IMD A;  1MDI A;  1TRU A;  4NMU A;  2V6K A;  1F9M A;  2A4V A;  2QA2 A;  1BQ7 A;  2BMX A;  3D0Z A;  1PKW A;  3BJ5 A;  1K0C A;  1UA5 A;  3HHV A;  1YQ1 A;  4WBR D;  1TRS A;  1U3I A;  2E2G A;  2B5X A;  1PN9 A;  4DEJ A;  5ID2 A;  5ECI B;  1C72 A;  1PN0 A;  2ALB A;  4TOP A;  4F9Z A;  1OKD A;  5CAX A;  2H66 A;  5C00 A;  3EE2 A;  2GGT A;  3KTL A;  5COH A;  4IQA A;  4WKW A;  4G2E A;  5CO3 A;  4IVF A;  4KB3 A;  4YAV A;  2DJK A;  4K6X A;  1X9M B;  1EGO A;  4EVM A;  5JWO B;  1V40 A;  3IK7 A;  4BPY A;  3M9K A;  7GSS A;  2M72 A;  2V2G A;  3F6D A;  3VFI A;  5D9T A;  2HRN A;  3M0F A;  5DCG A;  2IME A;  2MBT A;  3ZFL A;  3IHQ A;  2EIR A;  3GSS A;  4NWY A;  1HD2 A;  3BCK A;  1XPV A;  3PIN A;  2H01 A;  4H86 A;  2LV3 A;  3ZIV A;  4TVE A;  1GLQ A;  2Z9S A;  3H79 A;  3U5R E;  3K8N A;  3MSZ A;  2WZ9 A;  2ZNM A;  2OBK A;  4HU9 A;  2VIM A;  5B6N A;  4GF0 A;  4OWY A;  4CHS A;  1O7U A;  4J56 E;  3GX0 A;  2PU9 C;  2JSY A;  3D21 A;  5C04 A;  3L9S A;  4WET A;  2MZC A;  4GQF A;  5IM9 A;  3KH9 A;  5G2Z A;  5E59 A;  2IMD A;  2GSS A;  1QQ2 A;  2WB9 A;  1OC8 A;  5F8B A;  5DQS A;  1SK2 A;  3LYK A;  2X8G A;  3HVS A;  3HY2 A;  4HJM A;  2L4C A;  2PVO C;  4YAP A;  2RM5 A;  1WJK A;  4MDC A;  4G0L A;  5G5E A;  3MIX A;  2DIY A;  1X5C A;  3KM6 A;  1ST9 A;  1T1V A;  5CRE A;  1F37 A;  4ZBA A;  4X0X A;  4FO5 A;  3Q19 A;  2VLV A;  5CP1 A;  3O76 A;  5AN1 A;  4ECI A;  3EVI A;  5ECP B;  1JLV A;  4KDU A;  3PGT A;  3TCO A;  4I2T A;  2K8V A;  3LXZ A;  1ZYE A;  1MD3 A;  2GS3 A;  2OKA A;  2F51 A;  3DYR A;  4Z2R A;  5J5N A;  4CY8 A;  1TRW A;  3L9V A;  3RBT A;  4RQX A;  2H1A A;  3FZ5 A;  3P2A A;  3ZTL A;  3ME7 A;  2B5E A;  1EV4 A;  2CA8 A;  2C0F A;  1K0A A;  4O5Q A;  1IYI A;  2YN1 A;  2YV9 A;  5FWG A;  1PMT A;  2REM A;  4HS1 A;  5D9V A;  2FWE A;  4IP6 A;  4ML1 A;  2E2M A;  1XZO A;  2L6D A;  2OBI A;  3QMX A;  3LSZ A;  2M80 A;  3QFA C;  5ECM B;  1F6M C;  3TKQ A;  3EWL A;  2DML A;  1PD2 1;  2IFQ A;  3QPM A;  2LST A;  4ML6 A;  3HJP A;  2IMI A;  2C0D A;  1YZX A;  4L0W A;  1GSD A;  4AJ6 A;  5D9W A;  3DXB A;  1QFN A;  3Q18 A;  2MMZ A;  5D73 A;  1PA3 A;  4N0Z A;  3GUR A;  2CZ2 A;  3TOU A;  3UMA A;  1TTZ A;  1S3A A;  4MH2 A;  3DWV A;  4KA0 A;  3TUE A;  1ZGN A;  4X1U A;  2MYG A;  2LJK A;  1K3O A;  3V1W A;  2YCD A;  2FCH A;  4Q5N A;  5GST A;  4NV2 A;  3NOF A;  3FW2 A;  2NVL A;  5G1K A;  2EC4 A;  2FWG A;  1FOH A;  2OE3 A;  3ZRE A;  1Y6E A;  2HRA A;  5D93 A;  5JCU A;  1FHE A;  5D9X A;  3GTU B;  2X4A A;  2EIQ A;  1THO A;  3WT2 A;  1TK5 B;  2CX3 A;  1MEK A;  4PUR A;  4X43 A;  1XFL A;  4PNF A;  4LL1 B;  3HJO A;  4BVX B;  1YEP A;  1M9A A;  4IJI A;  2LQQ A;  1U88 A;  4OO5 A;  1YDK A;  1SD8 A;  2PMT A;  4JRR A;  1DE2 A;  1GP1 A;  3LG6 A;  2FY6 A;  1ILO A;  4MJE A;  4QQ7 A;  2AV4 A;  2GDR A;  2RUF A;  4FYC A;  2OAD A;  5ECK B;  1JZW A;  2L5L A;  3M1G A;  4Z2T A;  2CZ3 A;  1KBN A;  2FLS A;  3JCM L;  2VD0 A;  4JR4 A;  4HSC X;  2H6Y A;  1YF1 A;  1EOG A;  3C7M A;  4Q5Q A;  3PH9 A;  4O32 A;  4NV5 A;  3EMX A;  4TRX A;  1E2Y A;  1TDI A;  3TRX A;  1J0F A;  3IXR A;  1AIU A;  3GKK A;  4MF6 A;  1WE0 A;  1SJZ A;  4L5L A;  4EIP A;  4IHU A;  3GMF A;  4IKH A;  3WD6 A;  2H0H A;  5HR3 A;  1W4V A;  3HCZ A;  1GRX A;  4XHM A;  4O7H A;  1V58 A;  2ON7 A;  1K3L A;  5IMA A;  2IMF A;  2N5B A;  1X0R A;  3L9U A;  1KTE A;  3L78 A;  3A5W A;  20GS A;  5LCZ A;  1Q98 A;  3QR6 A;  3C8E A;  2B7J A;  1DE1 A;  5JCW A;  4F03 A;  1K0D A;  4POM A;  2JZR A;  3DIE A;  4DSQ A;  4TR0 A;  4KCA A;  2VUP A;  4V2M A;  1G7E A;  2VD1 A;  4ZB9 A;  1PFO A;  4EO3 A;  5B6M A;  1S3C A;  17GS A;  2HNL A;  5AIV A;  2L57 A;  1FVJ A;  3DML A;  14GS A;  2JZS A;  3A5I A;  5DJL A;  1FVK A;  1XOA A;  4LLR A;  5HQP A;  2GQL A;  3TKP A;  3TKR A;  3EUR A;  5DAK A;  2N5A A;  2C3T A;  2YNX A;  4FYB A;  4IP1 A;  4OO4 A;  1VF3 A;  4YKG A;  4XTS A;  2CVK A;  4FH8 A;  3H1N A;  1PSQ A;  4RI6 A;  1BJX A;  6GSV A;  4EDY A;  2WGR A;  1X9S B;  1QMV A;  4HZ2 A;  4MCU A;  1V9W A;  1BAY A;  1M0U A;  4G9H A;  2I81 A;  3FK8 A;  2RUE A;  5IMZ A;  4N10 A;  4YQU A;  4DSS A;  2HXK A;  18GS A;  1G7O A;  1EOH A;  2AHE A;  2CAQ A;  4BIK A;  3NZN A;  3US3 A;  3FKF A;  1Z5Y E;  1A24 A;  2CVB A;  3MAK A;  3CBU A;  1FB6 A;  4N30 A;  2C1Y A;  3W6G A;  4EXJ A;  4OCE A;  2G0F A;  3GKN A;  5ABR A;  1EGR A;  4KGI A;  6GSX A;  5AIX A;  3SBC A;  4PQH A;  4RI7 A;  1BYE A;  3TJG A;  1J08 A;  1OC9 A;  4G0I A;  4Q5F A;  3MDK A;  3D4M A;  5LD0 A;  3U6V A;  2YWI A;  2PBJ A;  3LXT A;  5FT3 A;  3DD3 A;  4MF5 A;  1R4W A;  2BTO T;  1T7P B;  2O7K A;  4MZC A;  4HEA 2;  1HNB A;  1JZR A;  2OAC A;  3WGE A;  2C4J A;  4KX4 A;  5H5R A;  1TU8 A;  1QK8 A;  2FA8 A;  4NPB A;  5IPH A;  2X99 A;  2E7P A;  3CRU A;  4IW9 A;  3G7I A;  3S9F A;  1SL0 B;  3J7Y b;  3TDG A;  5A4W A;  5G31 A;  3ZL5 A;  4CY6 A;  4K2X A;  5JCG A;  2DJ0 A;  3UJ1 A;  4TR1 A;  4ZIL A;  2GQK A;  1JFU A;  1AQW A;  1SK0 A;  3KMO A;  4YH2 A;  4IN0 A;  13GS A;  1NHY A;  3APS A;  3HKR A;  5DJM A;  3E0U A;  3G7J A;  2XHF A;  1X9W B;  1GNW A;  5INY A;  1EZK A;  1EP7 A;  2GQM A;  1ZL9 A;  2FWF A;  1AUC A;  2CAI A;  2VLU A;  4N0V A;  4MZB A;  5HFK A;  1SL2 B;  8GSS A;  2ON5 A;  1YJ6 A;  5CNW A;  2B7K A;  2C0G A;  2H75 A;  3GA4 A;  1N2A A;  5CRW A;  2ZCT A;  2WUL A;  1TP9 A;  5EVO A;  3PR8 A;  2QC7 A;  4MZW A;  3TJF A;  3ISO A;  1R7H A;  1FB0 A;  1PX6 A;  4POB A;  4KE3 A;  4GLT A;  4MP4 A;  3ZVJ A;  12GS A;  1YKC A;  2VCZ A;  4GWR A;  4F0B A;  5J41 A;  5ID2 B;  4MNN A;  5HFI A;  3FYG A;  1ERW A;  3GKM A;  5J9B A;  4BL7 A;  1GUH A;  4MH3 A;  2V1M A;  2MMN A;  2A2S A;  1RW1 A;  4EDZ A;  3F4S A;  2YWN A;  5EL8 A;  1GSY A;  3CXG A;  1TOF A;  4OCF A;  3IHG A;  2L4Q A;  2GZP A;  1OE7 A;  2WRT A;  2LNT A;  1A8L A;  2GT6 A;  1M3I A;  3P8W A;  4G19 A;  3VWV A;  3NIV A;  3KD0 A;  4K5R A;  4EF0 A;  1O85 A;  3G9B A;  4GSS A;  4K7I A;  1Z6M A;  4AGS A;  4JU5 A;  2HZF A;  5ECL B;  3BBY A;  2R0P A;  2V6O A;  4AJ7 A;  3IA1 A;  4WXT A;  2C8U A;  2HSY A;  4AJ8 A;  1K0M A;  2CX4 A;  1HNA A;  1A0F A;  4ECB A;  3A2V A;  3MNG A;  4BWS A;  5D8I A;  1B9X C;  2V41 A;  4D73 A;  3L4N A;  5IO0 A;  2FHE A;  3VLN A;  3HA9 A;  4NHW A;  2PGT A;  2FNO A;  2JL4 A;  4XRA A;  3QAV A;  4ZIJ A;  1ZZY A;  3GH6 A;  3TKS A;  1YEX A;  1NW2 A;  3APO A;  3I69 A;  4I8B A;  2GVP A;  3P90 A;  2GZZ A;  4X4J A;  4HI7 A;  1PX7 A;  3VWU A;  1A2M A;  3C1S A;  2VLT A;  1ERT A;  2PPT A;  4KH7 A;  5HFG A;  3GV1 A;  3F9U A;  2M46 A;  2OE1 A;  2VCT A;  3TJK A;  1A2L A;  1GNE A;  4HJ2 A;  4G10 A;  1JHB A;  2H8L A;  5IMV A;  4GTU A;  2YV7 A;  2YAN A;  4KF9 A;  2L59 A;  1V2A A;  4OFT A;  4HQS A;  1DUG A;  4ECC A;  4F0C A;  3TKS C;  3DVW A;  4EC0 A;  1ZMA A;  5HR2 A;  1XIY A;  3KIJ A;  1ZYQ B;  5GAN D;  1QUW A;  3QFB C;  2J23 A;  1U87 A;  2DJJ A;  4HU7 A;  1URM A;  3ERG A;  5ECS A;  1PGT A;  4ZB6 A;  1W89 A;  4KDX A;  3CQF A;  4XS6 A;  4MPG A;  4F82 A;  5JWR B;  1YKA A;  1XW5 A;  1GTI A;  4ZL7 A;  2DKH A;  2AUV A;  1AXD A;  4BVX A;  4YKF A;  5KOX A;  5IMF A;  1O73 A;  2LNS A;  2GTU A;  3ZZX A;  5ECO B;  5G1L A;  1FOV A;  2IFQ B;  3ZIT A;  3QAW A;  4ISD A;  2H6X A;  5HR1 A;  1AQX A;  4LL4 B;  2CQ9 A;  3LJR A;  1G6W A;  3I6A A;  4KCE A;  2K18 A;  4XS4 A;  3TRP A;  5ELG A;  4AF2 A;  1XWB A;  4ZBD A;  2HZE B;  3MWH A;  2HSM A;  3AY8 A;  3LGC A;  2XC2 A;  2QSI A;  3E9J B;  4OD7 A;  1TXX A;  19GS A;  2LQO A;  1V98 A;  2QGV A;  1FW1 A;  4ID0 A;  6GST A;  5H5S A;  3QAG A;  5B8B A;  2FD3 A;  2PN8 A;  1NM3 A;  5GAP D;  4MA9 A;  2HRF A;  4IJ3 A;  3WT1 A;  5DVB A;  3GNJ A;  4I5Q A;  2DJ2 A;  3TKS E;  1Z3E A;  3EU4 A;  3IC4 A;  4TXV A;  1GTB A;  4IS0 A;  1ZYP A;  3A2X A;  1Z9H A;  1VRS D;  2VM1 A;  1FO5 A;  1NSW A;  1PL1 A;  4O92 A;  4K5S A;  3UAR A;  2LTK A;  1QXH A;  1T4Z A;  4YQM A;  2H0G A;  2H70 A;  3FR9 A;  3GIX A;  3GKX A;  3FZA A;  4WEY A;  2D2Z A;  4FIW A;  4MJA A;  1R5A A;  1TK0 B;  2H1G A;  1OYJ A;  1BG5 A;  2AYT A;  3EPT A;  4PQI A;  6GSS A;  3UBL A;  2NTO A;  4V1A p;  4BVY A;  2VO4 A;  4ILF A;  1QGV A;  4TR4 A;  1PL2 A;  1XVW A;  2LKU A;  2R5G A;  3F3R A;  1Y25 A;  2H1D A;  3PPU A;  3ZLP A;  5A4U A;  2GZY A;  2FWH A;  2LS5 A;  4MJB A;  1GH2 A;  4K1F A;  2L6C A;  3RHC A;  1VF4 A;  1EEJ A;  2C3Q A;  3H93 A;  2KLX A;  2WS2 A;  3ZIJ A;  3L0H A;  3TGZ A;  1SJI A;  1T4Y A;  3H4K A;  2C0E A;  1THX A;  4WBJ A;  2B5Y A;  3BOA A;  4JBB A;  2VL2 C;  3VWW A;  4MJC A;  2A2P A;  2OJL A;  1GSF A;  2IMK A;  3GST A;  1GSS A;  4HQZ A;  2HI7 A;  5DAL B;  5J9C A;  4CW9 A;  3QDN A;  3FHK A;  1VF1 A;  1B9Y C;  3Q6O A;  4GST A;  2YZH A;  1GTA A;  2YWO A;  5IMC A;  1R5P A;  1TI1 A;  4KDY A;  3HYP A;  3F6F A;  1CQH A;  3BCI A;  4LA1 A;  3O3T A;  2CT6 A;  2JSZ A;  4ACS A;  1F2E A;  3RAZ A;  6GSW A;  3ZFB A;  4ZXG A;  3EU3 A;  2DLX A;  4TXO A;  2LRC A;  3EYT A;  1EEM A;  3IAM 2;  3EC3 A;  2G2Q A;  1AAZ A;  2NPB A;  1UVZ A;  1LBK A;  4FYU A;  2E0Q A;  2H30 A;  5J3R A;  2EIO A;  4F2I A;  4ZB8 A;  4XIH A;  2AB6 A;  2DBC A;  5KN0 A;  4ZBB A;  3VI7 A;  2H73 A;  4FQU A;  4EL1 A;  3LEF A;  2OE0 A;  1EV9 A;  1FG4 A;  1WOU A;  2DIZ A;  2DSA A;  3F3Q A;  4ICY A;  3TRQ A;  1F3B A;  2CV4 A;  1Z6N A;  3KEB A;  3LOR A;  1XW9 A;  3TOT A;  3UAP A;  4PUF C;  5ECR B;  2VL3 A;  4E8H A;  4GCI A;  1EWX A;  1XG8 A;  4JZQ A;  2VM2 A;  1B48 A;  3D4T A;  2YWM A;  4GRF A;  2H1B A;  3W8J A;  1XWK A;  1T3B A;  2HYX A;  2RLI A;  4E8E A;  3KTB A;  5DAK B;  3CTG A;  2IIY A;  2O89 A;  1ERV A;  4WF5 A;  5CRG A;  5KEJ A;  4XCS A;  1HNC A;  1K0O A;  5IO2 A;  4OFN A;  3H8Q A;  2P31 A;  1M9B A;  3IBH A;  5F06 A;  3G7Y A;  3GFK A;  2LRN A;  5CRD A;  3KMN A;  1XWG A;  1XWA A;  5F05 A;  2B1L A;  4JR6 A;  2FA4 A;  2MMO A;  2QA1 A;  3QD9 A;  5BMU A;  3ERF A;  1SD9 A;  4DSS B;  4KW6 A;  3TJJ A;  4QL9 A;  2JZT A;  3UL3 A;  3GH9 A;  1XVQ A;  3IRA A;  3ERW A;  1GUM A;  3O6T A;  1NHO A;  2H19 A;  3GHA A;  5IOW A;  3IV4 A;  1VGL A;  1U6T A;  1T00 A;  4EUY A;  5EPF A;  2WFC A;  2GT5 A;  1GL8 A;  2LEG A;  1OC9 B;  1CQG A;  1YF0 A;  3RPP A;  3CRT A;  2IWT A;  3N5O A;  4K0N A;  4OMV A;  1WMJ A;  1OKT A;  1K3Y A;  2H71 A;  4BA7 A;  9GSS A;  1GSU A;  2R3X A;  2O85 A;  3IAS 2;  2I9H A;  2B3S A;  3D22 A;  3Q74 A;  4MK3 A;  1T8E B;  11GS A;  2DKI A;  4KUN A;  2WJU A;  4JED A;  1WRY A;  2I1U A;  3FY7 A;  2XPD A;  3TJB A;  4K8M A;  3IK9 A;  4IQ1 A;  1XXU A;  2XBQ A;  5ECQ B;  4XRD A;  3A3T A;  4V1A g;  4TR1 B;  1MD4 A;  2DJ1 A;  4KSO A;  5AIS A;  3C1R A;  1PRX A;  3CYN A;  1O8X A;  1USB A;  4K7N A;  1FAA A;  2YJH A;  2RM6 A;  3HVN A;  3LW9 A;  4Z7X A;  1O81 A;  1SKS B;  4KND A;  5JWQ B;  1KEB A;  3HZ4 A;  2NDO A;  2QKE A;  1Q4J A;  1LJR A;  1ZCP A;  2JU5 A;  1E6B A;  2B6M A;  4JE1 A;  3UIW A;  4USS A;  4LMW A;  3HD5 A;  1HYU A;  1GUL A;  4DSR A;  2WCI A;  4WR4 A;  5F0G A;  2KP2 A;  1G0T A;  4J2F A;  1UC7 A;  1BX9 A;  4J57 E;  1AW9 A;  5DDL A;  1GSE A;  6GSU A;  2PVQ A;  3FMW A;  1A0R P;  3RDW A;  2I4A A;  1IYH A;  3GX8 A;  3GUS A;  4HDE A;  4P3Y B;  4BL7 B;  1H75 A;  3KP8 A;  2GSR A;  3N9J A;  1TU7 A;  2K8S A;  1H4O A;  3VK9 A;  3KGK A;  1WPI A;  5GZZ B;  1Z7R A;  4HZ4 A;  1GUK A;  3TB2 A;  1S3D A;  4WF4 A;  5BRT A;  3UBK A;  2ES7 A;  3VPQ A;  2IL3 A;  4OFM A;  3GN3 A;  3MYD A;  2H6Z A;  4I6X A;  4NHZ A;  4K2D A;  3J7Y k;  1JZO A;  3HJM A;  2H76 A;  1MDJ A;  4PQ1 A;  4IBP A;  4MPF A;  3F8U A;  2R4V A;  1SK1 A;  5ECH B;  1M2D A;  2R6K A;  2XBI A;  2JAD A;  4DVC A;  1ZYN A;  5KOW A;  4XS1 A;  5LNK e;  1SJ6 A;  4D73 B;  2RII A;  2F3M A;  5DCH A;  1B8X A;  2LUS A;  2VAF A;  3HZ8 A;  1ON4 A;  3F63 A;  5DBQ A;  1VF2 A;  5KN2 A;  1KNG A;  16GS A;  1XWC A;  5B7C A;  5E4W A;  2J9H A;  5ENU A;  1PQN A;  1M3J A;  2GST A;  2R0G A;  5CYY A;  1OC3 A;  1OVN A;  2GSQ A;  3C73 A;  1SKR B;  1SYR A;  2I3Y A;  2AJQ B;  4PXO A;  4IGJ A;  3ZRD A;  4BWQ A;  2KHP A;  4EE0 A;  3E3E A;  3IE3 A;  4PNG A;  1WIK A;  1YY7 A;  4PGT A;  2YJ7 A;  2B1K A;  1XOB A;  3FRC A;  1ABA A;  2VCW A;  3KCM A;  3GTU A;  1EP8 A;  2VCV A;  1TW9 A;  3R3E A;  4V2L A;  3WGD A;  1AC1 A;  3F4T A;  1HQO A;  2H74 A;  2HT9 A;  3KJY A;  5KN3 A;  2UZ8 A;  2K9F A;  4HOJ A;  2HZE A;  2C3N A;  5IQY A;  4RQR A;  1ML6 A;  2JAC A;  5ECN B;  3I43 A;  4Z2U A;  3CSJ A;  5L71 A;  3HDC A;  3EMP A;  3SWL A;  3DKS A;  3VI5 A;  3D5J A;  3LYP A;  4G0K A;  1S3R A;  2CVD A;  3VUR A;  1MDK A;  3OR5 A;  2TRX A;  2V32 A;  3DRN A;  2P5R A;  3RPN A;  2KP1 A;  5G5F A;  3F4R A;  4TN8 A;  3M8N A;  3CSI A;  1ERU A;  3QCP A;  1G6Y A;  2TIR A;  2H0I A;  2VL9 A;  1TRV A;  4L8E A;  3A2W A;  2FGX A;  3GL3 A;  4CDO A;  3ED3 A;  5IPG A;  3IR4 A;  1GSQ A;  1GWC A;  4LMV A;  3DEX A;  3ZVJ D;  1M99 A;  2FUG 2;  2P5Q A;  3KP9 A;  1XW6 A;  2X8H A;  5IOX A;  4K7O A;  4EKZ A;  4GQC A;  1R26 A;  4V2N A;  5DQY A;  4Q5R A;  2DC5 A;  4KAE A;  4PX1 A;  4TW5 A;  2VL2 A;  4TR3 A;  5IIZ A;  1TKD B;  1RQM A;  4XS4 B;  3CSH A;  1LU4 A;  3GL5 A;  5AGY A;  3UVH A;  5FHI A;  3WYW A;  5EY6 A;  2HE3 A;  4L0U A;  2MBS A;  1U3A A;  1K0N A;  3VWX A;  1JLW A;  1MTC A;  10GS A;  2YPM A;  2OA7 A;  2P0G A;  1UN2 A;  5DAL A;  1BED A;  4MF7 A;  2KOK A;  2O87 A;  3QOU A;  1SYX A;  2A4H A;  1OAZ A;  4I2U A;  1SKW B;  1PKZ A;  2F8F A;  3DVX A;  1N8J A;  3LWA A;  1GLP A;  2R0C A;  3ZMK A;  4KSM A;  4A5P A;  1DSB A;  3EIN A;  1V57 A;  3APQ A;  4RUV A;  4EIQ A;  2IN3 A;  4PTS A;  3FR6 A;  1WWJ A;  2IPA A;  4NXI A;  3FR3 A;  1I9D A;  3UVT A;  2TRC P;  6GSY A;  4K9Z A;  1B4P A;  4MMM A;  5HR0 A;  5H5Q A;  2MMA A;  4WR5 A;  1J9B A;  2PWJ A;  4BVY B; 
#chains in the Genus database with same CATH homology
 1RK4 A;  2HFD A;  1Z7P A;  2BJX A;  3D6I A;  1X5E A;  3M9J A;  1A2J A;  3IDV A;  3HXS A;  2AAW A;  3FZ9 A;  5F07 A;  2PER A;  1GTU A;  3VPT A;  4ZL8 A;  2NBS A;  3CTF A;  3F0I A;  1B4Q A;  2N5F A;  3I9V 2;  4N11 A;  2ZUP A;  3LQ7 A;  2X64 A;  1SU9 A;  4I97 A;  1JZD A;  3W8S A;  4HUA A;  5GSS A;  1ACV A;  3BD2 A;  1X5D A;  2VCX A;  2F9S A;  2IJY A;  3IC8 A;  4IEL A;  2YZU A;  22GS A;  1K0B A;  5CRH A;  2LRT A;  4YQV A;  3M3M A;  1F3A A;  1XCC A;  2YOI A;  4K0G A;  3GYK A;  2VOC A;  2PUK C;  5D96 A;  5G30 A;  4TKY A;  4PUA A;  3KH7 A;  1DBY A;  3RHB A;  1TI3 A;  2YP6 A;  2LJA A;  4POL A;  1M7T A;  3HVV A;  2XPE A;  1A23 A;  5ELA A;  1OE8 A;  3FEU A;  4O5R A;  2HLS A;  1WP0 A;  1SEN A;  5KN1 A;  4O5U A;  3WGX A;  1M2A A;  1SL1 B;  2GLR A;  4TXO B;  2A2R A;  5A5K A;  5A4V A;  3IPZ A;  5B8A A;  3P7X A;  3FZ4 A;  2K6V A;  3HVX A;  4GSN A;  4MAB A;  2HRK A;  4GXZ A;  1AQV A;  3KXO A;  1O8W A;  2WDU A;  3KZQ A;  4ECJ A;  3C71 A;  2KUC A;  4NAX A;  1A8Y A;  3UOM A;  2L5O A;  2O8V B;  3ME8 A;  2DMM A;  4ZL9 A;  3ZYW A;  2H72 A;  5J4U A;  3CMI A;  4ULX A;  2R37 A;  3ZML A;  2VCQ A;  3DGQ A;  3LFL A;  2X8C A;  2R2J A;  2DJ3 A;  4QL7 A;  2LJR A;  2C80 A;  2HSH A;  1I5G A;  4MLY A;  3R2Q A;  1M2B A;  3GRX A;  3IOS A;  1TK8 B;  1XBS A;  3UEM A;  1ZOF A;  4L5O A;  2F8A A;  1TJD A;  2X49 A;  1O6J A;  4POK A;  5IMD A;  1MDI A;  1TRU A;  4NMU A;  2V6K A;  1F9M A;  2A4V A;  2QA2 A;  1BQ7 A;  2BMX A;  3D0Z A;  1PKW A;  3BJ5 A;  1K0C A;  1UA5 A;  3HHV A;  1YQ1 A;  4WBR D;  1TRS A;  1U3I A;  2E2G A;  2B5X A;  1PN9 A;  4DEJ A;  5ID2 A;  5ECI B;  1C72 A;  1PN0 A;  2ALB A;  4TOP A;  4F9Z A;  1OKD A;  5CAX A;  2H66 A;  5C00 A;  3EE2 A;  2GGT A;  3KTL A;  5COH A;  4IQA A;  4WKW A;  4G2E A;  5CO3 A;  4IVF A;  4KB3 A;  4YAV A;  2DJK A;  4K6X A;  1X9M B;  1EGO A;  4EVM A;  5JWO B;  1V40 A;  3IK7 A;  4BPY A;  3M9K A;  7GSS A;  2M72 A;  2V2G A;  3F6D A;  3VFI A;  5D9T A;  2HRN A;  3M0F A;  5DCG A;  2IME A;  2MBT A;  3ZFL A;  3IHQ A;  2EIR A;  3GSS A;  4NWY A;  1HD2 A;  3BCK A;  1XPV A;  3PIN A;  2H01 A;  4H86 A;  2LV3 A;  3ZIV A;  4TVE A;  1GLQ A;  2Z9S A;  3H79 A;  3U5R E;  3K8N A;  3MSZ A;  2WZ9 A;  2ZNM A;  2OBK A;  4HU9 A;  2VIM A;  5B6N A;  4GF0 A;  4OWY A;  4CHS A;  1O7U A;  4J56 E;  3GX0 A;  2PU9 C;  2JSY A;  3D21 A;  5C04 A;  3L9S A;  4WET A;  2MZC A;  4GQF A;  5IM9 A;  3KH9 A;  5G2Z A;  5E59 A;  2IMD A;  2GSS A;  1QQ2 A;  2WB9 A;  1OC8 A;  5F8B A;  5DQS A;  1SK2 A;  3LYK A;  2X8G A;  3HVS A;  3HY2 A;  4HJM A;  2L4C A;  2PVO C;  4YAP A;  2RM5 A;  1WJK A;  4MDC A;  4G0L A;  5G5E A;  3MIX A;  2DIY A;  1X5C A;  3KM6 A;  1ST9 A;  1T1V A;  5CRE A;  1F37 A;  4ZBA A;  4X0X A;  4FO5 A;  3Q19 A;  2VLV A;  5CP1 A;  3O76 A;  5AN1 A;  4ECI A;  3EVI A;  5ECP B;  1JLV A;  4KDU A;  3PGT A;  3TCO A;  4I2T A;  2K8V A;  3LXZ A;  1ZYE A;  1MD3 A;  2GS3 A;  2OKA A;  2F51 A;  3DYR A;  4Z2R A;  5J5N A;  4CY8 A;  1TRW A;  3L9V A;  3RBT A;  4RQX A;  2H1A A;  3FZ5 A;  3P2A A;  3ZTL A;  3ME7 A;  2B5E A;  1EV4 A;  2CA8 A;  2C0F A;  1K0A A;  4O5Q A;  1IYI A;  2YN1 A;  2YV9 A;  5FWG A;  1PMT A;  2REM A;  4HS1 A;  5D9V A;  2FWE A;  4IP6 A;  4ML1 A;  2E2M A;  1XZO A;  2L6D A;  2OBI A;  3QMX A;  3LSZ A;  2M80 A;  3QFA C;  5ECM B;  1F6M C;  3TKQ A;  3EWL A;  2DML A;  1PD2 1;  2IFQ A;  3QPM A;  2LST A;  4ML6 A;  3HJP A;  2IMI A;  2C0D A;  1YZX A;  4L0W A;  1GSD A;  4AJ6 A;  5D9W A;  3DXB A;  1QFN A;  3Q18 A;  2MMZ A;  5D73 A;  1PA3 A;  4N0Z A;  3GUR A;  2CZ2 A;  3TOU A;  3UMA A;  1TTZ A;  1S3A A;  4MH2 A;  3DWV A;  4KA0 A;  3TUE A;  1ZGN A;  4X1U A;  2MYG A;  2LJK A;  1K3O A;  3V1W A;  2YCD A;  2FCH A;  4Q5N A;  5GST A;  4NV2 A;  3NOF A;  3FW2 A;  2NVL A;  5G1K A;  2EC4 A;  2FWG A;  1FOH A;  2OE3 A;  3ZRE A;  1Y6E A;  2HRA A;  5D93 A;  5JCU A;  1FHE A;  5D9X A;  3GTU B;  2X4A A;  2EIQ A;  1THO A;  3WT2 A;  1TK5 B;  2CX3 A;  1MEK A;  4PUR A;  4X43 A;  1XFL A;  4PNF A;  4LL1 B;  3HJO A;  4BVX B;  1YEP A;  1M9A A;  4IJI A;  2LQQ A;  1U88 A;  4OO5 A;  1YDK A;  1SD8 A;  2PMT A;  4JRR A;  1DE2 A;  1GP1 A;  3LG6 A;  2FY6 A;  1ILO A;  4MJE A;  4QQ7 A;  2AV4 A;  2GDR A;  2RUF A;  4FYC A;  2OAD A;  5ECK B;  1JZW A;  2L5L A;  3M1G A;  4Z2T A;  2CZ3 A;  1KBN A;  2FLS A;  3JCM L;  2VD0 A;  4JR4 A;  2H6Y A;  1YF1 A;  1EOG A;  3C7M A;  4Q5Q A;  3PH9 A;  4O32 A;  4NV5 A;  3EMX A;  4TRX A;  1E2Y A;  1TDI A;  3TRX A;  1J0F A;  3IXR A;  1AIU A;  3GKK A;  4MF6 A;  1WE0 A;  1SJZ A;  4L5L A;  4EIP A;  4IHU A;  3GMF A;  4IKH A;  3WD6 A;  2H0H A;  5HR3 A;  1W4V A;  3HCZ A;  1GRX A;  4XHM A;  4O7H A;  1V58 A;  2ON7 A;  1K3L A;  5IMA A;  2IMF A;  2N5B A;  1X0R A;  3L9U A;  1KTE A;  3L78 A;  3A5W A;  20GS A;  5LCZ A;  1Q98 A;  3QR6 A;  3C8E A;  2B7J A;  1DE1 A;  5JCW A;  4F03 A;  1K0D A;  4POM A;  2JZR A;  3DIE A;  4DSQ A;  4TR0 A;  4KCA A;  2VUP A;  4V2M A;  1G7E A;  2VD1 A;  4ZB9 A;  4EO3 A;  5B6M A;  1S3C A;  17GS A;  2HNL A;  5AIV A;  2L57 A;  1FVJ A;  3DML A;  14GS A;  2JZS A;  3A5I A;  5DJL A;  1FVK A;  1XOA A;  4LLR A;  5HQP A;  2GQL A;  3TKP A;  3TKR A;  3EUR A;  5DAK A;  2N5A A;  2C3T A;  2YNX A;  4FYB A;  4IP1 A;  4OO4 A;  1VF3 A;  4YKG A;  4XTS A;  2CVK A;  4FH8 A;  3H1N A;  1PSQ A;  4RI6 A;  1BJX A;  6GSV A;  4EDY A;  2WGR A;  1X9S B;  1QMV A;  4HZ2 A;  4MCU A;  1V9W A;  1BAY A;  1M0U A;  4G9H A;  2I81 A;  3FK8 A;  2RUE A;  5IMZ A;  4N10 A;  4YQU A;  4DSS A;  2HXK A;  18GS A;  1G7O A;  1EOH A;  2AHE A;  2CAQ A;  3NZN A;  3US3 A;  3FKF A;  1Z5Y E;  1A24 A;  2CVB A;  3MAK A;  3CBU A;  1FB6 A;  4N30 A;  2C1Y A;  3W6G A;  4EXJ A;  4OCE A;  2G0F A;  3GKN A;  5ABR A;  1EGR A;  4KGI A;  6GSX A;  5AIX A;  3SBC A;  4PQH A;  4RI7 A;  1BYE A;  3TJG A;  1J08 A;  1OC9 A;  4G0I A;  4Q5F A;  3MDK A;  3D4M A;  5LD0 A;  3U6V A;  2YWI A;  2PBJ A;  3LXT A;  5FT3 A;  3DD3 A;  4MF5 A;  1R4W A;  2BTO T;  1T7P B;  2O7K A;  4MZC A;  4HEA 2;  1HNB A;  1JZR A;  2OAC A;  3WGE A;  2C4J A;  4KX4 A;  5H5R A;  1TU8 A;  1QK8 A;  2FA8 A;  4NPB A;  5IPH A;  2X99 A;  2E7P A;  3CRU A;  4IW9 A;  3G7I A;  3S9F A;  1SL0 B;  3J7Y b;  3TDG A;  5A4W A;  5G31 A;  3ZL5 A;  4CY6 A;  4K2X A;  5JCG A;  2DJ0 A;  3UJ1 A;  4TR1 A;  4ZIL A;  2GQK A;  1JFU A;  1AQW A;  1SK0 A;  3KMO A;  4YH2 A;  4IN0 A;  13GS A;  1NHY A;  3APS A;  3HKR A;  5DJM A;  3E0U A;  3G7J A;  2XHF A;  1X9W B;  1GNW A;  5INY A;  1EZK A;  1EP7 A;  2GQM A;  1ZL9 A;  2FWF A;  1AUC A;  2CAI A;  2VLU A;  4N0V A;  4MZB A;  5HFK A;  1SL2 B;  8GSS A;  2ON5 A;  1YJ6 A;  5CNW A;  2B7K A;  2C0G A;  2H75 A;  3GA4 A;  1N2A A;  5CRW A;  2ZCT A;  2WUL A;  1TP9 A;  5EVO A;  3PR8 A;  2QC7 A;  4MZW A;  3TJF A;  3ISO A;  1R7H A;  1FB0 A;  1PX6 A;  4POB A;  4KE3 A;  4GLT A;  4MP4 A;  3ZVJ A;  12GS A;  1YKC A;  2VCZ A;  4GWR A;  4F0B A;  5J41 A;  5ID2 B;  4MNN A;  5HFI A;  3FYG A;  1ERW A;  3GKM A;  5J9B A;  4BL7 A;  1GUH A;  4MH3 A;  2V1M A;  2MMN A;  2A2S A;  1RW1 A;  4EDZ A;  3F4S A;  2YWN A;  5EL8 A;  1GSY A;  3CXG A;  1TOF A;  4OCF A;  3IHG A;  2L4Q A;  2GZP A;  1OE7 A;  2WRT A;  2LNT A;  1A8L A;  2GT6 A;  3P8W A;  4G19 A;  3VWV A;  3NIV A;  3KD0 A;  4K5R A;  4EF0 A;  1O85 A;  3G9B A;  4GSS A;  4K7I A;  1Z6M A;  4AGS A;  4JU5 A;  2HZF A;  5ECL B;  3BBY A;  2R0P A;  2V6O A;  4AJ7 A;  3IA1 A;  4WXT A;  2C8U A;  2HSY A;  4AJ8 A;  1K0M A;  2CX4 A;  1HNA A;  1A0F A;  4ECB A;  3A2V A;  3MNG A;  4BWS A;  5D8I A;  1B9X C;  2V41 A;  4D73 A;  3L4N A;  5IO0 A;  2FHE A;  3VLN A;  3HA9 A;  4NHW A;  2PGT A;  2FNO A;  2JL4 A;  4XRA A;  3QAV A;  4ZIJ A;  1ZZY A;  3GH6 A;  3TKS A;  1YEX A;  1NW2 A;  3APO A;  3I69 A;  4I8B A;  2GVP A;  3P90 A;  2GZZ A;  4X4J A;  4HI7 A;  1PX7 A;  3VWU A;  1A2M A;  3C1S A;  2VLT A;  1ERT A;  2PPT A;  4KH7 A;  5HFG A;  3GV1 A;  3F9U A;  2M46 A;  2OE1 A;  2VCT A;  3TJK A;  1A2L A;  1GNE A;  4HJ2 A;  4G10 A;  1JHB A;  2H8L A;  5IMV A;  4GTU A;  2YV7 A;  2YAN A;  4KF9 A;  2L59 A;  1V2A A;  4OFT A;  4HQS A;  1DUG A;  4ECC A;  4F0C A;  3TKS C;  3DVW A;  4EC0 A;  1ZMA A;  5HR2 A;  1XIY A;  3KIJ A;  1ZYQ B;  5GAN D;  1QUW A;  3QFB C;  2J23 A;  1U87 A;  2DJJ A;  4HU7 A;  1URM A;  3ERG A;  5ECS A;  1PGT A;  4ZB6 A;  1W89 A;  4KDX A;  4XS6 A;  4MPG A;  4F82 A;  5JWR B;  1YKA A;  1XW5 A;  1GTI A;  4ZL7 A;  2DKH A;  2AUV A;  1AXD A;  4BVX A;  4YKF A;  5KOX A;  5IMF A;  1O73 A;  2LNS A;  2GTU A;  3ZZX A;  5ECO B;  5G1L A;  1FOV A;  2IFQ B;  3ZIT A;  3QAW A;  4ISD A;  2H6X A;  5HR1 A;  1AQX A;  4LL4 B;  2CQ9 A;  3LJR A;  1G6W A;  3I6A A;  4KCE A;  2K18 A;  4XS4 A;  3TRP A;  5ELG A;  4AF2 A;  1XWB A;  4ZBD A;  2HZE B;  3MWH A;  2HSM A;  3AY8 A;  3LGC A;  2XC2 A;  2QSI A;  3E9J B;  4OD7 A;  1TXX A;  19GS A;  2LQO A;  1V98 A;  2QGV A;  1FW1 A;  4ID0 A;  6GST A;  5H5S A;  3QAG A;  5B8B A;  2FD3 A;  2PN8 A;  1NM3 A;  5GAP D;  4MA9 A;  2HRF A;  4IJ3 A;  3WT1 A;  5DVB A;  3GNJ A;  4I5Q A;  2DJ2 A;  3TKS E;  1Z3E A;  3EU4 A;  3IC4 A;  4TXV A;  1GTB A;  4IS0 A;  1ZYP A;  3A2X A;  1Z9H A;  1VRS D;  2VM1 A;  1FO5 A;  1NSW A;  1PL1 A;  4O92 A;  4K5S A;  3UAR A;  2LTK A;  1QXH A;  1T4Z A;  4YQM A;  2H0G A;  2H70 A;  3FR9 A;  3GIX A;  3GKX A;  3FZA A;  4WEY A;  2D2Z A;  4FIW A;  4MJA A;  1R5A A;  1TK0 B;  2H1G A;  1OYJ A;  1BG5 A;  2AYT A;  3EPT A;  4PQI A;  6GSS A;  3UBL A;  2NTO A;  4V1A p;  4BVY A;  2VO4 A;  4ILF A;  1QGV A;  4TR4 A;  1PL2 A;  1XVW A;  2LKU A;  2R5G A;  3F3R A;  1Y25 A;  2H1D A;  3PPU A;  3ZLP A;  5A4U A;  2GZY A;  2FWH A;  2LS5 A;  4MJB A;  1GH2 A;  4K1F A;  2L6C A;  3RHC A;  1VF4 A;  1EEJ A;  2C3Q A;  3H93 A;  2KLX A;  2WS2 A;  3ZIJ A;  3L0H A;  3TGZ A;  1SJI A;  1T4Y A;  3H4K A;  2C0E A;  1THX A;  4WBJ A;  2B5Y A;  3BOA A;  4JBB A;  2VL2 C;  3VWW A;  4MJC A;  2A2P A;  2OJL A;  1GSF A;  2IMK A;  3GST A;  1GSS A;  4HQZ A;  2HI7 A;  5DAL B;  5J9C A;  4CW9 A;  3QDN A;  3FHK A;  1VF1 A;  1B9Y C;  3Q6O A;  4GST A;  2YZH A;  1GTA A;  2YWO A;  5IMC A;  1R5P A;  1TI1 A;  4KDY A;  3HYP A;  3F6F A;  1CQH A;  3BCI A;  4LA1 A;  3O3T A;  2CT6 A;  2JSZ A;  4ACS A;  1F2E A;  3RAZ A;  6GSW A;  3ZFB A;  4ZXG A;  3EU3 A;  2DLX A;  4TXO A;  2LRC A;  3EYT A;  1EEM A;  3IAM 2;  3EC3 A;  2G2Q A;  1AAZ A;  2NPB A;  1UVZ A;  1LBK A;  4FYU A;  2E0Q A;  2H30 A;  5J3R A;  2EIO A;  4F2I A;  4ZB8 A;  4XIH A;  2AB6 A;  2DBC A;  5KN0 A;  4ZBB A;  3VI7 A;  2H73 A;  4FQU A;  4EL1 A;  3LEF A;  2OE0 A;  1EV9 A;  1FG4 A;  1WOU A;  2DIZ A;  2DSA A;  3F3Q A;  4ICY A;  3TRQ A;  1F3B A;  2CV4 A;  1Z6N A;  3KEB A;  3LOR A;  1XW9 A;  3TOT A;  3UAP A;  4PUF C;  5ECR B;  2VL3 A;  4E8H A;  4GCI A;  1EWX A;  4JZQ A;  2VM2 A;  1B48 A;  3D4T A;  2YWM A;  4GRF A;  2H1B A;  3W8J A;  1XWK A;  1T3B A;  2HYX A;  2RLI A;  4E8E A;  3KTB A;  5DAK B;  3CTG A;  2IIY A;  2O89 A;  1ERV A;  4WF5 A;  5CRG A;  5KEJ A;  4XCS A;  1HNC A;  1K0O A;  5IO2 A;  4OFN A;  3H8Q A;  2P31 A;  1M9B A;  3IBH A;  5F06 A;  3G7Y A;  3GFK A;  2LRN A;  5CRD A;  3KMN A;  1XWG A;  1XWA A;  5F05 A;  2B1L A;  4JR6 A;  2FA4 A;  2MMO A;  2QA1 A;  3QD9 A;  5BMU A;  3ERF A;  1SD9 A;  4DSS B;  4KW6 A;  3TJJ A;  4QL9 A;  2JZT A;  3UL3 A;  3GH9 A;  1XVQ A;  3IRA A;  3ERW A;  1GUM A;  3O6T A;  1NHO A;  2H19 A;  3GHA A;  5IOW A;  3IV4 A;  1VGL A;  1U6T A;  1T00 A;  4EUY A;  5EPF A;  2WFC A;  2GT5 A;  1GL8 A;  2LEG A;  1OC9 B;  1CQG A;  1YF0 A;  3RPP A;  3CRT A;  2IWT A;  3N5O A;  4K0N A;  4OMV A;  1WMJ A;  1OKT A;  1K3Y A;  2H71 A;  4BA7 A;  9GSS A;  1GSU A;  2R3X A;  2O85 A;  3IAS 2;  2I9H A;  2B3S A;  3D22 A;  3Q74 A;  4MK3 A;  1T8E B;  11GS A;  2DKI A;  4KUN A;  2WJU A;  4JED A;  1WRY A;  2I1U A;  3FY7 A;  2XPD A;  3TJB A;  4K8M A;  3IK9 A;  4IQ1 A;  1XXU A;  2XBQ A;  5ECQ B;  4XRD A;  3A3T A;  4V1A g;  4TR1 B;  1MD4 A;  2DJ1 A;  4KSO A;  5AIS A;  3C1R A;  1PRX A;  3CYN A;  1O8X A;  1USB A;  4K7N A;  1FAA A;  2YJH A;  2RM6 A;  3LW9 A;  4Z7X A;  1O81 A;  1SKS B;  4KND A;  5JWQ B;  1KEB A;  3HZ4 A;  2NDO A;  2QKE A;  1Q4J A;  1LJR A;  1ZCP A;  2JU5 A;  1E6B A;  2B6M A;  4JE1 A;  3UIW A;  4USS A;  4LMW A;  3HD5 A;  1HYU A;  1GUL A;  4DSR A;  2WCI A;  4WR4 A;  5F0G A;  2KP2 A;  1G0T A;  4J2F A;  1UC7 A;  1BX9 A;  4J57 E;  1AW9 A;  5DDL A;  1GSE A;  6GSU A;  2PVQ A;  3FMW A;  1A0R P;  3RDW A;  2I4A A;  1IYH A;  3GX8 A;  3GUS A;  4HDE A;  4P3Y B;  4BL7 B;  1H75 A;  3KP8 A;  2GSR A;  3N9J A;  1TU7 A;  2K8S A;  1H4O A;  3VK9 A;  3KGK A;  1WPI A;  5GZZ B;  1Z7R A;  4HZ4 A;  1GUK A;  3TB2 A;  1S3D A;  4WF4 A;  5BRT A;  3UBK A;  2ES7 A;  3VPQ A;  2IL3 A;  4OFM A;  3GN3 A;  3MYD A;  2H6Z A;  4I6X A;  4NHZ A;  4K2D A;  3J7Y k;  1JZO A;  3HJM A;  2H76 A;  1MDJ A;  4PQ1 A;  4IBP A;  4MPF A;  3F8U A;  2R4V A;  1SK1 A;  5ECH B;  1M2D A;  2R6K A;  2XBI A;  2JAD A;  4DVC A;  1ZYN A;  5KOW A;  4XS1 A;  5LNK e;  1SJ6 A;  4D73 B;  2RII A;  2F3M A;  5DCH A;  1B8X A;  2LUS A;  2VAF A;  3HZ8 A;  1ON4 A;  3F63 A;  5DBQ A;  1VF2 A;  5KN2 A;  1KNG A;  16GS A;  1XWC A;  5B7C A;  5E4W A;  2J9H A;  5ENU A;  1PQN A;  2GST A;  5CYY A;  2R0G A;  1OC3 A;  1OVN A;  2GSQ A;  3C73 A;  1SKR B;  1SYR A;  2I3Y A;  2AJQ B;  4PXO A;  4IGJ A;  3ZRD A;  4BWQ A;  2KHP A;  4EE0 A;  3E3E A;  3IE3 A;  4PNG A;  1WIK A;  1YY7 A;  4PGT A;  2YJ7 A;  2B1K A;  1XOB A;  3FRC A;  1ABA A;  2VCW A;  3KCM A;  3GTU A;  1EP8 A;  2VCV A;  1TW9 A;  3R3E A;  4V2L A;  3WGD A;  1AC1 A;  3F4T A;  1HQO A;  2H74 A;  2HT9 A;  3KJY A;  5KN3 A;  2UZ8 A;  2K9F A;  4HOJ A;  2HZE A;  2C3N A;  5IQY A;  4RQR A;  1ML6 A;  2JAC A;  5ECN B;  3I43 A;  4Z2U A;  3CSJ A;  5L71 A;  3HDC A;  3EMP A;  3SWL A;  3DKS A;  3VI5 A;  3D5J A;  3LYP A;  4G0K A;  2CVD A;  3VUR A;  1MDK A;  3OR5 A;  2TRX A;  2V32 A;  3DRN A;  2P5R A;  3RPN A;  2KP1 A;  5G5F A;  3F4R A;  4TN8 A;  3M8N A;  3CSI A;  1ERU A;  3QCP A;  1G6Y A;  2TIR A;  2H0I A;  2VL9 A;  1TRV A;  4L8E A;  3A2W A;  2FGX A;  3GL3 A;  4CDO A;  3ED3 A;  5IPG A;  3IR4 A;  1GSQ A;  1GWC A;  4LMV A;  3DEX A;  3ZVJ D;  1M99 A;  2FUG 2;  2P5Q A;  3KP9 A;  1XW6 A;  2X8H A;  5IOX A;  4K7O A;  4EKZ A;  4GQC A;  1R26 A;  4V2N A;  5DQY A;  4Q5R A;  2DC5 A;  4KAE A;  4PX1 A;  4TW5 A;  2VL2 A;  4TR3 A;  5IIZ A;  1TKD B;  1RQM A;  4XS4 B;  3CSH A;  1LU4 A;  3GL5 A;  5AGY A;  3UVH A;  5FHI A;  3WYW A;  5EY6 A;  2HE3 A;  4L0U A;  2MBS A;  1U3A A;  1K0N A;  3VWX A;  1JLW A;  1MTC A;  10GS A;  2YPM A;  2OA7 A;  2P0G A;  1UN2 A;  5DAL A;  1BED A;  4MF7 A;  2KOK A;  2O87 A;  3QOU A;  1SYX A;  2A4H A;  1OAZ A;  4I2U A;  1SKW B;  1PKZ A;  2F8F A;  3DVX A;  1N8J A;  3LWA A;  1GLP A;  2R0C A;  3ZMK A;  4KSM A;  4A5P A;  1DSB A;  3EIN A;  1V57 A;  3APQ A;  4RUV A;  4EIQ A;  2IN3 A;  4PTS A;  3FR6 A;  1WWJ A;  2IPA A;  4NXI A;  3FR3 A;  1I9D A;  3UVT A;  2TRC P;  6GSY A;  4K9Z A;  1B4P A;  4MMM A;  5HR0 A;  5H5Q A;  2MMA A;  4WR5 A;  1J9B A;  2PWJ A;  4BVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...