4MZPA

Mazf from s. aureus crystal form iii, c2221, 2.7 a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
PIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MazF mRNA interferase
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 32
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mzpA00
1UB4A 2C06A 3JRZA 5CQXA 2KMTA 4VUBA 5DLOA 5CKHA 4MDXA 5HKCA 3HPWA 2VUBA 1M1FA 5CKFA 5CK9A 5HK3A 4HKEA 5HK0A 5CQYA 1NE8A 3G7ZA 1X75C 4OF1A 5CKDA 3NFCA 4ME7A 5CCAA 2MF2A 4MZTA 5CO7A 4ELYC 1VUBA 5CKBA 4ELZC 5CKEA 4MZPA 5CR2A 3TCJA 4MZMA 3VUBA 3JSCA
chains in the Genus database with same CATH superfamily
3I55Q 1QVGS 5CQXA 3BE3A 3EHRA 2YLCA 2XHCA 3J81E 4C0ZA 1Q7YC 1XQHA 4EMHA 4F7UG 4R56A 3CCST 3L1AA 1K9MU 1ZSZA 1AZEA 2C0OA 5FU6B 3KBGA 4AFSC 2KVQG 3L2RA 4BI8B 3OA6A 2X51A 3D7SB 1YJNA 1I1JA 2P0QA 4KH0B 3ASKA 3SWNA 5HKCA 1SRMA 1O75A 3P8DA 4DEYA 4XTWA 3CCLQ 3DB3A 1ZA2B 3M55A 1TS9A 2V8JA 2I2LA 3RKXA 1RL2A 5I2SA 1VQ4A 2MIOA 4ANJA 2GTJA 1JB0E 2RI2A 4LXCA 3OW2P 2V26A 4DBFA 2GFUA 5D6XA 3CCVQ 2AK5A 2DEQA 3SEMA 1UHFA 1VQ6T 2M16A 3EG0A 4JJBA 3X25B 2RJEA 1PSEA 5IHNA 5KYWB 1MMGA 4F17A 5KYXB 2LQWA 1SRLA 2J6OA 3LGFA 4HCZA 1FWZA 1H3HA 2VB6A 3MEAA 1AWJA 2G3RA 3M53A 5M9OA 1M1GA 1Y71A 2CUDA 2LQKA 4J5YA 5IHIA 4HKEA 1FMVA 4RKUE 2RJCA 1VQMQ 3H0IA 2AKKA 3JCMX 1YIJA 1H92A 3AT1B 2FRWA 3VYGA 3QDFA 2R57A 5KYUB 4LE9A 4RTVA 2FB7A 2A3LA 1RADB 5IXFA 4F14A 3CC7A 2YDLA 3CCJQ 1G2BA 1NYGA 5GAN5 2GNCA 3EFRA 4RTZA 4AFQC 5LJ3f 3HRTA 3CCUQ 1QWFA 2GCXA 4EPCA 2MF2A 5A2QE 1NLPC 5CKBA 2LX9A 3I55A 3OMGA 1MMAA 2CYZB 2CP0A 2DXCA 1K73R 1NEBA 1YJWQ 1W1FA 2HQEA 5KYYA 4R0KA 3JCMd 1C6VX 4LUDA 5A0DA 1V1CA 1K4US 2CREA 3CCEA 2QA4T 1SSHA 2DD5A 3OMCA 2DLPA 3EFOB 2PUOB 2GGRA 4HVUA 1NPRA 3OSVA 2E3HA 4C92A 4AG1C 3CCQT 1JRIA 2A28A 2V1QA 5GAN4 2YUPA 2DJQA 5CCAA 4OMNA 2PQWA 3KUFA 1VQ7T 2HKNA 1XJWB 2EYWA 3L2QA 3G6ET 3JCMQ 1TU0B 5LJ3d 3RDVA 3CD6A 2DAQA 2C0TA 4RG2A 2LQ8A 4M77A 3RKYA 7AT1B 3JCMW 3OBWA 2BE9B 1AEYA 1NE8A 1M90C 4J83A 2CP5A 1M3CA 1YJ9A 4A4FA 4DBHA 2RA2A 4Z02A 2LC4A 1BCOA 5L23A 2HQHA 5GANf 3RR6A 3UA6A 3DKMA 4IUUA 1S1NA 1Q81C 2LVMA 1UG1A 1PD1A 5LJ5f 4PK4A 3CPWP 1KQSA 2DD4A 2XU8A 3MEVA 4PFZA 3QBYA 3PGGA 3JCMJ 3QWYA 1YHQA 4XTVA 3NPFA 1M8VA 2NUTB 2DL7A 3OSSC 3UF4A 2E65A 1LOJA 1RI9A 2R58A 2PUKB 3JSCA 4IIOA 4A4KA 4N4IA 1GL5A 1V29B 2RD1A 4C8QC 4F7UE 1BB9A 1XNIA 1I5LA 4LD6A 5A0LA 4FU6A 4TVRA 1UGQB 3M0SA 1R8OB 3VS4A 2DTHA 3MCAB 4XTZA 1WLPB 4M7DC 1M8MA 4KGZB 1IHVA 2M51A 1VYVA 1YJWA 4VUBA 4JZ4A 1N8RC 3FEOA 4NOYA 5GANd 1YJNT 2JTFA 2CP6A 3JCMP 2EGCA 1IRXA 1YWOA 2M0OA 4WTOB 1WFWA 5LJ5d 1AZGB 1X2QA 2RHUA 3PFSA 2VWFA 3BFMA 5KYWA 4C8QA 3G71T 4E7JA 1HSQA 2DL5A 4OMLA 2NWMA 1G83A 2K79A 3E9GA 3TREA 2L3RA 3JCMV 2RQTA 4JLGA 2COZA 2DTOA 1IXDA 1N5ZA 1NJIU 1MGQA 3S3NA 1JXMA 2VXFA 3RMSA 4GLMA 4XK8E 2QQSA 4M7DA 1KHIA 4IUQA 2BZXA 5GAOl 2F2XA 2PZ1A 2CSIA 3I9QA 3JCMb 1VQ5Q 3CEYA 2FG0A 1R77A 5KYUA 3UT1A 2DIGA 2R5MA 5FWCA 1ZBXA 3JCMe 2MAMA 4XQ3A 3VJPA 1CKAA 1K8AU 1PM3A 1Q86R 1YIJT 1OPLA 4OMOA 2ENMA 4OVAA 1ZSZB 1W2BA 1AWWA 2YRCA 3LW5E 3QKJA 4DQ2A 4GY5A 3MEUA 4EMGA 2D9TA 3OQ5A 3SWNB 4AMCA 1FXXA 2HL5C 3OYFA 1U1TA 2RQUA 5LJ3e 4IIMA 2BTTA 2O31A 4F04B 5GAOq 4ATOA 3FB9A 3CCQQ 2W10A 3OBYA 4BDYA 2NLUA 3C12A 1M30A 4ESRA 5IXBA 5GAMf 2QTXA 1TG0A 2HKQB 4C92F 4FYYB 3DLMA 2PU9B 2E12A 4HA8A 3TSZA 3EFOA 5CR2A 1WHKA 1GXIE 4JLIA 4PJOC 5FLXE 1VQLT 2XDDA 2EQJA 2RK1A 4J6YA 2HAXA 3CCET 4XU2A 3M4YA 4GBQA 1M1FA 4C92G 1QMCA 2FPFA 4M77F 3KXTA 3A8LB 4J7FA 1AWOA 1N27A 3E19A 5HY6A 1JXOA 2DEUA 4PKCC 4RTUA 4NL2A 4PJLA 2HCKA 1VQKT 5FROA 3CC2Q 1RACB 5GMKm 1T3SA 1T3LA 1TTHB 2DVJA 4CC4B 5LJ3j 3L42A 1K9MR 4C0DC 3MP1A 1VQPT 4IUTA 4M77G 3E9FA 3M54A 3CD6T 5GAN6 3G1JA 2L89A 3CXCA 2ABLA 4PJOA 2XDBA 1K1ZA 4C92D 2AZVA 2YT6A 5GAMd 4B9XA 4M75E 2DTIA 3CBMA 1VQ5A 1B34B 3CMEQ 1RAAB 4M7AC 4QQDA 4DEXA 4KRTA 5GANe 2Y4YA 2QTVA 5GAN7 1WGSA 2AIRB 1OU8A 2SEMA 1JU5C 1PG5B 1BI0A 1XOVA 1U1SA 4Z8AA 1KK7A 2V1RA 1FX7A 4FW1A 1B3QA 2EJGA 3I56T 5EG2A 1FMWA 4M77D 2E3IA 2FZKB 2D0QB 4OMQA 1O9SA 2LJ0A 1OX8A 3VS7A 3M58A 1W6XA 4E7HA 2H3JA 3MO8A 1JJ2P 3AHUA 2M1HA 1VYUA 4KBMB 4XU0A 5IT9E 3UATA 1VQ8A 2IPOB 1LCKA 1VUBA 2RQRA 2YWWA 2EIFA 1X6GA 3L2ZA 4QVCA 1TWBA 3H9NA 3JCMg 2DE0X 1SKUB 3HFOA 2FHDA 3NTKA 1KQSS 4BACA 1GCQC 4PLIA 3LYIA 4M7AA 3OS5A 4Y92A 4C8QF 3A8MB 3TEEA 2IG0A 4FSXA 3JV3A 5CQYA 1WYXA 3QHSA 1M9SA 1XTDA 5I2MA 1M27C 4KGXB 3SHWA 4A54A 2B8AA 3HHTB 5GANj 4BE1A 2DL3A 5LJ5j 3QPHA 1RAEB 1S72A 2J7IA 1VQNQ 3QO3A 3S6WA 4M7DF 3MHXA 5FRMA 4E2FB 3LGLA 1QCOA 5LJ3g 1KHCA 3INZA 2M0YA 1BCMA 3OYBA 1IGQA 1ZUKA 1GCPA 3HTRA 3QDRB 4IUVA 3VU3C 1WI7A 2CH4W 4IKFA 3CC2A 2E10A 1SHGA 2RQVA 3R6OA 1I81A 3C95A 4JUVA 4FSSA 4RCBA 1GCQA 3M0TA 2WACA 4Z89A 2COWA 2EGAA 1SEMA 4L5GA 4AFUC 1M3BA 5HK0A 2CP3A 2ZAEA 1ZLMA 4C8QD 4HT8A 3JCMh 3WVDB 4PNOA 3F70A 1RAFB 2J05A 2XG8D 2L5QA 1EFNA 2ROLA 4Y91A 3RIRA 2QGGA 1M1KU 5GAOn 2CZ7B 2QDLA 2DJZA 3PVQA 4A4GA 1BI3A 2X4XA 1Y07A 4E7ZA 3C94A 2J6KA 4LDUA 4D6WA 3TVTA 1MMDA 3M59A 2DKGA 3TQ7P 5CO7A 3L2UA 1WHMA 3Q1JA 2CDTA 3P8BB 2CUBA 1YITQ 3G4ST 1VQOQ 2BZ8A 3FRNA 1PHTA 2F5TX 3EGXA 4B9WA 4M78E 4MDXA 1QP2A 3CC4T 4LD9K 4C5EA 5D7UA 4C8QB 1U8RA 4ZGDB 5J26A 4II1A 4J9EA 5GANg 3ZBDA 2FRYA 3VYHB 1WJQA 1Y96A 4PL6A 1WX6A 3EHQA 3QIIA 2O4XA 2XICA 2YXYA 4QKUA 5LJ5g 5GAMe 4C0GA 2CKKA 4J9GA 4C92E 4AT1B 3GF5A 3GNGA 1W2BS 3OW2A 3CCRT 2DF6A 2E5KA 1K0XA 4M7DB 3JB9J 2LP5A 4OP0A 5GAOp 1KD1U 2OTLA 1OQKA 2DM1A 2OTJQ 1OYXA 1AT1B 1RUWA 2RJFA 2A37A 3CCMQ 4EIKA 4M77E 3PT9A 4PFOA 4PJOF 3M0PA 4XU1A 4XTXA 2CH4A 1ZUUA 2COYA 4J6XA 1NEGA 4B6MA 1J3TA 1NBEB 4OB3B 1SG5A 3OS0A 3TU4K 1Q82C 2EPDA 2MOXA 5AT1B 1YNZA 1QW1A 2C0IA 2L3SA 2PNIA 1BYMA 3H8ZA 2RMOA 2HEQA 2AKLA 2E6NA 1G3SA 2LDMA 4RUGA 1B34A 2DA9A 2MPXC 3NMZC 1TSFA 5KE3A 3H41A 1ACMB 5KCOA 4E7IA 1OOTA 1QVFP 5I21A 5GAMj 3PIOA 3H6ZA 1VQ9T 2EJFA 1TOVA 4AFZC 2KBTA 1X43A 3PVLA 2P84A 4MZTA 3MKDA 3I5RA 2FO0A 3EGUA 4JPBW 3QSUA 2G6FX 1KJWA 1YI2T 3OYJA 3CCLA 1NJIR 1Y7XA 4M7AF 4PJOD 3EG1A 1HD3A 5DLQE 1LNXA 1HJDA 1QP3A 1UDLA 4PJMA 4QQ6A 3CXCS 2I0NA 4PLLA 1OU9A 1IREB 4FYWB 3CCVA 1VQOA 2QEXQ 2EVRA 3HSBA 1Y0MA 1E7OA 2HNIA 4YTLA 2K4YA 2O9SA 2HQXA 1JBMA 2GTOA 1TUDA 1K8AR 2K3YA 3M0QA 1QCFA 2NYSA 3CPFA 2FL7A 2MI6A 3GP8A 5HCKA 1X69A 4X9DA 2QXFA 4O5VA 2JT4A 1QKXA 2F2WA 1EZZB 1PNJA 4LDXA 1VIEA 1N6AA 4PJOB 1S72T 3J80E 2A0FB 1G5VA 1VQMA 2QGFB 2MYSA 3CMAT 3HL8A 2K57A 3QWXX 3CCSQ 1FYNA 2IVWA 2LNVA 2DL8A 2OTJA 1N9SA 1YCYA 4F16A 1OPKA 4E7KA 3CCMA 2AZSA 5GJVB 4CRIA 1VOMA 4JZ3A 4XTYA 2H3EB 2NUPA 4BD3A 2A7YA 3RERA 4QVZA 5DY9A 3CCJA 5GAMg 3HFNA 2B86A 3M0RA 4JJCA 3GBQA 1TUGB 3HPWA 5CKFA 3CCUA 2DXBA 4CI0C 2OAUA 1TH7A 3CPWA 3EGDA 1WNLA 4KUDK 1K9MC 2JOYA 3X28B 4L6V5 4C0DB 4OGEA 2W0ZA 5CKEA 4L59A 1QVGP 1Q95G 3EH2A 3LX7A 1VQ6Q 2D8HA 2MMPA 3OYLA 1WHHA 1Z9QA 3JRZA 2AT1B 2EQMA 4J6WA 2RNAA 3ME9A 5GAOm 2EQUA 5HK3A 2X4JA 1BKBA 1ZX6A 2ESWA 3C4SA 4M7AB 2RF0A 2DETA 1VQ4T 1QCNA 2K5IA 2DBMA 2K3BA 3M4GA 3V8KA 1X75C 2KRMA 1JEGA 4ME7A 2JMCA 4RTTA 2YLBA 2KT8A 2FZCB 3VUBA 4XTUA 2A36A 1ZA1B 3J7AF 2OJ2A 2DX1A 1ZHIA 3GLXA 4N0AC 3H0FA 3C0CA 5C6SA 1KC8C 1ZQ1A 4A53A 3HP9A 2GBQA 3QXEB 2F2VA 4M4ZA 1M2OA 2JNGA 1VYTA 2VV5A 3MJXA 3E2UA 3UWNA 1MMNA 1I4K1 2OTLT 3MPUB 4C5GA 2VXEA 5CVIA 5FU7C 2HMAA 1UJ0A 4FW2A 3M57A 2O2OA 4J9HA 3DB4A 4BDZA 1YN8A 1WZOA 4DA4A 1Q7YU 4F7UA 2ED0A 3JAME 2QI2A 3OYCA 2YUQA 3CC7T 1WQWA 1QKWA 1KQ2A 1KG1A 2QA4Q 3BDLA 1YI2Q 3O5ZA 4A63B 1M3AA 4PFPA 1JO8A 2E4HA 4N0AA 2K9GA 4RCCA 3IQLA 2LCCA 3I55T 3GPLA 1K0SA 3ZL7C 2VYTA 2ED1A 4J8OA 2CT4A 4Y28E 2VGNA 4J9DA 2X9HA 2F5KA 1NLOC 3OYHA 4CC3A 1WXTA 4X1VA 3EGXB 2EAYA 4WF2A 1VQ7Q 4R55A 1BU1A 4ORZA 2CSQA 2RJDA 3OYYA 3G6EQ 1LVKA 3M5AA 2YSQA 4O6JA 2KEAA 1VIFA 2D1XA 1B7TA 3NGPA 2R5AA 5L8RE 1Y96B 2KRNA 2VGMA 2O4XB 1RI0A 1MHNA 1Q81R 1AOJA 2RQWA 2X4YA 3GNFB 2MK5A 3QG1A 1GFCA 4JRKA 2ZPGB 2EYXA 4FL6A 4OMFB 3VUZA 2CS7A 4DOWA 2M02A 1N9RA 2DRKA 2YRVA 1HK9A 1WIEA 3CCVT 2P4TA 2JJ9A 1PKSA 9ATCB 1OV3A 1JQQA 1M1KR 1MNDA 2E70A 3JCMc 1IB8A 4QT7A 2DO3A 2PVGB 1NZ9A 2ZPEB 2JTEA 2HSPA 3FJ5A 2JUFA 1YJ9T 1UJYA 4FYXB 2QQRA 2DFUA 4HVVA 2FYKA 2DRMA 2RHZA 5CK9A 2XD0A 4ZNXA 4N4GA 2DYIA 4BI3A 2E6ZA 5LJ5e 3VS2A 2JS0A 4RG8A 1N8RR 2H8HA 1YHQT 2KQWA 2JN0A 4JS4A 4JJNK 3RESA 1NM7A 2EKHA 1YJNQ 2ZGWA 2SRCA 4JRIA 1PCXA 2K7AA 3CCJT 3QJ6A 2QA4A 2PVDB 1YWPA 1GRIA 4ELYC 1ABQA 3CCUT 1VQ4Q 2O88A 1TUCA 3RUXA 3TCJA 5D6YA 2JVVA 4LUEA 3G71Q 1SHFA 1HXDA 2BZYA 3UDCA 3CCQA 2JM9A 3UPUA 4J9BA 3QUIA 1VA7A 1RAGB 1KD1R 2ATCB 3U23A 2EQKA 3WVEB 5IH2A 4RMOA 2KK4A 4M75C 1YJWT 3T9NA 2RI3A 1K73C 4ZGEB 1YBYA 1PWTA 4N4HA 1JJ2A 4WCIA 1BI1A 1QWEA 2K3XA 3X26B 1BI2A 1I8FA 1ABOA 1D3BA 4LN2A 2E64A 4RTYA 2CP7A 4C8QG 3HRUA 1YP5A 5D6WA 4BUGA 3CPWS 5KCHA 3S3OA 1WA7A 3EG3A 1MV0B 1M90U 3VS0A 3LH0A 1YIJQ 1PRMC 4K11A 1WXBA 4BI4A 4OMMA 2DL4A 2D0NA 4RTWA 3QZ9B 2CP2A 4JRQA 5EC7A 4M7DG 2J6FA 1Q81U 4OMPA 3VS6A 3VKIA 1DJ7B 3QJYA 1W4SA 3A8GB 2NUPB 3OS2A 4M75A 2YRDA 3OYAA 3E1SA 4F7UF 3SFMA 2VVKA 2HBPA 3A5ZB 5GAN2 4QVDA 3EGDB 3DLLA 2LNHB 2DERA 2Y4XA 4X34A 1Z9ZA 1UUEA 3CMEA 4KH1B 3A8HB 1I07A 4BY6C 1V76A 4RTXA 1OZ2A 2YUNA 3V8JA 2CZ1B 4M7DD 2XIDA 3VS1A 1KSWA 3REBB 4ZGJB 1C1AA 1VQLQ 2QYZA 2L3PA 4NL3A 3CCEQ 5LJ3h 2GQVA 5GAN8 4IURA 1R0CB 2ZPBB 1N8RU 3RNJA 1I5OB 3M0UA 1UEBA 2QK0A 1BBZA 1PC0A 3FJPA 2XI9A 3NFCA 1M5Q1 1VQKQ 3G71A 2Y90A 2OI3A 1QQJA 2X3XD 2D6FA 1VQPQ 3PMTA 2RPNA 3CD6Q 3TSWA 2HSEB 5GMKe 2KNBB 2MWPA 5GAN3 1YJ9Q 3BW1A 1WPYA 3EG9A 1VQNA 2EKOA 4FT4A 1KIKA 2DNUA 1ZSGA 2FVUA 1ZBJA 4C5HA 3JCMf 1E6GA 4QW2A 3R6NA 2ROTA 4E7SA 5KYNA 5J39A 2EYZA 2YHTA 1KC8U 2EW3A 2K2VA 4FM4B 2VC8A 3X20B 2FZGB 2HD0A 4E47A 3I56Q 1D0ZA 2RHXA 1RAIB 1QLYA 4M78C 2FEIA 3OYIA 4V2SA 1OX9A 1YHQQ 3V7CA 1P92A 4EMKC 2FPEA 3UA7A 3OYDA 4F7UB 4PJOG 5CAIA 4HCCA 1IGUA 3V7SA 1X2KA 1NYFA 2KAFA 1UGVA 2QASA 1E6HA 3EFSA 4LNPA 4C92C 3THKA 2KI7A 5GANh 1VQ5T 3HRSA 3OYGA 2XMFA 2DXTA 5LJ5h 5GMKj 2JM8A 2LMJA 1UGPB 2OX7A 2LX7A 3I35A 1UB4A 3O8VA 2KSSA 1H641 1X6OA 2KMTA 5LL6S 3PMIA 1Q86C 2KGTA 2LQNA 3HKSA 4M77C 2O9VA 5FU7B 1PSFA 1QVFA 3VS3A 1CSKA 1VQLA 4M78A 4C5IA 2JZ2A 1X6BA 2K6DA 3LWIA 2GF7A 4EMKA 2Z0WA 1U5SA 1TXQA 2LRQA 1YITA 2QQAA 3REAB 1VQ8T 2E1HA 5CKHA 1G3YA 1WQ7A 2DXUA 4X9CA 4JS5A 4M7AG 2VUBA 1A0NB 3WXMB 1VQKA 1F1BB 2L3QA 2LZ6B 4PJNA 2ZCFB 3GOXA 4A4HA 1MV3A 5KE2A 4C8QE 2RHYA 4MZPA 1C0MA 1KQSP 3SB2A 2OAWA 1VQPA 3M9QA 2RH2A 3CQTA 3EAEA 4KUIA 1Q7YR 2KR3A 5DLOA 5A0GA 1WJRA 1B07A 1IO6A 2KYBA 3OY9A 2QAZA 2BE7D 2RHIA 4M7DE 5FU6C 4M75F 4J7IA 2HL3A 2KROA 4M7AD 2BKDN 2RK2A 2RI5A 4CC2A 4OB0B 5IAYA 3CC2T 3PE0A 2EBPA 2DIQA 3I56A 2PVOB 4C0FA 4M75G 2NUZA 1T0HA 2WSFE 2M9UA 2CZ6B 1JJ2S 2KE9A 4OB1B 2L0AA 3V8LA 2DZ9A 2LCLA 3G4SQ 2HZYA 1M1KC 4UC4A 1PKTA 3FC3A 3FIFA 3CC4Q 1SF9A 5DM7R 3PNWC 1LPLA 3OYMA 1UTIA 2GQIA 4DOVA 4KT0E 1NPPA 3CMET 2DYBA 3EH1A 3OYEA 1EIFA 4LDVA 2KXDA 1KFZA 2VASA 1WHLA 3ULRB 4JDSA 1ARKA 2EJ9A 2K2MA 5J3BA 1X01A 3CCRQ 4M75D 2XK0A 1YFNA 2C06A 1G3WA 3ER0A 1G8XA 1QVGA 5FRNA 2PTKA 1UGRB 3NTHA 2K5LA 1D3BB 4Q5WA 3V7RA 3L2VA 2E5QA 1K73U 3EG2A 5IHKA 1RLQC 1AWXA 2L8DA 4FYVB 1AHJB 5CIUA 1AVZC 2QEXA 1R0BG 2WSEE 5KYXA 1Q82R 5GAMh 4ZN1A 2ZPHB 4Z88A 1RAHB 2HBWA 3GIBA 1KD1C 3URGA 1U06A 3META 4CC7A 1OULA 5GMKh 2VKNA 4MMLA 4FT2A 1W2BP 4M75B 3QZ5B 2A08A 1BK2A 3FLGA 2DVEA 5ECAA 1PRLC 1UFFA 1VQ9Q 1OEBA 2WSCE 4LDWA 1M2VB 1D1AA 1VQNT 1YCSB 3CCSA 4HCBA 1H3ZA 4PJOE 5AYFA 2DMOA 2JTMA 4OF1A 3RMQA 5FWBA 1GBQA 2QQ9A 3QYGB 4ELZC 4DBQA 3OB9A 4J9FA 4FIBA 1WJSA 8ATCB 2IIMA 1D09B 1MNEA 4HVWA 4QQGA 3OW2S 4NS5A 2V8KA 4MDWA 4A4EA 2MWOA 4OGCA 2JS2A 3NTIA 2KYMA 1K9AA 8AT1B 2QG9B 2ZPIB 1D1BA 1I0CA 3KFVA 4MMKA 4ZTJA 2E41A 3RBBB 1GBRA 3G4SA 3JB9F 4J9IA 5GJWB 1VQ8Q 4M78F 2X4WA 1VQ6A 2CZ0B 3CC4A 4BB7A 2EQIA 3MP6A 3SDZA 1M90R 1HYOA 1MUZA 4BE0A 3OS1A 1IHWA 2ZPFB 2X35A 2RB6A 4BY6B 3JB9I 5CKDA 3JB9G 4D8DA 2LJ3A 6AT1B 4M78G 4KGVB 3CCLT 3MEWA 3CCRA 3LH5A 3NHNA 2RM4A 4M7AE 2P0PA 5FW9A 4IUPA 4HXJA 1UGSB 3QYHB 3FDRA 3RKWA 1S72Q 3LLRA 2XDPA 1WHGA 4XAXB 2YUOA 3A8OB 4E7LA 3CMAQ 3BDUA 3EG9B 2DZCA 3SD4A 1YITT 4OB2B 1BIBA 1VQOT 1AD5A 1CKBA 1SPKA 3CXCP 3LWHA 1ZUYA 4LDYA 1WHJA 3OYNA 2KXCA 3ZFJA 3PIPA 3I5SA 3MP8A 1FMKA 3N5BB 5GAOr 3JB9D 2XKOC 3CBOA 3H0HA 1KQ1A 4M78D 1T0JA 2JW4A 1QVFS 1QVPA 3ZEHA 1Q82U 3A98A 2DBKA 3CBPA 1UE9A 1H8KA 5KH6A 2JMAA 1VQMT 2LCSA 3S3MA 2KDSA 1VQ9A 2OTJT 1M4ZA 2EWNA 2JXBA 3CCMT 4HCKA 2ECZA 2EYYA 4KULA 2LT4A 1G3TA 2NUTA 1U3OA 2RO0A 1BIAA 2P0KA 4JRPA 5I11A 3JB9H 1WXUA 5KYYB 1YI2A 3P8HA 1X27A 3L2WA 5GMKl 1GFDA 1RLPC 2BIVA 4JJDA 1UHCA 2EYQA 4BE2A 4M78B 2DILA 2O01E 1NG2A 1K76A 4EMKB 2LTOA 3A1PA 5I22A 4AG2C 1Q86U 2HDAA 4ZN3A 2X3WD 3BY7A 1VQ7A 5GMKi 2ZZDA 1OZ3A 2CT3A 3G6EA 2QDYB 3M56A 4C92B 1LJOA 2D8JA 4PJJA 2KT1A 4MZMA 1KC8R 2DPPB 4DBRA 4E6RA 3OYKA 2F69A 1Y57A 2P4RA 4XU3A 4GLKA 1D0XA 4J9CA 3VV0A 2FPDA 4P5NA 2EGEA 2L2PA 3X24B 1RABB 2LT1A 1NJIC 4M77B 1EX4A 2OTLQ 4HT9A 4FCYA 1ZSZC 4D8KA 1OI1A 1W70A 1D0YA 2GFAA 3VRYA 1IZ6A 3CMAA 2RN8A 2QEXT 2AHJB 2QQBA 2V8IA 3SWNC 4ZTFA 3CC7Q 1SSFA 3VRZA 2CGHA 2BUDA 2EFIA 5IN1A 1WDXA 3VS5A 2F1LA 3G7ZA 2DK3A 1UECA 4EDUA 2LJ1A 1D1CA 2MCNA 2KRSA 2K5FA 1K8AC 2KY9A 1PD0A 1M2VA 3PTAA 2J06A 5C0MA
chains in the Genus database with same CATH topology
1UB4A 3O8VA 5GMKm 1QVGS 2KSSA 1VQ4T 5CQXA 1H641 1X6OA 2KMTA 5LL6S 2K5IA 3PMIA 5LJ3j 3L42A 1Q86C 2YLCA 3HKSA 4M77C 4C0DC 2XHCA 3M4GA 3MP1A 3V8KA 3J81E 4C0ZA 1VQPT 4IUTA 4M77G 1Q7YC 3E9FA 1PSFA 5FU7B 1QVFA 3M54A 3CD6T 1X75C 1VQLA 1XQHA 5GAN6 4M78A 4C5IA 4ME7A 4EMHA 4F7UG 4R56A 2JZ2A 3CCST 2YLBA 3L1AA 1K9MU 3LWIA 2L89A 2GF7A 4EMKA 3CXCA 4PJOA 3VUBA 2XDBA 4XTUA 4C92D 2LRQA 5FU6B 3KBGA 1YITA 3J7AF 2QQAA 5GAMd 2KVQG 3L2RA 4BI8B 3OA6A 1ZHIA 2E1HA 4M75E 3GLXA 4B9XA 1VQ8T 1YJNA 2DTIA 4N0AC 2P0QA 3CBMA 1VQ5A 5CKHA 5C6SA 1G3YA 1B34B 3ASKA 1WQ7A 1KC8C 4M7AC 2DXUA 3SWNA 4X9CA 4QQDA 5HKCA 5GANe 4JS5A 1O75A 2VUBA 1ZQ1A 2Y4YA 3P8DA 4A53A 4XTWA 5GAN7 1WGSA 4M7AG 3DB3A 3HP9A 3WXMB 3QXEB 1VQKA 3M55A 2V8JA 2ZCFB 2I2LA 1BI0A 1RL2A 1U1SA 1XOVA 3RKXA 4A4HA 5I2SA 2JNGA 1FX7A 1VQ4A 5KE2A 2EJGA 2VV5A 4C8QE 2RHYA 3I56T 1JB0E 2RI2A 4MZPA 3UWNA 5EG2A 4M77D 1I4K1 3SB2A 2OTLT 2GFUA 1VQPA 4C5GA 2D0QB 2VXEA 5D6XA 5CVIA 3M9QA 1O9SA 2RH2A 2DEQA 3EAEA 4KUIA 5FU7C 1VQ6T 2M16A 5DLOA 5A0GA 3X25B 2RJEA 1PSEA 3M57A 1WJRA 3M58A 3OY9A 4E7HA 2H3JA 3DB4A 3MO8A 3AHUA 2M1HA 4BDZA 4DA4A 4KBMB 2RHIA 1Q7YU 4F7UA 4XU0A 4HCZA 3LGFA 2QI2A 5FU6C 3JAME 4M75F 3OYCA 3CC7T 1WQWA 5IT9E 1FWZA 4J7IA 1VQ8A 1KQ2A 1KG1A 1VUBA 2EIFA 3BDLA 3L2ZA 3MEAA 4QVCA 4M7AD 2BKDN 2G3RA 3JCMg 3M53A 5M9OA 2RK2A 2RI5A 1M1GA 3HFOA 2FHDA 4N0AA 1Y71A 3NTKA 4OB0B 4BACA 1KQSS 5IAYA 4RCCA 2LQKA 2LCCA 4PLIA 3CC2T 3LYIA 4J5YA 4M7AA 3I55T 3OS5A 4C8QF 3GPLA 3A8MB 3TEEA 2VYTA 4J8OA 4Y28E 2IG0A 2DIQA 2VGNA 4FSXA 3I56A 2PVOB 4HKEA 5CQYA 2F5KA 4C0FA 4RKUE 2RJCA 4M75G 3QHSA 1M9SA 1XTDA 5I2MA 3OYHA 3JCMX 2WSFE 2EAYA 2M9UA 4WF2A 2CZ6B 4A54A 4R55A 1YIJA 2B8AA 3HHTB 3VYGA 5GANj 1JJ2S 4OB1B 2RJDA 3OYYA 4BE1A 2R57A 3M5AA 3V8LA 2DZ9A 4O6JA 1VIFA 2LCLA 5LJ5j 3QPHA 1S72A 1M1KC 4UC4A 2FB7A 3FC3A 2R5AA 2A3LA 3QO3A 3MHXA 3S6WA 3FIFA 4M7DF 5L8RE 5FRMA 5DM7R 1Y96B 3CC7A 3PNWC 2VGMA 3LGLA 3OYMA 5LJ3g 1KHCA 2O4XB 3INZA 1RI0A 4DOVA 5GAN5 3EFRA 4KT0E 1NPPA 5LJ3f 3CMET 1MHNA 3OYBA 3HRTA 2GCXA 3QDRB 4IUVA 3OYEA 4EPCA 1EIFA 2MF2A 4LDVA 5A2QE 3VU3C 2X4YA 5CKBA 4IKFA 3CC2A 3GNFB 4JDSA 2QA4A 2E10A 2EJ9A 2LX9A 3QG1A 3I55A 4JRKA 5J3BA 1X01A 2ZPGB 4FL6A 4OMFB 3OMGA 3R6OA 1I81A 2XK0A 4M75D 3VUZA 2C06A 1G3WA 2CS7A 2CYZB 3C95A 3ER0A 4JUVA 4DOWA 1QVGA 5FRNA 4RCBA 1N9RA 1UGRB 2DXCA 3NTHA 2YRVA 2WACA 1HK9A 3CCVT 2P4TA 2K5LA 2HQEA 4L5GA 1D3BB 5HK0A 4Q5WA 3V7RA 3L2VA 2E5QA 1K73U 4C8QD 4HT8A 3JCMd 3JCMh 3WVDB 2L8DA 2E70A 3F70A 4PNOA 1AHJB 5CIUA 3JCMc 5A0DA 2XG8D 2L5QA 2DO3A 2PVGB 2QEXA 1NZ9A 3CCEA 2QA4T 2ZPEB 4Y91A 3RIRA 2DD5A 2JUFA 2WSEE 3OMCA 1YJ9T 5GAMh 1M1KU 4ZN1A 5GAOn 2CZ7B 2PUOB 2DJZA 1NPRA 4A4GA 1BI3A 2ZPHB 2QQRA 4M7DE 3OSVA 2X4XA 1Y07A 3C94A 2FYKA 4LDUA 4C92A 1JRIA 2RHZA 4D6WA 5CK9A 3CCQT 3M59A 1KD1C 3URGA 2XD0A 3GIBA 3META 4N4GA 5GAN4 5GMKh 4BI3A 2E6ZA 2DKGA 5CCAA 5LJ5e 5CO7A 3L2UA 4MMLA 3Q1JA 4FT2A 2PQWA 3KUFA 4RG8A 1VQ7T 4M75B 3P8BB 3QZ5B 3FLGA 2DVEA 3L2QA 3G6ET 3JCMQ 5LJ3d 1YHQT 2KQWA 2JN0A 4JS4A 2WSCE 3G4ST 4JJNK 3FRNA 3RESA 3CD6A 4LDWA 2DAQA 2F5TX 4RG2A 1VQNT 4B9WA 2LQ8A 2ZGWA 4M78E 4MDXA 1QP2A 3CC4T 4LD9K 4JRIA 4M77A 3CCSA 4HCBA 3RKYA 4C5EA 3CCJT 3JCMW 1H3ZA 3OBWA 4PJOE 5AYFA 1NE8A 2JTMA 3QJ6A 4J83A 4OF1A 5J26A 4C8QB 4ZGDB 4II1A 2PVDB 1U8RA 1M90C 3RMQA 5GANg 3ZBDA 1YJ9A 4A4FA 4ELYC 2RA2A 3VYHB 2QQ9A 1WJQA 1Y96A 2LC4A 3QYGB 4PL6A 4Z02A 4ELZC 3CCUT 3RUXA 3QIIA 2O4XA 5D6YA 3TCJA 5GANf 2XICA 3DKMA 5LJ5g 2JVVA 4IUUA 4C0GA 5GAMe 2CKKA 1HXDA 2LVMA 3OB9A 4FIBA 4C92E 3UDCA 3CCQA 1Q81C 1WJSA 3GF5A 3GNGA 3UPUA 1W2BS 5LJ5f 3QUIA 4QQGA 3OW2A 3OW2S 4NS5A 3CCRT 2V8KA 4MDWA 2DD4A 1KQSA 4A4EA 2EQKA 2MWOA 2XU8A 4OGCA 3WVEB 3NTIA 4M7DB 3JB9J 3MEVA 2ZPIB 4RMOA 2KK4A 4OP0A 5GAOp 4M75C 4MMKA 1YJWT 3T9NA 2RI3A 3QBYA 1K73C 1KD1U 2OTLA 3PGGA 4ZGEB 3JCMJ 1YHQA 4XTVA 4ZTJA 1YBYA 2E41A 4N4HA 1JJ2A 1OYXA 3G4SA 3JB9F 1M8VA 2RJFA 4M78F 1BI1A 3OSSC 2E65A 2X4WA 1VQ6A 1LOJA 2R58A 2PUKB 2CZ0B 3JSCA 4M77E 3PT9A 4BB7A 3X26B 2K3XA 3CC4A 4A4KA 1BI2A 4N4IA 4PJOF 1I8FA 1D3BA 1V29B 2RD1A 3MP6A 4XU1A 2E64A 4XTXA 4C8QC 4F7UE 3SDZA 1XNIA 4J6XA 1I5LA 4C8QG 4BE0A 3HRUA 4OB3B 4LD6A 4BUGA 5D6WA 3OS0A 3CPWS 5A0LA 4FU6A 5KCHA 4TVRA 3TU4K 3OS1A 3S3OA 1UGQB 1Q82C 1R8OB 2ZPFB 2X35A 1QW1A 2RB6A 4BY6B 3JB9I 5CKDA 1M90U 2DTHA 3JB9G 3CCLT 3H8ZA 1BYMA 4M78G 3LH0A 2E6NA 1G3SA 2LDMA 3MEWA 4BI4A 3CCRA 3MCAB 4XTZA 2RM4A 4M7AE 1B34A 2P0PA 4M7DC 4IUPA 3QZ9B 4JRQA 1UGSB 3QYHB 5KE3A 4M7DG 1Q81U 3FDRA 3RKWA 5KCOA 3LLRA 2XDPA 4XAXB 3VKIA 1DJ7B 4E7IA 3QJYA 4VUBA 1W4SA 3A8OB 4E7LA 1YJWA 5I21A 3BDUA 5GAMj 3PIOA 3H6ZA 1N8RC 1VQ9T 2EJFA 2DZCA 3A8GB 3SD4A 1YITT 4OB2B 1BIBA 1VQOT 3FEOA 4NOYA 3OS2A 5GANd 4M75A 1YJNT 2JTFA 3OYAA 3JCMP 3LWHA 2M0OA 3E1SA 4MZTA 4F7UF 3SFMA 5LJ5d 4LDYA 3OYNA 2HBPA 3A5ZB 5GAN2 2RHUA 3ZFJA 3PIPA 3PFSA 3MP8A 4QVDA 3DLLA 3N5BB 2Y4XA 3BFMA 4X34A 5GAOr 3QSUA 3CMEA 3JB9D 2XKOC 3CBOA 4C8QA 1KQ1A 4M78D 3G71T 3A8HB 4E7JA 4BY6C 1YI2T 3OYJA 3CCLA 1Y7XA 3E9GA 3TREA 1OZ2A 3V8JA 2L3RA 3JCMV 4M7AF 4PJOD 1QVFS 1QVPA 3ZEHA 2CZ1B 4M7DD 2XIDA 1Q82U 5DLQE 4JLGA 3CBPA 2DTOA 4ZGJB 1LNXA 1NJIU 1QP3A 1MGQA 3S3NA 4QQ6A 5KH6A 3CXCS 2VXFA 3RMSA 1VQMT 3S3MA 4XK8E 2KDSA 2QQSA 4PLLA 4NL3A 1VQ9A 1IREB 1KHIA 4M7DA 2OTJT 4IUQA 3CCVA 1VQOA 3HSBA 1M4ZA 2EWNA 3CCMT 5LJ3h 2GQVA 5GAN8 2HNIA 5GAOl 4IURA 4YTLA 2K4YA 4KULA 2HQXA 2LT4A 1JBMA 2ZPBB 1G3TA 3JCMb 1N8RU 2K3YA 3CEYA 2RO0A 1BIAA 3UT1A 1UEBA 2P0KA 2DIGA 2R5MA 4JRPA 1ZBXA 3FJPA 3JCMe 3JB9H 2XI9A 3NFCA 3CPFA 1M5Q1 2FL7A 2MI6A 3GP8A 2MAMA 4XQ3A 3VJPA 3G71A 4X9DA 1YI2A 1K8AU 2Y90A 3P8HA 2QXFA 4O5VA 3L2WA 5GMKl 2BIVA 1YIJT 2EYQA 4BE2A 2D6FA 4M78B 2O01E 4OVAA 4LDXA 1W2BA 4EMKB 3PMTA 1VIEA 2LTOA 1N6AA 4PJOB 1S72T 3J80E 3LW5E 1Q86U 1G5VA 1VQMA 3CMAT 3HL8A 3QKJA 2K57A 4DQ2A 4ZN3A 3BY7A 4GY5A 5GMKe 1VQ7A 2IVWA 2LNVA 2MWPA 2OTJA 5GMKi 1N9SA 3MEUA 1YCYA 2ZZDA 4EMGA 1OZ3A 5GAN3 3G6EA 2D9TA 3OQ5A 2QDYB 3SWNB 1FXXA 3CCMA 4E7KA 3M56A 4C92B 1LJOA 4CRIA 3BW1A 1WPYA 3OYFA 4MZMA 2DPPB 1VQNA 2EKOA 4FT4A 1U1TA 4XTYA 5LJ3e 2FVUA 4C5HA 3JCMf 4QW2A 2A7YA 4BD3A 5GAOq 4QVZA 3FB9A 5DY9A 3CCJA 3RERA 4ATOA 3OYKA 2F69A 3OBYA 4XU3A 5GAMg 2NLUA 3HFNA 4BDYA 3C12A 5J39A 2YHTA 4GLKA 1KC8U 3VV0A 2K2VA 4P5NA 3HPWA 4FM4B 5CKFA 2VC8A 5GAMf 3CCUA 2DXBA 4CI0C 2OAUA 1TH7A 2QTXA 3X20B 2HD0A 3CPWA 3X24B 4C92F 4E47A 2LT1A 1WNLA 4KUDK 1K9MC 2RHXA 2JOYA 3X28B 4M78C 3DLMA 1NJIC 4L6V5 4M77B 2PU9B 2E12A 4HA8A 4C0DB 3OYIA 4HT9A 4V2SA 4OGEA 5CKEA 4L59A 1OI1A 3V7CA 1P92A 4EMKC 5CR2A 1GXIE 2GFAA 4JLIA 3OYDA 5FLXE 4PJOC 4F7UB 3LX7A 1VQLT 2MMPA 1IZ6A 4PJOG 3CMAA 2XDDA 3OYLA 5CAIA 2EQJA 4HCCA 3JRZA 2RK1A 3V7SA 4J6YA 2KAFA 2EQMA 2QEXT 4J6WA 2HAXA 3CCET 3ME9A 2AHJB 2QQBA 3EFSA 4XU2A 5GAOm 2V8IA 3SWNC 4ZTFA 3M4YA 4C92C 1SSFA 1M1FA 2EQUA 2CGHA 2BUDA 2EFIA 2X4JA 1BKBA 5IN1A 4C92G 5HK3A 4M77F 3G7ZA 3A8LB 3C4SA 5GANh 3KXTA 2DK3A 4J7FA 4EDUA 1VQ5T 3HRSA 1N27A 3E19A 4M7AB 5HY6A 3OYGA 3GOXA 2K5FA 2DXTA 1K8AC 2KY9A 5LJ5h 5GMKj 4PKCC 4NL2A 3PTAA 1UGPB 1VQKT 5FROA 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UB4 A;  2C06 A;  3JRZ A;  5CQX A;  2KMT A;  4VUB A;  5DLO A;  5CKH A;  4MDX A;  5HKC A;  3HPW A;  2VUB A;  1M1F A;  5CKF A;  5CK9 A;  5HK3 A;  4HKE A;  5HK0 A;  5CQY A;  1NE8 A;  3G7Z A;  1X75 C;  4OF1 A;  5CKD A;  3NFC A;  4ME7 A;  5CCA A;  2MF2 A;  4MZT A;  5CO7 A;  4ELY C;  1VUB A;  5CKB A;  4ELZ C;  5CKE A;  4MZP A;  5CR2 A;  3TCJ A;  4MZM A;  3VUB A;  3JSC A; 
#chains in the Genus database with same CATH topology
 3I55 Q;  1QVG S;  5CQX A;  3BE3 A;  3EHR A;  2YLC A;  2XHC A;  3J81 E;  4C0Z A;  1Q7Y C;  1XQH A;  4EMH A;  4F7U G;  4R56 A;  3CCS T;  3L1A A;  1K9M U;  1ZSZ A;  1AZE A;  2C0O A;  5FU6 B;  3KBG A;  4AFS C;  2KVQ G;  3L2R A;  4BI8 B;  3OA6 A;  2X51 A;  3D7S B;  1YJN A;  1I1J A;  2P0Q A;  4KH0 B;  3ASK A;  3SWN A;  5HKC A;  1SRM A;  1O75 A;  3P8D A;  4DEY A;  4XTW A;  3CCL Q;  3DB3 A;  1ZA2 B;  3M55 A;  1TS9 A;  2V8J A;  2I2L A;  3RKX A;  1RL2 A;  5I2S A;  1VQ4 A;  2MIO A;  4ANJ A;  2GTJ A;  1JB0 E;  2RI2 A;  4LXC A;  3OW2 P;  2V26 A;  4DBF A;  2GFU A;  5D6X A;  3CCV Q;  2AK5 A;  2DEQ A;  3SEM A;  1UHF A;  1VQ6 T;  2M16 A;  3EG0 A;  4JJB A;  3X25 B;  2RJE A;  1PSE A;  5IHN A;  5KYW B;  1MMG A;  4F17 A;  5KYX B;  2LQW A;  1SRL A;  2J6O A;  3LGF A;  4HCZ A;  1FWZ A;  1H3H A;  2VB6 A;  3MEA A;  1AWJ A;  2G3R A;  3M53 A;  5M9O A;  1M1G A;  1Y71 A;  2CUD A;  2LQK A;  4J5Y A;  5IHI A;  4HKE A;  1FMV A;  4RKU E;  2RJC A;  1VQM Q;  3H0I A;  2AKK A;  3JCM X;  1YIJ A;  1H92 A;  3AT1 B;  2FRW A;  3VYG A;  3QDF A;  2R57 A;  5KYU B;  4LE9 A;  4RTV A;  2FB7 A;  2A3L A;  1RAD B;  5IXF A;  4F14 A;  3CC7 A;  2YDL A;  3CCJ Q;  1G2B A;  1NYG A;  5GAN 5;  2GNC A;  3EFR A;  4RTZ A;  4AFQ C;  5LJ3 f;  3HRT A;  3CCU Q;  1QWF A;  2GCX A;  4EPC A;  2MF2 A;  5A2Q E;  1NLP C;  5CKB A;  2LX9 A;  3I55 A;  3OMG A;  1MMA A;  2CYZ B;  2CP0 A;  2DXC A;  1K73 R;  1NEB A;  1YJW Q;  1W1F A;  2HQE A;  5KYY A;  4R0K A;  3JCM d;  1C6V X;  4LUD A;  5A0D A;  1V1C A;  1K4U S;  2CRE A;  3CCE A;  2QA4 T;  1SSH A;  2DD5 A;  3OMC A;  2DLP A;  3EFO B;  2PUO B;  2GGR A;  4HVU A;  1NPR A;  3OSV A;  2E3H A;  4C92 A;  4AG1 C;  3CCQ T;  1JRI A;  2A28 A;  2V1Q A;  5GAN 4;  2YUP A;  2DJQ A;  5CCA A;  4OMN A;  2PQW A;  3KUF A;  1VQ7 T;  2HKN A;  1XJW B;  2EYW A;  3L2Q A;  3G6E T;  3JCM Q;  1TU0 B;  5LJ3 d;  3RDV A;  3CD6 A;  2DAQ A;  2C0T A;  4RG2 A;  2LQ8 A;  4M77 A;  3RKY A;  7AT1 B;  3JCM W;  3OBW A;  2BE9 B;  1AEY A;  1NE8 A;  1M90 C;  4J83 A;  2CP5 A;  1M3C A;  1YJ9 A;  4A4F A;  4DBH A;  2RA2 A;  4Z02 A;  2LC4 A;  1BCO A;  5L23 A;  2HQH A;  5GAN f;  3RR6 A;  3UA6 A;  3DKM A;  4IUU A;  1S1N A;  1Q81 C;  2LVM A;  1UG1 A;  1PD1 A;  5LJ5 f;  4PK4 A;  3CPW P;  1KQS A;  2DD4 A;  2XU8 A;  3MEV A;  4PFZ A;  3QBY A;  3PGG A;  3JCM J;  3QWY A;  1YHQ A;  4XTV A;  3NPF A;  1M8V A;  2NUT B;  2DL7 A;  3OSS C;  3UF4 A;  2E65 A;  1LOJ A;  1RI9 A;  2R58 A;  2PUK B;  3JSC A;  4IIO A;  4A4K A;  4N4I A;  1GL5 A;  1V29 B;  2RD1 A;  4C8Q C;  4F7U E;  1BB9 A;  1XNI A;  1I5L A;  4LD6 A;  5A0L A;  4FU6 A;  4TVR A;  1UGQ B;  3M0S A;  1R8O B;  3VS4 A;  2DTH A;  3MCA B;  4XTZ A;  1WLP B;  4M7D C;  1M8M A;  4KGZ B;  1IHV A;  2M51 A;  1VYV A;  1YJW A;  4VUB A;  4JZ4 A;  1N8R C;  3FEO A;  4NOY A;  5GAN d;  1YJN T;  2JTF A;  2CP6 A;  3JCM P;  2EGC A;  1IRX A;  1YWO A;  2M0O A;  4WTO B;  1WFW A;  5LJ5 d;  1AZG B;  1X2Q A;  2RHU A;  3PFS A;  2VWF A;  3BFM A;  5KYW A;  4C8Q A;  3G71 T;  4E7J A;  1HSQ A;  2DL5 A;  4OML A;  2NWM A;  1G83 A;  2K79 A;  3E9G A;  3TRE A;  2L3R A;  3JCM V;  2RQT A;  4JLG A;  2COZ A;  2DTO A;  1IXD A;  1N5Z A;  1NJI U;  1MGQ A;  3S3N A;  1JXM A;  2VXF A;  3RMS A;  4GLM A;  4XK8 E;  2QQS A;  4M7D A;  1KHI A;  4IUQ A;  2BZX A;  5GAO l;  2F2X A;  2PZ1 A;  2CSI A;  3I9Q A;  3JCM b;  1VQ5 Q;  3CEY A;  2FG0 A;  1R77 A;  5KYU A;  3UT1 A;  2DIG A;  2R5M A;  5FWC A;  1ZBX A;  3JCM e;  2MAM A;  4XQ3 A;  3VJP A;  1CKA A;  1K8A U;  1PM3 A;  1Q86 R;  1YIJ T;  1OPL A;  4OMO A;  2ENM A;  4OVA A;  1ZSZ B;  1W2B A;  1AWW A;  2YRC A;  3LW5 E;  3QKJ A;  4DQ2 A;  4GY5 A;  3MEU A;  4EMG A;  2D9T A;  3OQ5 A;  3SWN B;  4AMC A;  1FXX A;  2HL5 C;  3OYF A;  1U1T A;  2RQU A;  5LJ3 e;  4IIM A;  2BTT A;  2O31 A;  4F04 B;  5GAO q;  4ATO A;  3FB9 A;  3CCQ Q;  2W10 A;  3OBY A;  4BDY A;  2NLU A;  3C12 A;  1M30 A;  4ESR A;  5IXB A;  5GAM f;  2QTX A;  1TG0 A;  2HKQ B;  4C92 F;  4FYY B;  3DLM A;  2PU9 B;  2E12 A;  4HA8 A;  3TSZ A;  3EFO A;  5CR2 A;  1WHK A;  1GXI E;  4JLI A;  4PJO C;  5FLX E;  1VQL T;  2XDD A;  2EQJ A;  2RK1 A;  4J6Y A;  2HAX A;  3CCE T;  4XU2 A;  3M4Y A;  4GBQ A;  1M1F A;  4C92 G;  1QMC A;  2FPF A;  4M77 F;  3KXT A;  3A8L B;  4J7F A;  1AWO A;  1N27 A;  3E19 A;  5HY6 A;  1JXO A;  2DEU A;  4PKC C;  4RTU A;  4NL2 A;  4PJL A;  2HCK A;  1VQK T;  5FRO A;  3CC2 Q;  1RAC B;  5GMK m;  1T3S A;  1T3L A;  1TTH B;  2DVJ A;  4CC4 B;  5LJ3 j;  3L42 A;  1K9M R;  4C0D C;  3MP1 A;  1VQP T;  4IUT A;  4M77 G;  3E9F A;  3M54 A;  3CD6 T;  5GAN 6;  3G1J A;  2L89 A;  3CXC A;  2ABL A;  4PJO A;  2XDB A;  1K1Z A;  4C92 D;  2AZV A;  2YT6 A;  5GAM d;  4B9X A;  4M75 E;  2DTI A;  3CBM A;  1VQ5 A;  1B34 B;  3CME Q;  1RAA B;  4M7A C;  4QQD A;  4DEX A;  4KRT A;  5GAN e;  2Y4Y A;  2QTV A;  5GAN 7;  1WGS A;  2AIR B;  1OU8 A;  2SEM A;  1JU5 C;  1PG5 B;  1BI0 A;  1XOV A;  1U1S A;  4Z8A A;  1KK7 A;  2V1R A;  1FX7 A;  4FW1 A;  1B3Q A;  2EJG A;  3I56 T;  5EG2 A;  1FMW A;  4M77 D;  2E3I A;  2FZK B;  2D0Q B;  4OMQ A;  1O9S A;  2LJ0 A;  1OX8 A;  3VS7 A;  3M58 A;  1W6X A;  4E7H A;  2H3J A;  3MO8 A;  1JJ2 P;  3AHU A;  2M1H A;  1VYU A;  4KBM B;  4XU0 A;  5IT9 E;  3UAT A;  1VQ8 A;  2IPO B;  1LCK A;  1VUB A;  2RQR A;  2YWW A;  2EIF A;  1X6G A;  3L2Z A;  4QVC A;  1TWB A;  3H9N A;  3JCM g;  2DE0 X;  1SKU B;  3HFO A;  2FHD A;  3NTK A;  1KQS S;  4BAC A;  1GCQ C;  4PLI A;  3LYI A;  4M7A A;  3OS5 A;  4Y92 A;  4C8Q F;  3A8M B;  3TEE A;  2IG0 A;  4FSX A;  3JV3 A;  5CQY A;  1WYX A;  3QHS A;  1M9S A;  1XTD A;  5I2M A;  1M27 C;  4KGX B;  3SHW A;  4A54 A;  2B8A A;  3HHT B;  5GAN j;  4BE1 A;  2DL3 A;  5LJ5 j;  3QPH A;  1RAE B;  1S72 A;  2J7I A;  1VQN Q;  3QO3 A;  3S6W A;  4M7D F;  3MHX A;  5FRM A;  4E2F B;  3LGL A;  1QCO A;  5LJ3 g;  1KHC A;  3INZ A;  2M0Y A;  1BCM A;  3OYB A;  1IGQ A;  1ZUK A;  1GCP A;  3HTR A;  3QDR B;  4IUV A;  3VU3 C;  1WI7 A;  2CH4 W;  4IKF A;  3CC2 A;  2E10 A;  1SHG A;  2RQV A;  3R6O A;  1I81 A;  3C95 A;  4JUV A;  4FSS A;  4RCB A;  1GCQ A;  3M0T A;  2WAC A;  4Z89 A;  2COW A;  2EGA A;  1SEM A;  4L5G A;  4AFU C;  1M3B A;  5HK0 A;  2CP3 A;  2ZAE A;  1ZLM A;  4C8Q D;  4HT8 A;  3JCM h;  3WVD B;  4PNO A;  3F70 A;  1RAF B;  2J05 A;  2XG8 D;  2L5Q A;  1EFN A;  2ROL A;  4Y91 A;  3RIR A;  2QGG A;  1M1K U;  5GAO n;  2CZ7 B;  2QDL A;  2DJZ A;  3PVQ A;  4A4G A;  1BI3 A;  2X4X A;  1Y07 A;  4E7Z A;  3C94 A;  2J6K A;  4LDU A;  4D6W A;  3TVT A;  1MMD A;  3M59 A;  2DKG A;  3TQ7 P;  5CO7 A;  3L2U A;  1WHM A;  3Q1J A;  2CDT A;  3P8B B;  2CUB A;  1YIT Q;  3G4S T;  1VQO Q;  2BZ8 A;  3FRN A;  1PHT A;  2F5T X;  3EGX A;  4B9W A;  4M78 E;  4MDX A;  1QP2 A;  3CC4 T;  4LD9 K;  4C5E A;  5D7U A;  4C8Q B;  1U8R A;  4ZGD B;  5J26 A;  4II1 A;  4J9E A;  5GAN g;  3ZBD A;  2FRY A;  3VYH B;  1WJQ A;  1Y96 A;  4PL6 A;  1WX6 A;  3EHQ A;  3QII A;  2O4X A;  2XIC A;  2YXY A;  4QKU A;  5LJ5 g;  5GAM e;  4C0G A;  2CKK A;  4J9G A;  4C92 E;  4AT1 B;  3GF5 A;  3GNG A;  1W2B S;  3OW2 A;  3CCR T;  2DF6 A;  2E5K A;  1K0X A;  4M7D B;  3JB9 J;  2LP5 A;  4OP0 A;  5GAO p;  1KD1 U;  2OTL A;  1OQK A;  2DM1 A;  2OTJ Q;  1OYX A;  1AT1 B;  1RUW A;  2RJF A;  2A37 A;  3CCM Q;  4EIK A;  4M77 E;  3PT9 A;  4PFO A;  4PJO F;  3M0P A;  4XU1 A;  4XTX A;  2CH4 A;  1ZUU A;  2COY A;  4J6X A;  1NEG A;  4B6M A;  1J3T A;  1NBE B;  4OB3 B;  1SG5 A;  3OS0 A;  3TU4 K;  1Q82 C;  2EPD A;  2MOX A;  5AT1 B;  1YNZ A;  1QW1 A;  2C0I A;  2L3S A;  2PNI A;  1BYM A;  3H8Z A;  2RMO A;  2HEQ A;  2AKL A;  2E6N A;  1G3S A;  2LDM A;  4RUG A;  1B34 A;  2DA9 A;  2MPX C;  3NMZ C;  1TSF A;  5KE3 A;  3H41 A;  1ACM B;  5KCO A;  4E7I A;  1OOT A;  1QVF P;  5I21 A;  5GAM j;  3PIO A;  3H6Z A;  1VQ9 T;  2EJF A;  1TOV A;  4AFZ C;  2KBT A;  1X43 A;  3PVL A;  2P84 A;  4MZT A;  3MKD A;  3I5R A;  2FO0 A;  3EGU A;  4JPB W;  3QSU A;  2G6F X;  1KJW A;  1YI2 T;  3OYJ A;  3CCL A;  1NJI R;  1Y7X A;  4M7A F;  4PJO D;  3EG1 A;  1HD3 A;  5DLQ E;  1LNX A;  1HJD A;  1QP3 A;  1UDL A;  4PJM A;  4QQ6 A;  3CXC S;  2I0N A;  4PLL A;  1OU9 A;  1IRE B;  4FYW B;  3CCV A;  1VQO A;  2QEX Q;  2EVR A;  3HSB A;  1Y0M A;  1E7O A;  2HNI A;  4YTL A;  2K4Y A;  2O9S A;  2HQX A;  1JBM A;  2GTO A;  1TUD A;  1K8A R;  2K3Y A;  3M0Q A;  1QCF A;  2NYS A;  3CPF A;  2FL7 A;  2MI6 A;  3GP8 A;  5HCK A;  1X69 A;  4X9D A;  2QXF A;  4O5V A;  2JT4 A;  1QKX A;  2F2W A;  1EZZ B;  1PNJ A;  4LDX A;  1VIE A;  1N6A A;  4PJO B;  1S72 T;  3J80 E;  2A0F B;  1G5V A;  1VQM A;  2QGF B;  2MYS A;  3CMA T;  3HL8 A;  2K57 A;  3QWX X;  3CCS Q;  1FYN A;  2IVW A;  2LNV A;  2DL8 A;  2OTJ A;  1N9S A;  1YCY A;  4F16 A;  1OPK A;  4E7K A;  3CCM A;  2AZS A;  5GJV B;  4CRI A;  1VOM A;  4JZ3 A;  4XTY A;  2H3E B;  2NUP A;  4BD3 A;  2A7Y A;  3RER A;  4QVZ A;  5DY9 A;  3CCJ A;  5GAM g;  3HFN A;  2B86 A;  3M0R A;  4JJC A;  3GBQ A;  1TUG B;  3HPW A;  5CKF A;  3CCU A;  2DXB A;  4CI0 C;  2OAU A;  1TH7 A;  3CPW A;  3EGD A;  1WNL A;  4KUD K;  1K9M C;  2JOY A;  3X28 B;  4L6V 5;  4C0D B;  4OGE A;  2W0Z A;  5CKE A;  4L59 A;  1QVG P;  1Q95 G;  3EH2 A;  3LX7 A;  1VQ6 Q;  2D8H A;  2MMP A;  3OYL A;  1WHH A;  1Z9Q A;  3JRZ A;  2AT1 B;  2EQM A;  4J6W A;  2RNA A;  3ME9 A;  5GAO m;  2EQU A;  5HK3 A;  2X4J A;  1BKB A;  1ZX6 A;  2ESW A;  3C4S A;  4M7A B;  2RF0 A;  2DET A;  1VQ4 T;  1QCN A;  2K5I A;  2DBM A;  2K3B A;  3M4G A;  3V8K A;  1X75 C;  2KRM A;  1JEG A;  4ME7 A;  2JMC A;  4RTT A;  2YLB A;  2KT8 A;  2FZC B;  3VUB A;  4XTU A;  2A36 A;  1ZA1 B;  3J7A F;  2OJ2 A;  2DX1 A;  1ZHI A;  3GLX A;  4N0A C;  3H0F A;  3C0C A;  5C6S A;  1KC8 C;  1ZQ1 A;  4A53 A;  3HP9 A;  2GBQ A;  3QXE B;  2F2V A;  4M4Z A;  1M2O A;  2JNG A;  1VYT A;  2VV5 A;  3MJX A;  3E2U A;  3UWN A;  1MMN A;  1I4K 1;  2OTL T;  3MPU B;  4C5G A;  2VXE A;  5CVI A;  5FU7 C;  2HMA A;  1UJ0 A;  4FW2 A;  3M57 A;  2O2O A;  4J9H A;  3DB4 A;  4BDZ A;  1YN8 A;  1WZO A;  4DA4 A;  1Q7Y U;  4F7U A;  2ED0 A;  3JAM E;  2QI2 A;  3OYC A;  2YUQ A;  3CC7 T;  1WQW A;  1QKW A;  1KQ2 A;  1KG1 A;  2QA4 Q;  3BDL A;  1YI2 Q;  3O5Z A;  4A63 B;  1M3A A;  4PFP A;  1JO8 A;  2E4H A;  4N0A A;  2K9G A;  4RCC A;  3IQL A;  2LCC A;  3I55 T;  3GPL A;  1K0S A;  3ZL7 C;  2VYT A;  2ED1 A;  4J8O A;  2CT4 A;  4Y28 E;  2VGN A;  4J9D A;  2X9H A;  2F5K A;  1NLO C;  3OYH A;  4CC3 A;  1WXT A;  4X1V A;  3EGX B;  2EAY A;  4WF2 A;  1VQ7 Q;  4R55 A;  1BU1 A;  4ORZ A;  2CSQ A;  2RJD A;  3OYY A;  3G6E Q;  1LVK A;  3M5A A;  2YSQ A;  4O6J A;  2KEA A;  1VIF A;  2D1X A;  1B7T A;  3NGP A;  2R5A A;  5L8R E;  1Y96 B;  2KRN A;  2VGM A;  2O4X B;  1RI0 A;  1MHN A;  1Q81 R;  1AOJ A;  2RQW A;  2X4Y A;  3GNF B;  2MK5 A;  3QG1 A;  1GFC A;  4JRK A;  2ZPG B;  2EYX A;  4FL6 A;  4OMF B;  3VUZ A;  2CS7 A;  4DOW A;  2M02 A;  1N9R A;  2DRK A;  2YRV A;  1HK9 A;  1WIE A;  3CCV T;  2P4T A;  2JJ9 A;  1PKS A;  9ATC B;  1OV3 A;  1JQQ A;  1M1K R;  1MND A;  2E70 A;  3JCM c;  1IB8 A;  4QT7 A;  2DO3 A;  2PVG B;  1NZ9 A;  2ZPE B;  2JTE A;  2HSP A;  3FJ5 A;  2JUF A;  1YJ9 T;  1UJY A;  4FYX B;  2QQR A;  2DFU A;  4HVV A;  2FYK A;  2DRM A;  2RHZ A;  5CK9 A;  2XD0 A;  4ZNX A;  4N4G A;  2DYI A;  4BI3 A;  2E6Z A;  5LJ5 e;  3VS2 A;  2JS0 A;  4RG8 A;  1N8R R;  2H8H A;  1YHQ T;  2KQW A;  2JN0 A;  4JS4 A;  4JJN K;  3RES A;  1NM7 A;  2EKH A;  1YJN Q;  2ZGW A;  2SRC A;  4JRI A;  1PCX A;  2K7A A;  3CCJ T;  3QJ6 A;  2QA4 A;  2PVD B;  1YWP A;  1GRI A;  4ELY C;  1ABQ A;  3CCU T;  1VQ4 Q;  2O88 A;  1TUC A;  3RUX A;  3TCJ A;  5D6Y A;  2JVV A;  4LUE A;  3G71 Q;  1SHF A;  1HXD A;  2BZY A;  3UDC A;  3CCQ A;  2JM9 A;  3UPU A;  4J9B A;  3QUI A;  1VA7 A;  1RAG B;  1KD1 R;  2ATC B;  3U23 A;  2EQK A;  3WVE B;  5IH2 A;  4RMO A;  2KK4 A;  4M75 C;  1YJW T;  3T9N A;  2RI3 A;  1K73 C;  4ZGE B;  1YBY A;  1PWT A;  4N4H A;  1JJ2 A;  4WCI A;  1BI1 A;  1QWE A;  2K3X A;  3X26 B;  1BI2 A;  1I8F A;  1ABO A;  1D3B A;  4LN2 A;  2E64 A;  4RTY A;  2CP7 A;  4C8Q G;  3HRU A;  1YP5 A;  5D6W A;  4BUG A;  3CPW S;  5KCH A;  3S3O A;  1WA7 A;  3EG3 A;  1MV0 B;  1M90 U;  3VS0 A;  3LH0 A;  1YIJ Q;  1PRM C;  4K11 A;  1WXB A;  4BI4 A;  4OMM A;  2DL4 A;  2D0N A;  4RTW A;  3QZ9 B;  2CP2 A;  4JRQ A;  5EC7 A;  4M7D G;  2J6F A;  1Q81 U;  4OMP A;  3VS6 A;  3VKI A;  1DJ7 B;  3QJY A;  1W4S A;  3A8G B;  2NUP B;  3OS2 A;  4M75 A;  2YRD A;  3OYA A;  3E1S A;  4F7U F;  3SFM A;  2VVK A;  2HBP A;  3A5Z B;  5GAN 2;  4QVD A;  3EGD B;  3DLL A;  2LNH B;  2DER A;  2Y4X A;  4X34 A;  1Z9Z A;  1UUE A;  3CME A;  4KH1 B;  3A8H B;  1I07 A;  4BY6 C;  1V76 A;  4RTX A;  1OZ2 A;  2YUN A;  3V8J A;  2CZ1 B;  4M7D D;  2XID A;  3VS1 A;  1KSW A;  3REB B;  4ZGJ B;  1C1A A;  1VQL Q;  2QYZ A;  2L3P A;  4NL3 A;  3CCE Q;  5LJ3 h;  2GQV A;  5GAN 8;  4IUR A;  1R0C B;  2ZPB B;  1N8R U;  3RNJ A;  1I5O B;  3M0U A;  1UEB A;  2QK0 A;  1BBZ A;  1PC0 A;  3FJP A;  2XI9 A;  3NFC A;  1M5Q 1;  1VQK Q;  3G71 A;  2Y90 A;  2OI3 A;  1QQJ A;  2X3X D;  2D6F A;  1VQP Q;  3PMT A;  2RPN A;  3CD6 Q;  3TSW A;  2HSE B;  5GMK e;  2KNB B;  2MWP A;  5GAN 3;  1YJ9 Q;  3BW1 A;  1WPY A;  3EG9 A;  1VQN A;  2EKO A;  4FT4 A;  1KIK A;  2DNU A;  1ZSG A;  2FVU A;  1ZBJ A;  4C5H A;  3JCM f;  1E6G A;  4QW2 A;  3R6N A;  2ROT A;  4E7S A;  5KYN A;  5J39 A;  2EYZ A;  2YHT A;  1KC8 U;  2EW3 A;  2K2V A;  4FM4 B;  2VC8 A;  3X20 B;  2FZG B;  2HD0 A;  4E47 A;  3I56 Q;  1D0Z A;  2RHX A;  1RAI B;  1QLY A;  4M78 C;  2FEI A;  3OYI A;  4V2S A;  1OX9 A;  1YHQ Q;  3V7C A;  1P92 A;  4EMK C;  2FPE A;  3UA7 A;  3OYD A;  4F7U B;  4PJO G;  5CAI A;  4HCC A;  1IGU A;  3V7S A;  1X2K A;  1NYF A;  2KAF A;  1UGV A;  2QAS A;  1E6H A;  3EFS A;  4LNP A;  4C92 C;  3THK A;  2KI7 A;  5GAN h;  1VQ5 T;  3HRS A;  3OYG A;  2XMF A;  2DXT A;  5LJ5 h;  5GMK j;  2JM8 A;  2LMJ A;  1UGP B;  2OX7 A;  2LX7 A;  3I35 A;  1UB4 A;  3O8V A;  2KSS A;  1H64 1;  1X6O A;  2KMT A;  5LL6 S;  3PMI A;  1Q86 C;  2KGT A;  2LQN A;  3HKS A;  4M77 C;  2O9V A;  5FU7 B;  1PSF A;  1QVF A;  3VS3 A;  1CSK A;  1VQL A;  4M78 A;  4C5I A;  2JZ2 A;  1X6B A;  2K6D A;  3LWI A;  2GF7 A;  4EMK A;  2Z0W A;  1U5S A;  1TXQ A;  2LRQ A;  1YIT A;  2QQA A;  3REA B;  1VQ8 T;  2E1H A;  5CKH A;  1G3Y A;  1WQ7 A;  2DXU A;  4X9C A;  4JS5 A;  4M7A G;  2VUB A;  1A0N B;  3WXM B;  1VQK A;  1F1B B;  2L3Q A;  2LZ6 B;  4PJN A;  2ZCF B;  3GOX A;  4A4H A;  1MV3 A;  5KE2 A;  4C8Q E;  2RHY A;  4MZP A;  1C0M A;  1KQS P;  3SB2 A;  2OAW A;  1VQP A;  3M9Q A;  2RH2 A;  3CQT A;  3EAE A;  4KUI A;  1Q7Y R;  2KR3 A;  5DLO A;  5A0G A;  1WJR A;  1B07 A;  1IO6 A;  2KYB A;  3OY9 A;  2QAZ A;  2BE7 D;  2RHI A;  4M7D E;  5FU6 C;  4M75 F;  4J7I A;  2HL3 A;  2KRO A;  4M7A D;  2BKD N;  2RK2 A;  2RI5 A;  4CC2 A;  4OB0 B;  5IAY A;  3CC2 T;  3PE0 A;  2EBP A;  2DIQ A;  3I56 A;  2PVO B;  4C0F A;  4M75 G;  2NUZ A;  1T0H A;  2WSF E;  2M9U A;  2CZ6 B;  1JJ2 S;  2KE9 A;  4OB1 B;  2L0A A;  3V8L A;  2DZ9 A;  2LCL A;  3G4S Q;  2HZY A;  1M1K C;  4UC4 A;  1PKT A;  3FC3 A;  3FIF A;  3CC4 Q;  1SF9 A;  5DM7 R;  3PNW C;  1LPL A;  3OYM A;  1UTI A;  2GQI A;  4DOV A;  4KT0 E;  1NPP A;  3CME T;  2DYB A;  3EH1 A;  3OYE A;  1EIF A;  4LDV A;  2KXD A;  1KFZ A;  2VAS A;  1WHL A;  3ULR B;  4JDS A;  1ARK A;  2EJ9 A;  2K2M A;  5J3B A;  1X01 A;  3CCR Q;  4M75 D;  2XK0 A;  1YFN A;  2C06 A;  1G3W A;  3ER0 A;  1G8X A;  1QVG A;  5FRN A;  2PTK A;  1UGR B;  3NTH A;  2K5L A;  1D3B B;  4Q5W A;  3V7R A;  3L2V A;  2E5Q A;  1K73 U;  3EG2 A;  5IHK A;  1RLQ C;  1AWX A;  2L8D A;  4FYV B;  1AHJ B;  5CIU A;  1AVZ C;  2QEX A;  1R0B G;  2WSE E;  5KYX A;  1Q82 R;  5GAM h;  4ZN1 A;  2ZPH B;  4Z88 A;  1RAH B;  2HBW A;  3GIB A;  1KD1 C;  3URG A;  1U06 A;  3MET A;  4CC7 A;  1OUL A;  5GMK h;  2VKN A;  4MML A;  4FT2 A;  1W2B P;  4M75 B;  3QZ5 B;  2A08 A;  1BK2 A;  3FLG A;  2DVE A;  5ECA A;  1PRL C;  1UFF A;  1VQ9 Q;  1OEB A;  2WSC E;  4LDW A;  1M2V B;  1D1A A;  1VQN T;  1YCS B;  3CCS A;  4HCB A;  1H3Z A;  4PJO E;  5AYF A;  2DMO A;  2JTM A;  4OF1 A;  3RMQ A;  5FWB A;  1GBQ A;  2QQ9 A;  3QYG B;  4ELZ C;  4DBQ A;  3OB9 A;  4J9F A;  4FIB A;  1WJS A;  8ATC B;  2IIM A;  1D09 B;  1MNE A;  4HVW A;  4QQG A;  3OW2 S;  4NS5 A;  2V8K A;  4MDW A;  4A4E A;  2MWO A;  4OGC A;  2JS2 A;  3NTI A;  2KYM A;  1K9A A;  8AT1 B;  2QG9 B;  2ZPI B;  1D1B A;  1I0C A;  3KFV A;  4MMK A;  4ZTJ A;  2E41 A;  3RBB B;  1GBR A;  3G4S A;  3JB9 F;  4J9I A;  5GJW B;  1VQ8 Q;  4M78 F;  2X4W A;  1VQ6 A;  2CZ0 B;  3CC4 A;  4BB7 A;  2EQI A;  3MP6 A;  3SDZ A;  1M90 R;  1HYO A;  1MUZ A;  4BE0 A;  3OS1 A;  1IHW A;  2ZPF B;  2X35 A;  2RB6 A;  4BY6 B;  3JB9 I;  5CKD A;  3JB9 G;  4D8D A;  2LJ3 A;  6AT1 B;  4M78 G;  4KGV B;  3CCL T;  3MEW A;  3CCR A;  3LH5 A;  3NHN A;  2RM4 A;  4M7A E;  2P0P A;  5FW9 A;  4IUP A;  4HXJ A;  1UGS B;  3QYH B;  3FDR A;  3RKW A;  1S72 Q;  3LLR A;  2XDP A;  1WHG A;  4XAX B;  2YUO A;  3A8O B;  4E7L A;  3CMA Q;  3BDU A;  3EG9 B;  2DZC A;  3SD4 A;  1YIT T;  4OB2 B;  1BIB A;  1VQO T;  1AD5 A;  1CKB A;  1SPK A;  3CXC P;  3LWH A;  1ZUY A;  4LDY A;  1WHJ A;  3OYN A;  2KXC A;  3ZFJ A;  3PIP A;  3I5S A;  3MP8 A;  1FMK A;  3N5B B;  5GAO r;  3JB9 D;  2XKO C;  3CBO A;  3H0H A;  1KQ1 A;  4M78 D;  1T0J A;  2JW4 A;  1QVF S;  1QVP A;  3ZEH A;  1Q82 U;  3A98 A;  2DBK A;  3CBP A;  1UE9 A;  1H8K A;  5KH6 A;  2JMA A;  1VQM T;  2LCS A;  3S3M A;  2KDS A;  1VQ9 A;  2OTJ T;  1M4Z A;  2EWN A;  2JXB A;  3CCM T;  4HCK A;  2ECZ A;  2EYY A;  4KUL A;  2LT4 A;  1G3T A;  2NUT A;  1U3O A;  2RO0 A;  1BIA A;  2P0K A;  4JRP A;  5I11 A;  3JB9 H;  1WXU A;  5KYY B;  1YI2 A;  3P8H A;  1X27 A;  3L2W A;  5GMK l;  1GFD A;  1RLP C;  2BIV A;  4JJD A;  1UHC A;  2EYQ A;  4BE2 A;  4M78 B;  2DIL A;  2O01 E;  1NG2 A;  1K76 A;  4EMK B;  2LTO A;  3A1P A;  5I22 A;  4AG2 C;  1Q86 U;  2HDA A;  4ZN3 A;  2X3W D;  3BY7 A;  1VQ7 A;  5GMK i;  2ZZD A;  1OZ3 A;  2CT3 A;  3G6E A;  2QDY B;  3M56 A;  4C92 B;  1LJO A;  2D8J A;  4PJJ A;  2KT1 A;  4MZM A;  1KC8 R;  2DPP B;  4DBR A;  4E6R A;  3OYK A;  2F69 A;  1Y57 A;  2P4R A;  4XU3 A;  4GLK A;  1D0X A;  4J9C A;  3VV0 A;  2FPD A;  4P5N A;  2EGE A;  2L2P A;  3X24 B;  1RAB B;  2LT1 A;  1NJI C;  4M77 B;  1EX4 A;  2OTL Q;  4HT9 A;  4FCY A;  1ZSZ C;  4D8K A;  1OI1 A;  1W70 A;  1D0Y A;  2GFA A;  3VRY A;  1IZ6 A;  3CMA A;  2RN8 A;  2QEX T;  2AHJ B;  2QQB A;  2V8I A;  3SWN C;  4ZTF A;  3CC7 Q;  1SSF A;  3VRZ A;  2CGH A;  2BUD A;  2EFI A;  5IN1 A;  1WDX A;  3VS5 A;  2F1L A;  3G7Z A;  2DK3 A;  1UEC A;  4EDU A;  2LJ1 A;  1D1C A;  2MCN A;  2KRS A;  2K5F A;  1K8A C;  2KY9 A;  1PD0 A;  1M2V A;  3PTA A;  2J06 A;  5C0M A; 
#chains in the Genus database with same CATH homology
 1UB4 A;  3O8V A;  5GMK m;  1QVG S;  2KSS A;  1VQ4 T;  5CQX A;  1H64 1;  1X6O A;  2KMT A;  5LL6 S;  2K5I A;  3PMI A;  5LJ3 j;  3L42 A;  1Q86 C;  2YLC A;  3HKS A;  4M77 C;  4C0D C;  2XHC A;  3M4G A;  3MP1 A;  3V8K A;  3J81 E;  4C0Z A;  1VQP T;  4IUT A;  4M77 G;  1Q7Y C;  3E9F A;  1PSF A;  5FU7 B;  1QVF A;  3M54 A;  3CD6 T;  1X75 C;  1VQL A;  1XQH A;  5GAN 6;  4M78 A;  4C5I A;  4ME7 A;  4EMH A;  4F7U G;  4R56 A;  2JZ2 A;  3CCS T;  2YLB A;  3L1A A;  1K9M U;  3LWI A;  2L89 A;  2GF7 A;  4EMK A;  3CXC A;  4PJO A;  3VUB A;  2XDB A;  4XTU A;  4C92 D;  2LRQ A;  5FU6 B;  3KBG A;  1YIT A;  3J7A F;  2QQA A;  5GAM d;  2KVQ G;  3L2R A;  4BI8 B;  3OA6 A;  1ZHI A;  2E1H A;  4M75 E;  3GLX A;  4B9X A;  1VQ8 T;  1YJN A;  2DTI A;  4N0A C;  2P0Q A;  3CBM A;  1VQ5 A;  5CKH A;  5C6S A;  1G3Y A;  1B34 B;  3ASK A;  1WQ7 A;  1KC8 C;  4M7A C;  2DXU A;  3SWN A;  4X9C A;  4QQD A;  5HKC A;  5GAN e;  4JS5 A;  1O75 A;  2VUB A;  1ZQ1 A;  2Y4Y A;  3P8D A;  4A53 A;  4XTW A;  5GAN 7;  1WGS A;  4M7A G;  3DB3 A;  3HP9 A;  3WXM B;  3QXE B;  1VQK A;  3M55 A;  2V8J A;  2ZCF B;  2I2L A;  1BI0 A;  1RL2 A;  1U1S A;  1XOV A;  3RKX A;  4A4H A;  5I2S A;  2JNG A;  1FX7 A;  1VQ4 A;  5KE2 A;  2EJG A;  2VV5 A;  4C8Q E;  2RHY A;  3I56 T;  1JB0 E;  2RI2 A;  4MZP A;  3UWN A;  5EG2 A;  4M77 D;  1I4K 1;  3SB2 A;  2OTL T;  2GFU A;  1VQP A;  4C5G A;  2D0Q B;  2VXE A;  5D6X A;  5CVI A;  3M9Q A;  1O9S A;  2RH2 A;  2DEQ A;  3EAE A;  4KUI A;  5FU7 C;  1VQ6 T;  2M16 A;  5DLO A;  5A0G A;  3X25 B;  2RJE A;  1PSE A;  3M57 A;  1WJR A;  3M58 A;  3OY9 A;  4E7H A;  2H3J A;  3DB4 A;  3MO8 A;  3AHU A;  2M1H A;  4BDZ A;  4DA4 A;  4KBM B;  2RHI A;  1Q7Y U;  4F7U A;  4XU0 A;  4HCZ A;  3LGF A;  2QI2 A;  5FU6 C;  3JAM E;  4M75 F;  3OYC A;  3CC7 T;  1WQW A;  5IT9 E;  1FWZ A;  4J7I A;  1VQ8 A;  1KQ2 A;  1KG1 A;  1VUB A;  2EIF A;  3BDL A;  3L2Z A;  3MEA A;  4QVC A;  4M7A D;  2BKD N;  2G3R A;  3JCM g;  3M53 A;  5M9O A;  2RK2 A;  2RI5 A;  1M1G A;  3HFO A;  2FHD A;  4N0A A;  1Y71 A;  3NTK A;  4OB0 B;  4BAC A;  1KQS S;  5IAY A;  4RCC A;  2LQK A;  2LCC A;  4PLI A;  3CC2 T;  3LYI A;  4J5Y A;  4M7A A;  3I55 T;  3OS5 A;  4C8Q F;  3GPL A;  3A8M B;  3TEE A;  2VYT A;  4J8O A;  4Y28 E;  2IG0 A;  2DIQ A;  2VGN A;  4FSX A;  3I56 A;  2PVO B;  4HKE A;  5CQY A;  2F5K A;  4C0F A;  4RKU E;  2RJC A;  4M75 G;  3QHS A;  1M9S A;  1XTD A;  5I2M A;  3OYH A;  3JCM X;  2WSF E;  2EAY A;  2M9U A;  4WF2 A;  2CZ6 B;  4A54 A;  4R55 A;  1YIJ A;  2B8A A;  3HHT B;  3VYG A;  5GAN j;  1JJ2 S;  4OB1 B;  2RJD A;  3OYY A;  4BE1 A;  2R57 A;  3M5A A;  3V8L A;  2DZ9 A;  4O6J A;  1VIF A;  2LCL A;  5LJ5 j;  3QPH A;  1S72 A;  1M1K C;  4UC4 A;  2FB7 A;  3FC3 A;  2R5A A;  2A3L A;  3QO3 A;  3MHX A;  3S6W A;  3FIF A;  4M7D F;  5L8R E;  5FRM A;  5DM7 R;  1Y96 B;  3CC7 A;  3PNW C;  2VGM A;  3LGL A;  3OYM A;  5LJ3 g;  1KHC A;  2O4X B;  3INZ A;  1RI0 A;  4DOV A;  5GAN 5;  3EFR A;  4KT0 E;  1NPP A;  5LJ3 f;  3CME T;  1MHN A;  3OYB A;  3HRT A;  2GCX A;  3QDR B;  4IUV A;  3OYE A;  4EPC A;  1EIF A;  2MF2 A;  4LDV A;  5A2Q E;  3VU3 C;  2X4Y A;  5CKB A;  4IKF A;  3CC2 A;  3GNF B;  4JDS A;  2QA4 A;  2E10 A;  2EJ9 A;  2LX9 A;  3QG1 A;  3I55 A;  4JRK A;  5J3B A;  1X01 A;  2ZPG B;  4FL6 A;  4OMF B;  3OMG A;  3R6O A;  1I81 A;  2XK0 A;  4M75 D;  3VUZ A;  2C06 A;  1G3W A;  2CS7 A;  2CYZ B;  3C95 A;  3ER0 A;  4JUV A;  4DOW A;  1QVG A;  5FRN A;  4RCB A;  1N9R A;  1UGR B;  2DXC A;  3NTH A;  2YRV A;  2WAC A;  1HK9 A;  3CCV T;  2P4T A;  2K5L A;  2HQE A;  4L5G A;  1D3B B;  5HK0 A;  4Q5W A;  3V7R A;  3L2V A;  2E5Q A;  1K73 U;  4C8Q D;  4HT8 A;  3JCM d;  3JCM h;  3WVD B;  2L8D A;  2E70 A;  3F70 A;  4PNO A;  1AHJ B;  5CIU A;  3JCM c;  5A0D A;  2XG8 D;  2L5Q A;  2DO3 A;  2PVG B;  2QEX A;  1NZ9 A;  3CCE A;  2QA4 T;  2ZPE B;  4Y91 A;  3RIR A;  2DD5 A;  2JUF A;  2WSE E;  3OMC A;  1YJ9 T;  5GAM h;  1M1K U;  4ZN1 A;  5GAO n;  2CZ7 B;  2PUO B;  2DJZ A;  1NPR A;  4A4G A;  1BI3 A;  2ZPH B;  2QQR A;  4M7D E;  3OSV A;  2X4X A;  1Y07 A;  3C94 A;  2FYK A;  4LDU A;  4C92 A;  1JRI A;  2RHZ A;  4D6W A;  5CK9 A;  3CCQ T;  3M59 A;  1KD1 C;  3URG A;  2XD0 A;  3GIB A;  3MET A;  4N4G A;  5GAN 4;  5GMK h;  4BI3 A;  2E6Z A;  2DKG A;  5CCA A;  5LJ5 e;  5CO7 A;  3L2U A;  4MML A;  3Q1J A;  4FT2 A;  2PQW A;  3KUF A;  4RG8 A;  1VQ7 T;  4M75 B;  3P8B B;  3QZ5 B;  3FLG A;  2DVE A;  3L2Q A;  3G6E T;  3JCM Q;  5LJ3 d;  1YHQ T;  2KQW A;  2JN0 A;  4JS4 A;  2WSC E;  3G4S T;  4JJN K;  3FRN A;  3RES A;  3CD6 A;  4LDW A;  2DAQ A;  2F5T X;  4RG2 A;  1VQN T;  4B9W A;  2LQ8 A;  2ZGW A;  4M78 E;  4MDX A;  1QP2 A;  3CC4 T;  4LD9 K;  4JRI A;  4M77 A;  3CCS A;  4HCB A;  3RKY A;  4C5E A;  3CCJ T;  3JCM W;  1H3Z A;  3OBW A;  4PJO E;  5AYF A;  1NE8 A;  2JTM A;  3QJ6 A;  4J83 A;  4OF1 A;  5J26 A;  4C8Q B;  4ZGD B;  4II1 A;  2PVD B;  1U8R A;  1M90 C;  3RMQ A;  5GAN g;  3ZBD A;  1YJ9 A;  4A4F A;  4ELY C;  2RA2 A;  3VYH B;  2QQ9 A;  1WJQ A;  1Y96 A;  2LC4 A;  3QYG B;  4PL6 A;  4Z02 A;  4ELZ C;  3CCU T;  3RUX A;  3QII A;  2O4X A;  5D6Y A;  3TCJ A;  5GAN f;  2XIC A;  3DKM A;  5LJ5 g;  2JVV A;  4IUU A;  4C0G A;  5GAM e;  2CKK A;  1HXD A;  2LVM A;  3OB9 A;  4FIB A;  4C92 E;  3UDC A;  3CCQ A;  1Q81 C;  1WJS A;  3GF5 A;  3GNG A;  3UPU A;  1W2B S;  5LJ5 f;  3QUI A;  4QQG A;  3OW2 A;  3OW2 S;  4NS5 A;  3CCR T;  2V8K A;  4MDW A;  2DD4 A;  1KQS A;  4A4E A;  2EQK A;  2MWO A;  2XU8 A;  4OGC A;  3WVE B;  3NTI A;  4M7D B;  3JB9 J;  3MEV A;  2ZPI B;  4RMO A;  2KK4 A;  4OP0 A;  5GAO p;  4M75 C;  4MMK A;  1YJW T;  3T9N A;  2RI3 A;  3QBY A;  1K73 C;  1KD1 U;  2OTL A;  3PGG A;  4ZGE B;  3JCM J;  1YHQ A;  4XTV A;  4ZTJ A;  1YBY A;  2E41 A;  4N4H A;  1JJ2 A;  1OYX A;  3G4S A;  3JB9 F;  1M8V A;  2RJF A;  4M78 F;  1BI1 A;  3OSS C;  2E65 A;  2X4W A;  1VQ6 A;  1LOJ A;  2R58 A;  2PUK B;  2CZ0 B;  3JSC A;  4M77 E;  3PT9 A;  4BB7 A;  3X26 B;  2K3X A;  3CC4 A;  4A4K A;  1BI2 A;  4N4I A;  4PJO F;  1I8F A;  1D3B A;  1V29 B;  2RD1 A;  3MP6 A;  4XU1 A;  2E64 A;  4XTX A;  4C8Q C;  4F7U E;  3SDZ A;  1XNI A;  4J6X A;  1I5L A;  4C8Q G;  4BE0 A;  3HRU A;  4OB3 B;  4LD6 A;  4BUG A;  5D6W A;  3OS0 A;  3CPW S;  5A0L A;  4FU6 A;  5KCH A;  4TVR A;  3TU4 K;  3OS1 A;  3S3O A;  1UGQ B;  1Q82 C;  1R8O B;  2ZPF B;  2X35 A;  1QW1 A;  2RB6 A;  4BY6 B;  3JB9 I;  5CKD A;  1M90 U;  2DTH A;  3JB9 G;  3CCL T;  3H8Z A;  1BYM A;  4M78 G;  3LH0 A;  2E6N A;  1G3S A;  2LDM A;  3MEW A;  4BI4 A;  3CCR A;  3MCA B;  4XTZ A;  2RM4 A;  4M7A E;  1B34 A;  2P0P A;  4M7D C;  4IUP A;  3QZ9 B;  4JRQ A;  1UGS B;  3QYH B;  5KE3 A;  4M7D G;  1Q81 U;  3FDR A;  3RKW A;  5KCO A;  3LLR A;  2XDP A;  4XAX B;  3VKI A;  1DJ7 B;  4E7I A;  3QJY A;  4VUB A;  1W4S A;  3A8O B;  4E7L A;  1YJW A;  5I21 A;  3BDU A;  5GAM j;  3PIO A;  3H6Z A;  1N8R C;  1VQ9 T;  2EJF A;  2DZC A;  3A8G B;  3SD4 A;  1YIT T;  4OB2 B;  1BIB A;  1VQO T;  3FEO A;  4NOY A;  3OS2 A;  5GAN d;  4M75 A;  1YJN T;  2JTF A;  3OYA A;  3JCM P;  3LWH A;  2M0O A;  3E1S A;  4MZT A;  4F7U F;  3SFM A;  5LJ5 d;  4LDY A;  3OYN A;  2HBP A;  3A5Z B;  5GAN 2;  2RHU A;  3ZFJ A;  3PIP A;  3PFS A;  3MP8 A;  4QVD A;  3DLL A;  3N5B B;  2Y4X A;  3BFM A;  4X34 A;  5GAO r;  3QSU A;  3CME A;  3JB9 D;  2XKO C;  3CBO A;  4C8Q A;  1KQ1 A;  4M78 D;  3G71 T;  3A8H B;  4E7J A;  4BY6 C;  1YI2 T;  3OYJ A;  3CCL A;  1Y7X A;  3E9G A;  3TRE A;  1OZ2 A;  3V8J A;  2L3R A;  3JCM V;  4M7A F;  4PJO D;  1QVF S;  1QVP A;  3ZEH A;  2CZ1 B;  4M7D D;  2XID A;  1Q82 U;  5DLQ E;  4JLG A;  3CBP A;  2DTO A;  4ZGJ B;  1LNX A;  1NJI U;  1QP3 A;  1MGQ A;  3S3N A;  4QQ6 A;  5KH6 A;  3CXC S;  2VXF A;  3RMS A;  1VQM T;  3S3M A;  4XK8 E;  2KDS A;  2QQS A;  4PLL A;  4NL3 A;  1VQ9 A;  1IRE B;  1KHI A;  4M7D A;  2OTJ T;  4IUQ A;  3CCV A;  1VQO A;  3HSB A;  1M4Z A;  2EWN A;  3CCM T;  5LJ3 h;  2GQV A;  5GAN 8;  2HNI A;  5GAO l;  4IUR A;  4YTL A;  2K4Y A;  4KUL A;  2HQX A;  2LT4 A;  1JBM A;  2ZPB B;  1G3T A;  3JCM b;  1N8R U;  2K3Y A;  3CEY A;  2RO0 A;  1BIA A;  3UT1 A;  1UEB A;  2P0K A;  2DIG A;  2R5M A;  4JRP A;  1ZBX A;  3FJP A;  3JCM e;  3JB9 H;  2XI9 A;  3NFC A;  3CPF A;  1M5Q 1;  2FL7 A;  2MI6 A;  3GP8 A;  2MAM A;  4XQ3 A;  3VJP A;  3G71 A;  4X9D A;  1YI2 A;  1K8A U;  2Y90 A;  3P8H A;  2QXF A;  4O5V A;  3L2W A;  5GMK l;  2BIV A;  1YIJ T;  2EYQ A;  4BE2 A;  2D6F A;  4M78 B;  2O01 E;  4OVA A;  4LDX A;  1W2B A;  4EMK B;  3PMT A;  1VIE A;  2LTO A;  1N6A A;  4PJO B;  1S72 T;  3J80 E;  3LW5 E;  1Q86 U;  1G5V A;  1VQM A;  3CMA T;  3HL8 A;  3QKJ A;  2K57 A;  4DQ2 A;  4ZN3 A;  3BY7 A;  4GY5 A;  5GMK e;  1VQ7 A;  2IVW A;  2LNV A;  2MWP A;  2OTJ A;  5GMK i;  1N9S A;  3MEU A;  1YCY A;  2ZZD A;  4EMG A;  1OZ3 A;  5GAN 3;  3G6E A;  2D9T A;  3OQ5 A;  2QDY B;  3SWN B;  1FXX A;  3CCM A;  4E7K A;  3M56 A;  4C92 B;  1LJO A;  4CRI A;  3BW1 A;  1WPY A;  3OYF A;  4MZM A;  2DPP B;  1VQN A;  2EKO A;  4FT4 A;  1U1T A;  4XTY A;  5LJ3 e;  2FVU A;  4C5H A;  3JCM f;  4QW2 A;  2A7Y A;  4BD3 A;  5GAO q;  4QVZ A;  3FB9 A;  5DY9 A;  3CCJ A;  3RER A;  4ATO A;  3OYK A;  2F69 A;  3OBY A;  4XU3 A;  5GAM g;  2NLU A;  3HFN A;  4BDY A;  3C12 A;  5J39 A;  2YHT A;  4GLK A;  1KC8 U;  3VV0 A;  2K2V A;  4P5N A;  3HPW A;  4FM4 B;  5CKF A;  2VC8 A;  5GAM f;  3CCU A;  2DXB A;  4CI0 C;  2OAU A;  1TH7 A;  2QTX A;  3X20 B;  2HD0 A;  3CPW A;  3X24 B;  4C92 F;  4E47 A;  2LT1 A;  1WNL A;  4KUD K;  1K9M C;  2RHX A;  2JOY A;  3X28 B;  4M78 C;  3DLM A;  1NJI C;  4L6V 5;  4M77 B;  2PU9 B;  2E12 A;  4HA8 A;  4C0D B;  3OYI A;  4HT9 A;  4V2S A;  4OGE A;  5CKE A;  4L59 A;  1OI1 A;  3V7C A;  1P92 A;  4EMK C;  5CR2 A;  1GXI E;  2GFA A;  4JLI A;  3OYD A;  5FLX E;  4PJO C;  4F7U B;  3LX7 A;  1VQL T;  2MMP A;  1IZ6 A;  4PJO G;  3CMA A;  2XDD A;  3OYL A;  5CAI A;  2EQJ A;  4HCC A;  3JRZ A;  2RK1 A;  3V7S A;  4J6Y A;  2KAF A;  2EQM A;  2QEX T;  4J6W A;  2HAX A;  3CCE T;  3ME9 A;  2AHJ B;  2QQB A;  3EFS A;  4XU2 A;  5GAO m;  2V8I A;  3SWN C;  4ZTF A;  3M4Y A;  4C92 C;  1SSF A;  1M1F A;  2EQU A;  2CGH A;  2BUD A;  2EFI A;  2X4J A;  1BKB A;  5IN1 A;  4C92 G;  5HK3 A;  4M77 F;  3G7Z A;  3A8L B;  3C4S A;  5GAN h;  3KXT A;  2DK3 A;  4J7F A;  4EDU A;  1VQ5 T;  3HRS A;  1N27 A;  3E19 A;  4M7A B;  5HY6 A;  3OYG A;  3GOX A;  2K5F A;  2DXT A;  1K8A C;  2KY9 A;  5LJ5 h;  5GMK j;  4PKC C;  4NL2 A;  3PTA A;  1UGP B;  1VQK T;  5FRO A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...