4N0AC

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
86
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDESVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm3
total genus 19
structure length 86
sequence length 93
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aC00
4A54A 3SWNC 3BW1A 4F7UG 4M7DE 4F7UB 4C8QD 2DTHA 3L2ZA 1WQWA 3JCMe 2EJ9A 3JCMQ 4C92F 3RESA 3JCMd 2K57A 3BDUA 4C8QE 5GAMg 4M7AE 5GAOn 1U1SA 4XTXA 4DQ2A 5LJ3f 4WF2A 5GAOp 4RCCA 4X9DA 5LJ5j 1B34B 2E41A 2E64A 5GMKl 2VC8A 4M7AG 4M7AB 5GAMj 1LNXA 4M77F 1WNLA 1BIAA 4XU3A 4C92D 5GMKm 4OP0A 3V8KA 3JCMJ 4M7DC 4EMHA 5GAN5 1N9SA 5GAOm 4M75B 4Y91A 4MMKA 2JN0A 3PGGA 3V8LA 3V7SA 3M4GA 4PJOD 2FB7A 5GAOq 5LJ3g 3RIRA 4J6WA 4M78F 4XU0A 5LJ5e 1D3BA 2VXFA 1HK9A 2ZGWA 5GAMe 4NL3A 5LJ5d 5GAN3 1JRIA 4V2SA 5LJ5h 2DJZA 4XQ3A 4M77G 4N0AC 1JBMA 4M78G 4N0AA 4M78B 3JCMX 4NL2A 3JCMf 1KQ1A 2DTOA 1B34A 1LJOA 4M78D 3JCMP 4QVCA 4M7AA 4M7AC 4XTUA 3V7RA 1U1TA 5GANh 1I4K1 4XU2A 2CGHA 3FIFA 4PJOF 4C8QF 1BIBA 5LJ3e 5LJ5g 3AHUA 4M7AF 3SWNA 5GANd 4PJOA 4PJOC 4M75C 3JCMc 1MGQA 2DVEA 2EAYA 4JRKA 4MMLA 5LJ3h 3SB2A 4A53A 5GMKj 3VU3C 4PJOB 1Y96A 2EJGA 4J6YA 2HNIA 4PJOG 5GANg 1N9RA 4F7UE 4M75D 4C92A 2RM4A 3JCMh 5LJ3j 4EMKB 3INZA 4PJOE 3GIBA 1WQ7A 4C92B 2YHTA 5GAN6 2YLCA 3V7CA 4EMKC 5LJ5f 4M78C 4XU1A 4M7AD 5GMKe 2EWNA 5GANe 2RD1A 3QSUA 4JUVA 4M75G 4C8QA 2RB6A 4M7DG 4RCBA 4PNOA 5GMKh 4M7DF 5GAMf 2DZCA 4J6XA 5GAN4 4M75E 4C8QG 4M7DA 1YCYA 4C8QB 4XTWA 1M8VA 5DY9A 1X01A 3QO3A 3BFMA 3QUIA 3HFNA 4HT9A 3JCMg 4C8QC 5I21A 5GAMd 3JB9F 3BY7A 3FJPA 2DEQA 2I2LA 2Y90A 3JCMV 5CAIA 3JCMb 3L1AA 2QTXA 4M7DD 5GAN8 2E1HA 4C92C 3EFRA 4M77D 1M5Q1 4HA8A 4M78E 3RKXA 5GMKi 4EMGA 3HSBA 4JRIA 3JB9J 1H641 1I81A 5GAN2 5GAOr 4M77A 4XTYA 4M75A 3V8JA 2RA2A 3RUXA 3JB9I 1WPYA 3HFOA 3RKYA 4M75F 4JLIA 2YLBA 3QHSA 3JB9D 1D3BB 3JB9G 1I5LA 4HT8A 2DTIA 2DZ9A 1LOJA 3RERA 4M77E 1TH7A 2DXTA 4X9CA 4QVDA 2DXUA 3EFSA 2FYKA 2DKGA 5GAN7 2E10A 4C92G 4M78A 5GAMh 4XTZA 5GAOl 4NOYA 5GANf 3FB9A 4M77B 1Y96B 5GANj 4J5YA 3RKWA 3JB9H 1KQ2A 4C92E 2E65A 4M77C 4M7DB 1HXDA 1I8FA 5LJ3d 4F7UA 3SWNB 3JCMW 2VXEA 2EJFA 4XTVA 4EMKA 4F7UF
chains in the Genus database with same CATH superfamily
4KULA 1WYXA 2HQEA 3G71Q 1VUBA 3M53A 1M3AA 1PNJA 5ECAA 2QG9B 2JVVA 3UWNA 1D0XA 2KXCA 2CP0A 3UPUA 4KBMB 4JJBA 2CH4A 4E6RA 5GMKm 3O5ZA 3QYHB 4ELZC 1WHLA 3PGGA 2VKNA 3CCMT 1WHJA 4NL3A 2ZPGB 2F5TX 2ZPHB 2FRWA 1M1KR 4J7IA 3JCMf 3G4SQ 2DIQA 3CCJA 5DLQE 4A53A 5KYYB 1CKBA 4RTWA 4C0DC 4PJNA 2MPXC 1EIFA 4M78C 2GQVA 2OJ2A 1Q7YC 2JM9A 1PKTA 2RB6A 2R5MA 2EKHA 1K73R 1GL5A 2AKLA 3TQ7P 3C0CA 1YCYA 3CCQT 5DY9A 2DIGA 3QUIA 5GAMd 1QCOA 2DEQA 3VYGA 5AYFA 4AFQC 3MP8A 4LDYA 2IIMA 4CC7A 3QWYA 3M5AA 1WZOA 4EMGA 1D0YA 2RHXA 3SEMA 2L3QA 1T0JA 1K73U 1VQOT 2XICA 2P4TA 5GJWB 2HCKA 3GLXA 3A98A 2IG0A 3EAEA 5C6SA 4OMMA 1Q81R 4HKEA 3EHRA 3I56Q 1HSQA 2KK4A 1S72Q 3L2WA 3TVTA 1SPKA 4HVUA 2H3JA 4R55A 3GIBA 1Q81U 3UA7A 4HCCA 1TWBA 3S3NA 1VQKT 1VQMA 3LYIA 1X2KA 2VGNA 3CMAT 3H0IA 3ZFJA 2BE7D 1MUZA 4LXCA 3QDFA 4RKUE 1WJSA 2GTJA 2KGTA 4XU3A 3TSZA 3V8LA 2FB7A 5GAMe 2BIVA 4V2SA 3UF4A 5FU7B 4M78G 1AWXA 4N0AA 4M78B 4PJLA 2LX7A 1VYUA 1XNIA 3CC4Q 1RI0A 2L2PA 4LDUA 1Y71A 4RTUA 4FU6A 1ZHIA 4PJOC 3SB2A 4PLIA 1QVFS 4PJOB 2ZAEA 4BD3A 4EDUA 2E12A 2NUTA 1NEBA 2LCSA 2RM4A 2DVJA 3JCMh 4A4GA 2DILA 4E7LA 1BI0A 4JJCA 3WXMB 5D6YA 4KH1B 1QLYA 1GBQA 1NJIC 5CKHA 4DBFA 1U5SA 4M7DF 3CQTA 4C8QG 2JM8A 1E6GA 1OX9A 5KYYA 4E7KA 3CCJT 2XMFA 2EW3A 1Q7YR 2L5QA 2V8JA 4ZNXA 2QTXA 3ASKA 4KH0B 4M7DD 3QKJA 5IN1A 3S3OA 2Z0WA 5IHKA 1YP5A 1NPRA 3VS3A 4RTVA 2DM1A 4XTYA 2EGAA 3DB4A 4PFZA 1QWFA 1WPYA 2O01E 3OA6A 1WIEA 1YJNQ 2JZ2A 5GAOl 3MP6A 4HVWA 4J5YA 2C0TA 1RAEB 1RAHB 1BK2A 2VB6A 3LH0A 3SWNB 4OB3B 2JMCA 1MMGA 1IO6A 1WJRA 1VQ9T 3JCMe 3OQ5A 1SKUB 1VYVA 3EGUA 2LP5A 1ZSZB 1AVZC 1EZZB 4J7FA 5GAMg 4C8QE 3J81E 3P8BB 1M1KU 1RAGB 1WNLA 4C92D 2J05A 5GAOm 1JXMA 1JU5C 2MF2A 3WVEB 1G2BA 1YWOA 2VYTA 5GAOq 3RIRA 1YITT 1UUEA 3OS0A 1VQLQ 1ZA1B 1M30A 1FYNA 1J3TA 4FYWB 4MDWA 1G3TA 4II1A 1YJWA 2DTOA 2MAMA 4XU2A 1MV3A 2CGHA 5LJ3e 1M1KC 2VVKA 2ZPFB 4CRIA 1OV3A 3L2UA 4M4ZA 5GANg 2A36A 3OS2A 5KH6A 4CC2A 4IKFA 1W2BP 2DRKA 3QWXX 2OAWA 4C92B 3HTRA 1JJ2A 1C1AA 4N4HA 3VYHB 2WSEE 1QVGS 4HCBA 2BKDN 3QZ5B 5IAYA 2YT6A 1S72T 5KE3A 3JSCA 3MEAA 2FRYA 3HFNA 3CCQA 2MOXA 4LNPA 2P84A 4JDSA 4BDYA 4B6MA 4RUGA 5CCAA 1M90U 2E1HA 3PVLA 4J83A 2K5FA 1JEGA 1HYOA 5I2MA 5KYUB 1TUDA 5GAN2 1CKAA 1VQ4A 1R8OB 4M75A 3H41A 3HFOA 1K8AC 4JLIA 4DBQA 4D8DA 4M77E 4QVDA 1BI1A 3SHWA 4E2FB 1LCKA 1AZEA 4QQDA 3FB9A 3M0UA 3TCJA 1I5OB 1RAAB 4M7DB 1H92A 1HXDA 1NE8A 2EJFA 1WXTA 2X35A 3SWNC 5IXFA 4J9BA 4F7UG 9ATCB 4KT0E 3OYFA 1AWOA 1WQWA 2DXBA 2PUOB 2AK5A 1UFFA 2CZ0B 4F04B 2DD5A 3H6ZA 1OOTA 4X9DA 2D8HA 4JZ3A 4BI3A 4CC3A 8AT1B 1SG5A 1Q82R 3QZ9B 2K3BA 1PWTA 2DPPB 3M58A 2DBKA 3CC7A 3I55A 4NS5A 2YRVA 1VQ5T 2F1LA 3OS5A 2DK3A 1ZSZC 5C0MA 2DJZA 4M77G 3CCST 4N0AC 3CD6A 4PFPA 3CCJQ 4MDXA 3V7RA 2QXFA 2JJ9A 1K0SA 4OB0B 1ACMB 3JCMc 1LPLA 2EAYA 3BDLA 3I35A 4DEYA 4Y28E 3DLLA 1AZGB 2L8DA 2KVQG 5FW9A 4C92A 1TOVA 3EG3A 4DOVA 1WQ7A 2I0NA 3QDRB 2KSSA 1YJNT 4PNOA 5FRNA 2ROLA 3BFMA 4MZPA 2OTJT 1ZBXA 1YI2Q 1PD0A 2GTOA 3NPFA 4PK4A 3REAB 2HZYA 4MZTA 2PUKB 4GLKA 3CCVQ 2OI3A 2EQKA 2EYYA 4E47A 3VJPA 2KROA 2J6KA 2ZPIB 1I5LA 4AG2C 4PLLA 3QXEB 5J39A 1UGPB 1Y96B 1W2BS 3OYAA 5CQYA 2HDAA 5GMKh 4WCIA 2A3LA 1YBYA 3M56A 1VQ8T 2FPDA 5FWCA 1VQ4Q 2CZ1B 1TSFA 5CKFA 3OYLA 2E41A 3H0FA 4BI8B 3E1SA 2D8JA 4M7DC 1PRLC 1GFDA 1ZLMA 3VS6A 2OTLT 2QEXQ 2QQAA 3V7SA 3F70A 5LJ3g 1WA7A 1ZUYA 3TU4K 1G3WA 2AT1B 2ED1A 2EYXA 2Y4XA 1AT1B 3CCMA 5IH2A 3VS1A 1R0CB 4X34A 3C12A 5FU7C 4E7ZA 3CCEA 2M0YA 4XTUA 1ABQA 1JO8A 3M9QA 3GPLA 1BBZA 2PVGB 1KFZA 2DVEA 2COWA 2LNVA 3NHNA 1WHHA 2GBQA 4IIOA 3NMZC 1UGSB 2XDPA 1BB9A 5GAN6 3X28B 1OYXA 4OVAA 2QYZA 4XU1A 2ESWA 3PIOA 5FRMA 2DLPA 3KFVA 4E7IA 2RI2A 4K11A 1SHFA 1X01A 1RUWA 5EC7A 4GY5A 3P8HA 3EH2A 2KEAA 3JCMb 5FROA 4FYYB 3THKA 1KD1U 1YN8A 2CREA 3HP9A 2E70A 2JS2A 4RTYA 3C94A 4M77A 3RMQA 4CC4B 3RKYA 1YJ9A 2DZ9A 2DYBA 5D6XA 2DKGA 1QVPA 4NOYA 2QQSA 2RHUA 3E9FA 2E5QA 5CO7A 3MEWA 2BE9B 1IGUA 2GNCA 5DLOA 1GBRA 3VS5A 2QQBA 1RACB 2LVMA 1K8AU 1I1JA 2RPNA 2LQWA 1JJ2P 3I55Q 1UDLA 2J6FA 2M1HA 5GAMj 3CC2Q 2KQWA 3OYDA 1UECA 3CCUQ 2DL5A 3EGDB 1W70A 3OYGA 1Q7YU 4FYXB 1MNEA 5LJ5d 3QJ6A 1YNZA 4UC4A 4EIKA 1JBMA 3ULRB 1T3SA 1YIJA 3X24B 5IXBA 1BCMA 2KDSA 4BY6C 2K9GA 1YI2T 2LRQA 3AHUA 1D1AA 4BY6B 1FXXA 3CMEQ 1VQPA 3PIPA 5KCOA 2KMTA 4J6YA 3RR6A 4LE9A 2JTMA 4DBRA 2AIRB 5EG2A 4BE2A 2H3EB 2RHYA 5LJ3j 1MV0B 4AFUC 4AFSC 1V76A 3V7CA 2CKKA 4C0FA 5GANe 4JUVA 2NUZA 4J6XA 4XTWA 1X43A 3A8MB 4KUDK 1M3BA 3JCMg 2KE9A 3CCUA 3FJPA 4ELYC 3M0SA 5HCKA 1KC8R 3EG0A 2RHZA 4M77D 1M5Q1 4HA8A 1M90C 5GMKi 4PJMA 1EFNA 1VOMA 3L42A 3LWIA 5DM7R 5CKDA 3NTKA 1M4ZA 4M75F 1K9MU 2P0QA 2PNIA 3CPWA 3MEVA 3TSWA 4A4EA 1X6OA 2DXUA 3OYKA 3C4SA 2FYKA 2MK5A 1S72A 1R0BG 2O4XA 2X3XD 2LC4A 3CXCS 3CPWP 5CR2A 2K3YA 3LH5A 4BUGA 1U06A 2JUFA 3HRUA 5LJ3d 4ZTFA 2G6FX 1YIJT 3GNGA 4C0GA 1QVFA 1AHJB 1ZSZA 2V8KA 3A8OB 4J9CA 2YUOA 2DMOA 2KYMA 4XTXA 1KC8C 1OULA 4IUUA 5GAOp 5LJ5j 2VC8A 1OU8A 2GFAA 3MPUB 3QIIA 1IREB 3G71A 1YJWT 2LT1A 1VYTA 2YUPA 2RN8A 4J6WA 2RNAA 5GAN3 1TUCA 4QQ6A 2QASA 5LJ5h 1X6BA 2NUPB 4J9FA 1IB8A 1KK7A 3CCRA 4VUBA 4M7AC 4LDXA 1G5VA 1GRIA 4PJOF 2LNHB 1N6AA 2YSQA 3NTIA 4HCKA 2L3PA 2O88A 1Y96A 1KIKA 3H9NA 3KBGA 2EYWA 3CCRT 2PVOB 4L59A 1G83A 4LDWA 1K76A 4A4KA 4J9GA 4O5VA 3EFOB 3CCMQ 1YITA 1PCXA 2EFIA 1I07A 2IVWA 4M7DA 2E6NA 1R77A 1WX6A 1WHGA 1KC8U 4LDVA 2LQNA 3CCSA 1F1BB 2KT8A 4JRIA 1IXDA 2QI2A 1O9SA 3JB9I 3I55T 4FW2A 4FT4A 3KUFA 3M0RA 1OPKA 4ZGEB 3VS0A 2HEQA 4FIBA 4C92G 3OSVA 3GOXA 4ME7A 2E65A 3M57A 1E6HA 1KSWA 2EIFA 1ZA2B 4C8QD 2KYBA 2K2MA 2FZCB 3EGXB 1X75C 4HVVA 1SSFA 2X4WA 2ED0A 4MZMA 2RJCA 3CCLT 2X3WD 4Y91A 2E6ZA 3HHTB 1XJWB 2CP7A 2ZPEB 5FU6C 4M78F 2CDTA 4BDZA 1ZUUA 3H0HA 3O8VA 4OGCA 1VQ7A 6AT1B 3I9QA 2QAZA 4BE1A 1VQKQ 1ZBJA 1W6XA 4QW2A 1QKXA 1M3CA 2EYZA 5GANd 1UHCA 2NLUA 3X26B 4BACA 4RMOA 1VQ6T 4F7UE 2LQKA 4BB7A 1NJIU 2FPEA 4J8OA 1N8RR 2YHTA 1W2BA 3GF5A 3FJ5A 5GMKe 1Y0MA 3QSUA 1ARKA 3I5SA 4QKUA 1H3ZA 1IHVA 4A4HA 5A0GA 2KBTA 3OB9A 5I21A 1YIJQ 3BY7A 2QA4A 4GBQA 3L1AA 2C06A 3CBMA 2EGEA 2H8HA 1B7TA 1OI1A 1VQKA 3OYBA 3JB9G 2R58A 1NYFA 2PVDB 3BE3A 2NUTB 3EFSA 3MKDA 1PSEA 5GAN7 2QDYB 3G1JA 1JJ2S 1IZ6A 4IUQA 2A37A 1I8FA 1Z9ZA 3JAME 2HBPA 4F7UF 2DERA 1VQ9A 1NEGA 3S3MA 1QCNA 3L2ZA 5CVIA 1OZ3A 4F14A 2K57A 2OX7A 1IHWA 1U1SA 4DQ2A 3NFCA 4M7AB 2F69A 3I5RA 3EG1A 4Y92A 3CCRQ 4OP0A 5KYWB 5FU6B 1JRIA 2D1XA 4D6WA 2DETA 4JLGA 1KHCA 2NYSA 4FYVB 5IHNA 1OQKA 2FG0A 1LJOA 2D6FA 1U1TA 5KYXB 3URGA 1EX4A 3SWNA 3OY9A 3ZBDA 5LJ3h 1PSFA 2EJGA 3R6OA 4J9HA 4PJOG 3M0PA 1PM3A 3EH1A 5HY6A 2ENMA 3HRSA 1TXQA 4JRQA 2O2OA 4M7AD 2JT4A 3U23A 1VQNQ 1D09B 1K9AA 1YITQ 3EGXA 4B9XA 1SRMA 2YRCA 5CKEA 1QVFP 1ZUKA 1KJWA 1Y07A 3EG2A 3ME9A 5CK9A 1NYGA 2I2LA 3DKMA 3MEUA 2M16A 1K4US 4J9IA 4FM4B 2FZGB 1Y7XA 3EFRA 1PRMC 4E7JA 3GBQA 1KQSS 3QBYA 5GAOr 4R0KA 2RH2A 2XDBA 2FPFA 1WLPB 1DJ7B 3M59A 4HT8A 2BZYA 2QA4T 2V1QA 8ATCB 1LOJA 2ABLA 2OTJA 1IRXA 3FEOA 2E3IA 1U3OA 1UGVA 2DBMA 1YHQA 5KYXA 1PHTA 2A28A 2F5KA 1U8RA 1QP3A 4M7DE 4YTLA 4J9DA 1Q86R 5CKBA 2JNGA 3ZEHA 1GCPA 3E19A 1MMNA 2F2XA 2KAFA 2KNBB 2AZSA 2EVRA 4KRTA 5GMKl 3OYEA 2XKOC 1VQ6Q 3CC4A 4FSXA 2FZKB 3V8KA 4OMFB 5GAN5 2X51A 4M75B 4MMKA 2GGRA 2CSIA 5L23A 2JTEA 2RQUA 1D3BA 3CCEQ 4ATOA 1K73C 1VQ5A 1P92A 4WTOB 2RJEA 4IIMA 3OBYA 1B34A 1JQQA 4C5HA 3TEEA 1Q82C 5GANh 4C8QF 4M7AF 3OYNA 2DL8A 4PJOA 4JRKA 1ZSGA 3VKIA 4E7SA 3LGFA 2DL7A 1KQSA 3CD6T 2IPOB 2B86A 1TTHB 2O9SA 2KI7A 2LJ0A 3DB3A 3OSSC 3HRTA 2W0ZA 2LT4A 1D0ZA 3I56A 2K5IA 3CC7T 4JS5A 3LX7A 2ECZA 3T9NA 2BUDA 3FRNA 4C8QB 3OYCA 3QO3A 2RI5A 2LCLA 2WACA 2RQWA 4RTXA 4OB2B 2V1RA 2Y90A 3JCMV 1M90R 3JV3A 3CMEA 1VQPQ 1V1CA 4OF1A 5HKCA 4M78E 2M51A 3M0TA 3RKXA 3OYJA 1H641 1O75A 1SRLA 3RUXA 3OYHA 1X27A 3QHSA 2RQTA 3OMCA 4CI0C 3UATA 3VUZA 3GP8A 3UA6A 2KT1A 1XQHA 2MWOA 4XTZA 5IT9E 3PFSA 3VS4A 1T0HA 4FCYA 1RLPC 4AMCA 3A8LB 1YCSB 1WHMA 4OMNA 4A54A 1VQ8A 1W4SA 2VV5A 3G4ST 4C92F 3RESA 2F2VA 4OMPA 3C95A 1HD3A 2DRMA 3CCVT 2X4YA 2K4YA 4RCCA 2E64A 1G8XA 2J06A 1YHQQ 3J80E 2WSFE 4EMHA 3E9GA 3CPFA 2RK2A 2ATCB 2K3XA 2K7AA 1VQNT 2VXFA 1V29B 3MHXA 3QYGB 2QEXA 4ZGDB 2K2VA 1VQ7Q 4QVZA 2YXYA 4QVCA 4M7AA 1PD1A 1D1CA 3PTAA 2XDDA 2YWWA 2VASA 1KG1A 4E7HA 3MO8A 4DOWA 5KYUA 1YJNA 2CS7A 4LUEA 2OTLQ 2L89A 1VQOQ 4C0ZA 2QEXT 1FMVA 1Q81C 2RI3A 4LD9K 2MIOA 3NGPA 4D8KA 2LZ6B 1VQNA 2EQIA 1M8MA 4BE0A 4M7DG 2F2WA 2K6DA 2QGFB 3Q1JA 1BI2A 1NBEB 2ZCFB 2QTVA 2C0OA 1RLQC 4F17A 2DL3A 4C8QC 1RABB 2RJDA 4XK8E 5KCHA 3CMAQ 5J3BA 2RQRA 3OYIA 5I2SA 1WFWA 2XD0A 1AWJA 1TH7A 1ZX6A 2MWPA 2COYA 3S6WA 5GANf 1NJIR 2KXDA 3JB9H 2D0QB 4C92E 3CXCP 1M1GA 3CCET 1G3SA 2CP2A 2PU9B 2C0IA 1QP2A 2KY9A 3PNWC 3BW1A 3LWHA 1QMCA 4BI4A 2EJ9A 2PQWA 4IUVA 3VRYA 1RL2A 4PL6A 5LJ3f 2JXBA 1FMKA 1UG1A 1B34B 2FL7A 5A2QE 2P4RA 2J6OA 4X1VA 3JCMJ 3AT1B 3EFOA 1GFCA 1E7OA 1UJ0A 4XU0A 1WJQA 2CUBA 2HQXA 3CC7Q 1VQMQ 3X20B 3JCMX 2O9VA 1UB4A 2G3RA 2DXCA 5KYWA 1K0XA 2KR3A 3M4YA 2QQRA 4JPBW 1VQPT 3R6NA 3OYMA 3RDVA 2JMAA 5GMKj 2LMJA 2DJQA 4M75D 2YRDA 3PT9A 4Z89A 2OAUA 2L0AA 2VGMA 2M9UA 2XU8A 2EQUA 4JRPA 2DE0X 4A63B 5LJ5f 1BU1A 3M0QA 4Z02A 1N8RC 3P8DA 4P5NA 1OX8A 2BZXA 2RHIA 4DBHA 2QK0A 2HL5C 2DZCA 4IURA 4M75E 1M8VA 1S1NA 4Z8AA 2DFUA 2CZ6B 4HT9A 4AG1C 3OMGA 1YJ9T 1KD1R 2SRCA 3OW2P 1VQOA 5GAN8 1VQ9Q 1IGQA 3VS7A 4O6JA 2J7IA 1BCOA 3V8JA 2RA2A 1ABOA 1YHQT 1PKSA 2GF7A 3RERA 2XK0A 2E10A 3DLMA 1HJDA 2V26A 5CQXA 2DYIA 3MJXA 2VUBA 1VQLT 1CSKA 4KUIA 3G4SA 1WGSA 1VQ7T 2YUQA 2DTHA 2EGCA 2PTKA 4L6V5 1M9SA 3BDUA 4M7AE 1MMAA 2CSQA 2JW4A 4M77F 4ORZA 4AFZC 4FW1A 2NUPA 1QVGA 3M4GA 2HBWA 3L2VA 3A5ZB 1AWWA 4C0DB 4JS4A 2A0FB 1QQJA 3KXTA 2PZ1A 3TREA 3SD4A 1UHFA 2OTLA 1KQ1A 3G6EA 1UEBA 2CP5A 5GJVB 1I4K1 2XG8D 1BIBA 4ANJA 1LVKA 3M54A 2GCXA 3VV0A 2CUDA 4OMOA 3CBPA 1C0MA 2DEUA 1N9RA 3LGLA 3G6ET 2LJ3A 3HKSA 1NLPC 3INZA 2M02A 2SEMA 2DNUA 1RADB 2EQJA 2ROTA 2LQ8A 2JS0A 1UGRB 2LCCA 4B9WA 2DO3A 1JXOA 1TUGB 4C5GA 2CH4W 2RMOA 2FVUA 3J7AF 4KGVB 3MCAB 2LJ1A 3QJYA 4QQGA 1M1FA 4JJNK 2Y4YA 1TG0A 1BI3A 1OZ2A 1VQLA 1Q86C 2DTIA 2JTFA 4XAXB 2MYSA 3L2RA 4PJJA 3QPHA 1N8RU 3CBOA 5GANj 1VQ5Q 2ZPBB 1KQ2A 2KRMA 1QWEA 2L3SA 3SDZA 2DAQA 4XTVA 3CMAA 1VQMT 3CCSQ 4GLMA 4PKCC 2O4XB 1QCFA 3JCMQ 1PC0A 3JCMd 1YFNA 3H8ZA 1X2QA 5GAOn 2RO0A 4LN2A 2KRNA 4M7AG 1LNXA 2VWFA 2A7YA 1OEBA 3CXCA 3UDCA 1N9SA 3EHQA 1XTDA 5CIUA 1RAFB 4AT1B 4TVRA 2CP6A 4ZN3A 5LJ5e 1Q82U 3PE0A 2RQVA 1XOVA 4XQ3A 5J26A 3WVDB 2EYQA 5M9OA 4OGEA 2NWMA 4N4GA 2OTJQ 4L5GA 3FIFA 1YJ9Q 1NLOC 2XI9A 4MMLA 4OMQA 1AD5A 4C5IA 4FT2A 3CCLQ 4PJOE 4EMKB 1NM7A 2BZ8A 2K79A 2YLCA 2EWNA 2COZA 4M75G 4C8QA 1K9MR 2EQMA 5LL6S 1QVGP 1N27A 3FDRA 5GAN4 3A8HB 2A08A 2L3RA 1Y57A 1A0NB 3E2UA 1VA7A 3PMIA 5CAIA 1SF9A 1VQ8Q 2WSCE 2ZZDA 2O31A 3HL8A 2RF0A 2X4XA 4LUDA 1VQ4T 5D7UA 1MHNA 3OYYA 3M55A 3D7SB 1I81A 2LX9A 4EPCA 1MNDA 3PMTA 3JB9D 1B07A 2YLBA 2GQIA 2XHCA 4X9CA 1Q86U 3OBWA 1GXIE 4M78A 5I11A 5GAMh 3VUBA 4ZGJB 1BYMA 2HD0A 1TS9A 1G3YA 3L2QA 1C6VX 2FO0A 3CC2A 4QT7A 4J9EA 2VXEA 3LLRA 1NZ9A 1UJYA 2DL4A 1M2OA 7AT1B 4ZTJA 4JZ4A 3RNJA 3OW2S 5AT1B 3CEYA 4WF2A 4ESRA 2X4JA 1M2VB 4KGZB 2M0OA 2GFUA 3IQLA 2QDLA 1UTIA 3G6EQ 2HL3A 1NPPA 1B3QA 2JN0A 1HK9A 1BKBA 4Z88A 3SFMA 2D0NA 1UE9A 2HSEB 1YWPA 3ER0A 3G71T 3JCMP 2CT4A 1SSHA 2X9HA 4ZN1A 1AOJA 1SHGA 1SEMA 2MI6A 3RBBB 2R5AA 1RI9A 2E4HA 1WXBA 2CT3A 2YDLA 2YUNA 1Q95G 3GNFB 4LD6A 2EBPA 4EMKC 2CYZB 2B8AA 2DD4A 2RJFA 1PG5B 5I22A 1FWZA 4IUTA 2HAXA 1N5ZA 5D6WA 1K1ZA 2K5LA 2EPDA 1GCQC 3JB9F 2LTOA 4IUPA 1M27C 4C92C 4RG2A 1TU0B 4R56A 5FLXE 3HSBA 3JB9J 3G7ZA 2CP3A 5L8RE 3RMSA 3LW5E 4C5EA 2KRSA 4FL6A 3CC2T 1D3BB 3CCUT 1VIEA 3CCLA 2DXTA 4PFOA 1AEYA 1X69A 1WXUA 5A0DA 2RK1A 3N5BB 4F16A 4M77B 2FEIA 3A1PA 3CCQQ 4M77C 2QGGA 1FMWA 4F7UA 2JOYA 2P0PA 3PVQA 4EMKA 4OB1B 4F7UB 2HSPA 3X25B 2MMPA 1H3HA 1RAIB 2W10A 1MMDA 2AHJB 1M2VA 4N4IA 4RTZA 3CMET 2HQHA 2CZ7B 2D9TA 2V8IA 4HCZA 1NG2A 2QA4Q 1I0CA 1BIAA 1WI7A 3FC3A 4HXJA 1Z9QA 1OPLA 1W1FA 4PJOD 3I56T 2DF6A 2QQ9A 2ZGWA 1H8KA 2EKOA 3META 1OU9A 4RTTA 3EGDA 1KQSP 4NL2A 2P0KA 4M78D 1JB0E 3QG1A 1FX7A 5FWBA 2FHDA 5LJ5g 3CPWS 2HKNA 3VRZA 4DA4A 1KHIA 1UGQB 4Q5WA 4M75C 1MGQA 4DEXA 3MP1A 5KE2A 1YI2A 3VS2A 3VU3C 2HNIA 2BTTA 1VIFA 4JJDA 5HK3A 1QKWA 1ZQ1A 3A8GB 1D1BA 4FSSA 5IHIA 2E3HA 4KGXB 3REBB 3OS1A 1X6GA 4A4FA 2RD1A 2XIDA 2AZVA 4RCBA 3UT1A 5GAMf 3FLGA 3CC4T 3JRZA 2LDMA 2DX1A 5HK0A 3NTHA 1T3LA 1KD1C 1GCQA 3EG9B 2MCNA 3ZL7C 3OW2A 3CD6Q 1QW1A 1K8AR 3EG9A 2DA9A 4RG8A 1VQ6A 1WDXA 5A0LA 1YJWQ 2HKQB 2R57A 2AKKA 2HMAA 1K9MC 3RKWA 1WHKA 3CCVA 3JCMW 2E5KA 4OMLA 5KYNA 3HPWA
chains in the Genus database with same CATH topology
1WGSA 2A3LA 1VQ7T 1YBYA 3M56A 4KULA 1VQ9A 1VQ8T 2HQEA 3S3MA 1VUBA 2DTHA 3L2ZA 5CVIA 3M53A 1OZ3A 4L6V5 1M9SA 2K57A 3BDUA 4M7AE 1U1SA 2JVVA 4DQ2A 2CZ1B 5CKFA 3OYLA 3NFCA 3UWNA 2E41A 4M7AB 2F69A 4M77F 4BI8B 3UPUA 4KBMB 3E1SA 5GMKm 4OP0A 4M7DC 3QYHB 4ELZC 1QVGA 2OTLT 2QQAA 3PGGA 3V7SA 3M4GA 3L2VA 3F70A 3CCMT 5LJ3g 3A5ZB 5FU6B 4C0DB 3TU4K 1G3WA 4NL3A 2ZPGB 4JS4A 2Y4XA 1JRIA 2F5TX 3KXTA 3CCMA 4D6WA 2ZPHB 4JLGA 3TREA 3SD4A 1KHCA 4X34A 4J7IA 3JCMf 3C12A 5FU7C 1KQ1A 3G6EA 2OTLA 1LJOA 1UEBA 3CCEA 2DIQA 2D6FA 4XTUA 1U1TA 3CCJA 1I4K1 3M9QA 2XG8D 3J7AF 1BIBA 3URGA 3GPLA 3SWNA 3M54A 5DLQE 2GCXA 3VV0A 3ZBDA 2PVGB 3OY9A 2DVEA 5LJ3h 4A53A 1PSFA 3CBPA 2EJGA 3R6OA 4PJOG 1N9RA 2LNVA 3LGLA 3G6ET 4C0DC 3HKSA 5HY6A 1UGSB 3INZA 3HRSA 2XDPA 4JRQA 5GAN6 3X28B 1OYXA 4M7AD 1EIFA 4OVAA 4M78C 4XU1A 2GQVA 4B9XA 2EQJA 3PIOA 1Q7YC 5FRMA 2RB6A 2LQ8A 2R5MA 4E7IA 1UGRB 2RI2A 5CKEA 2LCCA 4B9WA 2DO3A 3CCQT 1YCYA 1Y07A 5DY9A 1X01A 2DIGA 3ME9A 3QUIA 4C5GA 4GY5A 5GAMd 5CK9A 3P8HA 2DEQA 2I2LA 2FVUA 5AYFA 3VYGA 3JCMb 3MP8A 3DKMA 3MCAB 3MEUA 4LDYA 2M16A 5FROA 1KD1U 4FM4B 1Y7XA 3EFRA 3M5AA 4E7JA 3HP9A 1KQSS 3QBYA 4EMGA 2E70A 3QJYA 2RHXA 4QQGA 5GAOr 2RH2A 3C94A 2XDBA 4M77A 1DJ7B 1M1FA 3RMQA 4JJNK 2Y4YA 3M59A 1K73U 1BI3A 3RKYA 1OZ2A 1VQOT 4HT8A 1VQLA 1YJ9A 1Q86C 2QA4T 2XICA 2DTIA 2P4TA 2DZ9A 1LOJA 2JTFA 4XAXB 2OTJA 3GLXA 5D6XA 2DKGA 2IG0A 3EAEA 5C6SA 3L2RA 3FEOA 3QPHA 1QVPA 4NOYA 4HKEA 1N8RU 3CBOA 5GANj 2QQSA 2RHUA 2ZPBB 2KK4A 3E9FA 1KQ2A 2E5QA 3L2WA 5CO7A 1YHQA 3MEWA 3SDZA 2H3JA 2DAQA 4XTVA 2F5KA 4R55A 3CMAA 1VQMT 1U8RA 3GIBA 1Q81U 1QP3A 4HCCA 3S3NA 4M7DE 1VQKT 4PKCC 4YTLA 1VQMA 3LYIA 5DLOA 2VGNA 2O4XB 3CMAT 3JCMQ 5CKBA 2JNGA 3ZEHA 3E19A 3JCMd 3ZFJA 3H8ZA 2QQBA 5GAOn 2RO0A 2KAFA 2LVMA 1K8AU 4RKUE 2M1HA 1WJSA 5GMKl 3OYEA 2XKOC 5GAMj 1LNXA 2KQWA 4M7AG 3OYDA 2A7YA 4FSXA 3CC4A 4XU3A 3CXCA 3V8KA 4OMFB 3UDCA 5GAN5 1N9SA 4M75B 3OYGA 1XTDA 4MMKA 5CIUA 3V8LA 1Q7YU 2FB7A 4TVRA 4ZN3A 5LJ5e 1D3BA 5GAMe 4ATOA 2BIVA 1Q82U 5LJ5d 1K73C 3QJ6A 4V2SA 1XOVA 4UC4A 1VQ5A 1P92A 4XQ3A 5FU7B 5J26A 3WVDB 1JBMA 2EYQA 4M78G 4M78B 4N0AA 5M9OA 3X24B 2RJEA 1YIJA 4OGEA 2KDSA 1XNIA 3OBYA 1B34A 4N4GA 1RI0A 4C5HA 4LDUA 1Y71A 3TEEA 1Q82C 4BY6C 5GANh 4L5GA 3FIFA 4C8QF 2LRQA 4FU6A 1YI2T 4M7AF 3AHUA 3OYNA 4BY6B 1FXXA 2XI9A 1ZHIA 4PJOA 4PJOC 1VQPA 4JRKA 4MMLA 3PIPA 3SB2A 4PLIA 5KCOA 2KMTA 1QVFS 4PJOB 4J6YA 4C5IA 3VKIA 2JTMA 4BD3A 4EDUA 2E12A 3LGFA 4FT2A 5EG2A 4BE2A 1KQSA 3CD6T 2RHYA 2RM4A 3JCMh 5LJ3j 4EMKB 4PJOE 4A4GA 3OSSC 3DB3A 2YLCA 3V7CA 3HRTA 2CKKA 4C0FA 4E7LA 1BI0A 2LT4A 2EWNA 3WXMB 5GANe 5D6YA 4JUVA 4M75G 3I56A 4C8QA 2EQMA 5LL6S 1NJIC 2K5IA 5CKHA 3CC7T 4M7DF 1N27A 3FDRA 4JS5A 3LX7A 4J6XA 5GAN4 3T9NA 3A8HB 2BUDA 3FRNA 4C8QB 4XTWA 4C8QG 3OYCA 3A8MB 4KUDK 3QO3A 2L3RA 2RI5A 4E7KA 2LCLA 3CCJT 3JCMg 2WACA 4OB2B 3CCUA 3PMIA 5CAIA 3FJPA 4ELYC 2Y90A 2L5QA 2V8JA 3JCMV 3CMEA 2QTXA 3ASKA 4M7DD 3QKJA 2WSCE 2ZZDA 3HL8A 4OF1A 5IN1A 3S3OA 2X4XA 2RHZA 4M77D 5HKCA 1VQ4T 1M5Q1 4HA8A 1MHNA 3OYYA 4M78E 3RKXA 1NPRA 3M55A 5GMKi 1M90C 3OYJA 1H641 1I81A 1O75A 2LX9A 3L42A 4EPCA 3LWIA 3PMTA 5DM7R 4XTYA 3DB4A 3RUXA 5CKDA 3OYHA 1WPYA 2O01E 1M4ZA 3NTKA 4M75F 2YLBA 3QHSA 3JB9D 1K9MU 3OA6A 2P0QA 3OMCA 4CI0C 3G4SA 2XHCA 3MEVA 3VUZA 3CPWA 4X9CA 4A4EA 1X6OA 2DXUA 3OYKA 1Q86U 3C4SA 3OBWA 2FYKA 1S72A 3GP8A 1GXIE 2JZ2A 4M78A 5GAMh 1XQHA 2MWOA 4XTZA 3VUBA 4ZGJB 5GAOl 5IT9E 1BYMA 2HD0A 2O4XA 3MP6A 2LC4A 4J5YA 3CXCS 1G3YA 3PFSA 2K3YA 4BUGA 5CR2A 3L2QA 2JUFA 3HRUA 3LH0A 4OB3B 5LJ3d 3SWNB 3CC2A 2VXEA 4ZTFA 3LLRA 3A8LB 1NZ9A 1YIJT 3GNGA 4A54A 4C0GA 1WJRA 1VQ8A 1VQ9T 1AHJB 1QVFA 1W4SA 2VV5A 3JCMe 3G4ST 4ZTJA 2V8KA 3A8OB 3OQ5A 4C92F 3RESA 4J7FA 5GAMg 3C95A 4C8QE 3J81E 3CCVT 2X4YA 3P8BB 3CEYA 4XTXA 3OW2S 4WF2A 1M1KU 1KC8C 4IUUA 2X4JA 2K4YA 5GAOp 4RCCA 5LJ5j 2E64A 2M0OA 2VC8A 2GFUA 3J80E 1WNLA 4C92D 2WSFE 1NPPA 2GFAA 3QIIA 4EMHA 5GAOm 1IREB 3E9GA 3CPFA 3G71A 1YJWT 2RK2A 2LT1A 2JN0A 2K3XA 2MF2A 3WVEB 2VYTA 5GAOq 3RIRA 4J6WA 1VQNT 1YITT 2VXFA 1HK9A 1V29B 1BKBA 3MHXA 5GAN3 3OS0A 3QYGB 2QEXA 3SFMA 4QQ6A 4ZGDB 5LJ5h 2K2VA 4MDWA 1G3TA 3ER0A 4QVZA 4II1A 1YJWA 3G71T 2DTOA 2MAMA 3CCRA 3JCMP 4VUBA 4QVCA 4M7AA 4M7AC 4LDXA 4XU2A 5LJ3e 2CGHA 4PJOF 4ZN1A 1M1KC 3PTAA 1G5VA 2ZPFB 2MI6A 4CRIA 1N6AA 2XDDA 3NTIA 1KG1A 4E7HA 3L2UA 1Y96A 2R5AA 3MO8A 4DOWA 5GANg 1YJNA 3KBGA 2CS7A 3OS2A 3CCRT 5KH6A 2PVOB 4L59A 4IKFA 4LDWA 4A4KA 3GNFB 2L89A 4LD6A 4C92B 4C0ZA 2QEXT 1JJ2A 4O5VA 4EMKC 1Q81C 2RI3A 4LD9K 2CYZB 1YITA 1VQNA 2B8AA 2DD4A 4BE0A 4M7DG 4N4HA 3VYHB 2RJFA 2WSEE 1QVGS 4HCBA 2BKDN 2EFIA 5GMKh 3Q1JA 1BI2A 1FWZA 2ZCFB 2IVWA 3QZ5B 5IAYA 4IUTA 2E6NA 4M7DA 2HAXA 1S72T 5D6WA 5KE3A 2K5LA 3JSCA 3MEAA 3HFNA 3CCQA 4C8QC 3JB9F 2LTOA 4IUPA 2RJDA 4XK8E 1KC8U 4LDVA 5KCHA 4JDSA 4BDYA 5CCAA 1M90U 2E1HA 3CCSA 4C92C 4RG2A 4J83A 5J3BA 4R56A 2K5FA 5FLXE 3HSBA 4JRIA 3G7ZA 5I2MA 5L8RE 3RMSA 2QI2A 3LW5E 4C5EA 1O9SA 5GAN2 1VQ4A 3OYIA 5I2SA 1R8OB 4M75A 3JB9I 3I55T 3HFOA 4FL6A 1K8AC 2XD0A 4JLIA 3CC2T 4FT4A 1D3BB 3KUFA 3CCUT 1VIEA 3CCLA 4M77E 1TH7A 2DXTA 4QVDA 4ZGEB 1BI1A 2MWPA 4C92G 2RK1A 4FIBA 3N5BB 3OSVA 3S6WA 5A0DA 3GOXA 5GANf 4ME7A 3FB9A 4QQDA 4M77B 3JB9H 3TCJA 2D0QB 4C92E 2E65A 1M1GA 4M77C 3CCET 4M7DB 3M57A 1HXDA 1G3SA 2PU9B 1NE8A 2JOYA 4F7UA 2P0PA 2EJFA 1QP2A 4EMKA 2KY9A 3PNWC 2X35A 2EIFA 3BW1A 4OB1B 3SWNC 4F7UG 3LWHA 4F7UB 4C8QD 3OYFA 4KT0E 4BI4A 1WQWA 2DXBA 2EJ9A 2PUOB 2MMPA 3X25B 1X75C 2PQWA 1SSFA 4IUVA 2CZ0B 1RL2A 4PL6A 2AHJB 2X4WA 5LJ3f 2DD5A 4N4IA 3H6ZA 3CMET 4X9DA 4MZMA 1B34B 2FL7A 2CZ7B 2D9TA 4BI3A 5A2QE 2V8IA 4HCZA 3QZ9B 1BIAA 2RJCA 3FC3A 2DPPB 3CCLT 3JCMJ 4Y91A 3M58A 2E6ZA 3CC7A 3HHTB 3I55A 2ZPEB 5FU6C 4PJOD 3I56T 4NS5A 2YRVA 1VQ5T 4M78F 4XU0A 2QQ9A 1WJQA 4BDZA 2ZGWA 3OS5A 2DK3A 2HQXA 2EKOA 3O8VA 4OGCA 3META 5C0MA 2DJZA 1VQ7A 4M77G 3CCST 4N0AC 3CD6A 3X20B 3JCMX 1UB4A 2G3RA 4NL2A 4BE1A 2P0KA 4M78D 2DXCA 1JB0E 3QG1A 4MDXA 1FX7A 4QW2A 3V7RA 2QXFA 5LJ5g 2FHDA 3CPWS 4OB0B 3M4YA 2QQRA 1VQPT 5GANd 4DA4A 1KHIA 1UGQB 3OYMA 4M75C 2NLUA 1MGQA 2EAYA 3BDLA 4Q5WA 3JCMc 3X26B 3MP1A 5KE2A 5GMKj 4BACA 1YI2A 3VU3C 4RMOA 2HNIA 1VQ6T 1VIFA 4Y28E 4F7UE 2LQKA 3DLLA 2L8DA 2KVQG 4M75D 4C92A 5HK3A 3PT9A 2OAUA 1ZQ1A 4BB7A 1NJIU 4DOVA 2VGMA 3A8GB 4J8OA 1WQ7A 2M9UA 2XU8A 2YHTA 2EQUA 4JRPA 1W2BA 3GF5A 5LJ5f 3QDRB 5GMKe 3OS1A 4A4FA 2KSSA 2RD1A 3QSUA 4Z02A 1N8RC 3P8DA 4P5NA 2XIDA 1H3ZA 1YJNT 2RHIA 4RCBA 3UT1A 4A4HA 5A0GA 4PNOA 5GAMf 5FRNA 2DZCA 4IURA 4M75E 1M8VA 3OB9A 3FLGA 3CC4T 2CZ6B 3BFMA 3JRZA 1ZBXA 4MZPA 4HT9A 2OTJT 2LDMA 5I21A 3BY7A 2QA4A 3OMGA 1YJ9T 3L1AA 1VQOA 5GAN8 2C06A 3CBMA 5HK0A 4MZTA 2PUKB 3NTHA 4GLKA 1OI1A 1KD1C 4O6JA 1VQKA 2EQKA 4E47A 3VJPA 3OW2A 3V8JA 1QW1A 2RA2A 3OYBA 2ZPIB 3JB9J 1I5LA 3JB9G 1YHQT 2R58A 2PVDB 4RG8A 2GF7A 1VQ6A 3RERA 2XK0A 3EFSA 4PLLA 1PSEA 5A0LA 5GAN7 2R57A 2E10A 3DLMA 3QXEB 5J39A 2QDYB 1UGPB 1Y96B 1W2BS 1K9MC 3RKWA 1IZ6A 1JJ2S 5CQXA 4IUQA 3CCVA 3OYAA 3JAME 1I8FA 2VUBA 5CQYA 3JCMW 1VQLT 4KUIA 2HBPA 4F7UF 3HPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  3SWN C;  3BW1 A;  4F7U G;  4M7D E;  4F7U B;  4C8Q D;  2DTH A;  3L2Z A;  1WQW A;  3JCM e;  2EJ9 A;  3JCM Q;  4C92 F;  3RES A;  3JCM d;  2K57 A;  3BDU A;  4C8Q E;  5GAM g;  4M7A E;  5GAO n;  1U1S A;  4XTX A;  4DQ2 A;  5LJ3 f;  4WF2 A;  5GAO p;  4RCC A;  4X9D A;  5LJ5 j;  1B34 B;  2E41 A;  2E64 A;  5GMK l;  2VC8 A;  4M7A G;  4M7A B;  5GAM j;  1LNX A;  4M77 F;  1WNL A;  1BIA A;  4XU3 A;  4C92 D;  5GMK m;  4OP0 A;  3V8K A;  3JCM J;  4M7D C;  4EMH A;  5GAN 5;  1N9S A;  5GAO m;  4M75 B;  4Y91 A;  4MMK A;  2JN0 A;  3PGG A;  3V8L A;  3V7S A;  3M4G A;  4PJO D;  2FB7 A;  5GAO q;  5LJ3 g;  3RIR A;  4J6W A;  4M78 F;  4XU0 A;  5LJ5 e;  1D3B A;  2VXF A;  1HK9 A;  2ZGW A;  5GAM e;  4NL3 A;  5LJ5 d;  5GAN 3;  1JRI A;  4V2S A;  5LJ5 h;  2DJZ A;  4XQ3 A;  4M77 G;  4N0A C;  1JBM A;  4M78 G;  4N0A A;  4M78 B;  3JCM X;  4NL2 A;  3JCM f;  1KQ1 A;  2DTO A;  1B34 A;  1LJO A;  4M78 D;  3JCM P;  4QVC A;  4M7A A;  4M7A C;  4XTU A;  3V7R A;  1U1T A;  5GAN h;  1I4K 1;  4XU2 A;  2CGH A;  3FIF A;  4PJO F;  4C8Q F;  1BIB A;  5LJ3 e;  5LJ5 g;  3AHU A;  4M7A F;  3SWN A;  5GAN d;  4PJO A;  4PJO C;  4M75 C;  3JCM c;  1MGQ A;  2DVE A;  2EAY A;  4JRK A;  4MML A;  5LJ3 h;  3SB2 A;  4A53 A;  5GMK j;  3VU3 C;  4PJO B;  1Y96 A;  2EJG A;  4J6Y A;  2HNI A;  4PJO G;  5GAN g;  1N9R A;  4F7U E;  4M75 D;  4C92 A;  2RM4 A;  3JCM h;  5LJ3 j;  4EMK B;  3INZ A;  4PJO E;  3GIB A;  1WQ7 A;  4C92 B;  2YHT A;  5GAN 6;  2YLC A;  3V7C A;  4EMK C;  5LJ5 f;  4M78 C;  4XU1 A;  4M7A D;  5GMK e;  2EWN A;  5GAN e;  2RD1 A;  3QSU A;  4JUV A;  4M75 G;  4C8Q A;  2RB6 A;  4M7D G;  4RCB A;  4PNO A;  5GMK h;  4M7D F;  5GAM f;  2DZC A;  4J6X A;  5GAN 4;  4M75 E;  4C8Q G;  4M7D A;  1YCY A;  4C8Q B;  4XTW A;  1M8V A;  5DY9 A;  1X01 A;  3QO3 A;  3BFM A;  3QUI A;  3HFN A;  4HT9 A;  3JCM g;  4C8Q C;  5I21 A;  5GAM d;  3JB9 F;  3BY7 A;  3FJP A;  2DEQ A;  2I2L A;  2Y90 A;  3JCM V;  5CAI A;  3JCM b;  3L1A A;  2QTX A;  4M7D D;  5GAN 8;  2E1H A;  4C92 C;  3EFR A;  4M77 D;  1M5Q 1;  4HA8 A;  4M78 E;  3RKX A;  5GMK i;  4EMG A;  3HSB A;  4JRI A;  3JB9 J;  1H64 1;  1I81 A;  5GAN 2;  5GAO r;  4M77 A;  4XTY A;  4M75 A;  3V8J A;  2RA2 A;  3RUX A;  3JB9 I;  1WPY A;  3HFO A;  3RKY A;  4M75 F;  4JLI A;  2YLB A;  3QHS A;  3JB9 D;  1D3B B;  3JB9 G;  1I5L A;  4HT8 A;  2DTI A;  2DZ9 A;  1LOJ A;  3RER A;  4M77 E;  1TH7 A;  2DXT A;  4X9C A;  4QVD A;  2DXU A;  3EFS A;  2FYK A;  2DKG A;  5GAN 7;  2E10 A;  4C92 G;  4M78 A;  5GAM h;  4XTZ A;  5GAO l;  4NOY A;  5GAN f;  3FB9 A;  4M77 B;  1Y96 B;  5GAN j;  4J5Y A;  3RKW A;  3JB9 H;  1KQ2 A;  4C92 E;  2E65 A;  4M77 C;  4M7D B;  1HXD A;  1I8F A;  5LJ3 d;  4F7U A;  3SWN B;  3JCM W;  2VXE A;  2EJF A;  4XTV A;  4EMK A;  4F7U F; 
#chains in the Genus database with same CATH topology
 4KUL A;  1WYX A;  2HQE A;  3G71 Q;  1VUB A;  3M53 A;  1M3A A;  1PNJ A;  5ECA A;  2QG9 B;  2JVV A;  3UWN A;  1D0X A;  2KXC A;  2CP0 A;  3UPU A;  4KBM B;  4JJB A;  2CH4 A;  4E6R A;  5GMK m;  3O5Z A;  3QYH B;  4ELZ C;  1WHL A;  3PGG A;  2VKN A;  3CCM T;  1WHJ A;  4NL3 A;  2ZPG B;  2F5T X;  2ZPH B;  2FRW A;  1M1K R;  4J7I A;  3JCM f;  3G4S Q;  2DIQ A;  3CCJ A;  5DLQ E;  4A53 A;  5KYY B;  1CKB A;  4RTW A;  4C0D C;  4PJN A;  2MPX C;  1EIF A;  4M78 C;  2GQV A;  2OJ2 A;  1Q7Y C;  2JM9 A;  1PKT A;  2RB6 A;  2R5M A;  2EKH A;  1K73 R;  1GL5 A;  2AKL A;  3TQ7 P;  3C0C A;  1YCY A;  3CCQ T;  5DY9 A;  2DIG A;  3QUI A;  5GAM d;  1QCO A;  2DEQ A;  3VYG A;  5AYF A;  4AFQ C;  3MP8 A;  4LDY A;  2IIM A;  4CC7 A;  3QWY A;  3M5A A;  1WZO A;  4EMG A;  1D0Y A;  2RHX A;  3SEM A;  2L3Q A;  1T0J A;  1K73 U;  1VQO T;  2XIC A;  2P4T A;  5GJW B;  2HCK A;  3GLX A;  3A98 A;  2IG0 A;  3EAE A;  5C6S A;  4OMM A;  1Q81 R;  4HKE A;  3EHR A;  3I56 Q;  1HSQ A;  2KK4 A;  1S72 Q;  3L2W A;  3TVT A;  1SPK A;  4HVU A;  2H3J A;  4R55 A;  3GIB A;  1Q81 U;  3UA7 A;  4HCC A;  1TWB A;  3S3N A;  1VQK T;  1VQM A;  3LYI A;  1X2K A;  2VGN A;  3CMA T;  3H0I A;  3ZFJ A;  2BE7 D;  1MUZ A;  4LXC A;  3QDF A;  4RKU E;  1WJS A;  2GTJ A;  2KGT A;  4XU3 A;  3TSZ A;  3V8L A;  2FB7 A;  5GAM e;  2BIV A;  4V2S A;  3UF4 A;  5FU7 B;  4M78 G;  1AWX A;  4N0A A;  4M78 B;  4PJL A;  2LX7 A;  1VYU A;  1XNI A;  3CC4 Q;  1RI0 A;  2L2P A;  4LDU A;  1Y71 A;  4RTU A;  4FU6 A;  1ZHI A;  4PJO C;  3SB2 A;  4PLI A;  1QVF S;  4PJO B;  2ZAE A;  4BD3 A;  4EDU A;  2E12 A;  2NUT A;  1NEB A;  2LCS A;  2RM4 A;  2DVJ A;  3JCM h;  4A4G A;  2DIL A;  4E7L A;  1BI0 A;  4JJC A;  3WXM B;  5D6Y A;  4KH1 B;  1QLY A;  1GBQ A;  1NJI C;  5CKH A;  4DBF A;  1U5S A;  4M7D F;  3CQT A;  4C8Q G;  2JM8 A;  1E6G A;  1OX9 A;  5KYY A;  4E7K A;  3CCJ T;  2XMF A;  2EW3 A;  1Q7Y R;  2L5Q A;  2V8J A;  4ZNX A;  2QTX A;  3ASK A;  4KH0 B;  4M7D D;  3QKJ A;  5IN1 A;  3S3O A;  2Z0W A;  5IHK A;  1YP5 A;  1NPR A;  3VS3 A;  4RTV A;  2DM1 A;  4XTY A;  2EGA A;  3DB4 A;  4PFZ A;  1QWF A;  1WPY A;  2O01 E;  3OA6 A;  1WIE A;  1YJN Q;  2JZ2 A;  5GAO l;  3MP6 A;  4HVW A;  4J5Y A;  2C0T A;  1RAE B;  1RAH B;  1BK2 A;  2VB6 A;  3LH0 A;  3SWN B;  4OB3 B;  2JMC A;  1MMG A;  1IO6 A;  1WJR A;  1VQ9 T;  3JCM e;  3OQ5 A;  1SKU B;  1VYV A;  3EGU A;  2LP5 A;  1ZSZ B;  1AVZ C;  1EZZ B;  4J7F A;  5GAM g;  4C8Q E;  3J81 E;  3P8B B;  1M1K U;  1RAG B;  1WNL A;  4C92 D;  2J05 A;  5GAO m;  1JXM A;  1JU5 C;  2MF2 A;  3WVE B;  1G2B A;  1YWO A;  2VYT A;  5GAO q;  3RIR A;  1YIT T;  1UUE A;  3OS0 A;  1VQL Q;  1ZA1 B;  1M30 A;  1FYN A;  1J3T A;  4FYW B;  4MDW A;  1G3T A;  4II1 A;  1YJW A;  2DTO A;  2MAM A;  4XU2 A;  1MV3 A;  2CGH A;  5LJ3 e;  1M1K C;  2VVK A;  2ZPF B;  4CRI A;  1OV3 A;  3L2U A;  4M4Z A;  5GAN g;  2A36 A;  3OS2 A;  5KH6 A;  4CC2 A;  4IKF A;  1W2B P;  2DRK A;  3QWX X;  2OAW A;  4C92 B;  3HTR A;  1JJ2 A;  1C1A A;  4N4H A;  3VYH B;  2WSE E;  1QVG S;  4HCB A;  2BKD N;  3QZ5 B;  5IAY A;  2YT6 A;  1S72 T;  5KE3 A;  3JSC A;  3MEA A;  2FRY A;  3HFN A;  3CCQ A;  2MOX A;  4LNP A;  2P84 A;  4JDS A;  4BDY A;  4B6M A;  4RUG A;  5CCA A;  1M90 U;  2E1H A;  3PVL A;  4J83 A;  2K5F A;  1JEG A;  1HYO A;  5I2M A;  5KYU B;  1TUD A;  5GAN 2;  1CKA A;  1VQ4 A;  1R8O B;  4M75 A;  3H41 A;  3HFO A;  1K8A C;  4JLI A;  4DBQ A;  4D8D A;  4M77 E;  4QVD A;  1BI1 A;  3SHW A;  4E2F B;  1LCK A;  1AZE A;  4QQD A;  3FB9 A;  3M0U A;  3TCJ A;  1I5O B;  1RAA B;  4M7D B;  1H92 A;  1HXD A;  1NE8 A;  2EJF A;  1WXT A;  2X35 A;  3SWN C;  5IXF A;  4J9B A;  4F7U G;  9ATC B;  4KT0 E;  3OYF A;  1AWO A;  1WQW A;  2DXB A;  2PUO B;  2AK5 A;  1UFF A;  2CZ0 B;  4F04 B;  2DD5 A;  3H6Z A;  1OOT A;  4X9D A;  2D8H A;  4JZ3 A;  4BI3 A;  4CC3 A;  8AT1 B;  1SG5 A;  1Q82 R;  3QZ9 B;  2K3B A;  1PWT A;  2DPP B;  3M58 A;  2DBK A;  3CC7 A;  3I55 A;  4NS5 A;  2YRV A;  1VQ5 T;  2F1L A;  3OS5 A;  2DK3 A;  1ZSZ C;  5C0M A;  2DJZ A;  4M77 G;  3CCS T;  4N0A C;  3CD6 A;  4PFP A;  3CCJ Q;  4MDX A;  3V7R A;  2QXF A;  2JJ9 A;  1K0S A;  4OB0 B;  1ACM B;  3JCM c;  1LPL A;  2EAY A;  3BDL A;  3I35 A;  4DEY A;  4Y28 E;  3DLL A;  1AZG B;  2L8D A;  2KVQ G;  5FW9 A;  4C92 A;  1TOV A;  3EG3 A;  4DOV A;  1WQ7 A;  2I0N A;  3QDR B;  2KSS A;  1YJN T;  4PNO A;  5FRN A;  2ROL A;  3BFM A;  4MZP A;  2OTJ T;  1ZBX A;  1YI2 Q;  1PD0 A;  2GTO A;  3NPF A;  4PK4 A;  3REA B;  2HZY A;  4MZT A;  2PUK B;  4GLK A;  3CCV Q;  2OI3 A;  2EQK A;  2EYY A;  4E47 A;  3VJP A;  2KRO A;  2J6K A;  2ZPI B;  1I5L A;  4AG2 C;  4PLL A;  3QXE B;  5J39 A;  1UGP B;  1Y96 B;  1W2B S;  3OYA A;  5CQY A;  2HDA A;  5GMK h;  4WCI A;  2A3L A;  1YBY A;  3M56 A;  1VQ8 T;  2FPD A;  5FWC A;  1VQ4 Q;  2CZ1 B;  1TSF A;  5CKF A;  3OYL A;  2E41 A;  3H0F A;  4BI8 B;  3E1S A;  2D8J A;  4M7D C;  1PRL C;  1GFD A;  1ZLM A;  3VS6 A;  2OTL T;  2QEX Q;  2QQA A;  3V7S A;  3F70 A;  5LJ3 g;  1WA7 A;  1ZUY A;  3TU4 K;  1G3W A;  2AT1 B;  2ED1 A;  2EYX A;  2Y4X A;  1AT1 B;  3CCM A;  5IH2 A;  3VS1 A;  1R0C B;  4X34 A;  3C12 A;  5FU7 C;  4E7Z A;  3CCE A;  2M0Y A;  4XTU A;  1ABQ A;  1JO8 A;  3M9Q A;  3GPL A;  1BBZ A;  2PVG B;  1KFZ A;  2DVE A;  2COW A;  2LNV A;  3NHN A;  1WHH A;  2GBQ A;  4IIO A;  3NMZ C;  1UGS B;  2XDP A;  1BB9 A;  5GAN 6;  3X28 B;  1OYX A;  4OVA A;  2QYZ A;  4XU1 A;  2ESW A;  3PIO A;  5FRM A;  2DLP A;  3KFV A;  4E7I A;  2RI2 A;  4K11 A;  1SHF A;  1X01 A;  1RUW A;  5EC7 A;  4GY5 A;  3P8H A;  3EH2 A;  2KEA A;  3JCM b;  5FRO A;  4FYY B;  3THK A;  1KD1 U;  1YN8 A;  2CRE A;  3HP9 A;  2E70 A;  2JS2 A;  4RTY A;  3C94 A;  4M77 A;  3RMQ A;  4CC4 B;  3RKY A;  1YJ9 A;  2DZ9 A;  2DYB A;  5D6X A;  2DKG A;  1QVP A;  4NOY A;  2QQS A;  2RHU A;  3E9F A;  2E5Q A;  5CO7 A;  3MEW A;  2BE9 B;  1IGU A;  2GNC A;  5DLO A;  1GBR A;  3VS5 A;  2QQB A;  1RAC B;  2LVM A;  1K8A U;  1I1J A;  2RPN A;  2LQW A;  1JJ2 P;  3I55 Q;  1UDL A;  2J6F A;  2M1H A;  5GAM j;  3CC2 Q;  2KQW A;  3OYD A;  1UEC A;  3CCU Q;  2DL5 A;  3EGD B;  1W70 A;  3OYG A;  1Q7Y U;  4FYX B;  1MNE A;  5LJ5 d;  3QJ6 A;  1YNZ A;  4UC4 A;  4EIK A;  1JBM A;  3ULR B;  1T3S A;  1YIJ A;  3X24 B;  5IXB A;  1BCM A;  2KDS A;  4BY6 C;  2K9G A;  1YI2 T;  2LRQ A;  3AHU A;  1D1A A;  4BY6 B;  1FXX A;  3CME Q;  1VQP A;  3PIP A;  5KCO A;  2KMT A;  4J6Y A;  3RR6 A;  4LE9 A;  2JTM A;  4DBR A;  2AIR B;  5EG2 A;  4BE2 A;  2H3E B;  2RHY A;  5LJ3 j;  1MV0 B;  4AFU C;  4AFS C;  1V76 A;  3V7C A;  2CKK A;  4C0F A;  5GAN e;  4JUV A;  2NUZ A;  4J6X A;  4XTW A;  1X43 A;  3A8M B;  4KUD K;  1M3B A;  3JCM g;  2KE9 A;  3CCU A;  3FJP A;  4ELY C;  3M0S A;  5HCK A;  1KC8 R;  3EG0 A;  2RHZ A;  4M77 D;  1M5Q 1;  4HA8 A;  1M90 C;  5GMK i;  4PJM A;  1EFN A;  1VOM A;  3L42 A;  3LWI A;  5DM7 R;  5CKD A;  3NTK A;  1M4Z A;  4M75 F;  1K9M U;  2P0Q A;  2PNI A;  3CPW A;  3MEV A;  3TSW A;  4A4E A;  1X6O A;  2DXU A;  3OYK A;  3C4S A;  2FYK A;  2MK5 A;  1S72 A;  1R0B G;  2O4X A;  2X3X D;  2LC4 A;  3CXC S;  3CPW P;  5CR2 A;  2K3Y A;  3LH5 A;  4BUG A;  1U06 A;  2JUF A;  3HRU A;  5LJ3 d;  4ZTF A;  2G6F X;  1YIJ T;  3GNG A;  4C0G A;  1QVF A;  1AHJ B;  1ZSZ A;  2V8K A;  3A8O B;  4J9C A;  2YUO A;  2DMO A;  2KYM A;  4XTX A;  1KC8 C;  1OUL A;  4IUU A;  5GAO p;  5LJ5 j;  2VC8 A;  1OU8 A;  2GFA A;  3MPU B;  3QII A;  1IRE B;  3G71 A;  1YJW T;  2LT1 A;  1VYT A;  2YUP A;  2RN8 A;  4J6W A;  2RNA A;  5GAN 3;  1TUC A;  4QQ6 A;  2QAS A;  5LJ5 h;  1X6B A;  2NUP B;  4J9F A;  1IB8 A;  1KK7 A;  3CCR A;  4VUB A;  4M7A C;  4LDX A;  1G5V A;  1GRI A;  4PJO F;  2LNH B;  1N6A A;  2YSQ A;  3NTI A;  4HCK A;  2L3P A;  2O88 A;  1Y96 A;  1KIK A;  3H9N A;  3KBG A;  2EYW A;  3CCR T;  2PVO B;  4L59 A;  1G83 A;  4LDW A;  1K76 A;  4A4K A;  4J9G A;  4O5V A;  3EFO B;  3CCM Q;  1YIT A;  1PCX A;  2EFI A;  1I07 A;  2IVW A;  4M7D A;  2E6N A;  1R77 A;  1WX6 A;  1WHG A;  1KC8 U;  4LDV A;  2LQN A;  3CCS A;  1F1B B;  2KT8 A;  4JRI A;  1IXD A;  2QI2 A;  1O9S A;  3JB9 I;  3I55 T;  4FW2 A;  4FT4 A;  3KUF A;  3M0R A;  1OPK A;  4ZGE B;  3VS0 A;  2HEQ A;  4FIB A;  4C92 G;  3OSV A;  3GOX A;  4ME7 A;  2E65 A;  3M57 A;  1E6H A;  1KSW A;  2EIF A;  1ZA2 B;  4C8Q D;  2KYB A;  2K2M A;  2FZC B;  3EGX B;  1X75 C;  4HVV A;  1SSF A;  2X4W A;  2ED0 A;  4MZM A;  2RJC A;  3CCL T;  2X3W D;  4Y91 A;  2E6Z A;  3HHT B;  1XJW B;  2CP7 A;  2ZPE B;  5FU6 C;  4M78 F;  2CDT A;  4BDZ A;  1ZUU A;  3H0H A;  3O8V A;  4OGC A;  1VQ7 A;  6AT1 B;  3I9Q A;  2QAZ A;  4BE1 A;  1VQK Q;  1ZBJ A;  1W6X A;  4QW2 A;  1QKX A;  1M3C A;  2EYZ A;  5GAN d;  1UHC A;  2NLU A;  3X26 B;  4BAC A;  4RMO A;  1VQ6 T;  4F7U E;  2LQK A;  4BB7 A;  1NJI U;  2FPE A;  4J8O A;  1N8R R;  2YHT A;  1W2B A;  3GF5 A;  3FJ5 A;  5GMK e;  1Y0M A;  3QSU A;  1ARK A;  3I5S A;  4QKU A;  1H3Z A;  1IHV A;  4A4H A;  5A0G A;  2KBT A;  3OB9 A;  5I21 A;  1YIJ Q;  3BY7 A;  2QA4 A;  4GBQ A;  3L1A A;  2C06 A;  3CBM A;  2EGE A;  2H8H A;  1B7T A;  1OI1 A;  1VQK A;  3OYB A;  3JB9 G;  2R58 A;  1NYF A;  2PVD B;  3BE3 A;  2NUT B;  3EFS A;  3MKD A;  1PSE A;  5GAN 7;  2QDY B;  3G1J A;  1JJ2 S;  1IZ6 A;  4IUQ A;  2A37 A;  1I8F A;  1Z9Z A;  3JAM E;  2HBP A;  4F7U F;  2DER A;  1VQ9 A;  1NEG A;  3S3M A;  1QCN A;  3L2Z A;  5CVI A;  1OZ3 A;  4F14 A;  2K57 A;  2OX7 A;  1IHW A;  1U1S A;  4DQ2 A;  3NFC A;  4M7A B;  2F69 A;  3I5R A;  3EG1 A;  4Y92 A;  3CCR Q;  4OP0 A;  5KYW B;  5FU6 B;  1JRI A;  2D1X A;  4D6W A;  2DET A;  4JLG A;  1KHC A;  2NYS A;  4FYV B;  5IHN A;  1OQK A;  2FG0 A;  1LJO A;  2D6F A;  1U1T A;  5KYX B;  3URG A;  1EX4 A;  3SWN A;  3OY9 A;  3ZBD A;  5LJ3 h;  1PSF A;  2EJG A;  3R6O A;  4J9H A;  4PJO G;  3M0P A;  1PM3 A;  3EH1 A;  5HY6 A;  2ENM A;  3HRS A;  1TXQ A;  4JRQ A;  2O2O A;  4M7A D;  2JT4 A;  3U23 A;  1VQN Q;  1D09 B;  1K9A A;  1YIT Q;  3EGX A;  4B9X A;  1SRM A;  2YRC A;  5CKE A;  1QVF P;  1ZUK A;  1KJW A;  1Y07 A;  3EG2 A;  3ME9 A;  5CK9 A;  1NYG A;  2I2L A;  3DKM A;  3MEU A;  2M16 A;  1K4U S;  4J9I A;  4FM4 B;  2FZG B;  1Y7X A;  3EFR A;  1PRM C;  4E7J A;  3GBQ A;  1KQS S;  3QBY A;  5GAO r;  4R0K A;  2RH2 A;  2XDB A;  2FPF A;  1WLP B;  1DJ7 B;  3M59 A;  4HT8 A;  2BZY A;  2QA4 T;  2V1Q A;  8ATC B;  1LOJ A;  2ABL A;  2OTJ A;  1IRX A;  3FEO A;  2E3I A;  1U3O A;  1UGV A;  2DBM A;  1YHQ A;  5KYX A;  1PHT A;  2A28 A;  2F5K A;  1U8R A;  1QP3 A;  4M7D E;  4YTL A;  4J9D A;  1Q86 R;  5CKB A;  2JNG A;  3ZEH A;  1GCP A;  3E19 A;  1MMN A;  2F2X A;  2KAF A;  2KNB B;  2AZS A;  2EVR A;  4KRT A;  5GMK l;  3OYE A;  2XKO C;  1VQ6 Q;  3CC4 A;  4FSX A;  2FZK B;  3V8K A;  4OMF B;  5GAN 5;  2X51 A;  4M75 B;  4MMK A;  2GGR A;  2CSI A;  5L23 A;  2JTE A;  2RQU A;  1D3B A;  3CCE Q;  4ATO A;  1K73 C;  1VQ5 A;  1P92 A;  4WTO B;  2RJE A;  4IIM A;  3OBY A;  1B34 A;  1JQQ A;  4C5H A;  3TEE A;  1Q82 C;  5GAN h;  4C8Q F;  4M7A F;  3OYN A;  2DL8 A;  4PJO A;  4JRK A;  1ZSG A;  3VKI A;  4E7S A;  3LGF A;  2DL7 A;  1KQS A;  3CD6 T;  2IPO B;  2B86 A;  1TTH B;  2O9S A;  2KI7 A;  2LJ0 A;  3DB3 A;  3OSS C;  3HRT A;  2W0Z A;  2LT4 A;  1D0Z A;  3I56 A;  2K5I A;  3CC7 T;  4JS5 A;  3LX7 A;  2ECZ A;  3T9N A;  2BUD A;  3FRN A;  4C8Q B;  3OYC A;  3QO3 A;  2RI5 A;  2LCL A;  2WAC A;  2RQW A;  4RTX A;  4OB2 B;  2V1R A;  2Y90 A;  3JCM V;  1M90 R;  3JV3 A;  3CME A;  1VQP Q;  1V1C A;  4OF1 A;  5HKC A;  4M78 E;  2M51 A;  3M0T A;  3RKX A;  3OYJ A;  1H64 1;  1O75 A;  1SRL A;  3RUX A;  3OYH A;  1X27 A;  3QHS A;  2RQT A;  3OMC A;  4CI0 C;  3UAT A;  3VUZ A;  3GP8 A;  3UA6 A;  2KT1 A;  1XQH A;  2MWO A;  4XTZ A;  5IT9 E;  3PFS A;  3VS4 A;  1T0H A;  4FCY A;  1RLP C;  4AMC A;  3A8L B;  1YCS B;  1WHM A;  4OMN A;  4A54 A;  1VQ8 A;  1W4S A;  2VV5 A;  3G4S T;  4C92 F;  3RES A;  2F2V A;  4OMP A;  3C95 A;  1HD3 A;  2DRM A;  3CCV T;  2X4Y A;  2K4Y A;  4RCC A;  2E64 A;  1G8X A;  2J06 A;  1YHQ Q;  3J80 E;  2WSF E;  4EMH A;  3E9G A;  3CPF A;  2RK2 A;  2ATC B;  2K3X A;  2K7A A;  1VQN T;  2VXF A;  1V29 B;  3MHX A;  3QYG B;  2QEX A;  4ZGD B;  2K2V A;  1VQ7 Q;  4QVZ A;  2YXY A;  4QVC A;  4M7A A;  1PD1 A;  1D1C A;  3PTA A;  2XDD A;  2YWW A;  2VAS A;  1KG1 A;  4E7H A;  3MO8 A;  4DOW A;  5KYU A;  1YJN A;  2CS7 A;  4LUE A;  2OTL Q;  2L89 A;  1VQO Q;  4C0Z A;  2QEX T;  1FMV A;  1Q81 C;  2RI3 A;  4LD9 K;  2MIO A;  3NGP A;  4D8K A;  2LZ6 B;  1VQN A;  2EQI A;  1M8M A;  4BE0 A;  4M7D G;  2F2W A;  2K6D A;  2QGF B;  3Q1J A;  1BI2 A;  1NBE B;  2ZCF B;  2QTV A;  2C0O A;  1RLQ C;  4F17 A;  2DL3 A;  4C8Q C;  1RAB B;  2RJD A;  4XK8 E;  5KCH A;  3CMA Q;  5J3B A;  2RQR A;  3OYI A;  5I2S A;  1WFW A;  2XD0 A;  1AWJ A;  1TH7 A;  1ZX6 A;  2MWP A;  2COY A;  3S6W A;  5GAN f;  1NJI R;  2KXD A;  3JB9 H;  2D0Q B;  4C92 E;  3CXC P;  1M1G A;  3CCE T;  1G3S A;  2CP2 A;  2PU9 B;  2C0I A;  1QP2 A;  2KY9 A;  3PNW C;  3BW1 A;  3LWH A;  1QMC A;  4BI4 A;  2EJ9 A;  2PQW A;  4IUV A;  3VRY A;  1RL2 A;  4PL6 A;  5LJ3 f;  2JXB A;  1FMK A;  1UG1 A;  1B34 B;  2FL7 A;  5A2Q E;  2P4R A;  2J6O A;  4X1V A;  3JCM J;  3AT1 B;  3EFO A;  1GFC A;  1E7O A;  1UJ0 A;  4XU0 A;  1WJQ A;  2CUB A;  2HQX A;  3CC7 Q;  1VQM Q;  3X20 B;  3JCM X;  2O9V A;  1UB4 A;  2G3R A;  2DXC A;  5KYW A;  1K0X A;  2KR3 A;  3M4Y A;  2QQR A;  4JPB W;  1VQP T;  3R6N A;  3OYM A;  3RDV A;  2JMA A;  5GMK j;  2LMJ A;  2DJQ A;  4M75 D;  2YRD A;  3PT9 A;  4Z89 A;  2OAU A;  2L0A A;  2VGM A;  2M9U A;  2XU8 A;  2EQU A;  4JRP A;  2DE0 X;  4A63 B;  5LJ5 f;  1BU1 A;  3M0Q A;  4Z02 A;  1N8R C;  3P8D A;  4P5N A;  1OX8 A;  2BZX A;  2RHI A;  4DBH A;  2QK0 A;  2HL5 C;  2DZC A;  4IUR A;  4M75 E;  1M8V A;  1S1N A;  4Z8A A;  2DFU A;  2CZ6 B;  4HT9 A;  4AG1 C;  3OMG A;  1YJ9 T;  1KD1 R;  2SRC A;  3OW2 P;  1VQO A;  5GAN 8;  1VQ9 Q;  1IGQ A;  3VS7 A;  4O6J A;  2J7I A;  1BCO A;  3V8J A;  2RA2 A;  1ABO A;  1YHQ T;  1PKS A;  2GF7 A;  3RER A;  2XK0 A;  2E10 A;  3DLM A;  1HJD A;  2V26 A;  5CQX A;  2DYI A;  3MJX A;  2VUB A;  1VQL T;  1CSK A;  4KUI A;  3G4S A;  1WGS A;  1VQ7 T;  2YUQ A;  2DTH A;  2EGC A;  2PTK A;  4L6V 5;  1M9S A;  3BDU A;  4M7A E;  1MMA A;  2CSQ A;  2JW4 A;  4M77 F;  4ORZ A;  4AFZ C;  4FW1 A;  2NUP A;  1QVG A;  3M4G A;  2HBW A;  3L2V A;  3A5Z B;  1AWW A;  4C0D B;  4JS4 A;  2A0F B;  1QQJ A;  3KXT A;  2PZ1 A;  3TRE A;  3SD4 A;  1UHF A;  2OTL A;  1KQ1 A;  3G6E A;  1UEB A;  2CP5 A;  5GJV B;  1I4K 1;  2XG8 D;  1BIB A;  4ANJ A;  1LVK A;  3M54 A;  2GCX A;  3VV0 A;  2CUD A;  4OMO A;  3CBP A;  1C0M A;  2DEU A;  1N9R A;  3LGL A;  3G6E T;  2LJ3 A;  3HKS A;  1NLP C;  3INZ A;  2M02 A;  2SEM A;  2DNU A;  1RAD B;  2EQJ A;  2ROT A;  2LQ8 A;  2JS0 A;  1UGR B;  2LCC A;  4B9W A;  2DO3 A;  1JXO A;  1TUG B;  4C5G A;  2CH4 W;  2RMO A;  2FVU A;  3J7A F;  4KGV B;  3MCA B;  2LJ1 A;  3QJY A;  4QQG A;  1M1F A;  4JJN K;  2Y4Y A;  1TG0 A;  1BI3 A;  1OZ2 A;  1VQL A;  1Q86 C;  2DTI A;  2JTF A;  4XAX B;  2MYS A;  3L2R A;  4PJJ A;  3QPH A;  1N8R U;  3CBO A;  5GAN j;  1VQ5 Q;  2ZPB B;  1KQ2 A;  2KRM A;  1QWE A;  2L3S A;  3SDZ A;  2DAQ A;  4XTV A;  3CMA A;  1VQM T;  3CCS Q;  4GLM A;  4PKC C;  2O4X B;  1QCF A;  3JCM Q;  1PC0 A;  3JCM d;  1YFN A;  3H8Z A;  1X2Q A;  5GAO n;  2RO0 A;  4LN2 A;  2KRN A;  4M7A G;  1LNX A;  2VWF A;  2A7Y A;  1OEB A;  3CXC A;  3UDC A;  1N9S A;  3EHQ A;  1XTD A;  5CIU A;  1RAF B;  4AT1 B;  4TVR A;  2CP6 A;  4ZN3 A;  5LJ5 e;  1Q82 U;  3PE0 A;  2RQV A;  1XOV A;  4XQ3 A;  5J26 A;  3WVD B;  2EYQ A;  5M9O A;  4OGE A;  2NWM A;  4N4G A;  2OTJ Q;  4L5G A;  3FIF A;  1YJ9 Q;  1NLO C;  2XI9 A;  4MML A;  4OMQ A;  1AD5 A;  4C5I A;  4FT2 A;  3CCL Q;  4PJO E;  4EMK B;  1NM7 A;  2BZ8 A;  2K79 A;  2YLC A;  2EWN A;  2COZ A;  4M75 G;  4C8Q A;  1K9M R;  2EQM A;  5LL6 S;  1QVG P;  1N27 A;  3FDR A;  5GAN 4;  3A8H B;  2A08 A;  2L3R A;  1Y57 A;  1A0N B;  3E2U A;  1VA7 A;  3PMI A;  5CAI A;  1SF9 A;  1VQ8 Q;  2WSC E;  2ZZD A;  2O31 A;  3HL8 A;  2RF0 A;  2X4X A;  4LUD A;  1VQ4 T;  5D7U A;  1MHN A;  3OYY A;  3M55 A;  3D7S B;  1I81 A;  2LX9 A;  4EPC A;  1MND A;  3PMT A;  3JB9 D;  1B07 A;  2YLB A;  2GQI A;  2XHC A;  4X9C A;  1Q86 U;  3OBW A;  1GXI E;  4M78 A;  5I11 A;  5GAM h;  3VUB A;  4ZGJ B;  1BYM A;  2HD0 A;  1TS9 A;  1G3Y A;  3L2Q A;  1C6V X;  2FO0 A;  3CC2 A;  4QT7 A;  4J9E A;  2VXE A;  3LLR A;  1NZ9 A;  1UJY A;  2DL4 A;  1M2O A;  7AT1 B;  4ZTJ A;  4JZ4 A;  3RNJ A;  3OW2 S;  5AT1 B;  3CEY A;  4WF2 A;  4ESR A;  2X4J A;  1M2V B;  4KGZ B;  2M0O A;  2GFU A;  3IQL A;  2QDL A;  1UTI A;  3G6E Q;  2HL3 A;  1NPP A;  1B3Q A;  2JN0 A;  1HK9 A;  1BKB A;  4Z88 A;  3SFM A;  2D0N A;  1UE9 A;  2HSE B;  1YWP A;  3ER0 A;  3G71 T;  3JCM P;  2CT4 A;  1SSH A;  2X9H A;  4ZN1 A;  1AOJ A;  1SHG A;  1SEM A;  2MI6 A;  3RBB B;  2R5A A;  1RI9 A;  2E4H A;  1WXB A;  2CT3 A;  2YDL A;  2YUN A;  1Q95 G;  3GNF B;  4LD6 A;  2EBP A;  4EMK C;  2CYZ B;  2B8A A;  2DD4 A;  2RJF A;  1PG5 B;  5I22 A;  1FWZ A;  4IUT A;  2HAX A;  1N5Z A;  5D6W A;  1K1Z A;  2K5L A;  2EPD A;  1GCQ C;  3JB9 F;  2LTO A;  4IUP A;  1M27 C;  4C92 C;  4RG2 A;  1TU0 B;  4R56 A;  5FLX E;  3HSB A;  3JB9 J;  3G7Z A;  2CP3 A;  5L8R E;  3RMS A;  3LW5 E;  4C5E A;  2KRS A;  4FL6 A;  3CC2 T;  1D3B B;  3CCU T;  1VIE A;  3CCL A;  2DXT A;  4PFO A;  1AEY A;  1X69 A;  1WXU A;  5A0D A;  2RK1 A;  3N5B B;  4F16 A;  4M77 B;  2FEI A;  3A1P A;  3CCQ Q;  4M77 C;  2QGG A;  1FMW A;  4F7U A;  2JOY A;  2P0P A;  3PVQ A;  4EMK A;  4OB1 B;  4F7U B;  2HSP A;  3X25 B;  2MMP A;  1H3H A;  1RAI B;  2W10 A;  1MMD A;  2AHJ B;  1M2V A;  4N4I A;  4RTZ A;  3CME T;  2HQH A;  2CZ7 B;  2D9T A;  2V8I A;  4HCZ A;  1NG2 A;  2QA4 Q;  1I0C A;  1BIA A;  1WI7 A;  3FC3 A;  4HXJ A;  1Z9Q A;  1OPL A;  1W1F A;  4PJO D;  3I56 T;  2DF6 A;  2QQ9 A;  2ZGW A;  1H8K A;  2EKO A;  3MET A;  1OU9 A;  4RTT A;  3EGD A;  1KQS P;  4NL2 A;  2P0K A;  4M78 D;  1JB0 E;  3QG1 A;  1FX7 A;  5FWB A;  2FHD A;  5LJ5 g;  3CPW S;  2HKN A;  3VRZ A;  4DA4 A;  1KHI A;  1UGQ B;  4Q5W A;  4M75 C;  1MGQ A;  4DEX A;  3MP1 A;  5KE2 A;  1YI2 A;  3VS2 A;  3VU3 C;  2HNI A;  2BTT A;  1VIF A;  4JJD A;  5HK3 A;  1QKW A;  1ZQ1 A;  3A8G B;  1D1B A;  4FSS A;  5IHI A;  2E3H A;  4KGX B;  3REB B;  3OS1 A;  1X6G A;  4A4F A;  2RD1 A;  2XID A;  2AZV A;  4RCB A;  3UT1 A;  5GAM f;  3FLG A;  3CC4 T;  3JRZ A;  2LDM A;  2DX1 A;  5HK0 A;  3NTH A;  1T3L A;  1KD1 C;  1GCQ A;  3EG9 B;  2MCN A;  3ZL7 C;  3OW2 A;  3CD6 Q;  1QW1 A;  1K8A R;  3EG9 A;  2DA9 A;  4RG8 A;  1VQ6 A;  1WDX A;  5A0L A;  1YJW Q;  2HKQ B;  2R57 A;  2AKK A;  2HMA A;  1K9M C;  3RKW A;  1WHK A;  3CCV A;  3JCM W;  2E5K A;  4OML A;  5KYN A;  3HPW A; 
#chains in the Genus database with same CATH homology
 1WGS A;  2A3L A;  1VQ7 T;  1YBY A;  3M56 A;  4KUL A;  1VQ9 A;  1VQ8 T;  2HQE A;  3S3M A;  1VUB A;  2DTH A;  3L2Z A;  5CVI A;  3M53 A;  1OZ3 A;  4L6V 5;  1M9S A;  2K57 A;  3BDU A;  4M7A E;  1U1S A;  2JVV A;  4DQ2 A;  2CZ1 B;  5CKF A;  3OYL A;  3NFC A;  3UWN A;  2E41 A;  4M7A B;  2F69 A;  4M77 F;  4BI8 B;  3UPU A;  4KBM B;  3E1S A;  5GMK m;  4OP0 A;  4M7D C;  3QYH B;  4ELZ C;  1QVG A;  2OTL T;  2QQA A;  3PGG A;  3V7S A;  3M4G A;  3L2V A;  3F70 A;  3CCM T;  5LJ3 g;  3A5Z B;  5FU6 B;  4C0D B;  3TU4 K;  1G3W A;  4NL3 A;  2ZPG B;  4JS4 A;  2Y4X A;  1JRI A;  2F5T X;  3KXT A;  3CCM A;  4D6W A;  2ZPH B;  4JLG A;  3TRE A;  3SD4 A;  1KHC A;  4X34 A;  4J7I A;  3JCM f;  3C12 A;  5FU7 C;  1KQ1 A;  3G6E A;  2OTL A;  1LJO A;  1UEB A;  3CCE A;  2DIQ A;  2D6F A;  4XTU A;  1U1T A;  3CCJ A;  1I4K 1;  3M9Q A;  2XG8 D;  3J7A F;  1BIB A;  3URG A;  3GPL A;  3SWN A;  3M54 A;  5DLQ E;  2GCX A;  3VV0 A;  3ZBD A;  2PVG B;  3OY9 A;  2DVE A;  5LJ3 h;  4A53 A;  1PSF A;  3CBP A;  2EJG A;  3R6O A;  4PJO G;  1N9R A;  2LNV A;  3LGL A;  3G6E T;  4C0D C;  3HKS A;  5HY6 A;  1UGS B;  3INZ A;  3HRS A;  2XDP A;  4JRQ A;  5GAN 6;  3X28 B;  1OYX A;  4M7A D;  1EIF A;  4OVA A;  4M78 C;  4XU1 A;  2GQV A;  4B9X A;  2EQJ A;  3PIO A;  1Q7Y C;  5FRM A;  2RB6 A;  2LQ8 A;  2R5M A;  4E7I A;  1UGR B;  2RI2 A;  5CKE A;  2LCC A;  4B9W A;  2DO3 A;  3CCQ T;  1YCY A;  1Y07 A;  5DY9 A;  1X01 A;  2DIG A;  3ME9 A;  3QUI A;  4C5G A;  4GY5 A;  5GAM d;  5CK9 A;  3P8H A;  2DEQ A;  2I2L A;  2FVU A;  5AYF A;  3VYG A;  3JCM b;  3MP8 A;  3DKM A;  3MCA B;  3MEU A;  4LDY A;  2M16 A;  5FRO A;  1KD1 U;  4FM4 B;  1Y7X A;  3EFR A;  3M5A A;  4E7J A;  3HP9 A;  1KQS S;  3QBY A;  4EMG A;  2E70 A;  3QJY A;  2RHX A;  4QQG A;  5GAO r;  2RH2 A;  3C94 A;  2XDB A;  4M77 A;  1DJ7 B;  1M1F A;  3RMQ A;  4JJN K;  2Y4Y A;  3M59 A;  1K73 U;  1BI3 A;  3RKY A;  1OZ2 A;  1VQO T;  4HT8 A;  1VQL A;  1YJ9 A;  1Q86 C;  2QA4 T;  2XIC A;  2DTI A;  2P4T A;  2DZ9 A;  1LOJ A;  2JTF A;  4XAX B;  2OTJ A;  3GLX A;  5D6X A;  2DKG A;  2IG0 A;  3EAE A;  5C6S A;  3L2R A;  3FEO A;  3QPH A;  1QVP A;  4NOY A;  4HKE A;  1N8R U;  3CBO A;  5GAN j;  2QQS A;  2RHU A;  2ZPB B;  2KK4 A;  3E9F A;  1KQ2 A;  2E5Q A;  3L2W A;  5CO7 A;  1YHQ A;  3MEW A;  3SDZ A;  2H3J A;  2DAQ A;  4XTV A;  2F5K A;  4R55 A;  3CMA A;  1VQM T;  1U8R A;  3GIB A;  1Q81 U;  1QP3 A;  4HCC A;  3S3N A;  4M7D E;  1VQK T;  4PKC C;  4YTL A;  1VQM A;  3LYI A;  5DLO A;  2VGN A;  2O4X B;  3CMA T;  3JCM Q;  5CKB A;  2JNG A;  3ZEH A;  3E19 A;  3JCM d;  3ZFJ A;  3H8Z A;  2QQB A;  5GAO n;  2RO0 A;  2KAF A;  2LVM A;  1K8A U;  4RKU E;  2M1H A;  1WJS A;  5GMK l;  3OYE A;  2XKO C;  5GAM j;  1LNX A;  2KQW A;  4M7A G;  3OYD A;  2A7Y A;  4FSX A;  3CC4 A;  4XU3 A;  3CXC A;  3V8K A;  4OMF B;  3UDC A;  5GAN 5;  1N9S A;  4M75 B;  3OYG A;  1XTD A;  4MMK A;  5CIU A;  3V8L A;  1Q7Y U;  2FB7 A;  4TVR A;  4ZN3 A;  5LJ5 e;  1D3B A;  5GAM e;  4ATO A;  2BIV A;  1Q82 U;  5LJ5 d;  1K73 C;  3QJ6 A;  4V2S A;  1XOV A;  4UC4 A;  1VQ5 A;  1P92 A;  4XQ3 A;  5FU7 B;  5J26 A;  3WVD B;  1JBM A;  2EYQ A;  4M78 G;  4M78 B;  4N0A A;  5M9O A;  3X24 B;  2RJE A;  1YIJ A;  4OGE A;  2KDS A;  1XNI A;  3OBY A;  1B34 A;  4N4G A;  1RI0 A;  4C5H A;  4LDU A;  1Y71 A;  3TEE A;  1Q82 C;  4BY6 C;  5GAN h;  4L5G A;  3FIF A;  4C8Q F;  2LRQ A;  4FU6 A;  1YI2 T;  4M7A F;  3AHU A;  3OYN A;  4BY6 B;  1FXX A;  2XI9 A;  1ZHI A;  4PJO A;  4PJO C;  1VQP A;  4JRK A;  4MML A;  3PIP A;  3SB2 A;  4PLI A;  5KCO A;  2KMT A;  1QVF S;  4PJO B;  4J6Y A;  4C5I A;  3VKI A;  2JTM A;  4BD3 A;  4EDU A;  2E12 A;  3LGF A;  4FT2 A;  5EG2 A;  4BE2 A;  1KQS A;  3CD6 T;  2RHY A;  2RM4 A;  3JCM h;  5LJ3 j;  4EMK B;  4PJO E;  4A4G A;  3OSS C;  3DB3 A;  2YLC A;  3V7C A;  3HRT A;  2CKK A;  4C0F A;  4E7L A;  1BI0 A;  2LT4 A;  2EWN A;  3WXM B;  5GAN e;  5D6Y A;  4JUV A;  4M75 G;  3I56 A;  4C8Q A;  2EQM A;  5LL6 S;  1NJI C;  2K5I A;  5CKH A;  3CC7 T;  4M7D F;  1N27 A;  3FDR A;  4JS5 A;  3LX7 A;  4J6X A;  5GAN 4;  3T9N A;  3A8H B;  2BUD A;  3FRN A;  4C8Q B;  4XTW A;  4C8Q G;  3OYC A;  3A8M B;  4KUD K;  3QO3 A;  2L3R A;  2RI5 A;  4E7K A;  2LCL A;  3CCJ T;  3JCM g;  2WAC A;  4OB2 B;  3CCU A;  3PMI A;  5CAI A;  3FJP A;  4ELY C;  2Y90 A;  2L5Q A;  2V8J A;  3JCM V;  3CME A;  2QTX A;  3ASK A;  4M7D D;  3QKJ A;  2WSC E;  2ZZD A;  3HL8 A;  4OF1 A;  5IN1 A;  3S3O A;  2X4X A;  2RHZ A;  4M77 D;  5HKC A;  1VQ4 T;  1M5Q 1;  4HA8 A;  1MHN A;  3OYY A;  4M78 E;  3RKX A;  1NPR A;  3M55 A;  5GMK i;  1M90 C;  3OYJ A;  1H64 1;  1I81 A;  1O75 A;  2LX9 A;  3L42 A;  4EPC A;  3LWI A;  3PMT A;  5DM7 R;  4XTY A;  3DB4 A;  3RUX A;  5CKD A;  3OYH A;  1WPY A;  2O01 E;  1M4Z A;  3NTK A;  4M75 F;  2YLB A;  3QHS A;  3JB9 D;  1K9M U;  3OA6 A;  2P0Q A;  3OMC A;  4CI0 C;  3G4S A;  2XHC A;  3MEV A;  3VUZ A;  3CPW A;  4X9C A;  4A4E A;  1X6O A;  2DXU A;  3OYK A;  1Q86 U;  3C4S A;  3OBW A;  2FYK A;  1S72 A;  3GP8 A;  1GXI E;  2JZ2 A;  4M78 A;  5GAM h;  1XQH A;  2MWO A;  4XTZ A;  3VUB A;  4ZGJ B;  5GAO l;  5IT9 E;  1BYM A;  2HD0 A;  2O4X A;  3MP6 A;  2LC4 A;  4J5Y A;  3CXC S;  1G3Y A;  3PFS A;  2K3Y A;  4BUG A;  5CR2 A;  3L2Q A;  2JUF A;  3HRU A;  3LH0 A;  4OB3 B;  5LJ3 d;  3SWN B;  3CC2 A;  2VXE A;  4ZTF A;  3LLR A;  3A8L B;  1NZ9 A;  1YIJ T;  3GNG A;  4A54 A;  4C0G A;  1WJR A;  1VQ8 A;  1VQ9 T;  1AHJ B;  1QVF A;  1W4S A;  2VV5 A;  3JCM e;  3G4S T;  4ZTJ A;  2V8K A;  3A8O B;  3OQ5 A;  4C92 F;  3RES A;  4J7F A;  5GAM g;  3C95 A;  4C8Q E;  3J81 E;  3CCV T;  2X4Y A;  3P8B B;  3CEY A;  4XTX A;  3OW2 S;  4WF2 A;  1M1K U;  1KC8 C;  4IUU A;  2X4J A;  2K4Y A;  5GAO p;  4RCC A;  5LJ5 j;  2E64 A;  2M0O A;  2VC8 A;  2GFU A;  3J80 E;  1WNL A;  4C92 D;  2WSF E;  1NPP A;  2GFA A;  3QII A;  4EMH A;  5GAO m;  1IRE B;  3E9G A;  3CPF A;  3G71 A;  1YJW T;  2RK2 A;  2LT1 A;  2JN0 A;  2K3X A;  2MF2 A;  3WVE B;  2VYT A;  5GAO q;  3RIR A;  4J6W A;  1VQN T;  1YIT T;  2VXF A;  1HK9 A;  1V29 B;  1BKB A;  3MHX A;  5GAN 3;  3OS0 A;  3QYG B;  2QEX A;  3SFM A;  4QQ6 A;  4ZGD B;  5LJ5 h;  2K2V A;  4MDW A;  1G3T A;  3ER0 A;  4QVZ A;  4II1 A;  1YJW A;  3G71 T;  2DTO A;  2MAM A;  3CCR A;  3JCM P;  4VUB A;  4QVC A;  4M7A A;  4M7A C;  4LDX A;  4XU2 A;  5LJ3 e;  2CGH A;  4PJO F;  4ZN1 A;  1M1K C;  3PTA A;  1G5V A;  2ZPF B;  2MI6 A;  4CRI A;  1N6A A;  2XDD A;  3NTI A;  1KG1 A;  4E7H A;  3L2U A;  1Y96 A;  2R5A A;  3MO8 A;  4DOW A;  5GAN g;  1YJN A;  3KBG A;  2CS7 A;  3OS2 A;  3CCR T;  5KH6 A;  2PVO B;  4L59 A;  4IKF A;  4LDW A;  4A4K A;  3GNF B;  2L89 A;  4LD6 A;  4C92 B;  4C0Z A;  2QEX T;  1JJ2 A;  4O5V A;  4EMK C;  1Q81 C;  2RI3 A;  4LD9 K;  2CYZ B;  1YIT A;  1VQN A;  2B8A A;  2DD4 A;  4BE0 A;  4M7D G;  4N4H A;  3VYH B;  2RJF A;  2WSE E;  1QVG S;  4HCB A;  2BKD N;  2EFI A;  5GMK h;  3Q1J A;  1BI2 A;  1FWZ A;  2ZCF B;  2IVW A;  3QZ5 B;  5IAY A;  4IUT A;  2E6N A;  4M7D A;  2HAX A;  1S72 T;  5D6W A;  5KE3 A;  2K5L A;  3JSC A;  3MEA A;  3HFN A;  3CCQ A;  4C8Q C;  3JB9 F;  2LTO A;  4IUP A;  2RJD A;  4XK8 E;  1KC8 U;  4LDV A;  5KCH A;  4JDS A;  4BDY A;  5CCA A;  1M90 U;  2E1H A;  3CCS A;  4C92 C;  4RG2 A;  4J83 A;  5J3B A;  4R56 A;  2K5F A;  5FLX E;  3HSB A;  4JRI A;  3G7Z A;  5I2M A;  5L8R E;  3RMS A;  2QI2 A;  3LW5 E;  4C5E A;  1O9S A;  5GAN 2;  1VQ4 A;  3OYI A;  5I2S A;  1R8O B;  4M75 A;  3JB9 I;  3I55 T;  3HFO A;  4FL6 A;  1K8A C;  2XD0 A;  4JLI A;  3CC2 T;  4FT4 A;  1D3B B;  3KUF A;  3CCU T;  1VIE A;  3CCL A;  4M77 E;  1TH7 A;  2DXT A;  4QVD A;  4ZGE B;  1BI1 A;  2MWP A;  4C92 G;  2RK1 A;  4FIB A;  3N5B B;  3OSV A;  3S6W A;  5A0D A;  3GOX A;  5GAN f;  4ME7 A;  3FB9 A;  4QQD A;  4M77 B;  3JB9 H;  3TCJ A;  2D0Q B;  4C92 E;  2E65 A;  1M1G A;  4M77 C;  3CCE T;  4M7D B;  3M57 A;  1HXD A;  1G3S A;  2PU9 B;  1NE8 A;  2JOY A;  4F7U A;  2P0P A;  2EJF A;  1QP2 A;  4EMK A;  2KY9 A;  3PNW C;  2X35 A;  2EIF A;  3BW1 A;  4OB1 B;  3SWN C;  4F7U G;  3LWH A;  4F7U B;  4C8Q D;  3OYF A;  4KT0 E;  4BI4 A;  1WQW A;  2DXB A;  2EJ9 A;  2PUO B;  2MMP A;  3X25 B;  1X75 C;  2PQW A;  1SSF A;  4IUV A;  2CZ0 B;  1RL2 A;  4PL6 A;  2AHJ B;  2X4W A;  5LJ3 f;  2DD5 A;  4N4I A;  3H6Z A;  3CME T;  4X9D A;  4MZM A;  1B34 B;  2FL7 A;  2CZ7 B;  2D9T A;  4BI3 A;  5A2Q E;  2V8I A;  4HCZ A;  3QZ9 B;  1BIA A;  2RJC A;  3FC3 A;  2DPP B;  3CCL T;  3JCM J;  4Y91 A;  3M58 A;  2E6Z A;  3CC7 A;  3HHT B;  3I55 A;  2ZPE B;  5FU6 C;  4PJO D;  3I56 T;  4NS5 A;  2YRV A;  1VQ5 T;  4M78 F;  4XU0 A;  2QQ9 A;  1WJQ A;  4BDZ A;  2ZGW A;  3OS5 A;  2DK3 A;  2HQX A;  2EKO A;  3O8V A;  4OGC A;  3MET A;  5C0M A;  2DJZ A;  1VQ7 A;  4M77 G;  3CCS T;  4N0A C;  3CD6 A;  3X20 B;  3JCM X;  1UB4 A;  2G3R A;  4NL2 A;  4BE1 A;  2P0K A;  4M78 D;  2DXC A;  1JB0 E;  3QG1 A;  4MDX A;  1FX7 A;  4QW2 A;  3V7R A;  2QXF A;  5LJ5 g;  2FHD A;  3CPW S;  4OB0 B;  3M4Y A;  2QQR A;  1VQP T;  5GAN d;  4DA4 A;  1KHI A;  1UGQ B;  3OYM A;  4M75 C;  2NLU A;  1MGQ A;  2EAY A;  3BDL A;  4Q5W A;  3JCM c;  3X26 B;  3MP1 A;  5KE2 A;  5GMK j;  4BAC A;  1YI2 A;  3VU3 C;  4RMO A;  2HNI A;  1VQ6 T;  1VIF A;  4Y28 E;  4F7U E;  2LQK A;  3DLL A;  2L8D A;  2KVQ G;  4M75 D;  4C92 A;  5HK3 A;  3PT9 A;  2OAU A;  1ZQ1 A;  4BB7 A;  1NJI U;  4DOV A;  2VGM A;  3A8G B;  4J8O A;  1WQ7 A;  2M9U A;  2XU8 A;  2YHT A;  2EQU A;  4JRP A;  1W2B A;  3GF5 A;  5LJ5 f;  3QDR B;  5GMK e;  3OS1 A;  4A4F A;  2KSS A;  2RD1 A;  3QSU A;  4Z02 A;  1N8R C;  3P8D A;  4P5N A;  2XID A;  1H3Z A;  1YJN T;  2RHI A;  4RCB A;  3UT1 A;  4A4H A;  5A0G A;  4PNO A;  5GAM f;  5FRN A;  2DZC A;  4IUR A;  4M75 E;  1M8V A;  3OB9 A;  3FLG A;  3CC4 T;  2CZ6 B;  3BFM A;  3JRZ A;  1ZBX A;  4MZP A;  4HT9 A;  2OTJ T;  2LDM A;  5I21 A;  3BY7 A;  2QA4 A;  3OMG A;  1YJ9 T;  3L1A A;  1VQO A;  5GAN 8;  2C06 A;  3CBM A;  5HK0 A;  4MZT A;  2PUK B;  3NTH A;  4GLK A;  1OI1 A;  1KD1 C;  4O6J A;  1VQK A;  2EQK A;  4E47 A;  3VJP A;  3OW2 A;  3V8J A;  1QW1 A;  2RA2 A;  3OYB A;  2ZPI B;  3JB9 J;  1I5L A;  3JB9 G;  1YHQ T;  2R58 A;  2PVD B;  4RG8 A;  2GF7 A;  1VQ6 A;  3RER A;  2XK0 A;  3EFS A;  4PLL A;  1PSE A;  5A0L A;  5GAN 7;  2R57 A;  2E10 A;  3DLM A;  3QXE B;  5J39 A;  2QDY B;  1UGP B;  1Y96 B;  1W2B S;  1K9M C;  3RKW A;  1IZ6 A;  1JJ2 S;  5CQX A;  4IUQ A;  3CCV A;  3OYA A;  3JAM E;  1I8F A;  2VUB A;  5CQY A;  3JCM W;  1VQL T;  4KUI A;  2HBP A;  4F7U F;  3HPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...