4N0AC

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
86
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDESVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm3
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 19
structure length 86
sequence length 93
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aC00
1D3BB 2E10A 5DY9A 1Y96B 2Y90A 4DQ2A 3JCMQ 2DTIA 4M77B 4M78F 5LJ5f 3JCMe 5GAOm 3JCMh 3EFSA 4QVCA 3HSBA 1U1SA 5LJ3f 5GAOp 4HT8A 3JCMW 3RIRA 4M7DG 3RUXA 5GANd 3JB9F 5GAMe 4PJOA 2I2LA 4XTWA 5GAMd 2YHTA 3RERA 1I81A 2DXUA 4RCCA 4M77D 4M78G 5GMKe 5GAMg 3JCMV 1N9RA 5LJ5j 4C8QE 2VC8A 2DKGA 4M77C 3RKXA 4C8QA 1MGQA 3JB9G 2RD1A 1YCYA 4EMGA 2JN0A 4J6YA 4M7AE 2DEQA 3GIBA 1U1TA 1M5Q1 3FB9A 5GAN2 4M75E 4M75A 3BFMA 4JRIA 1LNXA 4XTYA 2DZCA 2DZ9A 2QTXA 4JRKA 4F7UA 3JCMc 4F7UE 3INZA 1I8FA 4M77F 2DTHA 3AHUA 2RA2A 4EMKB 3EFRA 3PGGA 1BIBA 4NL3A 3V8JA 3V8KA 4QVDA 1I4K1 1WQWA 5I21A 4N0AA 4PJOE 3VU3C 5GAMh 4M7DA 4M7DE 3RKYA 3JCMf 4M77G 4WF2A 5GANe 2CGHA 4M7AD 4A53A 3RKWA 1Y96A 3BY7A 4XU3A 3HFOA 1JRIA 2DJZA 4M78E 4M78A 3SWNA 4Y91A 4C92D 5GMKh 1HXDA 1JBMA 4MMKA 4MMLA 5GAMf 1B34A 4NOYA 4EMKC 5GANg 4XTXA 2DVEA 5LJ3d 4HT9A 5GMKl 1N9SA 5GAN4 5LJ3g 4XU1A 4C8QB 2FYKA 3QHSA 4HA8A 3M4GA 4XTVA 4JLIA 5GAMj 3QO3A 2E65A 4XU2A 4PJOD 4X9DA 3QUIA 4XTZA 3JCMb 4M7AB 2E64A 4X9CA 4M7AF 1BIAA 3QSUA 2EWNA 5GAN6 5GMKj 4C92F 4C92B 5GMKm 4C8QD 4C8QG 3V8LA 5GAOq 3L2ZA 1M8VA 4M75B 2RB6A 4F7UB 3JB9H 4EMHA 4C8QC 2EJ9A 3JB9I 4M7AG 1D3BA 4XTUA 3SB2A 5GANh 4PJOB 4M77E 1WPYA 4M77A 3FJPA 3JCMJ 1HK9A 4C92G 4M7AC 2YLBA 1X01A 2VXEA 5LJ5e 4J6WA 2EJFA 4M75G 4M75D 1H641 4PJOF 3RESA 4C92C 1WNLA 5LJ3e 5LJ3h 5LJ5d 1LOJA 5CAIA 5GANf 1I5LA 4M7DB 4M75C 5GAN5 5LJ5g 4NL2A 2HNIA 4M78B 3SWNB 4JUVA 4C8QF 1LJOA 4XU0A 2RM4A 5GAN3 3JCMd 5GAN8 1TH7A 1B34B 4PJOG 4RCBA 4M7DD 3JCMg 2EJGA 2ZGWA 3FIFA 3V7SA 4N0AC 5GANj 4PJOC 3L1AA 4J6XA 1KQ2A 4M7DC 1WQ7A 4M78D 4V2SA 3BDUA 3JCMP 3BW1A 4OP0A 2EAYA 2FB7A 4M75F 2VXFA 4F7UF 5GAN7 4M78C 3SWNC 5LJ3j 3JB9J 4J5YA 3JB9D 5GAOl 2E41A 2YLCA 2DXTA 5GAOn 4M7AA 5GAOr 3V7CA 4XQ3A 4EMKA 5GMKi 4C92E 1KQ1A 4C92A 4A54A 5LJ5h 4F7UG 3HFNA 2E1HA 2DTOA 2K57A 4PNOA 3V7RA 3JCMX 4M7DF
chains in the Genus database with same CATH superfamily
3CXCP 1WIEA 1R0CB 1U1SA 2LX9A 2ED0A 4M7DG 1QWFA 2X4JA 2P4RA 3CCUQ 2CT4A 1WFWA 3LGFA 2KGTA 3WXMB 2CZ7B 2DL7A 1UGSB 3VS4A 3CMEQ 4JJDA 1WA7A 4HCZA 3GIBA 3REAB 1KHCA 2D8JA 1MHNA 4OMFB 1WHMA 1D09B 1T0JA 2OAWA 3OYDA 5I21A 4M78E 1NE8A 1VQ8A 2D8HA 4A4EA 1U8RA 2EBPA 2XICA 2R5MA 1NG2A 3MEVA 1IZ6A 4C8QB 1YHQT 3O8VA 2HSEB 1M27C 1VYUA 2XHCA 1YJ9Q 4QQ6A 4M75B 2QAZA 2JTEA 3OS2A 4MZPA 2AKKA 5AYFA 2VB6A 3EG9A 2JNGA 2J06A 1YWOA 5CAIA 1BI1A 1WYXA 2QK0A 4DEXA 5EC7A 4QKUA 5HCKA 3PT9A 3FIFA 1YIJT 5D7UA 1HYOA 3U23A 1H92A 5CCAA 4BY6C 2KVQG 1Y0MA 2V1RA 2CP7A 2X9HA 2E41A 2RJEA 4M7AA 1PG5B 2FZCB 2KRNA 1RAGB 4IIOA 3OYEA 4QQGA 3EH2A 2M16A 3MP6A 5GAOp 1AWWA 3GF5A 5D6YA 4E2FB 2O9VA 3RERA 4RCCA 4FL6A 4LDXA 1NYGA 3S6WA 2HBPA 4ATOA 2RQUA 2R5AA 3CCVT 2RD1A 1UECA 3CCET 5IHIA 1M5Q1 2L3RA 1YJNQ 6AT1B 4F7UA 3UWNA 1WHHA 4KGZB 2KT8A 2H8HA 3RMQA 3OMCA 3OYMA 3CCUA 1QVFA 3CCRA 2YXYA 1X6OA 4ORZA 3TSZA 2DE0X 3HHTB 1E7OA 4MMKA 5HY6A 2O4XB 3H41A 4LD6A 4KUDK 2L2PA 1K76A 3E1SA 1D1AA 5LJ3g 1VQKT 3CBOA 2FVUA 4RTWA 2EQMA 4A4FA 2RI5A 2CZ0B 3L2QA 2YSQA 1QCFA 4C92F 2DETA 3UPUA 1H3ZA 2LDMA 3QG1A 4RTUA 2F2XA 1KQSS 1X01A 5FU6C 1TXQA 3G7ZA 1I5LA 1MV0B 4OMLA 5I22A 1PWTA 1UE9A 2LZ6B 4M78B 1RAHB 2RH2A 5A0DA 1QMCA 3BDLA 2ZGWA 1YJ9A 5FU7C 2K2MA 5KH6A 1IREB 2E6NA 2DYBA 5KYYA 2GGRA 2E3IA 1K9AA 2FPEA 4XQ3A 4FYYB 5LJ5h 1M2VB 1Q81C 1M1GA 3HFNA 1W70A 3JAME 1QLYA 3OY9A 2W10A 8ATCB 2OTJT 2O88A 3FEOA 2DXUA 1TUCA 1TOVA 2AK5A 1OZ2A 1YITT 1VQ5T 4BE0A 2DVJA 2CT3A 1HJDA 5FWBA 3DLMA 3OQ5A 3L2UA 1F1BB 1ZSGA 1VQMQ 4BB7A 3S3OA 4KH0B 2HAXA 2M9UA 3GOXA 3CCVQ 5KYXA 4HVWA 3QPHA 4OMNA 4ZN3A 1WDXA 1VQLT 2CGHA 3LLRA 1EFNA 2KXDA 4C92D 1HXDA 1UGRB 4FW1A 2EGAA 2GFUA 2XG8D 3C0CA 4XTXA 3PMIA 1KC8U 4DBQA 1YJNA 2D0NA 2HKNA 2RHIA 2PUKB 2JOYA 3RBBB 2HD0A 2DRMA 5D6WA 4AFSC 2IPOB 1UEBA 1D1CA 1MV3A 2EWNA 1K8AU 2RI3A 3G6EQ 2MYSA 5CQYA 2CUDA 2F5TX 1K73R 2NLUA 3UDCA 1VQKQ 4ZGJB 5GANh 3CBMA 1QCNA 4QQDA 2VXEA 3X25B 2FPFA 2NUTA 3ZL7C 5LJ5d 1WNLA 1K4US 3VRZA 4Z8AA 2E12A 2RM4A 4FSXA 3S3NA 3CCSA 2C0TA 2KSSA 1JB0E 2QYZA 4F17A 1KQ2A 2PZ1A 2EAYA 2FL7A 3VS6A 4YTLA 2FZGB 5IHKA 3G4SA 1MMDA 5GAOn 1PRLC 1DJ7B 4MDXA 5GMKi 3DLLA 2DK3A 3EGDB 1X75C 2E10A 2EYWA 4ZNXA 3CCJA 2ABLA 2KYBA 2LJ3A 2L5QA 3EFOB 4XTWA 1PC0A 3CPWS 2DBKA 2LQNA 2BTTA 2FPDA 1N9RA 2D1XA 1ZSZB 2OTJQ 1PSEA 1OQKA 2IIMA 1M9SA 3VJPA 1XJWB 3C94A 4IUTA 5CKEA 4JJCA 1YITQ 4LDWA 1VQ5Q 3KUFA 1M3BA 2E5QA 3PGGA 2KRMA 4JJBA 3NFCA 1KC8C 4PJOE 3KXTA 1VQ6T 1RLQC 3E19A 5IXBA 4BI4A 1M90C 4PFPA 5GANd 2DJZA 5GMKh 1NPRA 4J9CA 1WJSA 2P84A 2XD0A 1K8AC 1PNJA 4C0DB 1TSFA 1VQMA 4QW2A 1AZEA 3M59A 2PQWA 4ZN1A 2E3HA 3MJXA 4RUGA 1OU9A 4KRTA 3IQLA 4M7AF 4J9IA 2AHJB 2CP5A 1X2QA 2HQXA 4RTVA 4EMHA 2EJ9A 1PM3A 1XNIA 1D3BA 3SEMA 2YWWA 3OYBA 1RAAB 2GBQA 4R55A 3H6ZA 2V8JA 4P5NA 4C92C 2HCKA 1LOJA 4AFUC 2LP5A 1MUZA 2Z0WA 5I2MA 3VV0A 5GAN3 3G1JA 4PJOG 3H0HA 3G6EA 5HK3A 2KNBB 2H3JA 3DB4A 1M8MA 1VQKA 1ZBJA 1TU0B 3BE3A 4F7UF 1SKUB 5GAN7 4OGCA 3A5ZB 5A0GA 2KYMA 2L8DA 1Q95G 1PHTA 4C92E 3QWYA 2X4XA 4CC7A 3JV3A 3CMAQ 2J6KA 4PL6A 5GAOm 2D6FA 2DL5A 3J7AF 1R8OB 4RTZA 4JS4A 1UHCA 3JB9F 1ARKA 2ESWA 1TTHB 1G8XA 1I81A 3OSSC 4M77C 3VUZA 1Q82U 2BKDN 2X4YA 1C0MA 1NM7A 1U1TA 2CYZB 2DILA 3FB9A 4LNPA 2QASA 2V8KA 1N8RC 3G71T 1AD5A 2E4HA 4D8KA 2R58A 1HD3A 3M0QA 3UF4A 1Q86C 4J7IA 2EYYA 2CP3A 2XIDA 4M7AD 4KULA 2KY9A 1UTIA 4MMLA 4OVAA 1O75A 2RQVA 1V29B 2JZ2A 4Z89A 1T0HA 2AKLA 1S1NA 1VQ5A 4HVUA 1VIEA 2FYKA 3QHSA 1ZA1B 2DL3A 3M4YA 4X9DA 1W2BA 2QQRA 1BIAA 4Q5WA 2OTLT 2EQUA 1GBQA 1GFCA 3OSVA 2FRYA 2YRDA 1ZBXA 4HCKA 3M0UA 2DRKA 1IHWA 3EH1A 1G3WA 1IB8A 2FO0A 4M77A 1I1JA 1IHVA 3R6OA 3OYFA 4PJOB 4ANJA 1IGQA 1OU8A 2HNIA 1WHGA 1P92A 1QW1A 1UDLA 3HRSA 1X2KA 2JVVA 2Y4YA 2DLPA 4M7DC 1W4SA 2XI9A 1YJWQ 4HKEA 1XQHA 4LXCA 3X24B 1WJQA 2JTMA 3JB9D 2M51A 1W2BP 1VQPT 2O01E 3L2RA 2B8AA 5KYWB 4PNOA 3FLGA 4HCBA 1HSQA 2LJ0A 3CC7Q 3JCMh 1YP5A 2ROLA 5GAMe 1AOJA 3EG0A 2XU8A 3H9NA 1CKBA 4IURA 4CC4B 2QEXT 2C0OA 2X51A 4BI3A 1AVZC 5HK0A 3CMAA 2YUQA 1G83A 3MKDA 1I07A 3OYNA 4PFOA 3L2WA 4J83A 2RK2A 1BIBA 4BUGA 1C6VX 2JW4A 3CXCS 2KQWA 4CI0C 4M7DA 1N6AA 2YUOA 2FEIA 3LWHA 4IUPA 1AT1B 2E70A 3CCQT 3G71Q 3I5RA 3FRNA 4D8DA 1WLPB 4FYWB 2Y4XA 1LPLA 2A37A 5LL6S 4HT9A 3MP1A 1WJRA 5GAN4 2K5FA 4B9XA 3E9GA 3PMTA 3QUIA 1BKBA 3QSUA 3EGXB 5GMKm 3Q1JA 1QVGS 5GAOq 1R0BG 1N8RR 2RB6A 1Q86R 3JCMJ 3HKSA 2LC4A 1HK9A 4PFZA 4M7AC 4RG8A 2R57A 3URGA 2OTLQ 3EG1A 2VGMA 3TEEA 1SG5A 2IG0A 2CZ1B 4N4GA 3JCMd 2YUNA 2DFUA 1ACMB 1U5SA 3M9QA 1IXDA 3L1AA 3I56A 3MEUA 3JCMP 2VXFA 3META 3OYKA 4J9FA 3S3MA 2BIVA 4L59A 2MK5A 1BCOA 4B9WA 2NUZA 2JS2A 3JCMe 3OS1A 1KHIA 5LJ3f 2AZVA 4HT8A 1VQPQ 1YJWA 4E7SA 1LCKA 2LQKA 4M78G 3M5AA 4KBMB 5LJ5j 4N4HA 4F04B 2JMCA 4GLMA 4PK4A 3M0RA 2D0QB 5CKFA 3CC7A 3VYGA 3P8BB 3BFMA 4F7UE 4DOWA 2OX7A 2D9TA 2DTHA 2QEXQ 2HZYA 3VS7A 1Q81U 3SFMA 1GCQA 3PIPA 1G3TA 2DA9A 2YDLA 1M1FA 3VYHB 4FT2A 2RQWA 2CZ6B 3I9QA 3M55A 1AEYA 1YFNA 2DXBA 3TSWA 2HQEA 3CCQQ 3CC2T 1K73C 1QCOA 4PKCC 4XTZA 1O9SA 5FROA 4OMMA 1OPKA 4OGEA 3F70A 2GTOA 3G71A 4F16A 4AFZC 4XTUA 4C5GA 1YI2T 3CMEA 1SHGA 1RUWA 4MZTA 4E7HA 5FWCA 1KQSA 1T3LA 2EYXA 1YWPA 5GAN5 2DF6A 4AT1B 2QA4T 1MMGA 1VQ7T 2KR3A 3ZEHA 4N0AC 5GANj 3ZBDA 5DLOA 4L5GA 4MDWA 1E6HA 3JB9J 2OTLA 4C5HA 2IVWA 3CCMT 1YHQQ 2VVKA 1QVFP 3UA6A 1RABB 1VIFA 2YRVA 4DQ2A 5LJ5f 2LMJA 3EG9B 2COZA 3NHNA 2DM1A 2RJCA 1QKWA 1YCSB 2DAQA 2C0IA 4JDSA 3M0TA 1OX9A 2CP2A 4JZ4A 4Z88A 2A0FB 1MNDA 1YIJQ 4PLIA 2H3EB 2ED1A 2EKOA 3RDVA 1VQPA 4II1A 4M77F 2O2OA 4ELYC 4NL3A 3V8JA 4QVDA 2XMFA 3O5ZA 4N0AA 4J7FA 3VU3C 2HDAA 2CP0A 2KXCA 1G2BA 2COYA 2HKQB 2E6ZA 4BE1A 5J26A 3T9NA 1B34A 4BI8B 4QT7A 4IUUA 1ZLMA 3EFOA 1N9SA 3CC4T 2JM8A 3X20B 2RQTA 4FCYA 5DM7R 2QEXA 4DBHA 3H0IA 3QO3A 2DERA 2KK4A 2P0KA 4X9CA 3UT1A 2V26A 5GMKj 1KIKA 3CCEQ 3SHWA 2F69A 5IN1A 4F7UB 3JB9I 5KYUA 1UFFA 2CDTA 2KT1A 4IUQA 4BDZA 1WPYA 3CEYA 3CC2Q 1VQ9T 3RESA 2MWOA 5GANf 1ZUUA 4LN2A 5LJ5g 2M1HA 3CCQA 4OMOA 2K9GA 1M90U 4BY6B 2CH4W 4KGVB 4CRIA 2F2VA 2QQSA 1YI2Q 1JXOA 3TQ7P 1Q7YC 1X27A 3V7SA 4J6XA 4DA4A 2EKHA 4QVZA 2KMTA 2QA4Q 3SWNC 3PNWC 1VQ7Q 1W1FA 2EQIA 3LWIA 2X3XD 3I55T 3NTHA 4M7DF 4XK8E 1UGVA 2A3LA 1X6GA 1OPLA 2DJQA 3MCAB 4E7IA 4M77D 1PD1A 1VQOT 2EW3A 1K1ZA 2VC8A 2XKOC 1YHQA 3CPWA 2VKNA 4EMGA 4J9BA 2DBMA 2O9SA 1B3QA 2X35A 1UJ0A 2DZ9A 3LGLA 5KYYB 3JCMc 1PKTA 3CQTA 2QDLA 3AHUA 4BACA 2RA2A 5IH2A 1FMVA 1I4K1 3ER0A 1SHFA 2AIRB 2LNVA 2A7YA 1RAFB 1Y7XA 3VS2A 3SWNA 1I0CA 4XAXB 4EMKC 5GANg 1BI0A 1YIJA 2BE7D 4O5VA 3OA6A 2QTVA 1YN8A 2HMAA 4FYXB 4PJJA 5I11A 3M4GA 2A28A 2EIFA 1C1AA 2EGEA 1QP2A 3WVDB 1J3TA 1WI7A 5FU6B 1ZUKA 4M4ZA 1NPPA 4HCCA 1V76A 2PVGB 1M8VA 3PIOA 1N5ZA 4E7ZA 1FWZA 1RL2A 5DLQE 1N8RU 2MCNA 2ZPBB 3FJPA 3VUBA 5KYXB 1Q86U 5KCOA 1H3HA 3A8HB 5FU7B 4PJNA 1EX4A 2KDSA 1VQ4T 2LX7A 1VQLQ 3M58A 4XU0A 3CCVA 1VQ8T 4M7DD 4DBFA 3CCEA 2MMPA 1M1KC 2FZKB 4V2SA 2GQVA 4OP0A 2FB7A 1NYFA 1ZX6A 3A1PA 1UUEA 3RR6A 1VYVA 4ZTFA 3L2VA 4AMCA 1MNEA 4EMKA 3KBGA 2FRWA 5J3BA 2DTOA 3V7RA 3OW2S 2MOXA 1YI2A 3P8HA 4JLGA 3JRZA 4A4HA 2KI7A 1K9MC 3HSBA 1OI1A 2NUTB 3QYHB 3RUXA 3I55Q 4PJOA 4LDVA 2OAUA 4AFQC 1MGQA 4JRQA 1Q7YR 2OI3A 1BYMA 2JN0A 2EFIA 1KK7A 4EDUA 1ABQA 2PU9B 4XTYA 2V8IA 2DZCA 2LT1A 1VQOQ 5FRNA 2PTKA 1RADB 2QXFA 3M53A 2ENMA 5GJVB 2CREA 3QXEB 4WCIA 2RQRA 1PKSA 3REBB 5KYWA 5GAMh 3NTKA 1FMKA 1TWBA 4A53A 2ZPFB 4Z02A 5IT9E 2COWA 2QQ9A 2VV5A 5CVIA 1JJ2S 4E6RA 1JU5C 4IKFA 4TVRA 3J81E 2FG0A 2RF0A 3C95A 4XTVA 1FXXA 4Y92A 2ROTA 3ME9A 4MZMA 3L2ZA 4C8QC 1U06A 4M77E 2MWPA 3TU4K 4C92G 4IUVA 2OTJA 3CCRT 4M75C 2ZPHB 1WHKA 3FDRA 1YITA 1VQ6Q 2E5KA 5CKBA 3QBYA 3OS5A 2HSPA 3A8OB 3L42A 4EPCA 1FX7A 1KG1A 3FC3A 2EPDA 3PTAA 1VQ4Q 1RACB 4J5YA 2RJFA 1WHJA 1GXIE 5M9OA 1VQ8Q 2EQKA 4CC3A 1VQLA 1M3AA 2JT4A 1KJWA 4NS5A 1KD1C 1D3BB 1D0YA 1BCMA 5C6SA 3JCMW 3VS5A 1X69A 2VUBA 1NJIR 1UGQB 1WXBA 2NYSA 3CBPA 5GAMd 4KH1B 1SRLA 1N27A 3OS0A 4C8QA 2W0ZA 5KE3A 2JXBA 1M1KR 4PJLA 4ME7A 2RMOA 2JM9A 3J80E 2K4YA 2PVDB 1VUBA 8AT1B 4M75A 1IGUA 4WTOB 2K5LA 2K3BA 3I55A 2NUPB 2KBTA 5A0LA 2X3WD 4J8OA 4M7DE 3I35A 1G5VA 1BI3A 3M0PA 3CXCA 1EIFA 1K9MR 3BY7A 2QG9B 1EZZB 3MEWA 4BE2A 1GRIA 1QWEA 4LDYA 1BBZA 9ATCB 2A08A 5IHNA 1D0XA 5CO7A 2G3RA 2MPXC 2K3YA 1NBEB 4D6WA 2F1LA 1B07A 1OEBA 3QJ6A 1PRMC 2J6OA 5GJWB 5GAN6 4C92B 3V8LA 5AT1B 3N5BB 4N4IA 2LVMA 2RHZA 3RMSA 3E9FA 1QVGA 1AWOA 1M30A 3PE0A 2AT1B 1PD0A 1H641 2X4WA 1Y71A 4FM4B 1JO8A 4J9GA 5IAYA 1YNZA 5J39A 1FYNA 4RTXA 3TVTA 2O31A 3JCMg 1D0ZA 2BE9B 1E6GA 2RO0A 1R77A 1YJNT 3CCRQ 4K11A 2K3XA 4C0GA 4M78C 1K73U 1ABOA 4X1VA 2ZPIB 5GAOr 3PVQA 2XDDA 2DXCA 1VQ6A 2P0PA 2QQAA 2K79A 5DY9A 1NEGA 2VASA 1Y96B 1QVGP 4M77B 1SSHA 1IO6A 4CC2A 4A4GA 1XTDA 2O4XA 2HBWA 1GCQC 1VQ4A 4DBRA 1WXUA 4UC4A 1YCYA 4LUDA 3CCST 4M7AE 3OYHA 4PJMA 2J05A 2DL8A 4JRKA 2NWMA 2RHXA 1NLPC 4J9EA 4E47A 4OB2B 3G4ST 2LTOA 3V8KA 4GLKA 1KD1R 5KE2A 2RN8A 2JMAA 3QDRB 4AG1C 2JTFA 4XU3A 4M78A 1JBMA 3CCJT 3A8LB 4NOYA 2DO3A 1AWJA 1UGPB 3CCLT 3QIIA 2LCSA 2XDPA 2K6DA 4LE9A 2RHUA 2ATCB 1RLPC 1IRXA 1M2VA 1VYTA 3NMZC 3QDFA 4M7AG 1XOVA 2JS0A 1TUGB 1QKXA 2OJ2A 2YLBA 1QQJA 4PJOF 5LJ3h 4M7DB 2P4TA 3QJYA 1ZHIA 2EYZA 2KRSA 1ZUYA 2VWFA 3D7SB 4JUVA 2GF7A 1TH7A 4RTYA 1G3SA 7AT1B 2RJDA 4RCBA 2CUBA 2BZXA 1UJYA 2L89A 4EIKA 1Z9QA 1VQMT 1Q82R 2WSFE 2DIGA 4FYVB 5C0MA 1X6BA 3CPFA 2KAFA 2G6FX 3H0FA 4F7UG 1JEGA 4ESRA 1Y57A 2Y90A 4LDUA 2DTIA 2RI2A 3LX7A 2LCCA 2XDBA 1B7TA 4L6V5 1SPKA 2F5KA 3FJ5A 2M02A 3C4SA 3OYYA 2PUOB 2DEUA 3E2UA 3JB9G 1U3OA 4JS5A 3G6ET 1Q7YU 5CQXA 2PNIA 3GNFB 4C5EA 4PLLA 4JJNK 2QTXA 1QVFS 4OMPA 3TCJA 2LQ8A 2YRCA 2LRQA 3CCSQ 1ZSZC 3JSCA 1KQSP 4FW2A 3EHQA 1RAIB 2GCXA 2L3PA 1PCXA 2ZAEA 3RKWA 2VGNA 2DD4A 2M0OA 3HFOA 4Y91A 3THKA 2F2WA 3G4SQ 5LJ3d 2A36A 2KE9A 1Y07A 3EAEA 5A2QE 4LD9K 3OB9A 2ZCFB 1TUDA 4PJOD 2EYQA 4M7AB 1BB9A 3CCJQ 4C0DC 3OBWA 3EGDA 3OYCA 3CCLQ 2ZPEB 3OMGA 2L3QA 3DB3A 2EGCA 4J6WA 3TREA 2I0NA 5LJ3e 4C0FA 2J6FA 1S72T 1OZ3A 4JZ3A 3PFSA 4C8QF 2K2VA 3X28B 4F14A 2SEMA 1ZSZA 3UATA 5CKDA 4M75F 2LQWA 1GFDA 5EG2A 2YLCA 3A98A 3LH0A 3ZFJA 1A0NB 3RNJA 5ECAA 2GFAA 1VQNT 5FW9A 2K57A 3CD6T 2LT4A 2ZZDA 4OF1A 1K0XA 3VS1A 2V1QA 1D1BA 1W6XA 5L23A 2I2LA 1NJIU 1H8KA 1AHJB 2CSIA 1I5OB 3PVLA 2DKGA 4R0KA 4J9HA 2DEQA 2MF2A 2QGFB 1M1KU 3NTIA 4E7LA 4JRIA 1LNXA 3P8DA 2L0AA 1WHLA 4RKUE 3INZA 1ZA2B 4R56A 2JJ9A 3EFRA 3CCMQ 2HL5C 2WSEE 4HXJA 5I2SA 4WF2A 4E7KA 1K9MU 3WVEB 4JRPA 3HRTA 3LYIA 3UA7A 4Y28E 2P0QA 2J7IA 4HA8A 5GAMj 4XU2A 3AT1B 1WGSA 3JCMb 1WX6A 2E64A 4LUEA 2CSQA 4DOVA 2DL4A 4FIBA 4C8QD 2MI6A 3CMAT 3I5SA 3JB9H 4DEYA 4GY5A 2PVOB 2CKKA 3SB2A 2RK1A 3GPLA 4RMOA 2JUFA 5LJ5e 4HVVA 2EJFA 4M75D 1G3YA 3VS0A 5FRMA 3R6NA 3MPUB 2M0YA 2QGGA 1TG0A 1VOMA 1LJOA 3CPWP 1B34B 3EG2A 2LNHB 4FSSA 2KROA 2DPPB 3QYGB 4PJOC 1X43A 1WQ7A 4X34A 3CCLA 4ELZC 1GL5A 2HL3A 1S72Q 4OB0B 1ZQ1A 3M54A 3CC4Q 2QQBA 4GBQA 5GAOl 5CK9A 3X26B 1OULA 1FMWA 2EQJA 2CH4A 1KSWA 5FLXE 2XK0A 2LJ1A 5IXFA 1TS9A 4C0ZA 1CKAA 4ZGDB 1NJIC 3A8GB 5KYUB 4M78F 4QVCA 3OW2A 2DMOA 1Q81R 3HPWA 1MMAA 2MIOA 1VQ9Q 1VQNQ 3C12A 2K7AA 3HP9A 1UG1A 3CD6Q 3M0SA 3JCMV 3CC2A 3RKXA 2GTJA 3LH5A 3M56A 3HRUA 4KGXB 4O6JA 2AZSA 1LVKA 3NPFA 5KYNA 3QKJA 3I56T 5GAN2 2BUDA 3EGUA 1NLOC 3GNGA 1SF9A 3MHXA 2BZYA 1SEMA 1WQWA 3OYJA 2QA4A 3KFVA 1KD1U 1VQ7A 5GANe 3ASKA 4BD3A 3OW2P 2WACA 3QZ9B 5KCHA 5GAMf 3MO8A 3DKMA 1YJWT 3LW5E 3QZ5B 1OYXA 2C06A 1JJ2A 4JLIA 2E65A 3CCMA 2VYTA 2HQHA 1GBRA 5CKHA 4OB1B 2DIQA 4J9DA 3HL8A 3CC7T 1AZGB 2CP6A 1M3CA 4ZTJA 2NUPA 4RG2A 5D6XA 4BDYA 1CSKA 1UHFA 3OYAA 3SWNB 1NZ9A 1K0SA 1M4ZA 2EJGA 2QDYB 3SDZA 5CIUA 1BK2A 2DNUA 1SSFA 4M78D 2B86A 3BW1A 3VS3A 1JJ2P 1PSFA 2WSCE 2K5IA 1BU1A 3A8MB 2QI2A 3GBQA 3ULRB 2DXTA 2LCLA 1VA7A 4RTTA 1KQ1A 4C92A 4A54A 3GP8A 3CCUT 2E1HA 4AG2C 3JCMQ 4VUBA 3EFSA 3CMET 2GNCA 1WZOA 2FHDA 3RIRA 1OV3A 4ZGEB 1S72A 2YHTA 3CC4A 5GMKe 5GAMg 4A63B 4C8QE 3MEAA 1NEBA 2L3SA 3GLXA 1OOTA 4J6YA 4A4KA 1QP3A 4FT4A 3EGXA 1GCPA 1WXTA 4M75E 2MAMA 1QVPA 3QWXX 1T3SA 5HKCA 1I8FA 3OYGA 1RAEB 1JXMA 1MMNA 4EMKB 1VQ9A 1VQNA 1RI0A 3CD6A 2YT6A 1UB4A 3I56Q 2GQIA 3RKYA 3JCMf 1RI9A 4M77G 1M2OA 2ECZA 1Y96A 1JRIA 1KC8R 1SRMA 2DVEA 1YJ9T 1M90R 5GMKl 3OBYA 1W2BS 4XU1A 2CS7A 2BZ8A 1K8AR 4C8QG 3OYIA 3M57A 5CR2A 4OB3B 3VKIA 3OYLA 2SRCA 2EVRA 5L8RE 4M75G 2ZPGB 3NGPA 3EG3A 3EHRA 1KFZA 1Z9ZA 4KT0E 1VQOA 4NL2A 1YBYA 4E7JA 2KEAA 2RNAA 4OMQA 2YUPA 5GAN8 1JQQA 4C5IA 1Q82C 3H8ZA 3VRYA 3BDUA 1BI2A 2DD5A 1AWXA 2RPNA 4FU6A 5LJ3j 2DX1A 3HTRA 2HEQA 4KUIA 4IIMA 2DYIA 1V1CA 4B6MA 3V7CA 1OX8A 2RHYA 4JPBW 3JCMX 3SD4A 3MP8A
chains in the Genus database with same CATH topology
2Y90A 4PL6A 5GAOm 4LDUA 2DTIA 4XK8E 2D6FA 3J7AF 1R8OB 2RI2A 3LX7A 1U1SA 2A3LA 2LCCA 2LX9A 2XDBA 4L6V5 4JS4A 4M7DG 3JB9F 3MCAB 2X4JA 2F5KA 4E7IA 1I81A 3OYYA 3C4SA 3OSSC 2PUOB 4M77D 1VQOT 3LGFA 2VC8A 2XKOC 4M77C 3VUZA 3CPWA 3WXMB 1YHQA 1Q82U 2BKDN 2CZ7B 1UGSB 3JB9G 4EMGA 4JS5A 2X4YA 3G6ET 1Q7YU 5CQXA 3GNFB 4C5EA 4HCZA 4PLLA 3GIBA 1U1TA 4JJNK 2CYZB 2X35A 3FB9A 1KHCA 1MHNA 2V8KA 1N8RC 3G71T 2QTXA 2DZ9A 3LGLA 1QVFS 3JCMc 4OMFB 3AHUA 4BACA 2R58A 2RA2A 3TCJA 1Q86C 2LQ8A 2LRQA 1I4K1 3JSCA 4J7IA 3ER0A 5I21A 3OYDA 2LNVA 2A7YA 2GCXA 2XIDA 4M7AD 4KULA 1Y7XA 2VGNA 2KY9A 2DD4A 2M0OA 3HFOA 4M78E 1NE8A 3RKWA 3SWNA 4Y91A 1VQ8A 4XAXB 4MMLA 4A4EA 4OVAA 1O75A 4EMKC 5GANg 1V29B 1U8RA 1BI0A 1YIJA 5LJ3d 4O5VA 3OA6A 2JZ2A 2XICA 1Y07A 2R5MA 3EAEA 3MEVA 1VQ5A 1IZ6A 5A2QE 4C8QB 1VIEA 2FYKA 3QHSA 4LD9K 3M4GA 3OB9A 2ZCFB 2EIFA 1YHQT 4PJOD 3WVDB 1QP2A 3M4YA 3O8VA 4X9DA 1W2BA 2EYQA 4M7AB 2QQRA 1BIAA 4Q5WA 5FU6B 2OTLT 2EQUA 3OSVA 2XHCA 1NPPA 4C0DC 1ZBXA 4HCCA 2PVGB 3OBWA 4QQ6A 1M8VA 4M75B 3PIOA 1FWZA 1RL2A 5DLQE 3OYCA 1N8RU 2ZPEB 3OS2A 1VQ6A 1G3WA 4MZPA 2ZPBB 4M77A 3OMGA 3FJPA 3VUBA 5AYFA 3R6OA 1Q86U 3DB3A 5KCOA 3OYFA 4J6WA 2JNGA 3A8HB 3TREA 5LJ3e 5FU7B 4C0FA 4PJOB 5CAIA 1S72T 2KDSA 1OZ3A 1BI1A 1VQ4T 3PFSA 2HNIA 3M58A 4C8QF 4XU0A 1P92A 2K2VA 3CCVA 3X28B 1QW1A 1VQ8T 4M7DD 3HRSA 3PT9A 3CCEA 3FIFA 2MMPA 2JVVA 2Y4YA 1YIJT 1M1KC 4M7DC 1W4SA 2XI9A 5CKDA 4V2SA 5CCAA 2GQVA 4OP0A 2FB7A 4M75F 4HKEA 4BY6C 1XQHA 2KVQG 3X24B 1WJQA 2JTMA 3JB9D 2E41A 2RJEA 5EG2A 2YLCA 1VQPT 2O01E 3LH0A 3ZFJA 2B8AA 3L2RA 4ZTFA 3L2VA 4M7AA 4EMKA 2GFAA 3KBGA 1VQNT 5J3BA 2K57A 2DTOA 3FLGA 4PNOA 3V7RA 4HCBA 3CD6T 3OYEA 3OW2S 2LT4A 4QQGA 1YI2A 2ZZDA 4OF1A 3P8HA 2M16A 4JLGA 3JRZA 3JCMh 4A4HA 1K9MC 3HSBA 1OI1A 3MP6A 3QYHB 5GAOp 3GF5A 5D6YA 3RUXA 5GAMe 4PJOA 2I2LA 1NJIU 3RERA 4RCCA 4FL6A 2XU8A 4LDVA 2OAUA 3L2UA 4LDXA 1AHJB 3S6WA 2HBPA 2DKGA 4ATOA 1MGQA 4IURA 4JRQA 2R5AA 2QEXT 3CCVT 2RD1A 1BYMA 2JN0A 2DEQA 2MF2A 3CCET 4BI3A 1M1KU 5HK0A 3CMAA 2EFIA 3NTIA 4E7LA 1M5Q1 2L3RA 4EDUA 2PU9B 4XTYA 2V8IA 1LNXA 3P8DA 2DZCA 2LT1A 4JRIA 3UWNA 4F7UA 5FRNA 4RKUE 2QXFA 3INZA 3M53A 3OYNA 3L2WA 4R56A 3RMQA 4J83A 2RK2A 3EFRA 3OMCA 1BIBA 3QXEB 4BUGA 3OYMA 3CCRA 3CCUA 1QVFA 3CXCS 2KQWA 1X6OA 4CI0C 2WSEE 5GAMh 4M7DA 1N6AA 3NTKA 3LWHA 5I2SA 4WF2A 4IUPA 2E70A 3HHTB 4A53A 3CCQT 2ZPFB 4Z02A 4E7KA 5IT9E 1K9MU 4MMKA 3WVEB 4JRPA 3FRNA 3HRTA 2QQ9A 3LYIA 2VV5A 2O4XB 4LD6A 5CVIA 5HY6A 4KUDK 2Y4XA 4Y28E 1JJ2S 3E1SA 5LL6S 4HT9A 2P0QA 3MP1A 4IKFA 1WJRA 4TVRA 5GAN4 5LJ3g 3J81E 1VQKT 3CBOA 2FVUA 2K5FA 3C95A 4HA8A 4B9XA 3E9GA 4XTVA 1FXXA 5GAMj 2EQMA 3PMTA 4XU2A 4A4FA 1WGSA 3QUIA 3JCMb 2E64A 2RI5A 1BKBA 2CZ0B 3L2QA 3ME9A 3QSUA 4DOVA 4C92F 5GMKm 4FIBA 4C8QD 2MI6A 3Q1JA 3UPUA 4MZMA 2LDMA 3L2ZA 3QG1A 5GAOq 1QVGS 3CMAT 2RB6A 3JB9H 1H3ZA 4GY5A 2PVOB 4C8QC 2CKKA 3SB2A 2RK1A 3GPLA 4RMOA 4M77E 2MWPA 1KQSS 3JCMJ 3HKSA 2JUFA 2LC4A 1HK9A 4C92G 4IUVA 3TU4K 1X01A 4RG8A 5FU6C 2R57A 5LJ5e 4M7AC 2OTJA 2EJFA 4M75D 1G3YA 3URGA 3CCRT 3G7ZA 1I5LA 2VGMA 5FRMA 3TEEA 2IG0A 2CZ1B 2ZPHB 4M75C 3FDRA 1YITA 4M78B 1LJOA 4N4GA 3JCMd 2RH2A 1B34B 5A0DA 5CKBA 3M9QA 3QBYA 3BDLA 2ZGWA 3OS5A 1YJ9A 2DPPB 3A8OB 3L42A 3QYGB 3L1AA 5FU7C 4EPCA 5KH6A 1FX7A 3I56A 4PJOC 3MEUA 1WQ7A 4X34A 3CCLA 4ELZC 1KG1A 3JCMP 4OB0B 3FC3A 1IREB 2E6NA 2VXFA 3META 1ZQ1A 3OYKA 3PTAA 3M54A 2QQBA 4J5YA 3S3MA 2RJFA 5GAOl 5CK9A 3X26B 1GXIE 5M9OA 2BIVA 2EQJA 5FLXE 2EQKA 4L59A 2XK0A 4XQ3A 4C0ZA 5LJ5h 1Q81C 1M1GA 3HFNA 4ZGDB 1VQLA 1NJIC 4NS5A 3JAME 3A8GB 1KD1C 1D3BB 4B9WA 4M78F 3JCMe 3OY9A 3OS1A 4QVCA 1KHIA 3OW2A 5LJ3f 5C6SA 4HT8A 3JCMW 2VUBA 3HPWA 2OTJT 1UGQB 1YJWA 3FEOA 3CBPA 3C12A 5GAMd 2DXUA 2LQKA 3HP9A 4M78G 3M5AA 4KBMB 1N27A 1OZ2A 1YITT 3JCMV 5LJ5j 3OS0A 1VQ5T 4BE0A 4C8QA 3CC2A 3RKXA 5KE3A 3M56A 3HRUA 4N4HA 4O6JA 4ME7A 2D0QB 3DLMA 2K4YA 3OQ5A 3QKJA 5CKFA 3J80E 2PVDB 3I56T 1VUBA 3VYGA 3CC7A 3P8BB 2BUDA 5GAN2 4M75A 3BFMA 4F7UE 2HAXA 4BB7A 3S3OA 2K5LA 2M9UA 4DOWA 2D9TA 2DTHA 3I55A 3GOXA 3GNGA 5A0LA 3MHXA 1WQWA 3QPHA 4ZN3A 4J8OA 3SFMA 3OYJA 1Q81U 4M7DE 2QA4A 1VQLT 1G5VA 3PIPA 1BI3A 1KD1U 1G3TA 5GANe 3CXCA 2CGHA 3LLRA 1EIFA 1VQ7A 3ASKA 3BY7A 4BD3A 1M1FA 3VYHB 4C92D 2WACA 1HXDA 1UGRB 3MEWA 3QZ9B 5GAMf 5KCHA 4BE2A 3MO8A 4FT2A 2GFUA 2XG8D 4LDYA 4XTXA 3PMIA 1KC8U 1YJNA 3DKMA 2RHIA 2PUKB 1YJWT 3LW5E 2CZ6B 3QZ5B 3M55A 2G3RA 2JOYA 2K3YA 5CO7A 1OYXA 2C06A 2HD0A 4D6WA 2DXBA 1JJ2A 2HQEA 4JLIA 3CC2T 1K73C 2E65A 5D6WA 4PKCC 3QJ6A 3CCMA 2VYTA 1O9SA 4XTZA 5FROA 1UEBA 1K8AU 2EWNA 4OGEA 5GAN6 2RI3A 5CKHA 4OB1B 4C92B 5CQYA 2DIQA 3V8LA 2F5TX 3F70A 3G71A 3HL8A 3N5BB 4N4IA 2LVMA 3CC7T 2NLUA 3UDCA 2RHZA 4XTUA 3E9FA 3RMSA 4C5GA 4ZGJB 5GANh 1YI2T 3CBMA 3CMEA 4ZTJA 1QVGA 4QQDA 4MZTA 2VXEA 3X25B 4E7HA 4RG2A 5D6XA 1H641 2X4WA 5LJ5d 1WNLA 1Y71A 1KQSA 4FM4B 4BDYA 5GAN5 2QA4T 2E12A 5IAYA 1VQ7T 5J39A 3OYAA 3SWNB 1NZ9A 2RM4A 4FSXA 1M4ZA 3S3NA 3CCSA 3JCMg 3ZEHA 2EJGA 2QDYB 2KSSA 3SDZA 1JB0E 4N0AC 2RO0A 5CIUA 5GANj 1YJNT 1KQ2A 1SSFA 3ZBDA 4M78D 2K3XA 5DLOA 4L5GA 3BW1A 2EAYA 4C0GA 4MDWA 4M78C 1PSFA 2FL7A 2WSCE 4YTLA 3JB9J 2K5IA 3A8MB 1K73U 2QI2A 2OTLA 3G4SA 4C5HA 2IVWA 2DXTA 2ZPIB 5GAOn 3CCMT 5GAOr 2LCLA 1DJ7B 4MDXA 5GMKi 2XDDA 2DXCA 3DLLA 1KQ1A 4C92A 4A54A 3GP8A 2P0PA 2DK3A 2E1HA 2QQAA 1VIFA 3CCUT 1X75C 2E10A 5DY9A 2YRVA 1Y96B 3JCMQ 4DQ2A 4M77B 5LJ5f 4VUBA 3EFSA 3CCJA 3CMET 2FHDA 3RIRA 4A4GA 4ZGEB 1XTDA 1S72A 2O4XA 2L5QA 4XTWA 2YHTA 3CPWS 1VQ4A 3CC4A 2RJCA 5GMKe 5GAMg 1N9RA 4UC4A 4C8QE 3MEAA 2DAQA 3GLXA 4JDSA 1YCYA 3CCST 4J6YA 4A4KA 1QP3A 3OYHA 4M7AE 4FT4A 1PSEA 4PLIA 4M75E 1M9SA 2MAMA 1QVPA 2RHXA 4JRKA 3C94A 3VJPA 4IUTA 5CKEA 2EKOA 4LDWA 5HKCA 1VQPA 1I8FA 4II1A 4M77F 4E47A 3OYGA 4OB2B 3G4ST 3KUFA 1VQ9A 4EMKB 4ELYC 2E5QA 3PGGA 1VQNA 4NL3A 3V8JA 1RI0A 3NFCA 2LTOA 3V8KA 4QVDA 1KC8C 3CD6A 4GLKA 4N0AA 4J7FA 3KXTA 1UB4A 1VQ6T 5KE2A 3VU3C 4PJOE 3RKYA 3JCMf 3E19A 3QDRB 4M77G 4BI4A 1M90C 2E6ZA 1Y96A 2JTFA 4XU3A 5GANd 1JRIA 2DJZA 4M78A 5GMKh 1NPRA 4BE1A 1JBMA 5J26A 3CCJT 3T9NA 1B34A 1WJSA 3A8LB 4NOYA 4BI8B 2DO3A 4IUUA 2DVEA 2XD0A 1K8AC 1YJ9T 4C0DB 1UGPB 4QW2A 1VQMA 5GMKl 3M59A 1N9SA 3CC4T 3CCLT 3OBYA 2PQWA 4XU1A 3X20B 4ZN1A 1W2BS 3QIIA 5DM7R 2CS7A 2QEXA 3QO3A 2KK4A 2XDPA 2P0KA 4X9CA 2RHUA 4M7AF 3UT1A 2AHJB 5GMKj 4C8QG 2HQXA 2F69A 5IN1A 4F7UB 3OYIA 4EMHA 3M57A 5CR2A 2EJ9A 4OB3B 3JB9I 1XNIA 1D3BA 4M7AG 1XOVA 3VKIA 4BDZA 4IUQA 3OYLA 3OYBA 1WPYA 3CEYA 2YLBA 1VQ9T 5L8RE 4R55A 3H6ZA 2V8JA 4M75G 3RESA 4P5NA 4PJOF 2ZPGB 4C92C 2MWOA 5LJ3h 1LOJA 2P4TA 3QJYA 1ZHIA 5GANf 4M7DB 4KT0E 5LJ5g 2M1HA 1YBYA 4NL2A 5I2MA 3CCQA 4E7JA 1VQOA 1M90U 3VV0A 4BY6B 4JUVA 4CRIA 5GAN3 5GAN8 2GF7A 1TH7A 2QQSA 4C5IA 1G3SA 1Q82C 4PJOG 2RJDA 3H8ZA 3G6EA 4RCBA 5HK3A 1Q7YC 2H3JA 3V7SA 3DB4A 4J6XA 4DA4A 2L89A 1VQMT 3BDUA 1BI2A 1VQKA 2DD5A 4QVZA 2KMTA 4FU6A 2WSFE 4F7UF 5GAN7 3SWNC 5LJ3j 3PNWC 4OGCA 3A5ZB 2DIGA 5A0GA 3LWIA 4KUIA 5C0MA 2L8DA 3CPFA 3I55T 3V7CA 3NTHA 2KAFA 4C92E 2RHYA 4F7UG 2X4XA 3JCMX 4M7DF 3SD4A 3MP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3B B;  2E10 A;  5DY9 A;  1Y96 B;  2Y90 A;  4DQ2 A;  3JCM Q;  2DTI A;  4M77 B;  4M78 F;  5LJ5 f;  3JCM e;  5GAO m;  3JCM h;  3EFS A;  4QVC A;  3HSB A;  1U1S A;  5LJ3 f;  5GAO p;  4HT8 A;  3JCM W;  3RIR A;  4M7D G;  3RUX A;  5GAN d;  3JB9 F;  5GAM e;  4PJO A;  2I2L A;  4XTW A;  5GAM d;  2YHT A;  3RER A;  1I81 A;  2DXU A;  4RCC A;  4M77 D;  4M78 G;  5GMK e;  5GAM g;  3JCM V;  1N9R A;  5LJ5 j;  4C8Q E;  2VC8 A;  2DKG A;  4M77 C;  3RKX A;  4C8Q A;  1MGQ A;  3JB9 G;  2RD1 A;  1YCY A;  4EMG A;  2JN0 A;  4J6Y A;  4M7A E;  2DEQ A;  3GIB A;  1U1T A;  1M5Q 1;  3FB9 A;  5GAN 2;  4M75 E;  4M75 A;  3BFM A;  4JRI A;  1LNX A;  4XTY A;  2DZC A;  2DZ9 A;  2QTX A;  4JRK A;  4F7U A;  3JCM c;  4F7U E;  3INZ A;  1I8F A;  4M77 F;  2DTH A;  3AHU A;  2RA2 A;  4EMK B;  3EFR A;  3PGG A;  1BIB A;  4NL3 A;  3V8J A;  3V8K A;  4QVD A;  1I4K 1;  1WQW A;  5I21 A;  4N0A A;  4PJO E;  3VU3 C;  5GAM h;  4M7D A;  4M7D E;  3RKY A;  3JCM f;  4M77 G;  4WF2 A;  5GAN e;  2CGH A;  4M7A D;  4A53 A;  3RKW A;  1Y96 A;  3BY7 A;  4XU3 A;  3HFO A;  1JRI A;  2DJZ A;  4M78 E;  4M78 A;  3SWN A;  4Y91 A;  4C92 D;  5GMK h;  1HXD A;  1JBM A;  4MMK A;  4MML A;  5GAM f;  1B34 A;  4NOY A;  4EMK C;  5GAN g;  4XTX A;  2DVE A;  5LJ3 d;  4HT9 A;  5GMK l;  1N9S A;  5GAN 4;  5LJ3 g;  4XU1 A;  4C8Q B;  2FYK A;  3QHS A;  4HA8 A;  3M4G A;  4XTV A;  4JLI A;  5GAM j;  3QO3 A;  2E65 A;  4XU2 A;  4PJO D;  4X9D A;  3QUI A;  4XTZ A;  3JCM b;  4M7A B;  2E64 A;  4X9C A;  4M7A F;  1BIA A;  3QSU A;  2EWN A;  5GAN 6;  5GMK j;  4C92 F;  4C92 B;  5GMK m;  4C8Q D;  4C8Q G;  3V8L A;  5GAO q;  3L2Z A;  1M8V A;  4M75 B;  2RB6 A;  4F7U B;  3JB9 H;  4EMH A;  4C8Q C;  2EJ9 A;  3JB9 I;  4M7A G;  1D3B A;  4XTU A;  3SB2 A;  5GAN h;  4PJO B;  4M77 E;  1WPY A;  4M77 A;  3FJP A;  3JCM J;  1HK9 A;  4C92 G;  4M7A C;  2YLB A;  1X01 A;  2VXE A;  5LJ5 e;  4J6W A;  2EJF A;  4M75 G;  4M75 D;  1H64 1;  4PJO F;  3RES A;  4C92 C;  1WNL A;  5LJ3 e;  5LJ3 h;  5LJ5 d;  1LOJ A;  5CAI A;  5GAN f;  1I5L A;  4M7D B;  4M75 C;  5GAN 5;  5LJ5 g;  4NL2 A;  2HNI A;  4M78 B;  3SWN B;  4JUV A;  4C8Q F;  1LJO A;  4XU0 A;  2RM4 A;  5GAN 3;  3JCM d;  5GAN 8;  1TH7 A;  1B34 B;  4PJO G;  4RCB A;  4M7D D;  3JCM g;  2EJG A;  2ZGW A;  3FIF A;  3V7S A;  4N0A C;  5GAN j;  4PJO C;  3L1A A;  4J6X A;  1KQ2 A;  4M7D C;  1WQ7 A;  4M78 D;  4V2S A;  3BDU A;  3JCM P;  3BW1 A;  4OP0 A;  2EAY A;  2FB7 A;  4M75 F;  2VXF A;  4F7U F;  5GAN 7;  4M78 C;  3SWN C;  5LJ3 j;  3JB9 J;  4J5Y A;  3JB9 D;  5GAO l;  2E41 A;  2YLC A;  2DXT A;  5GAO n;  4M7A A;  5GAO r;  3V7C A;  4XQ3 A;  4EMK A;  5GMK i;  4C92 E;  1KQ1 A;  4C92 A;  4A54 A;  5LJ5 h;  4F7U G;  3HFN A;  2E1H A;  2DTO A;  2K57 A;  4PNO A;  3V7R A;  3JCM X;  4M7D F; 
#chains in the Genus database with same CATH topology
 3CXC P;  1WIE A;  1R0C B;  1U1S A;  2LX9 A;  2ED0 A;  4M7D G;  1QWF A;  2X4J A;  2P4R A;  3CCU Q;  2CT4 A;  1WFW A;  3LGF A;  2KGT A;  3WXM B;  2CZ7 B;  2DL7 A;  1UGS B;  3VS4 A;  3CME Q;  4JJD A;  1WA7 A;  4HCZ A;  3GIB A;  3REA B;  1KHC A;  2D8J A;  1MHN A;  4OMF B;  1WHM A;  1D09 B;  1T0J A;  2OAW A;  3OYD A;  5I21 A;  4M78 E;  1NE8 A;  1VQ8 A;  2D8H A;  4A4E A;  1U8R A;  2EBP A;  2XIC A;  2R5M A;  1NG2 A;  3MEV A;  1IZ6 A;  4C8Q B;  1YHQ T;  3O8V A;  2HSE B;  1M27 C;  1VYU A;  2XHC A;  1YJ9 Q;  4QQ6 A;  4M75 B;  2QAZ A;  2JTE A;  3OS2 A;  4MZP A;  2AKK A;  5AYF A;  2VB6 A;  3EG9 A;  2JNG A;  2J06 A;  1YWO A;  5CAI A;  1BI1 A;  1WYX A;  2QK0 A;  4DEX A;  5EC7 A;  4QKU A;  5HCK A;  3PT9 A;  3FIF A;  1YIJ T;  5D7U A;  1HYO A;  3U23 A;  1H92 A;  5CCA A;  4BY6 C;  2KVQ G;  1Y0M A;  2V1R A;  2CP7 A;  2X9H A;  2E41 A;  2RJE A;  4M7A A;  1PG5 B;  2FZC B;  2KRN A;  1RAG B;  4IIO A;  3OYE A;  4QQG A;  3EH2 A;  2M16 A;  3MP6 A;  5GAO p;  1AWW A;  3GF5 A;  5D6Y A;  4E2F B;  2O9V A;  3RER A;  4RCC A;  4FL6 A;  4LDX A;  1NYG A;  3S6W A;  2HBP A;  4ATO A;  2RQU A;  2R5A A;  3CCV T;  2RD1 A;  1UEC A;  3CCE T;  5IHI A;  1M5Q 1;  2L3R A;  1YJN Q;  6AT1 B;  4F7U A;  3UWN A;  1WHH A;  4KGZ B;  2KT8 A;  2H8H A;  3RMQ A;  3OMC A;  3OYM A;  3CCU A;  1QVF A;  3CCR A;  2YXY A;  1X6O A;  4ORZ A;  3TSZ A;  2DE0 X;  3HHT B;  1E7O A;  4MMK A;  5HY6 A;  2O4X B;  3H41 A;  4LD6 A;  4KUD K;  2L2P A;  1K76 A;  3E1S A;  1D1A A;  5LJ3 g;  1VQK T;  3CBO A;  2FVU A;  4RTW A;  2EQM A;  4A4F A;  2RI5 A;  2CZ0 B;  3L2Q A;  2YSQ A;  1QCF A;  4C92 F;  2DET A;  3UPU A;  1H3Z A;  2LDM A;  3QG1 A;  4RTU A;  2F2X A;  1KQS S;  1X01 A;  5FU6 C;  1TXQ A;  3G7Z A;  1I5L A;  1MV0 B;  4OML A;  5I22 A;  1PWT A;  1UE9 A;  2LZ6 B;  4M78 B;  1RAH B;  2RH2 A;  5A0D A;  1QMC A;  3BDL A;  2ZGW A;  1YJ9 A;  5FU7 C;  2K2M A;  5KH6 A;  1IRE B;  2E6N A;  2DYB A;  5KYY A;  2GGR A;  2E3I A;  1K9A A;  2FPE A;  4XQ3 A;  4FYY B;  5LJ5 h;  1M2V B;  1Q81 C;  1M1G A;  3HFN A;  1W70 A;  3JAM E;  1QLY A;  3OY9 A;  2W10 A;  8ATC B;  2OTJ T;  2O88 A;  3FEO A;  2DXU A;  1TUC A;  1TOV A;  2AK5 A;  1OZ2 A;  1YIT T;  1VQ5 T;  4BE0 A;  2DVJ A;  2CT3 A;  1HJD A;  5FWB A;  3DLM A;  3OQ5 A;  3L2U A;  1F1B B;  1ZSG A;  1VQM Q;  4BB7 A;  3S3O A;  4KH0 B;  2HAX A;  2M9U A;  3GOX A;  3CCV Q;  5KYX A;  4HVW A;  3QPH A;  4OMN A;  4ZN3 A;  1WDX A;  1VQL T;  2CGH A;  3LLR A;  1EFN A;  2KXD A;  4C92 D;  1HXD A;  1UGR B;  4FW1 A;  2EGA A;  2GFU A;  2XG8 D;  3C0C A;  4XTX A;  3PMI A;  1KC8 U;  4DBQ A;  1YJN A;  2D0N A;  2HKN A;  2RHI A;  2PUK B;  2JOY A;  3RBB B;  2HD0 A;  2DRM A;  5D6W A;  4AFS C;  2IPO B;  1UEB A;  1D1C A;  1MV3 A;  2EWN A;  1K8A U;  2RI3 A;  3G6E Q;  2MYS A;  5CQY A;  2CUD A;  2F5T X;  1K73 R;  2NLU A;  3UDC A;  1VQK Q;  4ZGJ B;  5GAN h;  3CBM A;  1QCN A;  4QQD A;  2VXE A;  3X25 B;  2FPF A;  2NUT A;  3ZL7 C;  5LJ5 d;  1WNL A;  1K4U S;  3VRZ A;  4Z8A A;  2E12 A;  2RM4 A;  4FSX A;  3S3N A;  3CCS A;  2C0T A;  2KSS A;  1JB0 E;  2QYZ A;  4F17 A;  1KQ2 A;  2PZ1 A;  2EAY A;  2FL7 A;  3VS6 A;  4YTL A;  2FZG B;  5IHK A;  3G4S A;  1MMD A;  5GAO n;  1PRL C;  1DJ7 B;  4MDX A;  5GMK i;  3DLL A;  2DK3 A;  3EGD B;  1X75 C;  2E10 A;  2EYW A;  4ZNX A;  3CCJ A;  2ABL A;  2KYB A;  2LJ3 A;  2L5Q A;  3EFO B;  4XTW A;  1PC0 A;  3CPW S;  2DBK A;  2LQN A;  2BTT A;  2FPD A;  1N9R A;  2D1X A;  1ZSZ B;  2OTJ Q;  1PSE A;  1OQK A;  2IIM A;  1M9S A;  3VJP A;  1XJW B;  3C94 A;  4IUT A;  5CKE A;  4JJC A;  1YIT Q;  4LDW A;  1VQ5 Q;  3KUF A;  1M3B A;  2E5Q A;  3PGG A;  2KRM A;  4JJB A;  3NFC A;  1KC8 C;  4PJO E;  3KXT A;  1VQ6 T;  1RLQ C;  3E19 A;  5IXB A;  4BI4 A;  1M90 C;  4PFP A;  5GAN d;  2DJZ A;  5GMK h;  1NPR A;  4J9C A;  1WJS A;  2P84 A;  2XD0 A;  1K8A C;  1PNJ A;  4C0D B;  1TSF A;  1VQM A;  4QW2 A;  1AZE A;  3M59 A;  2PQW A;  4ZN1 A;  2E3H A;  3MJX A;  4RUG A;  1OU9 A;  4KRT A;  3IQL A;  4M7A F;  4J9I A;  2AHJ B;  2CP5 A;  1X2Q A;  2HQX A;  4RTV A;  4EMH A;  2EJ9 A;  1PM3 A;  1XNI A;  1D3B A;  3SEM A;  2YWW A;  3OYB A;  1RAA B;  2GBQ A;  4R55 A;  3H6Z A;  2V8J A;  4P5N A;  4C92 C;  2HCK A;  1LOJ A;  4AFU C;  2LP5 A;  1MUZ A;  2Z0W A;  5I2M A;  3VV0 A;  5GAN 3;  3G1J A;  4PJO G;  3H0H A;  3G6E A;  5HK3 A;  2KNB B;  2H3J A;  3DB4 A;  1M8M A;  1VQK A;  1ZBJ A;  1TU0 B;  3BE3 A;  4F7U F;  1SKU B;  5GAN 7;  4OGC A;  3A5Z B;  5A0G A;  2KYM A;  2L8D A;  1Q95 G;  1PHT A;  4C92 E;  3QWY A;  2X4X A;  4CC7 A;  3JV3 A;  3CMA Q;  2J6K A;  4PL6 A;  5GAO m;  2D6F A;  2DL5 A;  3J7A F;  1R8O B;  4RTZ A;  4JS4 A;  1UHC A;  3JB9 F;  1ARK A;  2ESW A;  1TTH B;  1G8X A;  1I81 A;  3OSS C;  4M77 C;  3VUZ A;  1Q82 U;  2BKD N;  2X4Y A;  1C0M A;  1NM7 A;  1U1T A;  2CYZ B;  2DIL A;  3FB9 A;  4LNP A;  2QAS A;  2V8K A;  1N8R C;  3G71 T;  1AD5 A;  2E4H A;  4D8K A;  2R58 A;  1HD3 A;  3M0Q A;  3UF4 A;  1Q86 C;  4J7I A;  2EYY A;  2CP3 A;  2XID A;  4M7A D;  4KUL A;  2KY9 A;  1UTI A;  4MML A;  4OVA A;  1O75 A;  2RQV A;  1V29 B;  2JZ2 A;  4Z89 A;  1T0H A;  2AKL A;  1S1N A;  1VQ5 A;  4HVU A;  1VIE A;  2FYK A;  3QHS A;  1ZA1 B;  2DL3 A;  3M4Y A;  4X9D A;  1W2B A;  2QQR A;  1BIA A;  4Q5W A;  2OTL T;  2EQU A;  1GBQ A;  1GFC A;  3OSV A;  2FRY A;  2YRD A;  1ZBX A;  4HCK A;  3M0U A;  2DRK A;  1IHW A;  3EH1 A;  1G3W A;  1IB8 A;  2FO0 A;  4M77 A;  1I1J A;  1IHV A;  3R6O A;  3OYF A;  4PJO B;  4ANJ A;  1IGQ A;  1OU8 A;  2HNI A;  1WHG A;  1P92 A;  1QW1 A;  1UDL A;  3HRS A;  1X2K A;  2JVV A;  2Y4Y A;  2DLP A;  4M7D C;  1W4S A;  2XI9 A;  1YJW Q;  4HKE A;  1XQH A;  4LXC A;  3X24 B;  1WJQ A;  2JTM A;  3JB9 D;  2M51 A;  1W2B P;  1VQP T;  2O01 E;  3L2R A;  2B8A A;  5KYW B;  4PNO A;  3FLG A;  4HCB A;  1HSQ A;  2LJ0 A;  3CC7 Q;  3JCM h;  1YP5 A;  2ROL A;  5GAM e;  1AOJ A;  3EG0 A;  2XU8 A;  3H9N A;  1CKB A;  4IUR A;  4CC4 B;  2QEX T;  2C0O A;  2X51 A;  4BI3 A;  1AVZ C;  5HK0 A;  3CMA A;  2YUQ A;  1G83 A;  3MKD A;  1I07 A;  3OYN A;  4PFO A;  3L2W A;  4J83 A;  2RK2 A;  1BIB A;  4BUG A;  1C6V X;  2JW4 A;  3CXC S;  2KQW A;  4CI0 C;  4M7D A;  1N6A A;  2YUO A;  2FEI A;  3LWH A;  4IUP A;  1AT1 B;  2E70 A;  3CCQ T;  3G71 Q;  3I5R A;  3FRN A;  4D8D A;  1WLP B;  4FYW B;  2Y4X A;  1LPL A;  2A37 A;  5LL6 S;  4HT9 A;  3MP1 A;  1WJR A;  5GAN 4;  2K5F A;  4B9X A;  3E9G A;  3PMT A;  3QUI A;  1BKB A;  3QSU A;  3EGX B;  5GMK m;  3Q1J A;  1QVG S;  5GAO q;  1R0B G;  1N8R R;  2RB6 A;  1Q86 R;  3JCM J;  3HKS A;  2LC4 A;  1HK9 A;  4PFZ A;  4M7A C;  4RG8 A;  2R57 A;  3URG A;  2OTL Q;  3EG1 A;  2VGM A;  3TEE A;  1SG5 A;  2IG0 A;  2CZ1 B;  4N4G A;  3JCM d;  2YUN A;  2DFU A;  1ACM B;  1U5S A;  3M9Q A;  1IXD A;  3L1A A;  3I56 A;  3MEU A;  3JCM P;  2VXF A;  3MET A;  3OYK A;  4J9F A;  3S3M A;  2BIV A;  4L59 A;  2MK5 A;  1BCO A;  4B9W A;  2NUZ A;  2JS2 A;  3JCM e;  3OS1 A;  1KHI A;  5LJ3 f;  2AZV A;  4HT8 A;  1VQP Q;  1YJW A;  4E7S A;  1LCK A;  2LQK A;  4M78 G;  3M5A A;  4KBM B;  5LJ5 j;  4N4H A;  4F04 B;  2JMC A;  4GLM A;  4PK4 A;  3M0R A;  2D0Q B;  5CKF A;  3CC7 A;  3VYG A;  3P8B B;  3BFM A;  4F7U E;  4DOW A;  2OX7 A;  2D9T A;  2DTH A;  2QEX Q;  2HZY A;  3VS7 A;  1Q81 U;  3SFM A;  1GCQ A;  3PIP A;  1G3T A;  2DA9 A;  2YDL A;  1M1F A;  3VYH B;  4FT2 A;  2RQW A;  2CZ6 B;  3I9Q A;  3M55 A;  1AEY A;  1YFN A;  2DXB A;  3TSW A;  2HQE A;  3CCQ Q;  3CC2 T;  1K73 C;  1QCO A;  4PKC C;  4XTZ A;  1O9S A;  5FRO A;  4OMM A;  1OPK A;  4OGE A;  3F70 A;  2GTO A;  3G71 A;  4F16 A;  4AFZ C;  4XTU A;  4C5G A;  1YI2 T;  3CME A;  1SHG A;  1RUW A;  4MZT A;  4E7H A;  5FWC A;  1KQS A;  1T3L A;  2EYX A;  1YWP A;  5GAN 5;  2DF6 A;  4AT1 B;  2QA4 T;  1MMG A;  1VQ7 T;  2KR3 A;  3ZEH A;  4N0A C;  5GAN j;  3ZBD A;  5DLO A;  4L5G A;  4MDW A;  1E6H A;  3JB9 J;  2OTL A;  4C5H A;  2IVW A;  3CCM T;  1YHQ Q;  2VVK A;  1QVF P;  3UA6 A;  1RAB B;  1VIF A;  2YRV A;  4DQ2 A;  5LJ5 f;  2LMJ A;  3EG9 B;  2COZ A;  3NHN A;  2DM1 A;  2RJC A;  1QKW A;  1YCS B;  2DAQ A;  2C0I A;  4JDS A;  3M0T A;  1OX9 A;  2CP2 A;  4JZ4 A;  4Z88 A;  2A0F B;  1MND A;  1YIJ Q;  4PLI A;  2H3E B;  2ED1 A;  2EKO A;  3RDV A;  1VQP A;  4II1 A;  4M77 F;  2O2O A;  4ELY C;  4NL3 A;  3V8J A;  4QVD A;  2XMF A;  3O5Z A;  4N0A A;  4J7F A;  3VU3 C;  2HDA A;  2CP0 A;  2KXC A;  1G2B A;  2COY A;  2HKQ B;  2E6Z A;  4BE1 A;  5J26 A;  3T9N A;  1B34 A;  4BI8 B;  4QT7 A;  4IUU A;  1ZLM A;  3EFO A;  1N9S A;  3CC4 T;  2JM8 A;  3X20 B;  2RQT A;  4FCY A;  5DM7 R;  2QEX A;  4DBH A;  3H0I A;  3QO3 A;  2DER A;  2KK4 A;  2P0K A;  4X9C A;  3UT1 A;  2V26 A;  5GMK j;  1KIK A;  3CCE Q;  3SHW A;  2F69 A;  5IN1 A;  4F7U B;  3JB9 I;  5KYU A;  1UFF A;  2CDT A;  2KT1 A;  4IUQ A;  4BDZ A;  1WPY A;  3CEY A;  3CC2 Q;  1VQ9 T;  3RES A;  2MWO A;  5GAN f;  1ZUU A;  4LN2 A;  5LJ5 g;  2M1H A;  3CCQ A;  4OMO A;  2K9G A;  1M90 U;  4BY6 B;  2CH4 W;  4KGV B;  4CRI A;  2F2V A;  2QQS A;  1YI2 Q;  1JXO A;  3TQ7 P;  1Q7Y C;  1X27 A;  3V7S A;  4J6X A;  4DA4 A;  2EKH A;  4QVZ A;  2KMT A;  2QA4 Q;  3SWN C;  3PNW C;  1VQ7 Q;  1W1F A;  2EQI A;  3LWI A;  2X3X D;  3I55 T;  3NTH A;  4M7D F;  4XK8 E;  1UGV A;  2A3L A;  1X6G A;  1OPL A;  2DJQ A;  3MCA B;  4E7I A;  4M77 D;  1PD1 A;  1VQO T;  2EW3 A;  1K1Z A;  2VC8 A;  2XKO C;  1YHQ A;  3CPW A;  2VKN A;  4EMG A;  4J9B A;  2DBM A;  2O9S A;  1B3Q A;  2X35 A;  1UJ0 A;  2DZ9 A;  3LGL A;  5KYY B;  3JCM c;  1PKT A;  3CQT A;  2QDL A;  3AHU A;  4BAC A;  2RA2 A;  5IH2 A;  1FMV A;  1I4K 1;  3ER0 A;  1SHF A;  2AIR B;  2LNV A;  2A7Y A;  1RAF B;  1Y7X A;  3VS2 A;  3SWN A;  1I0C A;  4XAX B;  4EMK C;  5GAN g;  1BI0 A;  1YIJ A;  2BE7 D;  4O5V A;  3OA6 A;  2QTV A;  1YN8 A;  2HMA A;  4FYX B;  4PJJ A;  5I11 A;  3M4G A;  2A28 A;  2EIF A;  1C1A A;  2EGE A;  1QP2 A;  3WVD B;  1J3T A;  1WI7 A;  5FU6 B;  1ZUK A;  4M4Z A;  1NPP A;  4HCC A;  1V76 A;  2PVG B;  1M8V A;  3PIO A;  1N5Z A;  4E7Z A;  1FWZ A;  1RL2 A;  5DLQ E;  1N8R U;  2MCN A;  2ZPB B;  3FJP A;  3VUB A;  5KYX B;  1Q86 U;  5KCO A;  1H3H A;  3A8H B;  5FU7 B;  4PJN A;  1EX4 A;  2KDS A;  1VQ4 T;  2LX7 A;  1VQL Q;  3M58 A;  4XU0 A;  3CCV A;  1VQ8 T;  4M7D D;  4DBF A;  3CCE A;  2MMP A;  1M1K C;  2FZK B;  4V2S A;  2GQV A;  4OP0 A;  2FB7 A;  1NYF A;  1ZX6 A;  3A1P A;  1UUE A;  3RR6 A;  1VYV A;  4ZTF A;  3L2V A;  4AMC A;  1MNE A;  4EMK A;  3KBG A;  2FRW A;  5J3B A;  2DTO A;  3V7R A;  3OW2 S;  2MOX A;  1YI2 A;  3P8H A;  4JLG A;  3JRZ A;  4A4H A;  2KI7 A;  1K9M C;  3HSB A;  1OI1 A;  2NUT B;  3QYH B;  3RUX A;  3I55 Q;  4PJO A;  4LDV A;  2OAU A;  4AFQ C;  1MGQ A;  4JRQ A;  1Q7Y R;  2OI3 A;  1BYM A;  2JN0 A;  2EFI A;  1KK7 A;  4EDU A;  1ABQ A;  2PU9 B;  4XTY A;  2V8I A;  2DZC A;  2LT1 A;  1VQO Q;  5FRN A;  2PTK A;  1RAD B;  2QXF A;  3M53 A;  2ENM A;  5GJV B;  2CRE A;  3QXE B;  4WCI A;  2RQR A;  1PKS A;  3REB B;  5KYW A;  5GAM h;  3NTK A;  1FMK A;  1TWB A;  4A53 A;  2ZPF B;  4Z02 A;  5IT9 E;  2COW A;  2QQ9 A;  2VV5 A;  5CVI A;  1JJ2 S;  4E6R A;  1JU5 C;  4IKF A;  4TVR A;  3J81 E;  2FG0 A;  2RF0 A;  3C95 A;  4XTV A;  1FXX A;  4Y92 A;  2ROT A;  3ME9 A;  4MZM A;  3L2Z A;  4C8Q C;  1U06 A;  4M77 E;  2MWP A;  3TU4 K;  4C92 G;  4IUV A;  2OTJ A;  3CCR T;  4M75 C;  2ZPH B;  1WHK A;  3FDR A;  1YIT A;  1VQ6 Q;  2E5K A;  5CKB A;  3QBY A;  3OS5 A;  2HSP A;  3A8O B;  3L42 A;  4EPC A;  1FX7 A;  1KG1 A;  3FC3 A;  2EPD A;  3PTA A;  1VQ4 Q;  1RAC B;  4J5Y A;  2RJF A;  1WHJ A;  1GXI E;  5M9O A;  1VQ8 Q;  2EQK A;  4CC3 A;  1VQL A;  1M3A A;  2JT4 A;  1KJW A;  4NS5 A;  1KD1 C;  1D3B B;  1D0Y A;  1BCM A;  5C6S A;  3JCM W;  3VS5 A;  1X69 A;  2VUB A;  1NJI R;  1UGQ B;  1WXB A;  2NYS A;  3CBP A;  5GAM d;  4KH1 B;  1SRL A;  1N27 A;  3OS0 A;  4C8Q A;  2W0Z A;  5KE3 A;  2JXB A;  1M1K R;  4PJL A;  4ME7 A;  2RMO A;  2JM9 A;  3J80 E;  2K4Y A;  2PVD B;  1VUB A;  8AT1 B;  4M75 A;  1IGU A;  4WTO B;  2K5L A;  2K3B A;  3I55 A;  2NUP B;  2KBT A;  5A0L A;  2X3W D;  4J8O A;  4M7D E;  3I35 A;  1G5V A;  1BI3 A;  3M0P A;  3CXC A;  1EIF A;  1K9M R;  3BY7 A;  2QG9 B;  1EZZ B;  3MEW A;  4BE2 A;  1GRI A;  1QWE A;  4LDY A;  1BBZ A;  9ATC B;  2A08 A;  5IHN A;  1D0X A;  5CO7 A;  2G3R A;  2MPX C;  2K3Y A;  1NBE B;  4D6W A;  2F1L A;  1B07 A;  1OEB A;  3QJ6 A;  1PRM C;  2J6O A;  5GJW B;  5GAN 6;  4C92 B;  3V8L A;  5AT1 B;  3N5B B;  4N4I A;  2LVM A;  2RHZ A;  3RMS A;  3E9F A;  1QVG A;  1AWO A;  1M30 A;  3PE0 A;  2AT1 B;  1PD0 A;  1H64 1;  2X4W A;  1Y71 A;  4FM4 B;  1JO8 A;  4J9G A;  5IAY A;  1YNZ A;  5J39 A;  1FYN A;  4RTX A;  3TVT A;  2O31 A;  3JCM g;  1D0Z A;  2BE9 B;  1E6G A;  2RO0 A;  1R77 A;  1YJN T;  3CCR Q;  4K11 A;  2K3X A;  4C0G A;  4M78 C;  1K73 U;  1ABO A;  4X1V A;  2ZPI B;  5GAO r;  3PVQ A;  2XDD A;  2DXC A;  1VQ6 A;  2P0P A;  2QQA A;  2K79 A;  5DY9 A;  1NEG A;  2VAS A;  1Y96 B;  1QVG P;  4M77 B;  1SSH A;  1IO6 A;  4CC2 A;  4A4G A;  1XTD A;  2O4X A;  2HBW A;  1GCQ C;  1VQ4 A;  4DBR A;  1WXU A;  4UC4 A;  1YCY A;  4LUD A;  3CCS T;  4M7A E;  3OYH A;  4PJM A;  2J05 A;  2DL8 A;  4JRK A;  2NWM A;  2RHX A;  1NLP C;  4J9E A;  4E47 A;  4OB2 B;  3G4S T;  2LTO A;  3V8K A;  4GLK A;  1KD1 R;  5KE2 A;  2RN8 A;  2JMA A;  3QDR B;  4AG1 C;  2JTF A;  4XU3 A;  4M78 A;  1JBM A;  3CCJ T;  3A8L B;  4NOY A;  2DO3 A;  1AWJ A;  1UGP B;  3CCL T;  3QII A;  2LCS A;  2XDP A;  2K6D A;  4LE9 A;  2RHU A;  2ATC B;  1RLP C;  1IRX A;  1M2V A;  1VYT A;  3NMZ C;  3QDF A;  4M7A G;  1XOV A;  2JS0 A;  1TUG B;  1QKX A;  2OJ2 A;  2YLB A;  1QQJ A;  4PJO F;  5LJ3 h;  4M7D B;  2P4T A;  3QJY A;  1ZHI A;  2EYZ A;  2KRS A;  1ZUY A;  2VWF A;  3D7S B;  4JUV A;  2GF7 A;  1TH7 A;  4RTY A;  1G3S A;  7AT1 B;  2RJD A;  4RCB A;  2CUB A;  2BZX A;  1UJY A;  2L89 A;  4EIK A;  1Z9Q A;  1VQM T;  1Q82 R;  2WSF E;  2DIG A;  4FYV B;  5C0M A;  1X6B A;  3CPF A;  2KAF A;  2G6F X;  3H0F A;  4F7U G;  1JEG A;  4ESR A;  1Y57 A;  2Y90 A;  4LDU A;  2DTI A;  2RI2 A;  3LX7 A;  2LCC A;  2XDB A;  1B7T A;  4L6V 5;  1SPK A;  2F5K A;  3FJ5 A;  2M02 A;  3C4S A;  3OYY A;  2PUO B;  2DEU A;  3E2U A;  3JB9 G;  1U3O A;  4JS5 A;  3G6E T;  1Q7Y U;  5CQX A;  2PNI A;  3GNF B;  4C5E A;  4PLL A;  4JJN K;  2QTX A;  1QVF S;  4OMP A;  3TCJ A;  2LQ8 A;  2YRC A;  2LRQ A;  3CCS Q;  1ZSZ C;  3JSC A;  1KQS P;  4FW2 A;  3EHQ A;  1RAI B;  2GCX A;  2L3P A;  1PCX A;  2ZAE A;  3RKW A;  2VGN A;  2DD4 A;  2M0O A;  3HFO A;  4Y91 A;  3THK A;  2F2W A;  3G4S Q;  5LJ3 d;  2A36 A;  2KE9 A;  1Y07 A;  3EAE A;  5A2Q E;  4LD9 K;  3OB9 A;  2ZCF B;  1TUD A;  4PJO D;  2EYQ A;  4M7A B;  1BB9 A;  3CCJ Q;  4C0D C;  3OBW A;  3EGD A;  3OYC A;  3CCL Q;  2ZPE B;  3OMG A;  2L3Q A;  3DB3 A;  2EGC A;  4J6W A;  3TRE A;  2I0N A;  5LJ3 e;  4C0F A;  2J6F A;  1S72 T;  1OZ3 A;  4JZ3 A;  3PFS A;  4C8Q F;  2K2V A;  3X28 B;  4F14 A;  2SEM A;  1ZSZ A;  3UAT A;  5CKD A;  4M75 F;  2LQW A;  1GFD A;  5EG2 A;  2YLC A;  3A98 A;  3LH0 A;  3ZFJ A;  1A0N B;  3RNJ A;  5ECA A;  2GFA A;  1VQN T;  5FW9 A;  2K57 A;  3CD6 T;  2LT4 A;  2ZZD A;  4OF1 A;  1K0X A;  3VS1 A;  2V1Q A;  1D1B A;  1W6X A;  5L23 A;  2I2L A;  1NJI U;  1H8K A;  1AHJ B;  2CSI A;  1I5O B;  3PVL A;  2DKG A;  4R0K A;  4J9H A;  2DEQ A;  2MF2 A;  2QGF B;  1M1K U;  3NTI A;  4E7L A;  4JRI A;  1LNX A;  3P8D A;  2L0A A;  1WHL A;  4RKU E;  3INZ A;  1ZA2 B;  4R56 A;  2JJ9 A;  3EFR A;  3CCM Q;  2HL5 C;  2WSE E;  4HXJ A;  5I2S A;  4WF2 A;  4E7K A;  1K9M U;  3WVE B;  4JRP A;  3HRT A;  3LYI A;  3UA7 A;  4Y28 E;  2P0Q A;  2J7I A;  4HA8 A;  5GAM j;  4XU2 A;  3AT1 B;  1WGS A;  3JCM b;  1WX6 A;  2E64 A;  4LUE A;  2CSQ A;  4DOV A;  2DL4 A;  4FIB A;  4C8Q D;  2MI6 A;  3CMA T;  3I5S A;  3JB9 H;  4DEY A;  4GY5 A;  2PVO B;  2CKK A;  3SB2 A;  2RK1 A;  3GPL A;  4RMO A;  2JUF A;  5LJ5 e;  4HVV A;  2EJF A;  4M75 D;  1G3Y A;  3VS0 A;  5FRM A;  3R6N A;  3MPU B;  2M0Y A;  2QGG A;  1TG0 A;  1VOM A;  1LJO A;  3CPW P;  1B34 B;  3EG2 A;  2LNH B;  4FSS A;  2KRO A;  2DPP B;  3QYG B;  4PJO C;  1X43 A;  1WQ7 A;  4X34 A;  3CCL A;  4ELZ C;  1GL5 A;  2HL3 A;  1S72 Q;  4OB0 B;  1ZQ1 A;  3M54 A;  3CC4 Q;  2QQB A;  4GBQ A;  5GAO l;  5CK9 A;  3X26 B;  1OUL A;  1FMW A;  2EQJ A;  2CH4 A;  1KSW A;  5FLX E;  2XK0 A;  2LJ1 A;  5IXF A;  1TS9 A;  4C0Z A;  1CKA A;  4ZGD B;  1NJI C;  3A8G B;  5KYU B;  4M78 F;  4QVC A;  3OW2 A;  2DMO A;  1Q81 R;  3HPW A;  1MMA A;  2MIO A;  1VQ9 Q;  1VQN Q;  3C12 A;  2K7A A;  3HP9 A;  1UG1 A;  3CD6 Q;  3M0S A;  3JCM V;  3CC2 A;  3RKX A;  2GTJ A;  3LH5 A;  3M56 A;  3HRU A;  4KGX B;  4O6J A;  2AZS A;  1LVK A;  3NPF A;  5KYN A;  3QKJ A;  3I56 T;  5GAN 2;  2BUD A;  3EGU A;  1NLO C;  3GNG A;  1SF9 A;  3MHX A;  2BZY A;  1SEM A;  1WQW A;  3OYJ A;  2QA4 A;  3KFV A;  1KD1 U;  1VQ7 A;  5GAN e;  3ASK A;  4BD3 A;  3OW2 P;  2WAC A;  3QZ9 B;  5KCH A;  5GAM f;  3MO8 A;  3DKM A;  1YJW T;  3LW5 E;  3QZ5 B;  1OYX A;  2C06 A;  1JJ2 A;  4JLI A;  2E65 A;  3CCM A;  2VYT A;  2HQH A;  1GBR A;  5CKH A;  4OB1 B;  2DIQ A;  4J9D A;  3HL8 A;  3CC7 T;  1AZG B;  2CP6 A;  1M3C A;  4ZTJ A;  2NUP A;  4RG2 A;  5D6X A;  4BDY A;  1CSK A;  1UHF A;  3OYA A;  3SWN B;  1NZ9 A;  1K0S A;  1M4Z A;  2EJG A;  2QDY B;  3SDZ A;  5CIU A;  1BK2 A;  2DNU A;  1SSF A;  4M78 D;  2B86 A;  3BW1 A;  3VS3 A;  1JJ2 P;  1PSF A;  2WSC E;  2K5I A;  1BU1 A;  3A8M B;  2QI2 A;  3GBQ A;  3ULR B;  2DXT A;  2LCL A;  1VA7 A;  4RTT A;  1KQ1 A;  4C92 A;  4A54 A;  3GP8 A;  3CCU T;  2E1H A;  4AG2 C;  3JCM Q;  4VUB A;  3EFS A;  3CME T;  2GNC A;  1WZO A;  2FHD A;  3RIR A;  1OV3 A;  4ZGE B;  1S72 A;  2YHT A;  3CC4 A;  5GMK e;  5GAM g;  4A63 B;  4C8Q E;  3MEA A;  1NEB A;  2L3S A;  3GLX A;  1OOT A;  4J6Y A;  4A4K A;  1QP3 A;  4FT4 A;  3EGX A;  1GCP A;  1WXT A;  4M75 E;  2MAM A;  1QVP A;  3QWX X;  1T3S A;  5HKC A;  1I8F A;  3OYG A;  1RAE B;  1JXM A;  1MMN A;  4EMK B;  1VQ9 A;  1VQN A;  1RI0 A;  3CD6 A;  2YT6 A;  1UB4 A;  3I56 Q;  2GQI A;  3RKY A;  3JCM f;  1RI9 A;  4M77 G;  1M2O A;  2ECZ A;  1Y96 A;  1JRI A;  1KC8 R;  1SRM A;  2DVE A;  1YJ9 T;  1M90 R;  5GMK l;  3OBY A;  1W2B S;  4XU1 A;  2CS7 A;  2BZ8 A;  1K8A R;  4C8Q G;  3OYI A;  3M57 A;  5CR2 A;  4OB3 B;  3VKI A;  3OYL A;  2SRC A;  2EVR A;  5L8R E;  4M75 G;  2ZPG B;  3NGP A;  3EG3 A;  3EHR A;  1KFZ A;  1Z9Z A;  4KT0 E;  1VQO A;  4NL2 A;  1YBY A;  4E7J A;  2KEA A;  2RNA A;  4OMQ A;  2YUP A;  5GAN 8;  1JQQ A;  4C5I A;  1Q82 C;  3H8Z A;  3VRY A;  3BDU A;  1BI2 A;  2DD5 A;  1AWX A;  2RPN A;  4FU6 A;  5LJ3 j;  2DX1 A;  3HTR A;  2HEQ A;  4KUI A;  4IIM A;  2DYI A;  1V1C A;  4B6M A;  3V7C A;  1OX8 A;  2RHY A;  4JPB W;  3JCM X;  3SD4 A;  3MP8 A; 
#chains in the Genus database with same CATH homology
 2Y90 A;  4PL6 A;  5GAO m;  4LDU A;  2DTI A;  4XK8 E;  2D6F A;  3J7A F;  1R8O B;  2RI2 A;  3LX7 A;  1U1S A;  2A3L A;  2LCC A;  2LX9 A;  2XDB A;  4L6V 5;  4JS4 A;  4M7D G;  3JB9 F;  3MCA B;  2X4J A;  2F5K A;  4E7I A;  1I81 A;  3OYY A;  3C4S A;  3OSS C;  2PUO B;  4M77 D;  1VQO T;  3LGF A;  2VC8 A;  2XKO C;  4M77 C;  3VUZ A;  3CPW A;  3WXM B;  1YHQ A;  1Q82 U;  2BKD N;  2CZ7 B;  1UGS B;  3JB9 G;  4EMG A;  4JS5 A;  2X4Y A;  3G6E T;  1Q7Y U;  5CQX A;  3GNF B;  4C5E A;  4HCZ A;  4PLL A;  3GIB A;  1U1T A;  4JJN K;  2CYZ B;  2X35 A;  3FB9 A;  1KHC A;  1MHN A;  2V8K A;  1N8R C;  3G71 T;  2QTX A;  2DZ9 A;  3LGL A;  1QVF S;  3JCM c;  4OMF B;  3AHU A;  4BAC A;  2R58 A;  2RA2 A;  3TCJ A;  1Q86 C;  2LQ8 A;  2LRQ A;  1I4K 1;  3JSC A;  4J7I A;  3ER0 A;  5I21 A;  3OYD A;  2LNV A;  2A7Y A;  2GCX A;  2XID A;  4M7A D;  4KUL A;  1Y7X A;  2VGN A;  2KY9 A;  2DD4 A;  2M0O A;  3HFO A;  4M78 E;  1NE8 A;  3RKW A;  3SWN A;  4Y91 A;  1VQ8 A;  4XAX B;  4MML A;  4A4E A;  4OVA A;  1O75 A;  4EMK C;  5GAN g;  1V29 B;  1U8R A;  1BI0 A;  1YIJ A;  5LJ3 d;  4O5V A;  3OA6 A;  2JZ2 A;  2XIC A;  1Y07 A;  2R5M A;  3EAE A;  3MEV A;  1VQ5 A;  1IZ6 A;  5A2Q E;  4C8Q B;  1VIE A;  2FYK A;  3QHS A;  4LD9 K;  3M4G A;  3OB9 A;  2ZCF B;  2EIF A;  1YHQ T;  4PJO D;  3WVD B;  1QP2 A;  3M4Y A;  3O8V A;  4X9D A;  1W2B A;  2EYQ A;  4M7A B;  2QQR A;  1BIA A;  4Q5W A;  5FU6 B;  2OTL T;  2EQU A;  3OSV A;  2XHC A;  1NPP A;  4C0D C;  1ZBX A;  4HCC A;  2PVG B;  3OBW A;  4QQ6 A;  1M8V A;  4M75 B;  3PIO A;  1FWZ A;  1RL2 A;  5DLQ E;  3OYC A;  1N8R U;  2ZPE B;  3OS2 A;  1VQ6 A;  1G3W A;  4MZP A;  2ZPB B;  4M77 A;  3OMG A;  3FJP A;  3VUB A;  5AYF A;  3R6O A;  1Q86 U;  3DB3 A;  5KCO A;  3OYF A;  4J6W A;  2JNG A;  3A8H B;  3TRE A;  5LJ3 e;  5FU7 B;  4C0F A;  4PJO B;  5CAI A;  1S72 T;  2KDS A;  1OZ3 A;  1BI1 A;  1VQ4 T;  3PFS A;  2HNI A;  3M58 A;  4C8Q F;  4XU0 A;  1P92 A;  2K2V A;  3CCV A;  3X28 B;  1QW1 A;  1VQ8 T;  4M7D D;  3HRS A;  3PT9 A;  3CCE A;  3FIF A;  2MMP A;  2JVV A;  2Y4Y A;  1YIJ T;  1M1K C;  4M7D C;  1W4S A;  2XI9 A;  5CKD A;  4V2S A;  5CCA A;  2GQV A;  4OP0 A;  2FB7 A;  4M75 F;  4HKE A;  4BY6 C;  1XQH A;  2KVQ G;  3X24 B;  1WJQ A;  2JTM A;  3JB9 D;  2E41 A;  2RJE A;  5EG2 A;  2YLC A;  1VQP T;  2O01 E;  3LH0 A;  3ZFJ A;  2B8A A;  3L2R A;  4ZTF A;  3L2V A;  4M7A A;  4EMK A;  2GFA A;  3KBG A;  1VQN T;  5J3B A;  2K57 A;  2DTO A;  3FLG A;  4PNO A;  3V7R A;  4HCB A;  3CD6 T;  3OYE A;  3OW2 S;  2LT4 A;  4QQG A;  1YI2 A;  2ZZD A;  4OF1 A;  3P8H A;  2M16 A;  4JLG A;  3JRZ A;  3JCM h;  4A4H A;  1K9M C;  3HSB A;  1OI1 A;  3MP6 A;  3QYH B;  5GAO p;  3GF5 A;  5D6Y A;  3RUX A;  5GAM e;  4PJO A;  2I2L A;  1NJI U;  3RER A;  4RCC A;  4FL6 A;  2XU8 A;  4LDV A;  2OAU A;  3L2U A;  4LDX A;  1AHJ B;  3S6W A;  2HBP A;  2DKG A;  4ATO A;  1MGQ A;  4IUR A;  4JRQ A;  2R5A A;  2QEX T;  3CCV T;  2RD1 A;  1BYM A;  2JN0 A;  2DEQ A;  2MF2 A;  3CCE T;  4BI3 A;  1M1K U;  5HK0 A;  3CMA A;  2EFI A;  3NTI A;  4E7L A;  1M5Q 1;  2L3R A;  4EDU A;  2PU9 B;  4XTY A;  2V8I A;  1LNX A;  3P8D A;  2DZC A;  2LT1 A;  4JRI A;  3UWN A;  4F7U A;  5FRN A;  4RKU E;  2QXF A;  3INZ A;  3M53 A;  3OYN A;  3L2W A;  4R56 A;  3RMQ A;  4J83 A;  2RK2 A;  3EFR A;  3OMC A;  1BIB A;  3QXE B;  4BUG A;  3OYM A;  3CCR A;  3CCU A;  1QVF A;  3CXC S;  2KQW A;  1X6O A;  4CI0 C;  2WSE E;  5GAM h;  4M7D A;  1N6A A;  3NTK A;  3LWH A;  5I2S A;  4WF2 A;  4IUP A;  2E70 A;  3HHT B;  4A53 A;  3CCQ T;  2ZPF B;  4Z02 A;  4E7K A;  5IT9 E;  1K9M U;  4MMK A;  3WVE B;  4JRP A;  3FRN A;  3HRT A;  2QQ9 A;  3LYI A;  2VV5 A;  2O4X B;  4LD6 A;  5CVI A;  5HY6 A;  4KUD K;  2Y4X A;  4Y28 E;  1JJ2 S;  3E1S A;  5LL6 S;  4HT9 A;  2P0Q A;  3MP1 A;  4IKF A;  1WJR A;  4TVR A;  5GAN 4;  5LJ3 g;  3J81 E;  1VQK T;  3CBO A;  2FVU A;  2K5F A;  3C95 A;  4HA8 A;  4B9X A;  3E9G A;  4XTV A;  1FXX A;  5GAM j;  2EQM A;  3PMT A;  4XU2 A;  4A4F A;  1WGS A;  3QUI A;  3JCM b;  2E64 A;  2RI5 A;  1BKB A;  2CZ0 B;  3L2Q A;  3ME9 A;  3QSU A;  4DOV A;  4C92 F;  5GMK m;  4FIB A;  4C8Q D;  2MI6 A;  3Q1J A;  3UPU A;  4MZM A;  2LDM A;  3L2Z A;  3QG1 A;  5GAO q;  1QVG S;  3CMA T;  2RB6 A;  3JB9 H;  1H3Z A;  4GY5 A;  2PVO B;  4C8Q C;  2CKK A;  3SB2 A;  2RK1 A;  3GPL A;  4RMO A;  4M77 E;  2MWP A;  1KQS S;  3JCM J;  3HKS A;  2JUF A;  2LC4 A;  1HK9 A;  4C92 G;  4IUV A;  3TU4 K;  1X01 A;  4RG8 A;  5FU6 C;  2R57 A;  5LJ5 e;  4M7A C;  2OTJ A;  2EJF A;  4M75 D;  1G3Y A;  3URG A;  3CCR T;  3G7Z A;  1I5L A;  2VGM A;  5FRM A;  3TEE A;  2IG0 A;  2CZ1 B;  2ZPH B;  4M75 C;  3FDR A;  1YIT A;  4M78 B;  1LJO A;  4N4G A;  3JCM d;  2RH2 A;  1B34 B;  5A0D A;  5CKB A;  3M9Q A;  3QBY A;  3BDL A;  2ZGW A;  3OS5 A;  1YJ9 A;  2DPP B;  3A8O B;  3L42 A;  3QYG B;  3L1A A;  5FU7 C;  4EPC A;  5KH6 A;  1FX7 A;  3I56 A;  4PJO C;  3MEU A;  1WQ7 A;  4X34 A;  3CCL A;  4ELZ C;  1KG1 A;  3JCM P;  4OB0 B;  3FC3 A;  1IRE B;  2E6N A;  2VXF A;  3MET A;  1ZQ1 A;  3OYK A;  3PTA A;  3M54 A;  2QQB A;  4J5Y A;  3S3M A;  2RJF A;  5GAO l;  5CK9 A;  3X26 B;  1GXI E;  5M9O A;  2BIV A;  2EQJ A;  5FLX E;  2EQK A;  4L59 A;  2XK0 A;  4XQ3 A;  4C0Z A;  5LJ5 h;  1Q81 C;  1M1G A;  3HFN A;  4ZGD B;  1VQL A;  1NJI C;  4NS5 A;  3JAM E;  3A8G B;  1KD1 C;  1D3B B;  4B9W A;  4M78 F;  3JCM e;  3OY9 A;  3OS1 A;  4QVC A;  1KHI A;  3OW2 A;  5LJ3 f;  5C6S A;  4HT8 A;  3JCM W;  2VUB A;  3HPW A;  2OTJ T;  1UGQ B;  1YJW A;  3FEO A;  3CBP A;  3C12 A;  5GAM d;  2DXU A;  2LQK A;  3HP9 A;  4M78 G;  3M5A A;  4KBM B;  1N27 A;  1OZ2 A;  1YIT T;  3JCM V;  5LJ5 j;  3OS0 A;  1VQ5 T;  4BE0 A;  4C8Q A;  3CC2 A;  3RKX A;  5KE3 A;  3M56 A;  3HRU A;  4N4H A;  4O6J A;  4ME7 A;  2D0Q B;  3DLM A;  2K4Y A;  3OQ5 A;  3QKJ A;  5CKF A;  3J80 E;  2PVD B;  3I56 T;  1VUB A;  3VYG A;  3CC7 A;  3P8B B;  2BUD A;  5GAN 2;  4M75 A;  3BFM A;  4F7U E;  2HAX A;  4BB7 A;  3S3O A;  2K5L A;  2M9U A;  4DOW A;  2D9T A;  2DTH A;  3I55 A;  3GOX A;  3GNG A;  5A0L A;  3MHX A;  1WQW A;  3QPH A;  4ZN3 A;  4J8O A;  3SFM A;  3OYJ A;  1Q81 U;  4M7D E;  2QA4 A;  1VQL T;  1G5V A;  3PIP A;  1BI3 A;  1KD1 U;  1G3T A;  5GAN e;  3CXC A;  2CGH A;  3LLR A;  1EIF A;  1VQ7 A;  3ASK A;  3BY7 A;  4BD3 A;  1M1F A;  3VYH B;  4C92 D;  2WAC A;  1HXD A;  1UGR B;  3MEW A;  3QZ9 B;  5GAM f;  5KCH A;  4BE2 A;  3MO8 A;  4FT2 A;  2GFU A;  2XG8 D;  4LDY A;  4XTX A;  3PMI A;  1KC8 U;  1YJN A;  3DKM A;  2RHI A;  2PUK B;  1YJW T;  3LW5 E;  2CZ6 B;  3QZ5 B;  3M55 A;  2G3R A;  2JOY A;  2K3Y A;  5CO7 A;  1OYX A;  2C06 A;  2HD0 A;  4D6W A;  2DXB A;  1JJ2 A;  2HQE A;  4JLI A;  3CC2 T;  1K73 C;  2E65 A;  5D6W A;  4PKC C;  3QJ6 A;  3CCM A;  2VYT A;  1O9S A;  4XTZ A;  5FRO A;  1UEB A;  1K8A U;  2EWN A;  4OGE A;  5GAN 6;  2RI3 A;  5CKH A;  4OB1 B;  4C92 B;  5CQY A;  2DIQ A;  3V8L A;  2F5T X;  3F70 A;  3G71 A;  3HL8 A;  3N5B B;  4N4I A;  2LVM A;  3CC7 T;  2NLU A;  3UDC A;  2RHZ A;  4XTU A;  3E9F A;  3RMS A;  4C5G A;  4ZGJ B;  5GAN h;  1YI2 T;  3CBM A;  3CME A;  4ZTJ A;  1QVG A;  4QQD A;  4MZT A;  2VXE A;  3X25 B;  4E7H A;  4RG2 A;  5D6X A;  1H64 1;  2X4W A;  5LJ5 d;  1WNL A;  1Y71 A;  1KQS A;  4FM4 B;  4BDY A;  5GAN 5;  2QA4 T;  2E12 A;  5IAY A;  1VQ7 T;  5J39 A;  3OYA A;  3SWN B;  1NZ9 A;  2RM4 A;  4FSX A;  1M4Z A;  3S3N A;  3CCS A;  3JCM g;  3ZEH A;  2EJG A;  2QDY B;  2KSS A;  3SDZ A;  1JB0 E;  4N0A C;  2RO0 A;  5CIU A;  5GAN j;  1YJN T;  1KQ2 A;  1SSF A;  3ZBD A;  4M78 D;  2K3X A;  5DLO A;  4L5G A;  3BW1 A;  2EAY A;  4C0G A;  4MDW A;  4M78 C;  1PSF A;  2FL7 A;  2WSC E;  4YTL A;  3JB9 J;  2K5I A;  3A8M B;  1K73 U;  2QI2 A;  2OTL A;  3G4S A;  4C5H A;  2IVW A;  2DXT A;  2ZPI B;  5GAO n;  3CCM T;  5GAO r;  2LCL A;  1DJ7 B;  4MDX A;  5GMK i;  2XDD A;  2DXC A;  3DLL A;  1KQ1 A;  4C92 A;  4A54 A;  3GP8 A;  2P0P A;  2DK3 A;  2E1H A;  2QQA A;  1VIF A;  3CCU T;  1X75 C;  2E10 A;  5DY9 A;  2YRV A;  1Y96 B;  3JCM Q;  4DQ2 A;  4M77 B;  5LJ5 f;  4VUB A;  3EFS A;  3CCJ A;  3CME T;  2FHD A;  3RIR A;  4A4G A;  4ZGE B;  1XTD A;  1S72 A;  2O4X A;  2L5Q A;  4XTW A;  2YHT A;  3CPW S;  1VQ4 A;  3CC4 A;  2RJC A;  5GMK e;  5GAM g;  1N9R A;  4UC4 A;  4C8Q E;  3MEA A;  2DAQ A;  3GLX A;  4JDS A;  1YCY A;  3CCS T;  4J6Y A;  4A4K A;  1QP3 A;  3OYH A;  4M7A E;  4FT4 A;  1PSE A;  4PLI A;  4M75 E;  1M9S A;  2MAM A;  1QVP A;  2RHX A;  4JRK A;  3C94 A;  3VJP A;  4IUT A;  5CKE A;  2EKO A;  4LDW A;  5HKC A;  1VQP A;  1I8F A;  4II1 A;  4M77 F;  4E47 A;  3OYG A;  4OB2 B;  3G4S T;  3KUF A;  1VQ9 A;  4EMK B;  4ELY C;  2E5Q A;  3PGG A;  1VQN A;  4NL3 A;  3V8J A;  1RI0 A;  3NFC A;  2LTO A;  3V8K A;  4QVD A;  1KC8 C;  3CD6 A;  4GLK A;  4N0A A;  4J7F A;  3KXT A;  1UB4 A;  1VQ6 T;  5KE2 A;  3VU3 C;  4PJO E;  3RKY A;  3JCM f;  3E19 A;  3QDR B;  4M77 G;  4BI4 A;  1M90 C;  2E6Z A;  1Y96 A;  2JTF A;  4XU3 A;  5GAN d;  1JRI A;  2DJZ A;  4M78 A;  5GMK h;  1NPR A;  4BE1 A;  1JBM A;  5J26 A;  3CCJ T;  3T9N A;  1B34 A;  1WJS A;  3A8L B;  4NOY A;  4BI8 B;  2DO3 A;  4IUU A;  2DVE A;  2XD0 A;  1K8A C;  1YJ9 T;  4C0D B;  1UGP B;  4QW2 A;  1VQM A;  5GMK l;  3M59 A;  1N9S A;  3CC4 T;  3CCL T;  3OBY A;  2PQW A;  4XU1 A;  3X20 B;  4ZN1 A;  1W2B S;  3QII A;  5DM7 R;  2CS7 A;  2QEX A;  3QO3 A;  2KK4 A;  2XDP A;  2P0K A;  4X9C A;  2RHU A;  4M7A F;  3UT1 A;  2AHJ B;  5GMK j;  4C8Q G;  2HQX A;  2F69 A;  5IN1 A;  4F7U B;  3OYI A;  4EMH A;  3M57 A;  5CR2 A;  2EJ9 A;  4OB3 B;  3JB9 I;  1XNI A;  1D3B A;  4M7A G;  1XOV A;  3VKI A;  4BDZ A;  4IUQ A;  3OYL A;  3OYB A;  1WPY A;  3CEY A;  2YLB A;  1VQ9 T;  5L8R E;  4R55 A;  3H6Z A;  2V8J A;  4M75 G;  3RES A;  4P5N A;  4PJO F;  2ZPG B;  4C92 C;  2MWO A;  5LJ3 h;  1LOJ A;  2P4T A;  3QJY A;  1ZHI A;  5GAN f;  4M7D B;  4KT0 E;  5LJ5 g;  2M1H A;  1YBY A;  4NL2 A;  5I2M A;  3CCQ A;  4E7J A;  1VQO A;  1M90 U;  3VV0 A;  4BY6 B;  4JUV A;  4CRI A;  5GAN 3;  5GAN 8;  2GF7 A;  1TH7 A;  2QQS A;  4C5I A;  1G3S A;  1Q82 C;  4PJO G;  2RJD A;  3H8Z A;  3G6E A;  4RCB A;  5HK3 A;  1Q7Y C;  2H3J A;  3V7S A;  3DB4 A;  4J6X A;  4DA4 A;  2L89 A;  1VQM T;  3BDU A;  1BI2 A;  1VQK A;  2DD5 A;  4QVZ A;  2KMT A;  4FU6 A;  2WSF E;  4F7U F;  5GAN 7;  3SWN C;  5LJ3 j;  3PNW C;  4OGC A;  3A5Z B;  2DIG A;  5A0G A;  3LWI A;  4KUI A;  5C0M A;  2L8D A;  3CPF A;  3I55 T;  3V7C A;  3NTH A;  2KAF A;  4C92 E;  2RHY A;  4F7U G;  2X4X A;  3JCM X;  4M7D F;  3SD4 A;  3MP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...