4N0AC

Crystal structure of lsm2-3-pat1c complex from saccharomyces cerevisiae
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
86
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDESVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVMTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm3
publication title Lsm2 and Lsm3 bridge the interaction of the Lsm1-7 complex with Pat1 for decapping activation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 19
structure length 86
sequence length 93
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n0aC00
4PJOB 4PJOD 4M77B 2E64A 4M77D 4XU1A 4C8QC 3RERA 4XTUA 4PJOE 4M77E 2DJZA 4XU2A 1JBMA 2EAYA 4X9CA 4QVCA 5LJ5d 5GMKh 2HNIA 2E1HA 4J6WA 3FJPA 1HK9A 1H641 4C8QB 4EMHA 4C8QD 1U1TA 4JRKA 5LJ5f 1KQ2A 4JRIA 4M75G 4C8QE 4XTYA 3JCMd 1X01A 1D3BB 2EJFA 1BIAA 2DXUA 1WPYA 4RCCA 5GAN2 4N0AA 3PGGA 5GMKl 4XQ3A 3RKWA 5GMKe 2E10A 1MGQA 4C92A 5LJ3h 3SWNB 3RKYA 1M8VA 4NL3A 5GMKj 3JCMX 4XTVA 4C92C 5GAMd 3JB9J 1YCYA 3RUXA 3L1AA 5GAN6 3JCMQ 4M7DD 4M7DB 3FIFA 4M7DE 4PNOA 5GAMf 5GAOn 4A54A 4F7UF 4XU0A 2CGHA 4M7AA 3RIRA 1BIBA 4JUVA 4M78G 2FB7A 2YLCA 5LJ3e 3QO3A 2DZ9A 2E65A 5LJ5g 4M7DG 3V8LA 3SB2A 2EJ9A 5GAOm 3EFRA 3JB9F 5LJ3j 4PJOG 5GAN7 4V2SA 4M77G 4HT9A 5GAOp 3RESA 3JCMg 3AHUA 3QSUA 4M75A 3JB9H 3GIBA 3JCMf 5GANd 4Y91A 4J6YA 4C8QG 1Y96A 2FYKA 5GANf 3FB9A 4RCBA 4XTXA 3BFMA 4C92F 2JN0A 5LJ5e 4N0AC 3HSBA 4JLIA 2DTOA 3HFOA 4XTWA 3JCMP 3V8KA 3V7CA 5GAMg 1B34A 3QUIA 4EMKA 5LJ5j 5GAN5 3BY7A 5CAIA 3M4GA 4MMKA 3JCMV 4C92B 2YHTA 4C92D 5I21A 1U1SA 1I5LA 4C92E 4QVDA 5GMKm 4M7AF 3V8JA 2DXTA 3INZA 4M78A 2VC8A 4M7AC 3BW1A 4M7DA 5LJ5h 5LJ3d 3V7RA 4F7UB 5GAN8 5GAOr 4F7UE 1I8FA 1M5Q1 4PJOA 5GAMe 4M7AB 4M7AD 1I81A 4M75F 4M77A 2YLBA 2EWNA 3JCMh 2I2LA 4M7AE 1N9SA 5GANg 4DQ2A 1WQ7A 5GAOq 3JB9D 3L2ZA 2DTIA 2ZGWA 4M75C 4F7UG 2K57A 5GAMj 4C8QA 2VXEA 4J5YA 4NL2A 4A53A 4HT8A 2DVEA 1JRIA 4NOYA 4XTZA 3HFNA 1D3BA 4M75B 4M75D 4WF2A 1WQWA 2EJGA 4M75E 2RA2A 4J6XA 4EMGA 3BDUA 2RB6A 3JB9G 1Y96B 2DTHA 3JCMe 1LJOA 2VXFA 5DY9A 4X9DA 4XU3A 5GAMh 5GAN3 3JCMW 3V7SA 3SWNA 5GANe 1N9RA 4EMKC 1WNLA 3JCMJ 5GAN4 2Y90A 4MMLA 2DEQA 4M78F 2DKGA 2DZCA 3SWNC 1B34B 2QTXA 4EMKB 5GANj 4M7DF 4C92G 3JB9I 5LJ3g 1I4K1 3JCMb 2RM4A 4HA8A 4M78C 5LJ3f 1HXDA 3JCMc 4M7DC 4PJOF 5GAOl 3VU3C 4M77F 3RKXA 1TH7A 1LOJA 1LNXA 4OP0A 2E41A 4M78B 1KQ1A 4M78D 4PJOC 5GANh 3EFSA 4M78E 4M77C 2RD1A 3QHSA 4C8QF 4F7UA 4M7AG 5GMKi
chains in the Genus database with same CATH superfamily
4M77E 2A28A 3CCRT 1PRMC 2SRCA 2HNIA 2HL3A 4C0GA 4LUEA 3M58A 3JV3A 3CCST 4LDVA 2PVOB 3NTKA 1PM3A 2K2MA 3H0HA 3PGGA 4OB0B 4C92A 1M8VA 2AKKA 3M59A 2JUFA 2JM9A 4M7DE 2EPDA 4OMNA 3CCRA 3OS5A 4RUGA 1VQNQ 2D8HA 1CSKA 2LZ6B 3CCSA 3UT1A 4HCCA 3I55T 5GAOp 2DM1A 4QVZA 1FMKA 1BB9A 1RUWA 1K8AU 4LDYA 4FYYB 2RI3A 5GANf 2K2VA 5FROA 4AFZC 5HK3A 4FM4B 4BACA 2HMAA 1FWZA 2O9SA 4KBMB 4KT0E 2O4XA 2CP7A 2CP5A 4AFUC 3L2WA 3MEAA 3G4ST 3M4GA 5I21A 1UJYA 4M7AF 4PJJA 3V8JA 3CCRQ 4M78A 4M7AC 1KG1A 4F7UE 3CCQA 1RAFB 5CKBA 1ZBJA 3CCSQ 1N9SA 4BY6B 4II1A 1NYFA 1K0SA 2CT3A 2R5AA 2YDLA 3G4SA 1AWJA 2RHUA 2KYMA 1JQQA 4HVWA 2GCXA 1KK7A 1WHHA 2AHJB 2KRNA 2K9GA 3M0TA 4M7DF 4LE9A 4FYXB 1XTDA 2EQKA 1YJWA 3E2UA 4M7DC 1ZLMA 4N4IA 3CCQQ 1LNXA 2E41A 2E3IA 1ZUKA 2EYXA 2RD1A 1ACMB 2KT8A 3VS7A 3J80E 1YJ9A 4A4HA 1YJNA 3VS1A 6AT1B 2EAYA 1SRLA 2EYQA 1FMWA 3G4SQ 2DRKA 1HD3A 2RNAA 3X20B 1TTHB 1PKTA 4J7FA 2NYSA 1QKWA 4RTZA 4BUGA 3OYKA 4KGVB 4GY5A 1VA7A 2DAQA 2KXDA 1D1CA 4EIKA 3S3OA 3PNWC 1KC8U 2L3SA 1YJWQ 2E4HA 5ECAA 2CSIA 4IUTA 1XQHA 5GAN6 3QZ5B 4F7UF 4D6WA 1I5OB 3OYEA 5I11A 1X43A 3EFRA 1M8MA 3HL8A 1YJNQ 4LD9K 4F16A 3CCMA 1O75A 2CP6A 2FG0A 4J9IA 2DFUA 4RCBA 2XI9A 2FZGB 2DTOA 4K11A 1B34A 3EGUA 2MK5A 2BZXA 1UFFA 3VS5A 1YCSB 2JOYA 1VQKA 2RQRA 3EH1A 4ZNXA 1QVFS 2E5QA 2QG9B 1BI1A 2PNIA 1RLQC 3CCMQ 4DQ2A 2DTIA 2EFIA 2L3RA 5I22A 1MMGA 9ATCB 2LTOA 3JCMW 2GFAA 2QDLA 1I0CA 2RHZA 1WNLA 2LCCA 4MDWA 2LQNA 2MPXC 3JB9I 1VQKQ 2GQIA 4Y92A 2XK0A 2KYBA 3TU4K 5GANh 2JJ9A 1KFZA 1PNJA 2CP2A 1IREB 5CQXA 3MEUA 2HSPA 3GPLA 2ZPHB 1TU0B 2DEUA 3HRTA 3HKSA 1WPYA 4JJDA 3OYFA 1A0NB 2F5TX 2CDTA 5GMKe 2ED0A 2LX9A 2V1RA 1SEMA 4PLLA 1LCKA 4OB2B 2EKOA 3H8ZA 1Q86C 2ATCB 2LNVA 1Y7XA 2KT1A 5LJ3e 2KI7A 4FW1A 1GXIE 2AZVA 1GFCA 2HZYA 4A4FA 1IXDA 2CH4W 4HT9A 3SFMA 3M9QA 2K5LA 2BUDA 2KSSA 1AWXA 2X4YA 3MP1A 1N6AA 1XOVA 2RK2A 2CZ6B 1R0BG 4XTXA 1KHCA 1NM7A 2EYZA 1VQLA 2AZSA 2ZPBB 5LJ5e 2LJ1A 2RPNA 4KUDK 1ZSZB 1WXBA 2QAZA 3P8BB 1VQ8T 2RF0A 5HKCA 5CKFA 2R5MA 1W70A 3C94A 2QEXT 3J7AF 4QT7A 4PKCC 3RNJA 4FT2A 2QTVA 4ESRA 2I0NA 2I2LA 1OX8A 2FZKB 3A8MB 3FRNA 4E6RA 2K57A 1RAIB 5KH6A 3GOXA 1PSFA 4HXJA 5C6SA 1WFWA 1WX6A 4M75B 3A8LB 1VQLQ 4EMGA 3TSWA 1XJWB 1VQ8A 1ZUYA 2KAFA 3FEOA 1TXQA 3M0UA 3NHNA 3JRZA 2E5KA 1N8RU 3C4SA 2YUPA 1X6BA 3OMGA 2RQTA 2LQ8A 2RM4A 5KYUB 2QK0A 3OY9A 3ZEHA 4ZN3A 2DO3A 4KGZB 1K8AC 3G71T 4PJOD 3SDZA 1T3LA 1EFNA 1V1CA 5CCAA 3NTHA 4BE0A 4KRTA 2PZ1A 4C8QD 2RN8A 1VQ8Q 1NE8A 1KJWA 4ATOA 1Q7YU 2WSFE 4PFPA 3MEVA 3PIPA 1WHGA 2XMFA 1E7OA 2AKLA 2GBQA 4N4HA 1K8AR 3TVTA 1YCYA 5KYXB 3L1AA 2ED1A 3LX7A 4PNOA 1G2BA 2L89A 1GCQA 2ZPFB 5DM7R 2EGCA 3ZL7C 5LJ5g 3CPWA 2XG8D 5GAOm 1OEBA 3JB9F 2VUBA 4BI8B 3RESA 2EQIA 3AHUA 1PD0A 3GIBA 2D9TA 1GBRA 3RMQA 4J6YA 1OOTA 4L6V5 3EG9A 3OSVA 1VIFA 3BFMA 3CCEA 4JLIA 1VQ6A 4XTWA 2HCKA 1T0HA 4JDSA 2A36A 3WVEB 4IUUA 2YWWA 2QQRA 3HRSA 3X28B 4C92E 4DBRA 2DIQA 1SSFA 2QQBA 1NBEB 2F2XA 3OMCA 1I8FA 4KGXB 2EIFA 4M7AB 2X35A 1AZGB 4J8OA 2P4RA 3KXTA 1WXUA 2DVEA 4Q5WA 2AT1B 4BD3A 3S3NA 4OMMA 2KEAA 3CCEQ 2CP3A 1HYOA 1WI7A 1QVGP 1VQ6Q 5GAN3 3MO8A 1ZUUA 1M27C 4EMKC 1QVGS 4PK4A 3D7SB 1J3TA 1PKSA 3CC4A 1UB4A 5CR2A 3JAME 2O01E 4NS5A 2JZ2A 1QP3A 1QQJA 4PJOF 5GAOl 4C0DC 2RHYA 3E9FA 4PJOC 2DIGA 3EFSA 3SD4A 4M78E 4C8QF 1KC8R 1G3YA 1QVFA 1NG2A 1G3TA 2RJCA 2AIRB 4C8QC 1GRIA 4DA4A 5IT9E 1Q81U 3E9GA 3FJPA 4E7JA 2X9HA 3LLRA 2F69A 4PJLA 1VQ4T 1CKBA 3EGDB 3QJ6A 2FO0A 2KDSA 3CC4Q 4B9XA 4MZTA 5CVIA 4C92C 3I56A 4HKEA 4F17A 4A54A 2LRQA 2E65A 4BDYA 1ZX6A 1G3WA 1VYUA 2J06A 1VQ4A 3JCMg 2A37A 3QDFA 3FB9A 2CKKA 5LL6S 4QW2A 2J6KA 3OYIA 3V8KA 5EG2A 2VKNA 3I56Q 2DXTA 2MAMA 5KCHA 2DRMA 5D6XA 3S3MA 1VQ4Q 5GAOq 1WQ7A 3QG1A 2E12A 1IO6A 2CS7A 5D7UA 2VXEA 4RG8A 3N5BB 2HSEB 4WF2A 5FWBA 2GF7A 2L3PA 4X9DA 3J81E 3PE0A 2HBPA 4ELYC 5FRNA 4C5IA 4F14A 5GAN4 1FXXA 1AWWA 1HXDA 5L8RE 1TH7A 2KRSA 1Z9ZA 2M0YA 2C0IA 4WCIA 4M77D 2DE0X 2YT6A 4OGCA 2DL3A 1AHJB 2K3XA 1NPPA 5GMKh 1OU9A 1U1TA 3FDRA 4M75G 1KHIA 4VUBA 4XTYA 3R6OA 3OYBA 3RKWA 1YIJT 5LJ3h 3SWNB 3OYDA 3THKA 3JB9J 4M7DD 1VQ9A 3DB3A 5GAMf 2J6FA 4JUVA 2RH2A 2YSQA 4ZTFA 1M4ZA 4ANJA 2EJ9A 3REAB 2MIOA 2V8JA 1OU8A 5AT1B 4J9HA 5IH2A 5GANd 1YIJA 3QKJA 2DERA 2JTEA 2E70A 4N0AC 2BIVA 2CZ7B 1IRXA 5IXFA 3JCMP 3EG1A 2PU9B 2E6NA 4CRIA 5CAIA 3JCMV 2GFUA 4CI0C 2ZPEB 1VQ9Q 4PJNA 1RL2A 2VC8A 1VUBA 2JVVA 1N8RR 3E19A 3L42A 1UGQB 1QWEA 4PL6A 4J9EA 2KNBB 3OW2A 1YIJQ 2J05A 4HT8A 4FYVB 2DNUA 3HFNA 1YNZA 2VWFA 5CIUA 2RA2A 3CXCA 2RB6A 2J7IA 2JW4A 4PFZA 4B6MA 2MCNA 4AFSC 5GANj 3I55A 2HKQB 4IUPA 3M4YA 3QPHA 3H41A 1QP2A 2PVGB 4M77F 3VV0A 1Q7YR 2KR3A 4M77C 2VGNA 4M7AG 5KE3A 4BE2A 1S1NA 1HK9A 1RADB 3EHQA 4BDZA 2K3YA 2ZPIB 3REBB 1BIAA 2DXUA 2O9VA 1ZSZA 1KSWA 5GAN2 2CREA 3CPWP 3M0SA 2COWA 3I55Q 1YHQT 3CPWS 1QVGA 2OTLT 1D09B 2XICA 1AVZC 2CGHA 2FB7A 1TSFA 4M7DG 2CZ0B 1SHFA 3M55A 4V2SA 4M75A 1Y71A 4C0ZA 1ZA1B 3RMSA 1IHWA 2M9UA 4J9BA 1EX4A 1NZ9A 1O9SA 4Y28E 1X6GA 5GJWB 4IKFA 4O5VA 3V7CA 3C0CA 3QZ9B 1K76A 3E1SA 5KYUA 4J83A 1WLPB 2KBTA 2XD0A 3BW1A 3ZFJA 1JXOA 1Q81C 5GAN8 1SHGA 3L2VA 2D0QB 4JPBW 2MYSA 2ZGWA 4F7UG 4J7IA 4A53A 1YHQQ 1JRIA 1I07A 2D0NA 1UGSB 2X3XD 1X6OA 3CEYA 2K5FA 5GAMh 4MZPA 2PQWA 5J3BA 1M9SA 1QKXA 5CQYA 1QVFP 3CCJT 1ARKA 1Q81R 2DVJA 1GBQA 5KYXA 4EMKB 3OYNA 1M1GA 3WXMB 2KE9A 2HD0A 4KULA 4OP0A 5KCOA 1TUGB 1WA7A 4C0DB 3CMET 3FC3A 3M0PA 4JS4A 4PJOB 2DJZA 2DXBA 4BI4A 4HVUA 2YUQA 3QWYA 2VV5A 2DILA 3F70A 3RR6A 4C8QB 4EMHA 3CCJA 3U23A 1D1AA 1YN8A 3BDLA 1AT1B 1ABQA 4KH1B 4CC3A 3G1JA 1QCNA 3GNFB 5FU7C 8AT1B 3QWXX 2WSCE 2EVRA 2LMJA 2OAUA 5A0DA 1ABOA 4M7AA 2JTMA 1IGQA 1U06A 4AG2C 3OS0A 1D0ZA 1WGSA 2K79A 1W1FA 4GBQA 3CCJQ 2PTKA 1KQSA 2DETA 4Y91A 3JSCA 4ZN1A 3CBPA 4JJCA 3QDRB 2KY9A 3HFOA 3OYHA 3QUIA 1CKAA 5GAN5 3MEWA 2QASA 1WHJA 4MMKA 1GL5A 1MV0B 1IB8A 2DF6A 2OAWA 5A0GA 4M7DA 1B3QA 3X24B 1W6XA 1M5Q1 3LGFA 2EGAA 2B86A 2E6ZA 1JXMA 4AG1C 3SHWA 3JB9D 3LH5A 1W2BS 1NEBA 3GF5A 3LWHA 1BU1A 3EH2A 2OX7A 3VKIA 1Y96B 3EGDA 1K9AA 1Q82U 3EGXB 2XKOC 4XK8E 2DZCA 1W4SA 4QKUA 1I4K1 3JCMc 3VU3C 2O88A 4Z8AA 1D1BA 4F7UA 2COYA 4RKUE 2RI2A 2YXYA 1M90U 4UC4A 4LDXA 3NTIA 2P4TA 2QEXA 1X01A 1D3BB 1PSEA 2RJFA 5FW9A 4DEXA 1K0XA 5CKEA 1M1KU 2F2VA 4ME7A 3EG0A 3HRUA 1YWPA 2W10A 3JCMQ 3L2QA 3RIRA 2F5KA 3CQTA 4N4GA 1V76A 5KYYA 5FLXE 2QEXQ 2X4WA 3G71A 3OA6A 4PJMA 1OV3A 2CH4A 4OF1A 2HQEA 3OW2P 4J9FA 4C92D 3M5AA 1BCOA 4X1VA 3OW2S 1X2KA 3CXCP 1SPKA 1AOJA 5LJ3d 1VYTA 3CXCS 1RI0A 2MWPA 4E7ZA 1Y07A 1WZOA 1G8XA 4QQGA 4DBHA 4XTZA 4RG2A 1M3BA 3JB9G 1EIFA 3JCMe 3G71Q 2CUDA 1LJOA 1ZQ1A 3SWNA 4E7KA 2EBPA 2JMCA 1MMNA 1ZHIA 2P0PA 3X26B 2QI2A 5LJ3f 3VRYA 5KE2A 1F1BB 1MNEA 1UHFA 4M78D 2YUNA 1G5VA 1KC8C 4M77B 1UUEA 3UA7A 2DBKA 1WHKA 5J39A 5C0MA 1U5SA 5LJ5f 1SF9A 3L2RA 1UG1A 2XU8A 2EQJA 4CC2A 2L8DA 2L3QA 2EJFA 2RQWA 3CC7T 2KK4A 5GJVB 2CYZB 3CCLT 1VQ5T 2IIMA 5D6WA 1D0XA 2C06A 3DKMA 1LVKA 3PIOA 1HSQA 4M7DB 1VYVA 2IVWA 4ZTJA 2FPEA 5GAOn 1WIEA 4E2FB 4XU0A 1Y0MA 4R56A 2R58A 2RK1A 2BZ8A 3NPFA 1YWOA 3CC7A 4PJOG 3HP9A 2EGEA 1MMAA 3EG3A 3CCLA 1BI3A 1RI9A 1X27A 2EW3A 4C8QG 3PMIA 3OYJA 1AZEA 4FSSA 4C92F 3A5ZB 4JRPA 3OYAA 2H8HA 3VS3A 1U1SA 5IXBA 3INZA 4DOWA 5KYNA 5DLOA 4F7UB 3MP8A 2RJDA 3CC7Q 1OX9A 3P8HA 2G3RA 4LDWA 3S6WA 3PVLA 2FHDA 1R8OB 3CCLQ 4IIOA 1VQ5Q 1U3OA 1OPKA 2DL8A 4LD6A 4C5HA 2YUOA 2LNHB 2EKHA 4E7HA 4M75E 3BDUA 2AK5A 3MJXA 2PUOB 5GANe 1GCPA 1KD1U 1TOVA 1TG0A 2FVUA 1Y57A 4MMLA 1VQPT 2YRCA 3QXEB 4M78F 3OS1A 4M78C 1JB0E 1TS9A 1ZA2B 2MF2A 3UA6A 3RKXA 1PCXA 2JNGA 3SEMA 1N5ZA 4E47A 2QGFB 1WDXA 5KYYB 1M3AA 1Q95G 3O5ZA 2KROA 1TUCA 2ZPGB 2E64A 2LT1A 2LP5A 1BI2A 4QVCA 1PD1A 3ER0A 1W2BA 4JRIA 2O2OA 3CBMA 1VQPA 1UE9A 4FW2A 5EC7A 1QCFA 1S72T 4RTYA 1MV3A 4P5NA 4RCCA 2K7AA 3CD6T 2ZCFB 4MDXA 3CCVT 1KQSP 3QIIA 5GAMd 2GGRA 3RUXA 3ASKA 1PC0A 3H0IA 5FU7B 1UTIA 1KQSS 2HAXA 4R55A 1G83A 1BIBA 3OBYA 1N27A 3QO3A 2XDBA 4DBQA 5J26A 2NUTB 2XIDA 1Q82C 2CSQA 4DBFA 1NLPC 1NJIU 1VQPQ 4RTWA 4GLKA 1Q86U 2D1XA 3DB4A 3CCVA 4F04B 1K1ZA 3LH0A 1U8RA 2J6OA 4EMKA 2DPPB 3OS2A 2V1QA 4ELZC 1LPLA 2DL4A 3MP6A 1AWOA 5CO7A 4A4KA 5LJ5h 1Q82R 2K6DA 3KFVA 3V7RA 1M90C 4BB7A 1WJRA 5M9OA 4PJOA 1I81A 2VVKA 4PLIA 4M7AE 1N8RC 2FPFA 2GQVA 5GANg 5GAMj 1VIEA 2M0OA 3UDCA 4C8QA 4HCKA 3FLGA 1M1KC 1PHTA 4E7LA 3VUZA 1VOMA 3CCVQ 1NLOC 2D6FA 1C0MA 5IN1A 2DTHA 3A8HB 1WHMA 3PMTA 3G6ET 3UATA 3CPFA 5IHNA 3LYIA 1UGRB 1M90R 3CMAT 2LJ0A 2LC4A 2ROTA 1YI2T 4Z89A 3JCMb 3OYGA 1JJ2A 1K73U 1T3SA 3MCAB 3ME9A 3TREA 3ZBDA 4TVRA 1Q7YC 1M1KR 3R6NA 4LUDA 2LT4A 2VYTA 3TSZA 1C1AA 3G6EA 1JBMA 1GFDA 3A1PA 2WSEE 3MKDA 4LNPA 2QGGA 2DL5A 2RQUA 3P8DA 3CMAA 3VS6A 2DX1A 4LXCA 2GTOA 1YI2A 2K5IA 3CCUT 3CCQT 2KXCA 4PFOA 3OBWA 1OQKA 1DJ7B 4OGEA 4E7SA 3VS4A 2OTJT 2ESWA 2NUZA 4XTVA 1UDLA 1MMDA 4HVVA 2JXBA 2FEIA 3NFCA 2ECZA 4OMFB 3V8LA 3UPUA 3G6EQ 1UJ0A 4JS5A 4M77G 2IPOB 3CCUA 2KQWA 1MNDA 2CP0A 1YJWT 3CMAQ 2X4XA 4JZ3A 1Y96A 2KMTA 1YI2Q 2OTJA 3HTRA 2K3BA 5IHIA 4AFQC 3EGXA 2RHXA 3VYHB 7AT1B 4DEYA 3NMZC 3A8OB 3VJPA 1YJ9T 1RACB 1YJNT 2KGTA 1I5LA 1NYGA 5L23A 1M2VB 2F1LA 4QVDA 1M1FA 3T9NA 1SSHA 1JEGA 1NPRA 1K4US 2ABLA 2NUPB 2RI5A 1PWTA 3C12A 2JMAA 3JCMh 3L2UA 2VASA 3CCUQ 1YHQA 1FMVA 1ZSGA 2M02A 2JS2A 5A0LA 4RTXA 2FRWA 3ULRB 2OTLA 1JO8A 1PG5B 2M16A 4GLMA 5AYFA 5KYWA 1D3BA 4R0KA 2OTJQ 2PVDB 3VS0A 1RLPC 2LDMA 2YRDA 4WTOB 4JJBA 1M3CA 1RAAB 1XNIA 4XU3A 3Q1JA 3UWNA 1QMCA 1YFNA 3CCMT 2DL7A 2DKGA 2C0TA 3GP8A 3VUBA 4B9WA 1RAHB 1SG5A 4QQ6A 1LOJA 2LCSA 1M30A 2QA4T 1JU5C 2DJQA 1OZ3A 3CBOA 3QYHB 1WYXA 4RTTA 2ENMA 3O8VA 5FU6C 2OTLQ 4XU2A 2HL5C 2RMOA 4X9CA 2E1HA 2KVQG 1YJ9Q 2DA9A 2K4YA 4JRKA 1VQKT 1TUDA 3GNGA 1BYMA 1QWFA 3I5RA 4N0AA 4XQ3A 4FIBA 2QA4A 3RKYA 4YTLA 1AD5A 1WJQA 2ZZDA 3GBQA 2V26A 1YP5A 2DYBA 3RBBB 1MHNA 4A4GA 3A98A 2YLCA 2A7YA 2G6FX 2P0KA 3SB2A 1UEBA 1E6HA 1VQOT 3DLLA 5GAN7 3AT1B 4X34A 2X51A 1KD1C 5HK0A 1D0YA 2LQWA 2M51A 3HSBA 4E7IA 4FL6A 1AEYA 3LGLA 2QA4Q 3CMEA 4C92B 2YHTA 2VB6A 5D6YA 3HPWA 1VQOA 1K9MU 2HDAA 1GCQC 2F2WA 2QQSA 3M57A 1VQMT 2DBMA 4IURA 4ORZA 3BE3A 2FL7A 1KD1R 2CZ1B 3DLMA 1UGPB 4M77A 1IZ6A 1ZBXA 2DYIA 4BE1A 3IQLA 2JM8A 2B8AA 3PT9A 4NOYA 2CT4A 1WQWA 2EJGA 3PTAA 3CMEQ 3M0RA 1H92A 1N9RA 2O4XB 4OVAA 2Y90A 1VQMA 3OB9A 3SWNC 1VQOQ 4IUQA 5CK9A 1W2BP 2Y4YA 1VQLT 4M78B 1NJIC 1RABB 3RERA 3I35A 4JRQA 4XAXB 2OI3A 2FZCB 1VQMQ 1TWBA 4Z02A 3MPUB 2E10A 1MGQA 4DOVA 4JJNK 1NJIR 2BKDN 2YRVA 2JT4A 4LDUA 1Q86R 1VQ7T 5DLQE 2WACA 1IGUA 2DMOA 1B7TA 2FPDA 4RTUA 4C5GA 2Z0WA 1IHVA 2MMPA 4OB3B 2EQUA 5KYWB 4D8KA 3QSUA 3JB9H 3TQ7P 2RHIA 2GNCA 4HCBA 1X75C 3H9NA 2W0ZA 4J9GA 1OYXA 4Z88A 3PVQA 3WVDB 2JN0A 2COZA 2BE9B 1VQ7A 2ZAEA 5I2MA 1K73C 2HBWA 5IHKA 1OPLA 2XDDA 5GMKm 1QVPA 4RTVA 2EYWA 3M0QA 3LW5E 1X2QA 2D8JA 2RQVA 5FRMA 4BY6C 4OMPA 1H8KA 1SRMA 2EWNA 2H3JA 4CC7A 3EFOA 5CKDA 3EHRA 2LJ3A 1UHCA 1T0JA 2A08A 1K73R 1JJ2P 1BCMA 3UF4A 2H3EB 1VQ7Q 5DY9A 1JJ2S 4C0FA 3JCMJ 2A0FB 2MWOA 4FYWB 5HY6A 1B34B 1YITT 5LJ3g 1EZZB 4HA8A 4OB1B 3GLXA 1KQ1A 1OZ2A 3CCET 1BI0A 3I9QA 3QHSA 2L0AA 1VQ6T 2NUTA 1RAEB 1H3HA 4OMOA 2P84A 4XU1A 4PJOE 5LJ5d 4J6WA 4M4ZA 3OYYA 2P0QA 3M53A 1Z9QA 1KQ2A 4FSXA 4C8QE 4ZGJB 1YITA 1B07A 5GMKl 2DXCA 2A3LA 3OSSC 5GMKj 3FIFA 1H3ZA 2LX7A 4IUVA 2O31A 2X4JA 3TCJA 2DZ9A 3A8GB 4FT4A 5IAYA 5LJ3j 2DK3A 3CC4T 2BE7D 5HCKA 3VRZA 2M1HA 2FYKA 1QLYA 1YITQ 2HQHA 2MI6A 5CKHA 3X25B 4OMQA 5LJ5j 3BY7A 1KIKA 4ZGDB 4FCYA 2E3HA 4BI3A 1C6VX 1R0CB 2QQ9A 4JZ4A 8ATCB 2QYZA 2QDYB 2JS0A 5GAMe 1VQ5A 3EAEA 2RJEA 2ROLA 2R57A 2FRYA 4L59A 4NL2A 2X3WD 5FWCA 4CC4B 1OI1A 3I56T 2HEQA 4M75D 5I2SA 4O6JA 3LWIA 2VGMA 1WHLA 2LVMA 3V7SA 3C95A 2QXFA 1UGVA 2NLUA 2HQXA 2DEQA 3OYMA 4ZGEB 2LQKA 1E6GA 2QTXA 4C92G 3OYCA 4EPCA 3EG2A 4KUIA 3NGPA 2LCLA 1WXTA 5A2QE 3QJYA 1BBZA 4J9CA 5GMKi 4A4EA 1OULA 3OQ5A 2Y4XA 3QYGB 4FU6A 4XTUA 1YBYA 2V8IA 3KBGA 1FYNA 1H641 5FU6B 3VS2A 3KUFA 3JCMd 4D8DA 1PRLC 2DD4A 1K9MC 2GTJA 3MHXA 2DLPA 1M2VA 4AMCA 4NL3A 3H6ZA 2V8KA 2XHCA 3HHTB 4EDUA 4L5GA 1M2OA 3VYGA 3JCMX 2BTTA 3CC2T 2NUPA 2OJ2A 3TEEA 4M78G 2IG0A 4AT1B 3EFOB 1BKBA 2BZYA 2JTFA 2C0OA 3G7ZA 1QW1A 1K9MR 3JCMf 4OMLA 3RDVA 3M56A 1G3SA 4RMOA 4KH0B 3META 1ZSZC 2XDPA 3H0FA 2QQAA 1I1JA 2EQMA 4A63B 1MUZA 4QQDA 3FJ5A 5GAMg 3CC2A 4C5EA 1NEGA 1UECA 3M54A 3I5SA 4JLGA 4HCZA 1RAGB 1S72A 1FX7A 5GAOr 1QCOA 1V29B 4M7AD 4M75F 2L2PA 2YLBA 3CD6A 2SEMA 2EYYA 3L2ZA 4M75C 4MZMA 1P92A 2L5QA 4J5YA 1WJSA 3OYLA 1VQ9T 1VQNT 4J6XA 2MOXA 3QBYA 2DD5A 2VXFA 1SKUB 1BK2A 3EG9B 3CC2Q 4LN2A 2PUKB 4J9DA 1HJDA 2HKNA 4IIMA 1R77A 2NWMA 1S72Q 3PFSA 3URGA 2CUBA 3CD6Q 1VQNA 2RO0A 1X69A 2KRMA
chains in the Genus database with same CATH topology
1G3TA 2RJCA 4RKUE 3O8VA 5FU6C 4C8QC 4DA4A 5IT9E 4M77E 4XU2A 3CCRT 4X9CA 1Q81U 2RI2A 1M90U 3E9GA 2HNIA 2E1HA 2KVQG 3FJPA 4C0GA 4UC4A 4LDXA 4E7JA 3NTIA 2K4YA 4JRKA 1VQKT 2P4TA 3M58A 2QEXA 1X01A 1D3BB 3CCST 1PSEA 3GNGA 4LDVA 3LLRA 1BYMA 2RJFA 2PVOB 2F69A 3NTKA 1VQ4T 3QJ6A 5CKEA 4N0AA 3PGGA 2KDSA 1M1KU 4XQ3A 4B9XA 4FIBA 4ME7A 4OB0B 4C92A 2QA4A 3HRUA 4YTLA 3RKYA 1M8VA 3M59A 4MZTA 1WJQA 2JUFA 2ZZDA 5CVIA 4C92C 3JCMQ 3I56A 4HKEA 3L2QA 4M7DE 1MHNA 4A4GA 4A54A 3CCRA 3OS5A 3RIRA 2YLCA 2F5KA 2LRQA 2A7YA 2E65A 2P0KA 3SB2A 4BDYA 1UEBA 4N4GA 1VQOT 3CCSA 3DLLA 5GAN7 1G3WA 3UT1A 4X34A 4HCCA 5FLXE 5GAOp 4QVZA 3I55T 3JCMg 1VQ4A 1K8AU 4LDYA 1KD1C 2RI3A 5HK0A 5GANf 2K2VA 3FB9A 5FROA 2CKKA 5HK3A 2X4WA 4FM4B 5LL6S 4BACA 1FWZA 4KBMB 4KT0E 4QW2A 4E7IA 2O4XA 4FL6A 3HSBA 3OYIA 3LGLA 3OA6A 3G71A 3CMEA 4OF1A 3V8KA 3L2WA 3MEAA 3G4ST 5EG2A 2HQEA 3M4GA 5I21A 4C92B 2YHTA 4C92D 3M5AA 5D6YA 4M7AF 3V8JA 2DXTA 3HPWA 1VQOA 1K9MU 2MAMA 4M78A 3OW2S 4M7AC 2QQSA 3M57A 1VQMT 5KCHA 1KG1A 4IURA 5LJ3d 4F7UE 3CCQA 2FL7A 5CKBA 2CZ1B 3DLMA 1UGPB 5D6XA 1RI0A 2MWPA 4M77A 3CXCS 3S3MA 1Y07A 1IZ6A 1N9SA 1ZBXA 5GAOq 1WQ7A 3QG1A 2E12A 4II1A 4BY6B 4BE1A 2CS7A 4QQGA 2VXEA 4RG8A 3N5BB 2B8AA 3PT9A 4NOYA 2R5AA 4XTZA 4RG2A 4WF2A 3G4SA 1WQWA 2EJGA 3JB9G 1EIFA 2GF7A 3JCMe 2RHUA 3PTAA 1LJOA 1ZQ1A 4X9DA 3J81E 2GCXA 3SWNA 1N9RA 2HBPA 2AHJB 4ELYC 4E7KA 5FRNA 2O4XB 4C5IA 4OVAA 2Y90A 5GAN4 1VQMA 1FXXA 3OB9A 3SWNC 2P0PA 1ZHIA 4M7DF 1XTDA 4IUQA 2EQKA 3X26B 5CK9A 2QI2A 1YJWA 5LJ3f 1HXDA 4M7DC 2Y4YA 5KE2A 5L8RE 1TH7A 4N4IA 1LNXA 1VQLT 2E41A 4M78B 4M78D 1NJIC 2RD1A 3J80E 1G5VA 1KC8C 4M77B 1YJ9A 4M77D 4A4HA 3RERA 1YJNA 4OGCA 1AHJB 2EAYA 2EYQA 1NPPA 2K3XA 5J39A 5GMKh 5C0MA 4JRQA 5LJ5f 1U1TA 3FDRA 4XAXB 3X20B 3L2RA 4M75G 1KHIA 4VUBA 2XU8A 2EQJA 4XTYA 3R6OA 2L8DA 2EJFA 3CC7T 4J7FA 2KK4A 4BUGA 3OYKA 3OYBA 2CYZB 3CCLT 4GY5A 1VQ5T 4Z02A 2DAQA 5D6WA 3RKWA 1YIJT 4DOVA 2E10A 1MGQA 3PNWC 5LJ3h 3DKMA 3SWNB 3S3OA 1KC8U 4JJNK 2C06A 3OYDA 2BKDN 3PIOA 2YRVA 4LDUA 3JB9J 4IUTA 4M7DB 4M7DD 1XQHA 5GAN6 3DB3A 1VQ7T 3QZ5B 2IVWA 5DLQE 4ZTJA 5GAMf 2WACA 5GAOn 4F7UF 4D6WA 4XU0A 4R56A 3OYEA 2R58A 4JUVA 2RH2A 4ZTFA 2RK1A 1M4ZA 4C5GA 2EJ9A 2MMPA 3EFRA 3HL8A 4OB3B 1VQ9A 4LD9K 3CC7A 2V8JA 2EQUA 3HP9A 4PJOG 1O75A 3CCMA 3QSUA 3CCLA 3JB9H 2RHIA 1BI3A 4HCBA 1X75C 5GANd 1YIJA 4C8QG 3PMIA 1OYXA 4RCBA 3OYJA 2XI9A 3QKJA 4C92F 3WVDB 2JN0A 2E70A 4N0AC 2BIVA 2DTOA 1VQ7A 5I2MA 2CZ7B 3A5ZB 3JCMP 1K73C 4JRPA 1B34A 2E6NA 2PU9B 4CRIA 3OYAA 5CAIA 3JCMV 2XDDA 1U1SA 2GFUA 2ZPEB 4CI0C 5GMKm 1QVPA 2JOYA 1VQKA 1RL2A 3INZA 3LW5E 2VC8A 4DOWA 5DLOA 1QVFS 4F7UB 1VUBA 2E5QA 2RJDA 3MP8A 5FRMA 4BY6C 2JVVA 3E19A 3L42A 4LDWA 1BI1A 2G3RA 3P8HA 2EWNA 3S6WA 2H3JA 5CKDA 2FHDA 4DQ2A 1R8OB 2DTIA 1UGQB 4LD6A 4PL6A 3OW2A 2EFIA 4HT8A 4C5HA 2L3RA 3HFNA 5CIUA 4E7HA 4M75E 2RA2A 3BDUA 2LTOA 2RB6A 3CXCA 3JCMW 5DY9A 1JJ2S 2GFAA 2PUOB 4C0FA 5GANe 2RHZA 1WNLA 3JCMJ 1KD1U 2LCCA 2FVUA 2MWOA 4MDWA 5HY6A 4MMLA 1VQPT 3QXEB 4M78F 3OS1A 3I55A 5GANj 1B34B 1YITT 3JB9I 5LJ3g 4IUPA 3M4YA 4HA8A 4M78C 3QPHA 1JB0E 2MF2A 1QP2A 2PVGB 4M77F 3RKXA 2XK0A 4OB1B 3VV0A 3GLXA 2JNGA 1KQ1A 1OZ2A 3CCET 3TU4K 1BI0A 5GANh 4E47A 4M77C 3QHSA 2VGNA 1VQ6T 4M7AG 5KE3A 1IREB 2ZPGB 4BE2A 5CQXA 2E64A 4XU1A 4PJOE 2LT1A 3MEUA 5LJ5d 1BI2A 4QVCA 4J6WA 1HK9A 3ER0A 3OYYA 3GPLA 2P0QA 3M53A 4BDZA 1W2BA 2K3YA 4FSXA 1KQ2A 2ZPIB 4JRIA 3CBMA 4C8QE 1VQPA 4ZGJB 2ZPHB 1BIAA 2DXUA 1YITA 1S72T 3HRTA 3HKSA 1WPYA 3OYFA 4P5NA 4RCCA 2F5TX 5GAN2 5GMKl 2DXCA 3CD6T 5GMKe 1YHQT 2LX9A 2A3LA 2ZCFB 4MDXA 3OSSC 3CPWS 3CCVT 4PLLA 5GMKj 1QVGA 2OTLT 3QIIA 5GAMd 3RUXA 3ASKA 3FIFA 1H3ZA 2XICA 4OB2B 2EKOA 3H8ZA 1Q86C 5FU7B 1KQSS 4IUVA 2CGHA 2LNVA 4R55A 1Y7XA 2X4JA 3TCJA 1BIBA 2HAXA 5LJ3e 2FB7A 3OBYA 1N27A 2DZ9A 3QO3A 2XDBA 4M7DG 2CZ0B 3A8GB 1GXIE 4FT4A 5IAYA 3M55A 2DK3A 5J26A 2XIDA 4A4FA 5LJ3j 3CC4T 4V2SA 4HT9A 3SFMA 1Q82C 3M9QA 2K5LA 4M75A 1NJIU 1Y71A 2BUDA 2KSSA 4C0ZA 2M1HA 2X4YA 3MP1A 4GLKA 1N6AA 2FYKA 3RMSA 1XOVA 1Q86U 2RK2A 2CZ6B 3DB4A 4XTXA 1KHCA 2M9UA 2MI6A 3CCVA 1VQLA 5CKHA 1NZ9A 2ZPBB 1O9SA 4Y28E 3X25B 5LJ5e 3LH0A 4KUDK 4IKFA 1U8RA 4O5VA 3V7CA 5LJ5j 4EMKA 2DPPB 3OS2A 3BY7A 3P8BB 3QZ9B 3E1SA 4ELZC 1VQ8T 5HKCA 4ZGDB 4J83A 4BI3A 5CKFA 3MP6A 2QQ9A 5CO7A 2R5MA 4A4KA 3C94A 2QEXT 3BW1A 3ZFJA 5LJ5h 2XD0A 2QDYB 3V7RA 1Q81C 5GAN8 1M90C 3J7AF 4BB7A 1WJRA 4PKCC 5M9OA 3L2VA 2D0QB 4FT2A 5GAMe 1VQ5A 4PJOA 1I81A 3EAEA 2RJEA 4PLIA 2I2LA 1N8RC 2GQVA 5GANg 4M7AE 2R57A 3A8MB 3FRNA 2ZGWA 5GAMj 4F7UG 1VIEA 2K57A 2M0OA 4J7IA 3UDCA 4L59A 4C8QA 4A53A 4NL2A 5KH6A 3GOXA 1PSFA 3FLGA 1JRIA 5C6SA 1M1KC 4E7LA 1UGSB 3VUZA 1OI1A 3I56T 4M75B 3A8LB 4M75D 2D6FA 5I2SA 4O6JA 4EMGA 1X6OA 3LWIA 3CEYA 5IN1A 2KAFA 2VGMA 2K5FA 2DTHA 1VQ8A 3A8HB 5GAMh 3PMTA 3FEOA 4MZPA 3G6ET 2LVMA 3V7SA 2PQWA 5J3BA 3CPFA 3C95A 1M9SA 5CQYA 3JRZA 3LYIA 2QXFA 2NLUA 1N8RU 3CCJT 1UGRB 2HQXA 3C4SA 2DEQA 3OYMA 4ZGEB 3OYNA 3CMAT 2QTXA 2LQKA 1M1GA 2LC4A 3OMGA 4C92G 4EMKB 2LQ8A 4EPCA 3OYCA 4BE0A 1YI2T 3WXMB 2RM4A 3JCMb 3OYGA 4KUIA 1JJ2A 1K73U 2HD0A 4KULA 3MCAB 4OP0A 3ME9A 3TREA 3ZBDA 2LCLA 4TVRA 3ZEHA 5KCOA 3OY9A 1Q7YC 5A2QE 4ZN3A 2DO3A 1K8AC 4C0DB 3G71T 3QJYA 3CMET 3FC3A 5GMKi 4JS4A 2LT4A 4PJOB 2VYTA 4A4EA 4PJOD 3SDZA 3OQ5A 2Y4XA 3QYGB 4FU6A 4XTUA 2DJZA 2DXBA 1JBMA 3G6EA 4BI4A 5CCAA 1YBYA 2V8IA 3NTHA 2VV5A 3F70A 3KBGA 1H641 2WSEE 5FU6B 4C8QB 4C8QD 4EMHA 3CCJA 3BDLA 1NE8A 3KUFA 3JCMd 3P8DA 3CMAA 4ATOA 1YI2A 2K5IA 3CCUT 1Q7YU 3CCQT 2WSFE 2DD4A 3MEVA 1K9MC 3PIPA 3OBWA 1DJ7B 4OGEA 3MHXA 4NL3A 2OTJT 3H6ZA 4N4HA 3GNFB 2V8KA 2XHCA 3HHTB 5FU7C 4EDUA 4L5GA 4XTVA 3VYGA 3JCMX 1YCYA 3L1AA 3LX7A 4PNOA 2L89A 3CC2T 2WSCE 5A0DA 2OAUA 2ZPFB 5DM7R 4M7AA 3TEEA 4M78G 2JTMA 2IG0A 1BKBA 3NFCA 5LJ5g 4OMFB 2JTFA 2XG8D 3V8LA 5GAOm 3CPWA 3JB9F 2VUBA 3OS0A 1WGSA 3UPUA 4JS5A 4BI8B 3G7ZA 1QW1A 4M77G 3CCUA 3RESA 2KQWA 3AHUA 3GIBA 2D9TA 3JCMf 1YJWT 1KQSA 4Y91A 3RMQA 2X4XA 4J6YA 1Y96A 3JSCA 2KMTA 1G3SA 3M56A 4L6V5 4ZN1A 4RMOA 3CBPA 2OTJA 3META 3OSVA 1VIFA 2XDPA 3BFMA 3QDRB 2QQAA 2EQMA 2KY9A 3CCEA 4JLIA 3HFOA 1VQ6A 4XTWA 2RHXA 4QQDA 3VYHB 5GAMg 3OYHA 3CC2A 3QUIA 4C5EA 3A8OB 4JDSA 3VJPA 3MEWA 5GAN5 1YJ9T 1YJNT 4MMKA 1I5LA 3WVEB 4IUUA 3X28B 2QQRA 3HRSA 4C92E 4QVDA 3M54A 1M1FA 3T9NA 1NPRA 2DIQA 1SSFA 2QQBA 4HCZA 4JLGA 5A0GA 4M7DA 3X24B 1S72A 1FX7A 5GAOr 2RI5A 1I8FA 1M5Q1 1V29B 2EIFA 3C12A 3OMCA 2X35A 4M7AB 3LGFA 4M75F 4J8OA 2YLBA 3CD6A 3JCMh 4M7AD 3L2UA 2E6ZA 1YHQA 3KXTA 3JB9D 3L2ZA 4M75C 4MZMA 1W2BS 1P92A 2L5QA 4J5YA 5A0LA 3GF5A 2DVEA 4Q5WA 2OTLA 1WJSA 3LWHA 5AYFA 2M16A 4BD3A 3OYLA 1VQ9T 1D3BA 1VQNT 2PVDB 3S3NA 2LDMA 4J6XA 3VKIA 1Y96B 1XNIA 3QBYA 2DD5A 2VXFA 4XU3A 5GAN3 1Q82U 3MO8A 3Q1JA 3UWNA 4EMKC 1QVGS 2PUKB 3CC4A 2XKOC 3CCMT 1UB4A 4XK8E 5CR2A 3JAME 2DKGA 2DZCA 1W4SA 2O01E 4NS5A 2JZ2A 3VUBA 4B9WA 1I4K1 3GP8A 1QP3A 3JCMc 4PJOF 5GAOl 3VU3C 4QQ6A 4C0DC 1LOJA 3PFSA 2QA4T 2RHYA 3E9FA 3URGA 4PJOC 2DIGA 3EFSA 3SD4A 4M78E 1VQNA 4C8QF 2RO0A 1OZ3A 4F7UA 3CBOA 1G3YA 1QVFA 3QYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO B;  4PJO D;  4M77 B;  2E64 A;  4M77 D;  4XU1 A;  4C8Q C;  3RER A;  4XTU A;  4PJO E;  4M77 E;  2DJZ A;  4XU2 A;  1JBM A;  2EAY A;  4X9C A;  4QVC A;  5LJ5 d;  5GMK h;  2HNI A;  2E1H A;  4J6W A;  3FJP A;  1HK9 A;  1H64 1;  4C8Q B;  4EMH A;  4C8Q D;  1U1T A;  4JRK A;  5LJ5 f;  1KQ2 A;  4JRI A;  4M75 G;  4C8Q E;  4XTY A;  3JCM d;  1X01 A;  1D3B B;  2EJF A;  1BIA A;  2DXU A;  1WPY A;  4RCC A;  5GAN 2;  4N0A A;  3PGG A;  5GMK l;  4XQ3 A;  3RKW A;  5GMK e;  2E10 A;  1MGQ A;  4C92 A;  5LJ3 h;  3SWN B;  3RKY A;  1M8V A;  4NL3 A;  5GMK j;  3JCM X;  4XTV A;  4C92 C;  5GAM d;  3JB9 J;  1YCY A;  3RUX A;  3L1A A;  5GAN 6;  3JCM Q;  4M7D D;  4M7D B;  3FIF A;  4M7D E;  4PNO A;  5GAM f;  5GAO n;  4A54 A;  4F7U F;  4XU0 A;  2CGH A;  4M7A A;  3RIR A;  1BIB A;  4JUV A;  4M78 G;  2FB7 A;  2YLC A;  5LJ3 e;  3QO3 A;  2DZ9 A;  2E65 A;  5LJ5 g;  4M7D G;  3V8L A;  3SB2 A;  2EJ9 A;  5GAO m;  3EFR A;  3JB9 F;  5LJ3 j;  4PJO G;  5GAN 7;  4V2S A;  4M77 G;  4HT9 A;  5GAO p;  3RES A;  3JCM g;  3AHU A;  3QSU A;  4M75 A;  3JB9 H;  3GIB A;  3JCM f;  5GAN d;  4Y91 A;  4J6Y A;  4C8Q G;  1Y96 A;  2FYK A;  5GAN f;  3FB9 A;  4RCB A;  4XTX A;  3BFM A;  4C92 F;  2JN0 A;  5LJ5 e;  4N0A C;  3HSB A;  4JLI A;  2DTO A;  3HFO A;  4XTW A;  3JCM P;  3V8K A;  3V7C A;  5GAM g;  1B34 A;  3QUI A;  4EMK A;  5LJ5 j;  5GAN 5;  3BY7 A;  5CAI A;  3M4G A;  4MMK A;  3JCM V;  4C92 B;  2YHT A;  4C92 D;  5I21 A;  1U1S A;  1I5L A;  4C92 E;  4QVD A;  5GMK m;  4M7A F;  3V8J A;  2DXT A;  3INZ A;  4M78 A;  2VC8 A;  4M7A C;  3BW1 A;  4M7D A;  5LJ5 h;  5LJ3 d;  3V7R A;  4F7U B;  5GAN 8;  5GAO r;  4F7U E;  1I8F A;  1M5Q 1;  4PJO A;  5GAM e;  4M7A B;  4M7A D;  1I81 A;  4M75 F;  4M77 A;  2YLB A;  2EWN A;  3JCM h;  2I2L A;  4M7A E;  1N9S A;  5GAN g;  4DQ2 A;  1WQ7 A;  5GAO q;  3JB9 D;  3L2Z A;  2DTI A;  2ZGW A;  4M75 C;  4F7U G;  2K57 A;  5GAM j;  4C8Q A;  2VXE A;  4J5Y A;  4NL2 A;  4A53 A;  4HT8 A;  2DVE A;  1JRI A;  4NOY A;  4XTZ A;  3HFN A;  1D3B A;  4M75 B;  4M75 D;  4WF2 A;  1WQW A;  2EJG A;  4M75 E;  2RA2 A;  4J6X A;  4EMG A;  3BDU A;  2RB6 A;  3JB9 G;  1Y96 B;  2DTH A;  3JCM e;  1LJO A;  2VXF A;  5DY9 A;  4X9D A;  4XU3 A;  5GAM h;  5GAN 3;  3JCM W;  3V7S A;  3SWN A;  5GAN e;  1N9R A;  4EMK C;  1WNL A;  3JCM J;  5GAN 4;  2Y90 A;  4MML A;  2DEQ A;  4M78 F;  2DKG A;  2DZC A;  3SWN C;  1B34 B;  2QTX A;  4EMK B;  5GAN j;  4M7D F;  4C92 G;  3JB9 I;  5LJ3 g;  1I4K 1;  3JCM b;  2RM4 A;  4HA8 A;  4M78 C;  5LJ3 f;  1HXD A;  3JCM c;  4M7D C;  4PJO F;  5GAO l;  3VU3 C;  4M77 F;  3RKX A;  1TH7 A;  1LOJ A;  1LNX A;  4OP0 A;  2E41 A;  4M78 B;  1KQ1 A;  4M78 D;  4PJO C;  5GAN h;  3EFS A;  4M78 E;  4M77 C;  2RD1 A;  3QHS A;  4C8Q F;  4F7U A;  4M7A G;  5GMK i; 
#chains in the Genus database with same CATH topology
 4M77 E;  2A28 A;  3CCR T;  1PRM C;  2SRC A;  2HNI A;  2HL3 A;  4C0G A;  4LUE A;  3M58 A;  3JV3 A;  3CCS T;  4LDV A;  2PVO B;  3NTK A;  1PM3 A;  2K2M A;  3H0H A;  3PGG A;  4OB0 B;  4C92 A;  1M8V A;  2AKK A;  3M59 A;  2JUF A;  2JM9 A;  4M7D E;  2EPD A;  4OMN A;  3CCR A;  3OS5 A;  4RUG A;  1VQN Q;  2D8H A;  1CSK A;  2LZ6 B;  3CCS A;  3UT1 A;  4HCC A;  3I55 T;  5GAO p;  2DM1 A;  4QVZ A;  1FMK A;  1BB9 A;  1RUW A;  1K8A U;  4LDY A;  4FYY B;  2RI3 A;  5GAN f;  2K2V A;  5FRO A;  4AFZ C;  5HK3 A;  4FM4 B;  4BAC A;  2HMA A;  1FWZ A;  2O9S A;  4KBM B;  4KT0 E;  2O4X A;  2CP7 A;  2CP5 A;  4AFU C;  3L2W A;  3MEA A;  3G4S T;  3M4G A;  5I21 A;  1UJY A;  4M7A F;  4PJJ A;  3V8J A;  3CCR Q;  4M78 A;  4M7A C;  1KG1 A;  4F7U E;  3CCQ A;  1RAF B;  5CKB A;  1ZBJ A;  3CCS Q;  1N9S A;  4BY6 B;  4II1 A;  1NYF A;  1K0S A;  2CT3 A;  2R5A A;  2YDL A;  3G4S A;  1AWJ A;  2RHU A;  2KYM A;  1JQQ A;  4HVW A;  2GCX A;  1KK7 A;  1WHH A;  2AHJ B;  2KRN A;  2K9G A;  3M0T A;  4M7D F;  4LE9 A;  4FYX B;  1XTD A;  2EQK A;  1YJW A;  3E2U A;  4M7D C;  1ZLM A;  4N4I A;  3CCQ Q;  1LNX A;  2E41 A;  2E3I A;  1ZUK A;  2EYX A;  2RD1 A;  1ACM B;  2KT8 A;  3VS7 A;  3J80 E;  1YJ9 A;  4A4H A;  1YJN A;  3VS1 A;  6AT1 B;  2EAY A;  1SRL A;  2EYQ A;  1FMW A;  3G4S Q;  2DRK A;  1HD3 A;  2RNA A;  3X20 B;  1TTH B;  1PKT A;  4J7F A;  2NYS A;  1QKW A;  4RTZ A;  4BUG A;  3OYK A;  4KGV B;  4GY5 A;  1VA7 A;  2DAQ A;  2KXD A;  1D1C A;  4EIK A;  3S3O A;  3PNW C;  1KC8 U;  2L3S A;  1YJW Q;  2E4H A;  5ECA A;  2CSI A;  4IUT A;  1XQH A;  5GAN 6;  3QZ5 B;  4F7U F;  4D6W A;  1I5O B;  3OYE A;  5I11 A;  1X43 A;  3EFR A;  1M8M A;  3HL8 A;  1YJN Q;  4LD9 K;  4F16 A;  3CCM A;  1O75 A;  2CP6 A;  2FG0 A;  4J9I A;  2DFU A;  4RCB A;  2XI9 A;  2FZG B;  2DTO A;  4K11 A;  1B34 A;  3EGU A;  2MK5 A;  2BZX A;  1UFF A;  3VS5 A;  1YCS B;  2JOY A;  1VQK A;  2RQR A;  3EH1 A;  4ZNX A;  1QVF S;  2E5Q A;  2QG9 B;  1BI1 A;  2PNI A;  1RLQ C;  3CCM Q;  4DQ2 A;  2DTI A;  2EFI A;  2L3R A;  5I22 A;  1MMG A;  9ATC B;  2LTO A;  3JCM W;  2GFA A;  2QDL A;  1I0C A;  2RHZ A;  1WNL A;  2LCC A;  4MDW A;  2LQN A;  2MPX C;  3JB9 I;  1VQK Q;  2GQI A;  4Y92 A;  2XK0 A;  2KYB A;  3TU4 K;  5GAN h;  2JJ9 A;  1KFZ A;  1PNJ A;  2CP2 A;  1IRE B;  5CQX A;  3MEU A;  2HSP A;  3GPL A;  2ZPH B;  1TU0 B;  2DEU A;  3HRT A;  3HKS A;  1WPY A;  4JJD A;  3OYF A;  1A0N B;  2F5T X;  2CDT A;  5GMK e;  2ED0 A;  2LX9 A;  2V1R A;  1SEM A;  4PLL A;  1LCK A;  4OB2 B;  2EKO A;  3H8Z A;  1Q86 C;  2ATC B;  2LNV A;  1Y7X A;  2KT1 A;  5LJ3 e;  2KI7 A;  4FW1 A;  1GXI E;  2AZV A;  1GFC A;  2HZY A;  4A4F A;  1IXD A;  2CH4 W;  4HT9 A;  3SFM A;  3M9Q A;  2K5L A;  2BUD A;  2KSS A;  1AWX A;  2X4Y A;  3MP1 A;  1N6A A;  1XOV A;  2RK2 A;  2CZ6 B;  1R0B G;  4XTX A;  1KHC A;  1NM7 A;  2EYZ A;  1VQL A;  2AZS A;  2ZPB B;  5LJ5 e;  2LJ1 A;  2RPN A;  4KUD K;  1ZSZ B;  1WXB A;  2QAZ A;  3P8B B;  1VQ8 T;  2RF0 A;  5HKC A;  5CKF A;  2R5M A;  1W70 A;  3C94 A;  2QEX T;  3J7A F;  4QT7 A;  4PKC C;  3RNJ A;  4FT2 A;  2QTV A;  4ESR A;  2I0N A;  2I2L A;  1OX8 A;  2FZK B;  3A8M B;  3FRN A;  4E6R A;  2K57 A;  1RAI B;  5KH6 A;  3GOX A;  1PSF A;  4HXJ A;  5C6S A;  1WFW A;  1WX6 A;  4M75 B;  3A8L B;  1VQL Q;  4EMG A;  3TSW A;  1XJW B;  1VQ8 A;  1ZUY A;  2KAF A;  3FEO A;  1TXQ A;  3M0U A;  3NHN A;  3JRZ A;  2E5K A;  1N8R U;  3C4S A;  2YUP A;  1X6B A;  3OMG A;  2RQT A;  2LQ8 A;  2RM4 A;  5KYU B;  2QK0 A;  3OY9 A;  3ZEH A;  4ZN3 A;  2DO3 A;  4KGZ B;  1K8A C;  3G71 T;  4PJO D;  3SDZ A;  1T3L A;  1EFN A;  1V1C A;  5CCA A;  3NTH A;  4BE0 A;  4KRT A;  2PZ1 A;  4C8Q D;  2RN8 A;  1VQ8 Q;  1NE8 A;  1KJW A;  4ATO A;  1Q7Y U;  2WSF E;  4PFP A;  3MEV A;  3PIP A;  1WHG A;  2XMF A;  1E7O A;  2AKL A;  2GBQ A;  4N4H A;  1K8A R;  3TVT A;  1YCY A;  5KYX B;  3L1A A;  2ED1 A;  3LX7 A;  4PNO A;  1G2B A;  2L89 A;  1GCQ A;  2ZPF B;  5DM7 R;  2EGC A;  3ZL7 C;  5LJ5 g;  3CPW A;  2XG8 D;  5GAO m;  1OEB A;  3JB9 F;  2VUB A;  4BI8 B;  3RES A;  2EQI A;  3AHU A;  1PD0 A;  3GIB A;  2D9T A;  1GBR A;  3RMQ A;  4J6Y A;  1OOT A;  4L6V 5;  3EG9 A;  3OSV A;  1VIF A;  3BFM A;  3CCE A;  4JLI A;  1VQ6 A;  4XTW A;  2HCK A;  1T0H A;  4JDS A;  2A36 A;  3WVE B;  4IUU A;  2YWW A;  2QQR A;  3HRS A;  3X28 B;  4C92 E;  4DBR A;  2DIQ A;  1SSF A;  2QQB A;  1NBE B;  2F2X A;  3OMC A;  1I8F A;  4KGX B;  2EIF A;  4M7A B;  2X35 A;  1AZG B;  4J8O A;  2P4R A;  3KXT A;  1WXU A;  2DVE A;  4Q5W A;  2AT1 B;  4BD3 A;  3S3N A;  4OMM A;  2KEA A;  3CCE Q;  2CP3 A;  1HYO A;  1WI7 A;  1QVG P;  1VQ6 Q;  5GAN 3;  3MO8 A;  1ZUU A;  1M27 C;  4EMK C;  1QVG S;  4PK4 A;  3D7S B;  1J3T A;  1PKS A;  3CC4 A;  1UB4 A;  5CR2 A;  3JAM E;  2O01 E;  4NS5 A;  2JZ2 A;  1QP3 A;  1QQJ A;  4PJO F;  5GAO l;  4C0D C;  2RHY A;  3E9F A;  4PJO C;  2DIG A;  3EFS A;  3SD4 A;  4M78 E;  4C8Q F;  1KC8 R;  1G3Y A;  1QVF A;  1NG2 A;  1G3T A;  2RJC A;  2AIR B;  4C8Q C;  1GRI A;  4DA4 A;  5IT9 E;  1Q81 U;  3E9G A;  3FJP A;  4E7J A;  2X9H A;  3LLR A;  2F69 A;  4PJL A;  1VQ4 T;  1CKB A;  3EGD B;  3QJ6 A;  2FO0 A;  2KDS A;  3CC4 Q;  4B9X A;  4MZT A;  5CVI A;  4C92 C;  3I56 A;  4HKE A;  4F17 A;  4A54 A;  2LRQ A;  2E65 A;  4BDY A;  1ZX6 A;  1G3W A;  1VYU A;  2J06 A;  1VQ4 A;  3JCM g;  2A37 A;  3QDF A;  3FB9 A;  2CKK A;  5LL6 S;  4QW2 A;  2J6K A;  3OYI A;  3V8K A;  5EG2 A;  2VKN A;  3I56 Q;  2DXT A;  2MAM A;  5KCH A;  2DRM A;  5D6X A;  3S3M A;  1VQ4 Q;  5GAO q;  1WQ7 A;  3QG1 A;  2E12 A;  1IO6 A;  2CS7 A;  5D7U A;  2VXE A;  4RG8 A;  3N5B B;  2HSE B;  4WF2 A;  5FWB A;  2GF7 A;  2L3P A;  4X9D A;  3J81 E;  3PE0 A;  2HBP A;  4ELY C;  5FRN A;  4C5I A;  4F14 A;  5GAN 4;  1FXX A;  1AWW A;  1HXD A;  5L8R E;  1TH7 A;  2KRS A;  1Z9Z A;  2M0Y A;  2C0I A;  4WCI A;  4M77 D;  2DE0 X;  2YT6 A;  4OGC A;  2DL3 A;  1AHJ B;  2K3X A;  1NPP A;  5GMK h;  1OU9 A;  1U1T A;  3FDR A;  4M75 G;  1KHI A;  4VUB A;  4XTY A;  3R6O A;  3OYB A;  3RKW A;  1YIJ T;  5LJ3 h;  3SWN B;  3OYD A;  3THK A;  3JB9 J;  4M7D D;  1VQ9 A;  3DB3 A;  5GAM f;  2J6F A;  4JUV A;  2RH2 A;  2YSQ A;  4ZTF A;  1M4Z A;  4ANJ A;  2EJ9 A;  3REA B;  2MIO A;  2V8J A;  1OU8 A;  5AT1 B;  4J9H A;  5IH2 A;  5GAN d;  1YIJ A;  3QKJ A;  2DER A;  2JTE A;  2E70 A;  4N0A C;  2BIV A;  2CZ7 B;  1IRX A;  5IXF A;  3JCM P;  3EG1 A;  2PU9 B;  2E6N A;  4CRI A;  5CAI A;  3JCM V;  2GFU A;  4CI0 C;  2ZPE B;  1VQ9 Q;  4PJN A;  1RL2 A;  2VC8 A;  1VUB A;  2JVV A;  1N8R R;  3E19 A;  3L42 A;  1UGQ B;  1QWE A;  4PL6 A;  4J9E A;  2KNB B;  3OW2 A;  1YIJ Q;  2J05 A;  4HT8 A;  4FYV B;  2DNU A;  3HFN A;  1YNZ A;  2VWF A;  5CIU A;  2RA2 A;  3CXC A;  2RB6 A;  2J7I A;  2JW4 A;  4PFZ A;  4B6M A;  2MCN A;  4AFS C;  5GAN j;  3I55 A;  2HKQ B;  4IUP A;  3M4Y A;  3QPH A;  3H41 A;  1QP2 A;  2PVG B;  4M77 F;  3VV0 A;  1Q7Y R;  2KR3 A;  4M77 C;  2VGN A;  4M7A G;  5KE3 A;  4BE2 A;  1S1N A;  1HK9 A;  1RAD B;  3EHQ A;  4BDZ A;  2K3Y A;  2ZPI B;  3REB B;  1BIA A;  2DXU A;  2O9V A;  1ZSZ A;  1KSW A;  5GAN 2;  2CRE A;  3CPW P;  3M0S A;  2COW A;  3I55 Q;  1YHQ T;  3CPW S;  1QVG A;  2OTL T;  1D09 B;  2XIC A;  1AVZ C;  2CGH A;  2FB7 A;  1TSF A;  4M7D G;  2CZ0 B;  1SHF A;  3M55 A;  4V2S A;  4M75 A;  1Y71 A;  4C0Z A;  1ZA1 B;  3RMS A;  1IHW A;  2M9U A;  4J9B A;  1EX4 A;  1NZ9 A;  1O9S A;  4Y28 E;  1X6G A;  5GJW B;  4IKF A;  4O5V A;  3V7C A;  3C0C A;  3QZ9 B;  1K76 A;  3E1S A;  5KYU A;  4J83 A;  1WLP B;  2KBT A;  2XD0 A;  3BW1 A;  3ZFJ A;  1JXO A;  1Q81 C;  5GAN 8;  1SHG A;  3L2V A;  2D0Q B;  4JPB W;  2MYS A;  2ZGW A;  4F7U G;  4J7I A;  4A53 A;  1YHQ Q;  1JRI A;  1I07 A;  2D0N A;  1UGS B;  2X3X D;  1X6O A;  3CEY A;  2K5F A;  5GAM h;  4MZP A;  2PQW A;  5J3B A;  1M9S A;  1QKX A;  5CQY A;  1QVF P;  3CCJ T;  1ARK A;  1Q81 R;  2DVJ A;  1GBQ A;  5KYX A;  4EMK B;  3OYN A;  1M1G A;  3WXM B;  2KE9 A;  2HD0 A;  4KUL A;  4OP0 A;  5KCO A;  1TUG B;  1WA7 A;  4C0D B;  3CME T;  3FC3 A;  3M0P A;  4JS4 A;  4PJO B;  2DJZ A;  2DXB A;  4BI4 A;  4HVU A;  2YUQ A;  3QWY A;  2VV5 A;  2DIL A;  3F70 A;  3RR6 A;  4C8Q B;  4EMH A;  3CCJ A;  3U23 A;  1D1A A;  1YN8 A;  3BDL A;  1AT1 B;  1ABQ A;  4KH1 B;  4CC3 A;  3G1J A;  1QCN A;  3GNF B;  5FU7 C;  8AT1 B;  3QWX X;  2WSC E;  2EVR A;  2LMJ A;  2OAU A;  5A0D A;  1ABO A;  4M7A A;  2JTM A;  1IGQ A;  1U06 A;  4AG2 C;  3OS0 A;  1D0Z A;  1WGS A;  2K79 A;  1W1F A;  4GBQ A;  3CCJ Q;  2PTK A;  1KQS A;  2DET A;  4Y91 A;  3JSC A;  4ZN1 A;  3CBP A;  4JJC A;  3QDR B;  2KY9 A;  3HFO A;  3OYH A;  3QUI A;  1CKA A;  5GAN 5;  3MEW A;  2QAS A;  1WHJ A;  4MMK A;  1GL5 A;  1MV0 B;  1IB8 A;  2DF6 A;  2OAW A;  5A0G A;  4M7D A;  1B3Q A;  3X24 B;  1W6X A;  1M5Q 1;  3LGF A;  2EGA A;  2B86 A;  2E6Z A;  1JXM A;  4AG1 C;  3SHW A;  3JB9 D;  3LH5 A;  1W2B S;  1NEB A;  3GF5 A;  3LWH A;  1BU1 A;  3EH2 A;  2OX7 A;  3VKI A;  1Y96 B;  3EGD A;  1K9A A;  1Q82 U;  3EGX B;  2XKO C;  4XK8 E;  2DZC A;  1W4S A;  4QKU A;  1I4K 1;  3JCM c;  3VU3 C;  2O88 A;  4Z8A A;  1D1B A;  4F7U A;  2COY A;  4RKU E;  2RI2 A;  2YXY A;  1M90 U;  4UC4 A;  4LDX A;  3NTI A;  2P4T A;  2QEX A;  1X01 A;  1D3B B;  1PSE A;  2RJF A;  5FW9 A;  4DEX A;  1K0X A;  5CKE A;  1M1K U;  2F2V A;  4ME7 A;  3EG0 A;  3HRU A;  1YWP A;  2W10 A;  3JCM Q;  3L2Q A;  3RIR A;  2F5K A;  3CQT A;  4N4G A;  1V76 A;  5KYY A;  5FLX E;  2QEX Q;  2X4W A;  3G71 A;  3OA6 A;  4PJM A;  1OV3 A;  2CH4 A;  4OF1 A;  2HQE A;  3OW2 P;  4J9F A;  4C92 D;  3M5A A;  1BCO A;  4X1V A;  3OW2 S;  1X2K A;  3CXC P;  1SPK A;  1AOJ A;  5LJ3 d;  1VYT A;  3CXC S;  1RI0 A;  2MWP A;  4E7Z A;  1Y07 A;  1WZO A;  1G8X A;  4QQG A;  4DBH A;  4XTZ A;  4RG2 A;  1M3B A;  3JB9 G;  1EIF A;  3JCM e;  3G71 Q;  2CUD A;  1LJO A;  1ZQ1 A;  3SWN A;  4E7K A;  2EBP A;  2JMC A;  1MMN A;  1ZHI A;  2P0P A;  3X26 B;  2QI2 A;  5LJ3 f;  3VRY A;  5KE2 A;  1F1B B;  1MNE A;  1UHF A;  4M78 D;  2YUN A;  1G5V A;  1KC8 C;  4M77 B;  1UUE A;  3UA7 A;  2DBK A;  1WHK A;  5J39 A;  5C0M A;  1U5S A;  5LJ5 f;  1SF9 A;  3L2R A;  1UG1 A;  2XU8 A;  2EQJ A;  4CC2 A;  2L8D A;  2L3Q A;  2EJF A;  2RQW A;  3CC7 T;  2KK4 A;  5GJV B;  2CYZ B;  3CCL T;  1VQ5 T;  2IIM A;  5D6W A;  1D0X A;  2C06 A;  3DKM A;  1LVK A;  3PIO A;  1HSQ A;  4M7D B;  1VYV A;  2IVW A;  4ZTJ A;  2FPE A;  5GAO n;  1WIE A;  4E2F B;  4XU0 A;  1Y0M A;  4R56 A;  2R58 A;  2RK1 A;  2BZ8 A;  3NPF A;  1YWO A;  3CC7 A;  4PJO G;  3HP9 A;  2EGE A;  1MMA A;  3EG3 A;  3CCL A;  1BI3 A;  1RI9 A;  1X27 A;  2EW3 A;  4C8Q G;  3PMI A;  3OYJ A;  1AZE A;  4FSS A;  4C92 F;  3A5Z B;  4JRP A;  3OYA A;  2H8H A;  3VS3 A;  1U1S A;  5IXB A;  3INZ A;  4DOW A;  5KYN A;  5DLO A;  4F7U B;  3MP8 A;  2RJD A;  3CC7 Q;  1OX9 A;  3P8H A;  2G3R A;  4LDW A;  3S6W A;  3PVL A;  2FHD A;  1R8O B;  3CCL Q;  4IIO A;  1VQ5 Q;  1U3O A;  1OPK A;  2DL8 A;  4LD6 A;  4C5H A;  2YUO A;  2LNH B;  2EKH A;  4E7H A;  4M75 E;  3BDU A;  2AK5 A;  3MJX A;  2PUO B;  5GAN e;  1GCP A;  1KD1 U;  1TOV A;  1TG0 A;  2FVU A;  1Y57 A;  4MML A;  1VQP T;  2YRC A;  3QXE B;  4M78 F;  3OS1 A;  4M78 C;  1JB0 E;  1TS9 A;  1ZA2 B;  2MF2 A;  3UA6 A;  3RKX A;  1PCX A;  2JNG A;  3SEM A;  1N5Z A;  4E47 A;  2QGF B;  1WDX A;  5KYY B;  1M3A A;  1Q95 G;  3O5Z A;  2KRO A;  1TUC A;  2ZPG B;  2E64 A;  2LT1 A;  2LP5 A;  1BI2 A;  4QVC A;  1PD1 A;  3ER0 A;  1W2B A;  4JRI A;  2O2O A;  3CBM A;  1VQP A;  1UE9 A;  4FW2 A;  5EC7 A;  1QCF A;  1S72 T;  4RTY A;  1MV3 A;  4P5N A;  4RCC A;  2K7A A;  3CD6 T;  2ZCF B;  4MDX A;  3CCV T;  1KQS P;  3QII A;  5GAM d;  2GGR A;  3RUX A;  3ASK A;  1PC0 A;  3H0I A;  5FU7 B;  1UTI A;  1KQS S;  2HAX A;  4R55 A;  1G83 A;  1BIB A;  3OBY A;  1N27 A;  3QO3 A;  2XDB A;  4DBQ A;  5J26 A;  2NUT B;  2XID A;  1Q82 C;  2CSQ A;  4DBF A;  1NLP C;  1NJI U;  1VQP Q;  4RTW A;  4GLK A;  1Q86 U;  2D1X A;  3DB4 A;  3CCV A;  4F04 B;  1K1Z A;  3LH0 A;  1U8R A;  2J6O A;  4EMK A;  2DPP B;  3OS2 A;  2V1Q A;  4ELZ C;  1LPL A;  2DL4 A;  3MP6 A;  1AWO A;  5CO7 A;  4A4K A;  5LJ5 h;  1Q82 R;  2K6D A;  3KFV A;  3V7R A;  1M90 C;  4BB7 A;  1WJR A;  5M9O A;  4PJO A;  1I81 A;  2VVK A;  4PLI A;  4M7A E;  1N8R C;  2FPF A;  2GQV A;  5GAN g;  5GAM j;  1VIE A;  2M0O A;  3UDC A;  4C8Q A;  4HCK A;  3FLG A;  1M1K C;  1PHT A;  4E7L A;  3VUZ A;  1VOM A;  3CCV Q;  1NLO C;  2D6F A;  1C0M A;  5IN1 A;  2DTH A;  3A8H B;  1WHM A;  3PMT A;  3G6E T;  3UAT A;  3CPF A;  5IHN A;  3LYI A;  1UGR B;  1M90 R;  3CMA T;  2LJ0 A;  2LC4 A;  2ROT A;  1YI2 T;  4Z89 A;  3JCM b;  3OYG A;  1JJ2 A;  1K73 U;  1T3S A;  3MCA B;  3ME9 A;  3TRE A;  3ZBD A;  4TVR A;  1Q7Y C;  1M1K R;  3R6N A;  4LUD A;  2LT4 A;  2VYT A;  3TSZ A;  1C1A A;  3G6E A;  1JBM A;  1GFD A;  3A1P A;  2WSE E;  3MKD A;  4LNP A;  2QGG A;  2DL5 A;  2RQU A;  3P8D A;  3CMA A;  3VS6 A;  2DX1 A;  4LXC A;  2GTO A;  1YI2 A;  2K5I A;  3CCU T;  3CCQ T;  2KXC A;  4PFO A;  3OBW A;  1OQK A;  1DJ7 B;  4OGE A;  4E7S A;  3VS4 A;  2OTJ T;  2ESW A;  2NUZ A;  4XTV A;  1UDL A;  1MMD A;  4HVV A;  2JXB A;  2FEI A;  3NFC A;  2ECZ A;  4OMF B;  3V8L A;  3UPU A;  3G6E Q;  1UJ0 A;  4JS5 A;  4M77 G;  2IPO B;  3CCU A;  2KQW A;  1MND A;  2CP0 A;  1YJW T;  3CMA Q;  2X4X A;  4JZ3 A;  1Y96 A;  2KMT A;  1YI2 Q;  2OTJ A;  3HTR A;  2K3B A;  5IHI A;  4AFQ C;  3EGX A;  2RHX A;  3VYH B;  7AT1 B;  4DEY A;  3NMZ C;  3A8O B;  3VJP A;  1YJ9 T;  1RAC B;  1YJN T;  2KGT A;  1I5L A;  1NYG A;  5L23 A;  1M2V B;  2F1L A;  4QVD A;  1M1F A;  3T9N A;  1SSH A;  1JEG A;  1NPR A;  1K4U S;  2ABL A;  2NUP B;  2RI5 A;  1PWT A;  3C12 A;  2JMA A;  3JCM h;  3L2U A;  2VAS A;  3CCU Q;  1YHQ A;  1FMV A;  1ZSG A;  2M02 A;  2JS2 A;  5A0L A;  4RTX A;  2FRW A;  3ULR B;  2OTL A;  1JO8 A;  1PG5 B;  2M16 A;  4GLM A;  5AYF A;  5KYW A;  1D3B A;  4R0K A;  2OTJ Q;  2PVD B;  3VS0 A;  1RLP C;  2LDM A;  2YRD A;  4WTO B;  4JJB A;  1M3C A;  1RAA B;  1XNI A;  4XU3 A;  3Q1J A;  3UWN A;  1QMC A;  1YFN A;  3CCM T;  2DL7 A;  2DKG A;  2C0T A;  3GP8 A;  3VUB A;  4B9W A;  1RAH B;  1SG5 A;  4QQ6 A;  1LOJ A;  2LCS A;  1M30 A;  2QA4 T;  1JU5 C;  2DJQ A;  1OZ3 A;  3CBO A;  3QYH B;  1WYX A;  4RTT A;  2ENM A;  3O8V A;  5FU6 C;  2OTL Q;  4XU2 A;  2HL5 C;  2RMO A;  4X9C A;  2E1H A;  2KVQ G;  1YJ9 Q;  2DA9 A;  2K4Y A;  4JRK A;  1VQK T;  1TUD A;  3GNG A;  1BYM A;  1QWF A;  3I5R A;  4N0A A;  4XQ3 A;  4FIB A;  2QA4 A;  3RKY A;  4YTL A;  1AD5 A;  1WJQ A;  2ZZD A;  3GBQ A;  2V26 A;  1YP5 A;  2DYB A;  3RBB B;  1MHN A;  4A4G A;  3A98 A;  2YLC A;  2A7Y A;  2G6F X;  2P0K A;  3SB2 A;  1UEB A;  1E6H A;  1VQO T;  3DLL A;  5GAN 7;  3AT1 B;  4X34 A;  2X51 A;  1KD1 C;  5HK0 A;  1D0Y A;  2LQW A;  2M51 A;  3HSB A;  4E7I A;  4FL6 A;  1AEY A;  3LGL A;  2QA4 Q;  3CME A;  4C92 B;  2YHT A;  2VB6 A;  5D6Y A;  3HPW A;  1VQO A;  1K9M U;  2HDA A;  1GCQ C;  2F2W A;  2QQS A;  3M57 A;  1VQM T;  2DBM A;  4IUR A;  4ORZ A;  3BE3 A;  2FL7 A;  1KD1 R;  2CZ1 B;  3DLM A;  1UGP B;  4M77 A;  1IZ6 A;  1ZBX A;  2DYI A;  4BE1 A;  3IQL A;  2JM8 A;  2B8A A;  3PT9 A;  4NOY A;  2CT4 A;  1WQW A;  2EJG A;  3PTA A;  3CME Q;  3M0R A;  1H92 A;  1N9R A;  2O4X B;  4OVA A;  2Y90 A;  1VQM A;  3OB9 A;  3SWN C;  1VQO Q;  4IUQ A;  5CK9 A;  1W2B P;  2Y4Y A;  1VQL T;  4M78 B;  1NJI C;  1RAB B;  3RER A;  3I35 A;  4JRQ A;  4XAX B;  2OI3 A;  2FZC B;  1VQM Q;  1TWB A;  4Z02 A;  3MPU B;  2E10 A;  1MGQ A;  4DOV A;  4JJN K;  1NJI R;  2BKD N;  2YRV A;  2JT4 A;  4LDU A;  1Q86 R;  1VQ7 T;  5DLQ E;  2WAC A;  1IGU A;  2DMO A;  1B7T A;  2FPD A;  4RTU A;  4C5G A;  2Z0W A;  1IHV A;  2MMP A;  4OB3 B;  2EQU A;  5KYW B;  4D8K A;  3QSU A;  3JB9 H;  3TQ7 P;  2RHI A;  2GNC A;  4HCB A;  1X75 C;  3H9N A;  2W0Z A;  4J9G A;  1OYX A;  4Z88 A;  3PVQ A;  3WVD B;  2JN0 A;  2COZ A;  2BE9 B;  1VQ7 A;  2ZAE A;  5I2M A;  1K73 C;  2HBW A;  5IHK A;  1OPL A;  2XDD A;  5GMK m;  1QVP A;  4RTV A;  2EYW A;  3M0Q A;  3LW5 E;  1X2Q A;  2D8J A;  2RQV A;  5FRM A;  4BY6 C;  4OMP A;  1H8K A;  1SRM A;  2EWN A;  2H3J A;  4CC7 A;  3EFO A;  5CKD A;  3EHR A;  2LJ3 A;  1UHC A;  1T0J A;  2A08 A;  1K73 R;  1JJ2 P;  1BCM A;  3UF4 A;  2H3E B;  1VQ7 Q;  5DY9 A;  1JJ2 S;  4C0F A;  3JCM J;  2A0F B;  2MWO A;  4FYW B;  5HY6 A;  1B34 B;  1YIT T;  5LJ3 g;  1EZZ B;  4HA8 A;  4OB1 B;  3GLX A;  1KQ1 A;  1OZ2 A;  3CCE T;  1BI0 A;  3I9Q A;  3QHS A;  2L0A A;  1VQ6 T;  2NUT A;  1RAE B;  1H3H A;  4OMO A;  2P84 A;  4XU1 A;  4PJO E;  5LJ5 d;  4J6W A;  4M4Z A;  3OYY A;  2P0Q A;  3M53 A;  1Z9Q A;  1KQ2 A;  4FSX A;  4C8Q E;  4ZGJ B;  1YIT A;  1B07 A;  5GMK l;  2DXC A;  2A3L A;  3OSS C;  5GMK j;  3FIF A;  1H3Z A;  2LX7 A;  4IUV A;  2O31 A;  2X4J A;  3TCJ A;  2DZ9 A;  3A8G B;  4FT4 A;  5IAY A;  5LJ3 j;  2DK3 A;  3CC4 T;  2BE7 D;  5HCK A;  3VRZ A;  2M1H A;  2FYK A;  1QLY A;  1YIT Q;  2HQH A;  2MI6 A;  5CKH A;  3X25 B;  4OMQ A;  5LJ5 j;  3BY7 A;  1KIK A;  4ZGD B;  4FCY A;  2E3H A;  4BI3 A;  1C6V X;  1R0C B;  2QQ9 A;  4JZ4 A;  8ATC B;  2QYZ A;  2QDY B;  2JS0 A;  5GAM e;  1VQ5 A;  3EAE A;  2RJE A;  2ROL A;  2R57 A;  2FRY A;  4L59 A;  4NL2 A;  2X3W D;  5FWC A;  4CC4 B;  1OI1 A;  3I56 T;  2HEQ A;  4M75 D;  5I2S A;  4O6J A;  3LWI A;  2VGM A;  1WHL A;  2LVM A;  3V7S A;  3C95 A;  2QXF A;  1UGV A;  2NLU A;  2HQX A;  2DEQ A;  3OYM A;  4ZGE B;  2LQK A;  1E6G A;  2QTX A;  4C92 G;  3OYC A;  4EPC A;  3EG2 A;  4KUI A;  3NGP A;  2LCL A;  1WXT A;  5A2Q E;  3QJY A;  1BBZ A;  4J9C A;  5GMK i;  4A4E A;  1OUL A;  3OQ5 A;  2Y4X A;  3QYG B;  4FU6 A;  4XTU A;  1YBY A;  2V8I A;  3KBG A;  1FYN A;  1H64 1;  5FU6 B;  3VS2 A;  3KUF A;  3JCM d;  4D8D A;  1PRL C;  2DD4 A;  1K9M C;  2GTJ A;  3MHX A;  2DLP A;  1M2V A;  4AMC A;  4NL3 A;  3H6Z A;  2V8K A;  2XHC A;  3HHT B;  4EDU A;  4L5G A;  1M2O A;  3VYG A;  3JCM X;  2BTT A;  3CC2 T;  2NUP A;  2OJ2 A;  3TEE A;  4M78 G;  2IG0 A;  4AT1 B;  3EFO B;  1BKB A;  2BZY A;  2JTF A;  2C0O A;  3G7Z A;  1QW1 A;  1K9M R;  3JCM f;  4OML A;  3RDV A;  3M56 A;  1G3S A;  4RMO A;  4KH0 B;  3MET A;  1ZSZ C;  2XDP A;  3H0F A;  2QQA A;  1I1J A;  2EQM A;  4A63 B;  1MUZ A;  4QQD A;  3FJ5 A;  5GAM g;  3CC2 A;  4C5E A;  1NEG A;  1UEC A;  3M54 A;  3I5S A;  4JLG A;  4HCZ A;  1RAG B;  1S72 A;  1FX7 A;  5GAO r;  1QCO A;  1V29 B;  4M7A D;  4M75 F;  2L2P A;  2YLB A;  3CD6 A;  2SEM A;  2EYY A;  3L2Z A;  4M75 C;  4MZM A;  1P92 A;  2L5Q A;  4J5Y A;  1WJS A;  3OYL A;  1VQ9 T;  1VQN T;  4J6X A;  2MOX A;  3QBY A;  2DD5 A;  2VXF A;  1SKU B;  1BK2 A;  3EG9 B;  3CC2 Q;  4LN2 A;  2PUK B;  4J9D A;  1HJD A;  2HKN A;  4IIM A;  1R77 A;  2NWM A;  1S72 Q;  3PFS A;  3URG A;  2CUB A;  3CD6 Q;  1VQN A;  2RO0 A;  1X69 A;  2KRM A; 
#chains in the Genus database with same CATH homology
 1G3T A;  2RJC A;  4RKU E;  3O8V A;  5FU6 C;  4C8Q C;  4DA4 A;  5IT9 E;  4M77 E;  4XU2 A;  3CCR T;  4X9C A;  1Q81 U;  2RI2 A;  1M90 U;  3E9G A;  2HNI A;  2E1H A;  2KVQ G;  3FJP A;  4C0G A;  4UC4 A;  4LDX A;  4E7J A;  3NTI A;  2K4Y A;  4JRK A;  1VQK T;  2P4T A;  3M58 A;  2QEX A;  1X01 A;  1D3B B;  3CCS T;  1PSE A;  3GNG A;  4LDV A;  3LLR A;  1BYM A;  2RJF A;  2PVO B;  2F69 A;  3NTK A;  1VQ4 T;  3QJ6 A;  5CKE A;  4N0A A;  3PGG A;  2KDS A;  1M1K U;  4XQ3 A;  4B9X A;  4FIB A;  4ME7 A;  4OB0 B;  4C92 A;  2QA4 A;  3HRU A;  4YTL A;  3RKY A;  1M8V A;  3M59 A;  4MZT A;  1WJQ A;  2JUF A;  2ZZD A;  5CVI A;  4C92 C;  3JCM Q;  3I56 A;  4HKE A;  3L2Q A;  4M7D E;  1MHN A;  4A4G A;  4A54 A;  3CCR A;  3OS5 A;  3RIR A;  2YLC A;  2F5K A;  2LRQ A;  2A7Y A;  2E65 A;  2P0K A;  3SB2 A;  4BDY A;  1UEB A;  4N4G A;  1VQO T;  3CCS A;  3DLL A;  5GAN 7;  1G3W A;  3UT1 A;  4X34 A;  4HCC A;  5FLX E;  5GAO p;  4QVZ A;  3I55 T;  3JCM g;  1VQ4 A;  1K8A U;  4LDY A;  1KD1 C;  2RI3 A;  5HK0 A;  5GAN f;  2K2V A;  3FB9 A;  5FRO A;  2CKK A;  5HK3 A;  2X4W A;  4FM4 B;  5LL6 S;  4BAC A;  1FWZ A;  4KBM B;  4KT0 E;  4QW2 A;  4E7I A;  2O4X A;  4FL6 A;  3HSB A;  3OYI A;  3LGL A;  3OA6 A;  3G71 A;  3CME A;  4OF1 A;  3V8K A;  3L2W A;  3MEA A;  3G4S T;  5EG2 A;  2HQE A;  3M4G A;  5I21 A;  4C92 B;  2YHT A;  4C92 D;  3M5A A;  5D6Y A;  4M7A F;  3V8J A;  2DXT A;  3HPW A;  1VQO A;  1K9M U;  2MAM A;  4M78 A;  3OW2 S;  4M7A C;  2QQS A;  3M57 A;  1VQM T;  5KCH A;  1KG1 A;  4IUR A;  5LJ3 d;  4F7U E;  3CCQ A;  2FL7 A;  5CKB A;  2CZ1 B;  3DLM A;  1UGP B;  5D6X A;  1RI0 A;  2MWP A;  4M77 A;  3CXC S;  3S3M A;  1Y07 A;  1IZ6 A;  1N9S A;  1ZBX A;  5GAO q;  1WQ7 A;  3QG1 A;  2E12 A;  4II1 A;  4BY6 B;  4BE1 A;  2CS7 A;  4QQG A;  2VXE A;  4RG8 A;  3N5B B;  2B8A A;  3PT9 A;  4NOY A;  2R5A A;  4XTZ A;  4RG2 A;  4WF2 A;  3G4S A;  1WQW A;  2EJG A;  3JB9 G;  1EIF A;  2GF7 A;  3JCM e;  2RHU A;  3PTA A;  1LJO A;  1ZQ1 A;  4X9D A;  3J81 E;  2GCX A;  3SWN A;  1N9R A;  2HBP A;  2AHJ B;  4ELY C;  4E7K A;  5FRN A;  2O4X B;  4C5I A;  4OVA A;  2Y90 A;  5GAN 4;  1VQM A;  1FXX A;  3OB9 A;  3SWN C;  2P0P A;  1ZHI A;  4M7D F;  1XTD A;  4IUQ A;  2EQK A;  3X26 B;  5CK9 A;  2QI2 A;  1YJW A;  5LJ3 f;  1HXD A;  4M7D C;  2Y4Y A;  5KE2 A;  5L8R E;  1TH7 A;  4N4I A;  1LNX A;  1VQL T;  2E41 A;  4M78 B;  4M78 D;  1NJI C;  2RD1 A;  3J80 E;  1G5V A;  1KC8 C;  4M77 B;  1YJ9 A;  4M77 D;  4A4H A;  3RER A;  1YJN A;  4OGC A;  1AHJ B;  2EAY A;  2EYQ A;  1NPP A;  2K3X A;  5J39 A;  5GMK h;  5C0M A;  4JRQ A;  5LJ5 f;  1U1T A;  3FDR A;  4XAX B;  3X20 B;  3L2R A;  4M75 G;  1KHI A;  4VUB A;  2XU8 A;  2EQJ A;  4XTY A;  3R6O A;  2L8D A;  2EJF A;  3CC7 T;  4J7F A;  2KK4 A;  4BUG A;  3OYK A;  3OYB A;  2CYZ B;  3CCL T;  4GY5 A;  1VQ5 T;  4Z02 A;  2DAQ A;  5D6W A;  3RKW A;  1YIJ T;  4DOV A;  2E10 A;  1MGQ A;  3PNW C;  5LJ3 h;  3DKM A;  3SWN B;  3S3O A;  1KC8 U;  4JJN K;  2C06 A;  3OYD A;  2BKD N;  3PIO A;  2YRV A;  4LDU A;  3JB9 J;  4IUT A;  4M7D B;  4M7D D;  1XQH A;  5GAN 6;  3DB3 A;  1VQ7 T;  3QZ5 B;  2IVW A;  5DLQ E;  4ZTJ A;  5GAM f;  2WAC A;  5GAO n;  4F7U F;  4D6W A;  4XU0 A;  4R56 A;  3OYE A;  2R58 A;  4JUV A;  2RH2 A;  4ZTF A;  2RK1 A;  1M4Z A;  4C5G A;  2EJ9 A;  2MMP A;  3EFR A;  3HL8 A;  4OB3 B;  1VQ9 A;  4LD9 K;  3CC7 A;  2V8J A;  2EQU A;  3HP9 A;  4PJO G;  1O75 A;  3CCM A;  3QSU A;  3CCL A;  3JB9 H;  2RHI A;  1BI3 A;  4HCB A;  1X75 C;  5GAN d;  1YIJ A;  4C8Q G;  3PMI A;  1OYX A;  4RCB A;  3OYJ A;  2XI9 A;  3QKJ A;  4C92 F;  3WVD B;  2JN0 A;  2E70 A;  4N0A C;  2BIV A;  2DTO A;  1VQ7 A;  5I2M A;  2CZ7 B;  3A5Z B;  3JCM P;  1K73 C;  4JRP A;  1B34 A;  2E6N A;  2PU9 B;  4CRI A;  3OYA A;  5CAI A;  3JCM V;  2XDD A;  1U1S A;  2GFU A;  2ZPE B;  4CI0 C;  5GMK m;  1QVP A;  2JOY A;  1VQK A;  1RL2 A;  3INZ A;  3LW5 E;  2VC8 A;  4DOW A;  5DLO A;  1QVF S;  4F7U B;  1VUB A;  2E5Q A;  2RJD A;  3MP8 A;  5FRM A;  4BY6 C;  2JVV A;  3E19 A;  3L42 A;  4LDW A;  1BI1 A;  2G3R A;  3P8H A;  2EWN A;  3S6W A;  2H3J A;  5CKD A;  2FHD A;  4DQ2 A;  1R8O B;  2DTI A;  1UGQ B;  4LD6 A;  4PL6 A;  3OW2 A;  2EFI A;  4HT8 A;  4C5H A;  2L3R A;  3HFN A;  5CIU A;  4E7H A;  4M75 E;  2RA2 A;  3BDU A;  2LTO A;  2RB6 A;  3CXC A;  3JCM W;  5DY9 A;  1JJ2 S;  2GFA A;  2PUO B;  4C0F A;  5GAN e;  2RHZ A;  1WNL A;  3JCM J;  1KD1 U;  2LCC A;  2FVU A;  2MWO A;  4MDW A;  5HY6 A;  4MML A;  1VQP T;  3QXE B;  4M78 F;  3OS1 A;  3I55 A;  5GAN j;  1B34 B;  1YIT T;  3JB9 I;  5LJ3 g;  4IUP A;  3M4Y A;  4HA8 A;  4M78 C;  3QPH A;  1JB0 E;  2MF2 A;  1QP2 A;  2PVG B;  4M77 F;  3RKX A;  2XK0 A;  4OB1 B;  3VV0 A;  3GLX A;  2JNG A;  1KQ1 A;  1OZ2 A;  3CCE T;  3TU4 K;  1BI0 A;  5GAN h;  4E47 A;  4M77 C;  3QHS A;  2VGN A;  1VQ6 T;  4M7A G;  5KE3 A;  1IRE B;  2ZPG B;  4BE2 A;  5CQX A;  2E64 A;  4XU1 A;  4PJO E;  2LT1 A;  3MEU A;  5LJ5 d;  1BI2 A;  4QVC A;  4J6W A;  1HK9 A;  3ER0 A;  3OYY A;  3GPL A;  2P0Q A;  3M53 A;  4BDZ A;  1W2B A;  2K3Y A;  4FSX A;  1KQ2 A;  2ZPI B;  4JRI A;  3CBM A;  4C8Q E;  1VQP A;  4ZGJ B;  2ZPH B;  1BIA A;  2DXU A;  1YIT A;  1S72 T;  3HRT A;  3HKS A;  1WPY A;  3OYF A;  4P5N A;  4RCC A;  2F5T X;  5GAN 2;  5GMK l;  2DXC A;  3CD6 T;  5GMK e;  1YHQ T;  2LX9 A;  2A3L A;  2ZCF B;  4MDX A;  3OSS C;  3CPW S;  3CCV T;  4PLL A;  5GMK j;  1QVG A;  2OTL T;  3QII A;  5GAM d;  3RUX A;  3ASK A;  3FIF A;  1H3Z A;  2XIC A;  4OB2 B;  2EKO A;  3H8Z A;  1Q86 C;  5FU7 B;  1KQS S;  4IUV A;  2CGH A;  2LNV A;  4R55 A;  1Y7X A;  2X4J A;  3TCJ A;  1BIB A;  2HAX A;  5LJ3 e;  2FB7 A;  3OBY A;  1N27 A;  2DZ9 A;  3QO3 A;  2XDB A;  4M7D G;  2CZ0 B;  3A8G B;  1GXI E;  4FT4 A;  5IAY A;  3M55 A;  2DK3 A;  5J26 A;  2XID A;  4A4F A;  5LJ3 j;  3CC4 T;  4V2S A;  4HT9 A;  3SFM A;  1Q82 C;  3M9Q A;  2K5L A;  4M75 A;  1NJI U;  1Y71 A;  2BUD A;  2KSS A;  4C0Z A;  2M1H A;  2X4Y A;  3MP1 A;  4GLK A;  1N6A A;  2FYK A;  3RMS A;  1XOV A;  1Q86 U;  2RK2 A;  2CZ6 B;  3DB4 A;  4XTX A;  1KHC A;  2M9U A;  2MI6 A;  3CCV A;  1VQL A;  5CKH A;  1NZ9 A;  2ZPB B;  1O9S A;  4Y28 E;  3X25 B;  5LJ5 e;  3LH0 A;  4KUD K;  4IKF A;  1U8R A;  4O5V A;  3V7C A;  5LJ5 j;  4EMK A;  2DPP B;  3OS2 A;  3BY7 A;  3P8B B;  3QZ9 B;  3E1S A;  4ELZ C;  1VQ8 T;  5HKC A;  4ZGD B;  4J83 A;  4BI3 A;  5CKF A;  3MP6 A;  2QQ9 A;  5CO7 A;  2R5M A;  4A4K A;  3C94 A;  2QEX T;  3BW1 A;  3ZFJ A;  5LJ5 h;  2XD0 A;  2QDY B;  3V7R A;  1Q81 C;  5GAN 8;  1M90 C;  3J7A F;  4BB7 A;  1WJR A;  4PKC C;  5M9O A;  3L2V A;  2D0Q B;  4FT2 A;  5GAM e;  1VQ5 A;  4PJO A;  1I81 A;  3EAE A;  2RJE A;  4PLI A;  2I2L A;  1N8R C;  2GQV A;  5GAN g;  4M7A E;  2R57 A;  3A8M B;  3FRN A;  2ZGW A;  5GAM j;  4F7U G;  1VIE A;  2K57 A;  2M0O A;  4J7I A;  3UDC A;  4L59 A;  4C8Q A;  4A53 A;  4NL2 A;  5KH6 A;  3GOX A;  1PSF A;  3FLG A;  1JRI A;  5C6S A;  1M1K C;  4E7L A;  1UGS B;  3VUZ A;  1OI1 A;  3I56 T;  4M75 B;  3A8L B;  4M75 D;  2D6F A;  5I2S A;  4O6J A;  4EMG A;  1X6O A;  3LWI A;  3CEY A;  5IN1 A;  2KAF A;  2VGM A;  2K5F A;  2DTH A;  1VQ8 A;  3A8H B;  5GAM h;  3PMT A;  3FEO A;  4MZP A;  3G6E T;  2LVM A;  3V7S A;  2PQW A;  5J3B A;  3CPF A;  3C95 A;  1M9S A;  5CQY A;  3JRZ A;  3LYI A;  2QXF A;  2NLU A;  1N8R U;  3CCJ T;  1UGR B;  2HQX A;  3C4S A;  2DEQ A;  3OYM A;  4ZGE B;  3OYN A;  3CMA T;  2QTX A;  2LQK A;  1M1G A;  2LC4 A;  3OMG A;  4C92 G;  4EMK B;  2LQ8 A;  4EPC A;  3OYC A;  4BE0 A;  1YI2 T;  3WXM B;  2RM4 A;  3JCM b;  3OYG A;  4KUI A;  1JJ2 A;  1K73 U;  2HD0 A;  4KUL A;  3MCA B;  4OP0 A;  3ME9 A;  3TRE A;  3ZBD A;  2LCL A;  4TVR A;  3ZEH A;  5KCO A;  3OY9 A;  1Q7Y C;  5A2Q E;  4ZN3 A;  2DO3 A;  1K8A C;  4C0D B;  3G71 T;  3QJY A;  3CME T;  3FC3 A;  5GMK i;  4JS4 A;  2LT4 A;  4PJO B;  2VYT A;  4A4E A;  4PJO D;  3SDZ A;  3OQ5 A;  2Y4X A;  3QYG B;  4FU6 A;  4XTU A;  2DJZ A;  2DXB A;  1JBM A;  3G6E A;  4BI4 A;  5CCA A;  1YBY A;  2V8I A;  3NTH A;  2VV5 A;  3F70 A;  3KBG A;  1H64 1;  2WSE E;  5FU6 B;  4C8Q B;  4C8Q D;  4EMH A;  3CCJ A;  3BDL A;  1NE8 A;  3KUF A;  3JCM d;  3P8D A;  3CMA A;  4ATO A;  1YI2 A;  2K5I A;  3CCU T;  1Q7Y U;  3CCQ T;  2WSF E;  2DD4 A;  3MEV A;  1K9M C;  3PIP A;  3OBW A;  1DJ7 B;  4OGE A;  3MHX A;  4NL3 A;  2OTJ T;  3H6Z A;  4N4H A;  3GNF B;  2V8K A;  2XHC A;  3HHT B;  5FU7 C;  4EDU A;  4L5G A;  4XTV A;  3VYG A;  3JCM X;  1YCY A;  3L1A A;  3LX7 A;  4PNO A;  2L89 A;  3CC2 T;  2WSC E;  5A0D A;  2OAU A;  2ZPF B;  5DM7 R;  4M7A A;  3TEE A;  4M78 G;  2JTM A;  2IG0 A;  1BKB A;  3NFC A;  5LJ5 g;  4OMF B;  2JTF A;  2XG8 D;  3V8L A;  5GAO m;  3CPW A;  3JB9 F;  2VUB A;  3OS0 A;  1WGS A;  3UPU A;  4JS5 A;  4BI8 B;  3G7Z A;  1QW1 A;  4M77 G;  3CCU A;  3RES A;  2KQW A;  3AHU A;  3GIB A;  2D9T A;  3JCM f;  1YJW T;  1KQS A;  4Y91 A;  3RMQ A;  2X4X A;  4J6Y A;  1Y96 A;  3JSC A;  2KMT A;  1G3S A;  3M56 A;  4L6V 5;  4ZN1 A;  4RMO A;  3CBP A;  2OTJ A;  3MET A;  3OSV A;  1VIF A;  2XDP A;  3BFM A;  3QDR B;  2QQA A;  2EQM A;  2KY9 A;  3CCE A;  4JLI A;  3HFO A;  1VQ6 A;  4XTW A;  2RHX A;  4QQD A;  3VYH B;  5GAM g;  3OYH A;  3CC2 A;  3QUI A;  4C5E A;  3A8O B;  4JDS A;  3VJP A;  3MEW A;  5GAN 5;  1YJ9 T;  1YJN T;  4MMK A;  1I5L A;  3WVE B;  4IUU A;  3X28 B;  2QQR A;  3HRS A;  4C92 E;  4QVD A;  3M54 A;  1M1F A;  3T9N A;  1NPR A;  2DIQ A;  1SSF A;  2QQB A;  4HCZ A;  4JLG A;  5A0G A;  4M7D A;  3X24 B;  1S72 A;  1FX7 A;  5GAO r;  2RI5 A;  1I8F A;  1M5Q 1;  1V29 B;  2EIF A;  3C12 A;  3OMC A;  2X35 A;  4M7A B;  3LGF A;  4M75 F;  4J8O A;  2YLB A;  3CD6 A;  3JCM h;  4M7A D;  3L2U A;  2E6Z A;  1YHQ A;  3KXT A;  3JB9 D;  3L2Z A;  4M75 C;  4MZM A;  1W2B S;  1P92 A;  2L5Q A;  4J5Y A;  5A0L A;  3GF5 A;  2DVE A;  4Q5W A;  2OTL A;  1WJS A;  3LWH A;  5AYF A;  2M16 A;  4BD3 A;  3OYL A;  1VQ9 T;  1D3B A;  1VQN T;  2PVD B;  3S3N A;  2LDM A;  4J6X A;  3VKI A;  1Y96 B;  1XNI A;  3QBY A;  2DD5 A;  2VXF A;  4XU3 A;  5GAN 3;  1Q82 U;  3MO8 A;  3Q1J A;  3UWN A;  4EMK C;  1QVG S;  2PUK B;  3CC4 A;  2XKO C;  3CCM T;  1UB4 A;  4XK8 E;  5CR2 A;  3JAM E;  2DKG A;  2DZC A;  1W4S A;  2O01 E;  4NS5 A;  2JZ2 A;  3VUB A;  4B9W A;  1I4K 1;  3GP8 A;  1QP3 A;  3JCM c;  4PJO F;  5GAO l;  3VU3 C;  4QQ6 A;  4C0D C;  1LOJ A;  3PFS A;  2QA4 T;  2RHY A;  3E9F A;  3URG A;  4PJO C;  2DIG A;  3EFS A;  3SD4 A;  4M78 E;  1VQN A;  4C8Q F;  2RO0 A;  1OZ3 A;  4F7U A;  3CBO A;  1G3Y A;  1QVF A;  3QYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...