4N0CD

42f3 tcr pcpe3/h-2ld complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
total genus 54
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cD02
3O4LB 1JBJA 4O02L 5D1QA 3VFVA 2DLFH 2UWEB 3GSXB 3L6FA 2PO6B 3QJHA 4WO4D 3HC0A 5FF6B 3TH2T 2IPTH 2PF6A 3PQYB 1I9JL 2GSGA 4XB8A 2V7NB 2FL5A 2JCCA 4NQEA 1A7PH 4JG1L 3OR6A 4QWWC 1PKOA 1I1FB 1QSEE 4ZUUB 3SDCC 1QA9B 2DS4A 1PX4A 1FZJB 1KJ2A 3TZVC 4KJQD 2VUYA 3QG6B 1JE6A 1I8KA 2NPLX 4QRQB 2P24B 4D0BB 4YXLH 2GTZB 3BISA 3QCVH 5I15H 3FMGL 4YPJA 5J06A 2WIIA 4ETYA 1CIUA 4PJHA 3LKRA 3T2OA 2EDXA 2QQNL 3H42H 4JG0L 4LEXH 5AWNL 4AG4L 1N5AB 2DM4A 3FQTA 3B9KA 3LSOA 5DQDL 3QPXL 1BD2E 1JVKA 4OD2A 5MHSE 3D3VA 4H25A 5C3LD 3O0RH 4FQHB 3DUSA 2D03L 4PJIB 1QRNA 4HIXL 3RNKA 5I8EB 1P84K 5GSVB 4WFED 1ND0B 1IM3A 2VN4A 4J3SA 1U8PB 3KG5A 1IAIH 3VXSA 4NO0A 5C0EB 3BRFA 3WIIL 2VXVH 1WC7B 2VXSH 4LQ1A 4ELMA 1QFWL 1CIDA 4QTHB 1Q8MA 5EPMA 5C71A 4XPAH 2EYTA 1ZHLA 1HOCB 2FDBP 3W9EB 1PLGH 4PRPE 1W8OA 4M62L 2BNRD 4YJZL 3KJ6H 1X5ZA 4QXGL 2J7LA 2FJHA 1P7QD 1FHGA 2P8LB 3X12A 4HWBA 4PV9A 2WBJA 1AP2B 5E6ID 3GMPA 3RVUC 1OPGH 4JFED 2ADJB 2AKRA 4QNPF 3U4EB 4HF5L 1WBXB 4DVBB 4XNMB 1KACB 5J1AB 1LDSA 4XVUD 4QHKJ 4K7PY 3IDGA 3CDGA 3W39A 3HFML 5T3XL 3DVFA 1AY1H 1FFOB 1E4WH 3D85A 2DICA 3UTTE 2XWTA 2EDKA 5IFJA 2BNRE 3D39B 1B0RA 3N1PC 3HG1D 4B7LA 3T2NH 3QIUC 3L5JA 1AJ7H 3TJEL 5B39A 1S7QA 1LDPL 5L0QB 1I1RA 2CR3A 2DOCA 3X12B 1BFOB 3U0TA 2XWJA 5C70A 4F33A 2HVJA 2CIIA 4OF5A 1AGDB 3FN3A 2YD5A 4G9FA 5T3ZE 3KS0J 2FBJH 3PV7A 1G9ML 3VWKC 2HLAB 3OJ2C 3ARRA 4HFUH 1T03L 4XNYL 5J6HA 3BGFC 5DEGA 1KF9B 1UEYA 2FX7H 1C5CL 3BGAA 1DN0B 4V1DA 4GBXB 1ED3B 1PQZA 5I17A 2DJSA 1NLBH 4M61B 4WI9A 5AZ2L 4DGVH 3WKMH 1YY8A 1OTSC 3OPZL 5F7EH 1A14H 1JMZA 2AK1H 1A02N 2H9GB 3OJVC 2VC2H 4L4TB 5IHUH 5DMIL 1RFDH 3RWEA 2NX5D 1FL3A 4RMSA 2IANB 1OPGL 3IB4A 1XGUA 2G75B 1MSPA 3N85H 4EXKA 4JO3H 4UQ3A 3NCFB 1IGJB 1U8IB 3TLRA 3GSUA 4UTAH 4AJ0A 4QTIH 3MLUH 3LQAC 3AS2A 5SWSA 2DLTA 1DQJA 1NCBL 3G04B 4I0PC 3G6JE 3MOQA 1G7QA 3B8YA 1DBJH 4F37F 4HULB 1WISA 3HZKA 4IBLT 2XXMB 3I02A 4J3VA 1JZ2A 4WFFE 4FXKA 5IJKC 3LS5L 3NFPA 1MI5A 3VFNB 1NFDB 2FO4A 3QDMA 5I8OH 2A6DA 3HI1A 4YDIH 2WUCL 5E2WH 3NIFE 1KXVC 5E9DD 1NCAH 5FKAB 3I85A 2G9HA 3C6SB 1QO3B 1X5KA 3QIWC 2OTUA 5EIIA 1JNLL 1H3VA 1NMBL 4DGYL 3V5KB 4JHWH 2X44D 4PP1D 1T7WA 2VITA 3Q2CA 5JO5A 4IJ3B 2F19H 1SHMA 3PGFH 3VXME 4KROB 3O2WL 2R2HB 4OZIF 1V3MA 3ZKND 5C09D 1P4IL 2J8UF 4XBEH 1WZMA 5B21A 4XTRC 1VB9A 2B4CH 2FH8A 3S4SA 3U36B 1JTTA 2NW3A 1EO5A 1YEGH 3BN9D 3PWUB 5GIRB 4HJ0D 3E3QE 4AEIL 3O3BB 1KTRL 1D6VL 3NTCL 3QXTA 5CP7B 2Q3ZA 1DVFB 4NQVA 2Q76B 1TZGL 3EOTL 4L8SC 4N1CA 4PY8J 3ZYJA 3BVNA 3WSQH 2GT9A 5EIQA 3O6KL 1U2HA 4YHYB 2VDOH 4JQXA 2D0GA 2QADD 3NN8A 3U9PH 1KT2A 1PKQE 3V8OA 3VH8A 4NUJA 3Q5YA 4UDTA 4K3HA 2RAMA 4ZAKC 3MGAA 2APFA 4M1CD 1O0VA 2Y36L 2X4RB 3DSNA 3DYMA 4YQXH 4XI5D 5IHZA 4F9LC 1U8HB 3T77B 1RVFH 3V7MA 3KYMB 2XG5A 3AU1B 3PWPB 3GK8L 5E6ZA 3JVGC 1YECL 5FYKE 2YEZB 1KIUA 1HILA 4APQD 4ZFGH 1MCDA 3VG0L 3HZKB 1MJ7L 1I8IB 3WLBA 1MHHA 5MERB 4KUCF 1JNNH 1D3CA 2C1PA 1T1WB 1Q94B 3C5JB 2NYYC 2IGFH 2XWBB 3SGDI 4TTDD 3WFDH 1TZIB 4Y16D 4NRYA 5DR5H 3C9NA 1A6ZB 3BN3B 3W9DA 4X6BA 4JVWA 4A2LA 3BPOC 3WLBB 4ODWB 1LP9F 3QNXB 1CDIA 3GKWH 4H1LA 3CVIL 4M00A 3UC0L 1T1XA 4Q9QH 1HSBA 1CGUA 1DBKH 2AK4E 2J88H 1FZKB 4LLDA 3U1SL 3G5VA 4YBQC 3V6ZA 1DLHB 1JZ3A 4HSQA 1AGFB 4XI5C 5GRYA 2ATKB 4WJ5A 5KVGL 3M8OH 3UO1H 4WEBL 5BZWA 3D25B 5DMJB 4YDKH 3IDYB 2BHUA 3V6FB 1BFOA 4PG2A 3OKNA 3UEZA 4MA1B 3TP4A 4X99B 3QO0B 4G9FB 3MGOA 3GJFA 1IILE 3BXNA 4MQXC 4UIKH 1D5XA 2HLFC 3GIVA 3MRNB 4JKPL 3TN0D 4K3GA 3RPIB 2VIRA 4ELMF 4E0RB 3F7VB 3LQMA 3OKOA 5TFSL 3STZB 4ZO8A 5DYOB 5EBLB 4K7PH 1Q38A 4E42B 5JTWA 1MIMH 3DO7B 2A6KA 5C0NC 4F58L 3UTOA 3GMPB 4P57B 4ZO9A 3CSBA 2V5RA 1H5BA 2V9QA 4N0UA 4MB3A 3SQBA 5CEYB 4MNQB 2ADGA 3W0WD 1ORQA 5IBTL 4DKFH 4KTDH 1CD9B 2ZJSL 1OAQH 2I5YH 5EA0H 4JFFD 1OD7A 5C0AB 3SKOB 4GMSH 3B9AA 3DIFA 4ODHL 3KPMB 4GXUN 2DAVA 1RUPL 4KAQL 4JRXB 1M4KA 3O11B 4NHUB 4LCCC 4ZTPL 1I9RL 3K3QA 3V6OE 2X4TB 4OAWB 1GGIH 4KTEH 3WN5B 4HKXA 4WUUD 1NL0L 1CL7I 3CUPA 3EYUL 1RHHB 3BDBA 3T8XB 5IB3B 4FS0A 2C4XA 1T66D 2B5IC 3WIHH 3NFPB 4JGUA 5AG8A 4LFHD 4EBQH 5C92A 2X5PA 4LVEA 4EIGB 3M1BB 4N0YH 4XCFL 3WYRA 4OZGF 2NXZB 3SJVD 1K5NB 4TOYL 3L7FB 3V52H 3U4AA 1MF2L 3HMXL 3UX9B 5F7EL 4LPTA 4XC1H 3HAEG 3FT3A 5KSVB 2C7UA 1BIIB 1CXKA 5BVPH 4LKCB 4O00A 5B38B 4B7IA 3QH3A 1G6RB 1UEMA 4JB9L 3INUL 2GYSA 2D0HA 2BJMH 4EN3D 4S2SA 3RY6C 5D6CA 1YY8B 4NBZB 5CGYC 4NHCL 3QEQD 4OV5A 4GG8B 4KKBD 3MLRH 3P4LA 5CILH 1K8IB 3S96B 3QZWG 3F62A 4MD5A 4MA7H 1XZ0B 4KJWC 1G6RA 4R9HA 3FB6A 2GCYA 2B8OT 5IVZB 4RX4D 3ZE1E 5JXEA 4YXHH 2Z93B 2RBLA 5DJAB 1T03H 2OI9B 5AYQA 3N1MC 3Q5TA 3C8KB 1CD0A 3I75B 3RTQA 1D6VH 3NTCH 1AGBA 4OBSA 2M26A 3C60D 3CMGA 2CLRB 3TIEA 1CFQB 1J1PH 2VKWA 4XP6H 3LZFH 1YNKL 1ZWIB 4OLUL 3SDAD 3U7YL 5HHPA 3GFUA 4MGXA 1M05B 3RBSA 2NY7L 1E4XI 1K8IA 3GJEB 3QPXH 4ETQB 2X4TA 4UAOC 4NZTL 1CT8B 4M1GL 4U1LB 4JO2H 3L3GB 3LEYH 5KZCD 1A64A 3IRPX 5DGQA 3MR9A 3ARPA 2AXGB 3I9GH 3DRTB 4Y5XA 3SDDC 1FV1B 1DBJL 1W72B 3THMH 1EBPA 1TITA 5FO9A 4YX2H 3E2HB 3VXSD 3SDCB 3W5MA 2DKMA 4RFNB 3TWCH 5C86A 1U9KA 5GJSH 4XH2B 1FFQA 4UOW0 2ICWB 1F4WH 3CX5J 3OSKA 2P44B 4JFOB 3VFTB 3L3IB 4XPBL 4J3OC 3VFUB 1EGJH 1E6OH 3ARED 1VGEL 3N9GH 3CDCA 5GSRB 4JFDD 3QIBB 1C5BL 5IMLB 4OLVH 3RWDA 3SJVA 1HNGA 5DD5L 1MCCA 4MAYC 5C2BL 3QA3B 2HG5B 4I9WE 4HWEH 4EDWH 3L5HA 1RZ8B 2GY7B 4OD1H 3SDCA 3UAJD 4Z8FH 5HSFA 4R4BB 3P77A 1OTSD 2D7TL 4HUXB 2D03H 4PS4L 3BYYA 1A0QL 3C8KA 4QF1B 1A8JH 4Y2DD 3LSOB 3I3EA 2XFXB 4UT7H 4XMPH 3GGWA 2ZCLL 2DQGH 4GKZA 5HDQH 3RZCA 1B90A 1ZGLB 1A7OL 2E7LA 4OZHB 5GRXG 4PS4H 3SCMD 1A6WL 1BPVA 5E8EB 3KDMB 5IMOA 1XGYH 2LV4A 2AJ3A 3W11D 3BKMH 2E7HA 3LRGA 3MUGB 5FGRA 1NKOA 4YX2L 5DGRA 3IDJB 5HVHB 2FD6L 4X9GA 3PWLA 4Z7WE 3VXQA 4JZOA 2VDMH 3IYLW 43C9A 1IM9D 1MQKL 4E41D 1JPSH 2OTPA 4XCCL 1RIUH 1HZHL 3DRQB 4X8XA 2GUOB 2VLKD 5GRUL 1YUHA 5IB5B 1BLNB 4LARL 3AM8A 3RU8H 1AXTH 4P5KB 1A6PA 1K9TA 1XZ0A 2R0KL 5E95B 1TNMA 2LU3A 4WIQA 1MAJA 4P2CG 1KCVL 1NGWA 1NCNA 3MUGA 3NCJH 1N6VA 1AHWB 5EU7E 5DD1L 4E41E 3CXDH 2VL5A 4DEPB 1OWRM 1MF2H 3HMXH 5B39G 5D2LB 2BOCB 5MP6L 1J0ZA 3OJDB 3NAAL 3SKMB 4JFEB 5F1SA 1L4IA 4E9LA 1EO7A 4YDVA 1S78C 3FOLA 3DMMA 4ELKB 5C6TL 4JRWA 5HJ3A 1HH9B 2F74B 1DCLA 3C5JA 1Q0XH 3RKPA 2LVCA 1OW0C 2XKNA 3PE9A 2IQAB 3QUYD 3FQNB 5E94A 3GSVA 5DJYA 3ZT7A 3TBSB 1U91B 3WEXB 1BVLA 2H2SC 4D3CH 3ULVD 1CE1L 4GRLB 4N0UB 1NH6A 4U1SA 2C4FU 1M7DB 1PSKL 2XNAA 3WIFA 3W2DL 5JORA 4MAYD 1M6OB 1GH7A 4G80B 5CUSL 8FABA 3WXVL 4O5LL 2QHRL 3TO4B 3WN5C 2X7LB 2O5YL 3QXUA 5LBSH 3GSOB 4LOUC 1A5FL 1U8MB 1J1XL 4GXUM 5JO5B 4V1DE 2OL3B 3L3IA 3BX7C 1BAFL 2XRAL 3AB0B 4NRZA 5FUZL 2VABA 1N5YH 4YXLL 5HYQB 4NRXB 4NDMA 1QR4A 3HG1E 3WL9A 2JELL 4PJFA 1A1NB 1WEJL 2QJDA 1QFUL 4YK4C 5D6DC 5DUMH 4NBXB 1FZOA 3HB3C 4FQ1L 2NYYD 3INUH 5GRJH 4Z0BH 1LHZA 3EFFB 3PJSB 4JPVH 3D0VB 3RDTC 5JMRA 4HK3J 2VERN 2E6QA 5SWSB 5J57B 4XX1E 1N59B 3PDOA 2HP4A 4FFWD 5D6CB 2ZUXA 2UUDH 3UDWA 5JHDA 2RHEA 2DLFL 4IIQB 1WWAX 1AI1L 3LS4H 4XT1C 5K9KB 3G9VA 3F12B 1I85A 1HXYA 2FEEI 1RZIA 3KPNA 4JY6B 5IJKA 1B2WH 4RCAA 2YXMA 5FCUL 4G9DB 4OF3A 1A7BA 2MJWA 5D1ZC 5BV7L 5IW6B 4MB5A 1OGAE 4M61A 3JWNC 5DVOA 1MLBA 1J87A 3OB8A 3TWCL 1SJHA 1P6FA 3CFEB 3QQ9C 1JPTL 3D18A 1ORSB 1WT5C 1Q1JH 3ARBC 2DDQL 4MQXD 4Y19E 4FZEL 2CJUH 4LPWA 4JM4H 3K80A 3IAGC 1Z2KA 3GSNH 3OGCA 1RZKC 4TNWK 3UP1A 1BX2B 5JZ7C 3CC5B 4M6MH 1INDH 1YN7A 1XR8A 5DS8B 5ADOL 2CK0L 4TYUA 1I85C 3SCMB 5M94B 4YXKH 4YO0B 3ARDA 3OB0K 3EO1A 3QJFA 1T6VN 4X80L 3IDIB 2NY2B 4K2UL 3V5HA 4EVNB 4MQSB 3DROB 3WFBH 5C08E 3GSQA 4MNHB 4XAWL 5B8CA 1OAUL 3TYGL 3SO3C 2DTMH 2R1WA 2EC9U 4POZC 1IC5H 3JTSA 3S88H 5LGKA 1XGPA 4JFPA 4RBPH 5L6YL 2X4RA 5F7YC 3IF1B 1KJ3H 4MJ5B 2VDLL 4S1RH 2C1OB 2E6PA 1QFPA 5EIVA 4Y5VA 3IU4H 4F7MA 1IEAA 2D9CA 5K93A 2APWA 5EUOE 3MA7A 2FR4B 4ZXBD 5I1HL 2AP2A 2KPNA 3DVNB 1H3WM 5F71A 2EDOA 1XR9B 5SWZB 3EFDH 4JLRB 3O4LE 1S7WB 3IDNA 2QSQA 3B3IA 4U1NB 2GW5A 1CU4L 4PRPA 5ALCL 3PL6D 2K7QA 4R7DA 4GRMA 5D2NC 3T0ED 2DQFA 3ARBB 4NQVB 2YN3A 4MA8H 3T0VA 1KV3A 5CHNA 4TULL 4WW2B 5J11B 1OAQL 1YPZF 5EA0L 2WZPD 5F1NB 5DWUH 1ZE3C 5FO7A 3EYQC 2ERJB 5KSAD 3VA2C 3ROLB 4QHMB 4XNXL 3QNXA 5HYJE 1IBGH 4DTGH 3HG1A 3OXRB 3DETC 2WNGA 4JFQB 1FFNB 3SDDD 1NGYB 5TF1L 3WSQL 4M1CC 5I0DA 4P4KD 5GJTL 4JPWL 2EDYA 4MDJB 4DVRH 3MLWL 1I3GH 3WFBL 2ZZUT 4NNYA 3MRDA 5E8NA 4ODXB 4YHPB 5T3ZH 1FAIL 1NDGA 1MCOL 2PYEB 4O2CB 3OKNB 4NUGH 2MNUA 5D7SL 4I77L 5DUML 3MMEA 4ZFOA 1BD2B 4FMKA 2R56L 3LPGA 4GAGH 3MNZA 4WFGE 1I1AB 4QYOA 4UUJB 4YBHA 1GGYA 1QLFA 5IEKB 5IB2B 5LJYH 4GG6F 6FABL 4AQ1B 1T89A 4HS6A 5D7JD 5FK9B 2APBA 4MNGA 3L1OL 3LQAL 3QDJE 1EV2E 2BOBA 3B2UC 5EO1A 1I7RA 5I8EA 1A4KA 3PQYA 2EZ0D 4NJAH 5FDYA 3QJHB 3BH8A 5J3HC 2ZPKL 1JI2A 4ODXA 4YHPA 4WFGD 5I9QC 4MA8L 5IW3A 1A7RH 1CLOH 1FBIH 4D9QE 1KGCE 4X5LA 2V6HA 2EEBA 1QACA 3M45A 1T1ZA 1NCDL 4LLMA 1S7VB 1MFCL 5EULV 3BGFB 1MRDL 3D0VA 3PP4L 4BZ1L 1AGEA 5JLZA 2GTZA 4R7NA 2ESVB 1DN0A 4WCYH 1S9VB 3KLDA 2JELH 3MRMB 4XPFL 3PWPA 3GMOB 5IBUG 4XP9L 3BKYL 5F1NA 5EU4B 1MAKA 3D85D 3VU2A 1E4JA 2ADJA 2AKRB 3IXAA 5TDOB 5DUBB 1BFSA 3H9SB 2CR6A 3AREC 3BP5A 4PV9B 2H45A 1MCPL 1TCRA 2PXYD 4A6YL 4PJ5A 1DUZA 4UU9B 3VFMB 4RIRB 5DC4B 3X11A 3GSWA 4UT9H 5L2KD 2R0WH 4P49A 4G6KH 1JPTH 1F4YL 1Y6NR 1FIGL 1OTTC 5F88A 4U6VH 2XWTB 4PJ5D 4JFFE 1WWWX 3G08A 1R3HB 4Y5VB 3A6CH 4FG6C 4HUNB 2XT1B 4O51A 3RTQD 4NKOA 3KYAA 1UVQA 1OT2A 2YD2A 3TA3A 3VXSB 1RJZB 3LKQA 1CGSH 2DMBA 4UMGA 3EYVB 3QHFH 1D6EB 3PWNB 4H88H 4B50A 3OKDB 3SDXB 5DD3L 2HKFL 1G7JA 3AMLA 1BM3L 1YZZA 4U7SA 1U91A 2ZUWA 3QCTH 2A83B 4FFVD 3IT8D 3MODL 1U3HD 5BS0E 3FONB 4YZFE 3SCMA 1WFNA 2XG4A 5DC0A 4RGOL 3QUYC 3FQTB 1PZ5A 3FN0H 4OZGB 5FCUH 3AXLA 4LHQB 3U7WH 3L3HA 3ORJA 3MBXH 2Y07H 5E2UL 4MZ3A 3SGKA 1ZT4B 2XKUA 3VD7A 3L3DB 4U1KA 1SJXA 2V17L 1FPTH 1KEML 2KQNA 3QI9A 4PGCB 1QKZH 4FQQB 5DD0L 1IGYB 5FA3A 2DLGA 5SWZD 4C56B 1I8MA 3OB0H 5IBUB 1NGQH 5JR1H 4KDTA 4P5KA 3GBMH 1MJUL 3LOWA 2X70B 3QG7H 1HZHH 1XIWD 2WW8A 2VC2L 1BJ1J 4ZXBA 1GGTA 1S9YA 2A77H 4NQEB 5F44A 3ARZA 4F7PA 1OL0A 2Z31A 3O45B 3BP6A 1FFPB 2IFFH 2DQEH 2NY4D 4PGBA 3MNVB 2EIZB 4YDLC 3RWFA 1JTOA 1JNJA 4XPBH 3QDJA 4V2BA 5ETUB 3FO2A 4KHTL 4P3DA 1R3IL 4QCIB 3RDTD 1FNSH 3HZMB 3WHE1 4RGMB 4LPVA 4G8IA 3LB6C 3MV7D 1HN1A 3WLWC 1XGYL 3LKNA 4U1IB 4XP1L 1YEFH 3O2DH 3Q6GH 1AP2A 1Z3GH 5IT2H 4PJAF 3EJZC 5E70A 3HNVH 1YUHB 5I71B 1ACYL 5F9OL 1JGVL 2XQYG 4XPTL 4NQTA 2UWEA 5HPMA 1YQVH 1J05A 4NQCA 5D7KD 3E8UH 2FR4A 4DCQB 1MHEB 4LSPL 2M2DA 5FUOH 1CDYA 4ZNEE 5GHWH 5F9OH 5F21B 1AQKL 1E0OB 2HAZA 4JO3L 1P84J 4FXGA 4QXGH 4PGCA 3LEVH 4L4VE 2IQ9H 2YPLE 5DD6B 3WS6C 4HC1A 3LQZB 2ZOLB 2P46B 1WWBX 5JPMA 2IMNA 3MBEA 5GPRA 2ZUTA 2XI9A 2VLJA 2R2CA 5HGDA 2D7QA 4JANA 1A2YA 3ULUL 5FDWA 2F53B 3BW9B 2R9HD 5I19L 3SDYH 1JPSL 3OAZH 4XCCH 2NQCA 4OGYH 5FFLA 3C2AL 4JFOA 3VFTA 4HMDA 2YSSB 5E94B 5C0CD 1E4WL 4XXCC 3RUGE 1FQ9C 2E9JA 5DRWA 5EOCH 4MAYB 2X89D 5L2JA 1IQDA 3A6OA 3RIFF 3O6FC 5I16B 4GRWH 2AJSL 4HUUA 1P2CB 3CJJA 3O81A 4LCUB 4WI4A 2IALA 5F3HA 3RGVA 4BKLB 5IEHA 5IMLA 5TQ2L 2VLJB 4W4NA 4LCWE 4X9BA 1UJTA 1GXEA 5HHPB 3WJLC 3QHZH 2J12B 2OSLA 4QRPA 4UNUA 2W59A 3UTSD 4TOYH 4JDVB 3VJ6B 2JK5A 3C5SA 3U79A 3V0VB 3U4BL 3MV8B 4WFFD 1ZEAH 1D5IL 2E8YA 2NY2C 4Z0XB 5TGBA 2P4AB 2IG2H 4DFHA 2DN7A 3E6HB 3P40A 3OKEB 3VA6A 1OGAB 3O9WD 3V6ZB 3V7AE 2IPUG 3J8F7 4GUPA 2V5MA 3BDYH 1RSFA 5K9JH 5KZCB 4XPHL 3DTXB 4I0PD 4ZFZA 4YEFA 2GCYB 1JZ6A 1N59A 2NY0B 1YMMD 1Y0LA 1XIWC 1WZKA 1G9NC 1JV5B 2JF1A 1F3JB 5EZLB 3TC9A 3BJLA 5B4MD 5DJXB 5D1XA 3VWJB 5BVJB 3FMGH 3QFJA 1OP3K 3QRGL 3D2UB 5IBLD 4IRSA 3ZDXE 2EYSA 5I1KL 3UYOD 1TFHA 4LHUA 5DK0A 4QCIA 2Z4QA 1E6OL 2ARJA 1TETH 3FO2B 3ZKXB 1E28B 4MCZA 3ES6A 4JQVC 5JW3H 5KSBF 3VXTB 4M8QA 4Z6AT 2AXHA 4LL9A 3PL6A 4MNGB 3G6JB 3O4OC 4G6KL 4P5TC 2AJXL 3HAEH 5H35B 3HE6C 3T65A 3QI9B 1LEGB 1OAZH 4GKSB 2EH8L 3L3DA 5DQJB 5ACMA 2YXFA 5D5MF 5E4EB 4OV5B 1NFDE 3V0AC 1Q9OB 2OR8A 3MRKB 5F7DA 4HKXB 4JRYB 3O2DL 4XVJH 4OAWA 1GZQA 2VQTA 2F54A 4ZNEA 3J7HA 1MRDH 2XY1A 4ZFOL 5DSCB 1KCRL 2MPAH 5BQ7A 4R8WL 3WUWA 1Q9WA 2EDNA 1ZT7A 4QLRA 3I6GB 5F1KC 3EYOA 3RVVC 3ULSB 5IFHL 5HGAB 3PWVB 4EI5D 2IAMD 5HDBF 3JZ7A 5I75B 5CS7A 1UXSA 1WBZA 4WWID 3LKQB 1CGWA 1KJ2L 4FABL 2VSCA 4JFHD 4L3EB 3C6LB 2JLLA 5INDA 2CDGB 1A2YB 2NW3B 1S7TA 4L1HA 3SOBL 2OYPA 3IXTB 3SO5A 4O58H 4JKPH 4Y2DA 1CG9A 1IM9B 4ETQA 4CBPA 1MPAH 1M7XA 5DJCB 5EBMB 3VI3F 3EDDA 1Z9SA 2D7NA 3B2VH 3QEGL 5A2JH 1OLZA 3T4YB 2X4SB 2X4PA 5BRZA 2NY6C 4XAKD 2EDQA 4HFWA 3I3BA 3B3IB 2W60A 4Z7VF 1YEHH 1KB9J 1TVHA 2HT2C 4Q0XL 4DFIA 4LQFL 3V95A 4XP4L 2AJYH 3X11B 1JGEB 7CGTA 2IH3A 2Z4QB 3WIHL 2GJJA 3D39D 5DURD 2X89A 2MSPA 1S9WB 1A6TA 1CFNB 1YEIH 5E1AA 1Z0MA 4YHIB 2ZUUA 1ZLSL 5TF1H 3LVEA 4LLVA 4OCWH 4XP4H 3MFFA 2IADB 5HHNB 3DGGB 2Q8AH 3QDJB 3F7VA 4NJAL 4LLQA 1CL7H 4OLXL 5C7XL 1JYNA 5FOBB 2RQ8A 4H8WC 5FHAL 4OI8A 5CSZB 2CLVB 5GS0D 2GITB 4KKNA 4G8EB 1NCDH 3NFSL 4GS7C 3OKYA 3RVWC 4KDWA 5CEXB 4H0IA 3WJJA 5EO9A 1GGBH 4O9HL 3MJ6A 5C0GA 1R0AH 4TUKL 1LO3L 2JJTA 2WBJD 2BY0A 4QXTA 3BDYL 5LGHH 5HHOB 3NCCB 3Q6FB 4OIIL 4ZDHB 3DMMC 5F3BB 5IOPA 3SDCD 3BPCB 4UINH 2ESVE 4FMFA 4IHOB 3S98A 1OCWL 4L8CB 1HSBB 4JZJA 2F19L 5KW9H 1I7RB 4BELD 1S7TB 4C55A 5INDB 4UI2A 3EOAA 7FABL 1MCPH 5F70A 4L3EA 4ZS7H 4PJCE 4XCFH 4WO4C 1RU9H 4K7PL 4XBGB 4I3RL 1IGCL 3GBNL 3BWUC 3OKLB 4OB5L 4R6UA 4XC3H 5CEZD 1N6QL 1RURL 3ME0A 3AY4A 2VDNH 1AR1C 3VD5A 4P2RB 4JFQA 5C9KA 3FQWA 1TQCB 1FJ1A 2AGJH 4QRRD 3X13B 3QPQC 5IKCA 5KVFH 5CP7A 3FQRA 3MLVL 3D85B 5F7DB 5JOFB 3B9KD 3CFKA 3BVNB 3S4SB 4TSAL 1T7VA 2G5RA 4CW1B 4CUCA 4P57A 3QDGA 4PLJD 1DL7H 4X7TB 5E7FA 1T6WA 1N26A 4MWFB 3WLWD 3MBED 4CGTA 2BZDA 4PLNC 2EH7H 1LEKB 3MV01 1A1NA 4Q7DA 1DUZB 4UU9A 1RZKH 5BJTA 1A7NH 5AD0A 1I1AC 5C0AE 1FO0B 1RVFL 2XPGA 3QIUB 1NC4D 3W9EA 1QPPA 1I7TB 4TUOA 2UY7A 1BVKA 1XAUA 5ID0A 4RDQF 3PGDB 4ZO7A 3MXWH 2FBJL 3B6SB 1WZ1L 3T4YA 1T80A 5CLWA 3D5OF 4RRPA 4FQIL 1NBZA 1PGRB 2BXYA 4G6JH 1S3KH 3HPLA 2W91A 32C2B 4XVJL 3CX5K 5F96H 1Z5LA 2Y7QA 4MJ5A 5FM8A 2ITDA 2VDOL 3SE3C 3RX5A 4RGNE 1XGPB 4L5FL 5C0RH 3T1WA 1JRHH 2DYPA 1IGFL 3QQNA 3K4ZA 3A0OA 1OAZL 2EH8H 5JW4N 4ODTL 5MEQB 3U2SB 4ZD3H 1YYML 3L5WA 5I1KH 3WNLA 2GK0B 5ANMA 4LKCA 5B38A 2FZ3A 2PUQT 4P46D 5KS9E 3P4NA 3OKLA 3DI2B 1SY6H 3QFDB 1T20B 1FVEA 1ZHNB 1JTPA 4OZ4A 1IMHC 4D2NA 5F7UA 5H8DA 1LMKA 4Y4FD 1J1OL 2ICWI 4KI5F 2FIRT 4X7EC 3OAZK 1NFDF 3WCYA 4QY8A 2GKIA 4JN2A 1GGCH 1X5GA 1M7IB 3BAEL 3MUY1 1T2JA 4ORGB 1LD9B 2LAGB 2R23B 3QQ3B 5GGSY 1KFAH 4LCIL 4LSRL 5TH2B 1U8QA 1QOKA 3MO1B 5EO9B 4J4PD 3RNQB 3P4NB 1FO0H 4S1SL 5HY9B 2VDLH 5I6XC 1IFHL 3T2NL 1A1OB 2ZCKL 2VMFA 2EDTA 3CFIC 1IAIL 3P2TA 3DOSA 1IL1B 3MNWB 5IMKA 3B5GA 5GRZA 3RHWF 1KBGH 1GC1H 2J4WH 3MLYL 4MDJA 3LV3B 2C9AA 3ROOB 1KTDB 5JPNA 1KN4H 1YDPB 3S6CA 3V4VH 2B2XL 3QFJB 3HNVL 5DHVH 4KHTH 4QRRA 3HPLB 1MHCB 2DQUL 5KG9A 3C5ZA 3C8DA 1MFAL 1BMGA 2HH0L 3QIWA 4KRPB 4M48H 4WRLA 5D71L 4UTAL 4DWHA 1SMOA 3VGDA 3QUXA 5DMGC 2YC1A 3IRZA 4JHZA 1J1XH 4FQXC 1IGTA 4PJXE 1B4JL 5F6IC 32C2A 3T09A 3DX7B 4U1NA 2I60H 2P48B 1A6VL 2E9WA 4LVNB 1KCUL 1MJ8H 5ELIA 4Z77A 3HZYB 5C08A 5BRZD 1J12A 1FZOB 2Y06H 3IKCA 3LEVL 1UM4L 4ORZC 1BZ9B 3TN0A 3LIZL 3O3EA 3WFHA 1Y18B 1MEXL 4MA3B 4POYA 5LVEA 4UDUB 1JWUA 4OI9A 3VDCA 2ERJC 4YPGA 1A3LH 2DLHA 3QUXB 4AENA 4FQJL 4MQTB 4A6YA 4IMLB 3CSYA 1YNLL 4LNRA 3JTSB 2BNUB 4MHHG 5GSRA 2R1WB 4X4YA 3NA4A 3TIDB 2BSED 1G1CA 1A4JA 4GW1B 1ZLUH 3P9MB 4DAGH 4MJIE 4JFPB 3MSPA 4CVXB 4PJEA 1U8PA 1XF2B 1QR1B 2ZCKH 3HR5A 1DQJB 2CGRH 1N8ZB 1ZVSA 3RIFK 1UWEL 1BWWA 4YWGL 1IGIH 1I1YB 3MOAL 1NCWH 3FQXA 3MO1A 1HQRA 4HGMA 3S36H 1CD1A 3BE1H 1FJ1B 3O2VH 4YIQB 1YEJH 4Y5XB 3JV6A 1NSNH 4EN3A 3TVMC 2F5AL 2BOCA 4MJID 1XR8B 5DS8A 4P2RE 3AB0C 3OAUL 4QTHA 2X70A 1VFAA 2FX8L 3NPSC 3MOAH 4U1MB 5JIKA 1RMFL 3O2DA 4NC2B 4KRLB 1RZJL 1AKJA 4X7SH 2R0LH 3N50A 5FA3B 4C56A 4KHXL 2I25N 3TPUA 1AXTL 4LSVH 3UZEA 3C6LC 5IVXE 3DV4B 5A3IC 3C60C 1ZHNA 3O9WB 3OL2A 3TBYA 4JZJB 1EFXD 3HNSL 4ACPA 4LCYA 1UCTA 2DWEA 2YKLL 4P5TD 5HYEA 4ODTH 3MV9A 4HLZH 3BJ91 1FNEB 1XCQA 4NP4H 1NC2A 4JM2F 5E8NB 5T1KD 1D5MB 3UTQB 3FOMB 3T0EC 4EOWL 1BLNA 3F7QA 4ENEC 5DTFB 1IEBA 2HT3C 3TVMA 3SPVA 1IAOA 3RWJA 3O6LH 1UXWA 5KVFL 3TBTA 3FL7A 1JZ7A 5EZLA 4N5EC 2ITCA 1AE6L 1MCQA 2A74A 5JDSA 2VYRE 4CU8A 3P3YA 3QO1B 2VDQL 1VA9A 3S5LB 4XNZB 5ENWB 4ZD3L 1J8HB 1BF8A 3MOBL 4WW2A 1ZEAL 2Q1EA 4YAQB 5CSGA 4PP1C 3PJSA 1X5XA 1S3KL 3I50L 3IGAA 4C57C 5FYJH 3WMSA 4AT6B 5GGRA 1P4LA 4WI7A 3UTPE 1NAMH 4M6AA 5HDQL 3BP6B 5BMFH 4U0RC 3UTTD 5FECB 4ZUTA 3T0EA 3MLYH 1T22B 2CO6B 3NZHH 1FORL 1MCWW 4G80A 1X3DA 5C3TA 4X4ME 4AIXA 1MELA 4C56D 1CZ8H 2EKSA 2HT2D 3SGKC 5C0CE 2EDHA 2XNAB 3QA3A 3NZ8A 1B0GB 4PBXA 1ADQH 2ZCHL 3L7EB 5HD8C 1O7VA 1OGAD 2F5BL 2A73A 1E4XL 2K7PA 1GZPB 4G42B 2WK2A 1XMWA 4I3SH 2NW2A 1U93A 1YA5A 5L8JB 4PRBA 2I60L 4NKMB 1HNFA 4P3CH 3HC4H 1BP3B 3VFPA 1F2QA 1LE9A 4P23A 1KJ3L 1PW3A 4XCNB 4W6WB 3C5ZC 2P1YA 3TV3L 1OTUC 4P9HL 3FOLB 5DF0A 1DL7L 2QR0A 4S10A 5HHOE 2FYYA 3UTSE 4KDTC 4W70A 1P1ZA 5D1ZD 4LFHG 1C16A 1JF5A 1KOAA 1X4YA 3VFGH 1H0DA 1U93B 4RMTA 3EOYG 1DBBH 3QDME 2V17H 2WIIB 2XTJC 4PY7B 1XF3B 2I9LA 3VXNA 4F57H 1MI5E 4YBLC 1OAYL 1ZHKA 3UJJH 5HI4D 4MVBD 1INEH 5D9SA 1HSAA 4NKOB 3G6JA 3CZFB 3MRRA 4JPWH 1EEUA 4K94C 3ZTNL 2CK2A 3C08L 3RPIA 1UWXH 4RWYL 3G5YA 3VI4E 4K55A 4IHOA 1SYSB 1ZLVK 4LAQL 3ZDZF 4HWZA 1GAFL 4ZTOH 2AV1A 2OBGA 3BZFB 4RFEB 4G6JL 3IAQA 4KTDL 3AAZB 1PG7L 5KSBE 1F4AA 3HAEA 3ZYOA 1W2KT 4AT6A 1KYOJ 1CU4H 2O26U 2ZUQC 3H9SA 1KJ2H 2I26N 2DQTH 2PO6A 4PJ8A 4FABH 2PXYB 4JZJC 2BC4B 1NLDH 2MOVA 3K0WA 1BECA 2IADA 5HHNA 5JW4Q 5T3ZL 4EI5A 4OZHA 4OQTL 1CFBA 3H0TB 4KK8C 1FG9C 1F3RB 4LLQB 3EDFA 1I9JH 1T1YA 5EZOH 2FWOB 5DRXA 3ETBF 5JHDD 2R15A 4G6AC 5C09E 3KNBA 4Y7MA 2NY5C 3TVMB 2WBJB 4WV1A 1RUML 1KB9K 1QSFA 2XA8H 3BHBA 1NGPH 4BFBD 2Z31B 4AQOA 1KC5L 1PY9A 2B1AH 4KMTL 5LXGL 4UZGA 3T0BA 1RIVL 1GGIL 3DUUB 3MBEC 4KTEL 1BWMA 3ULUD 4MHHI 2NXYD 1UA6L 4AEHH 2XACC 1FVCA 1R24A 5E24E 1PEWA 2VZSA 2ZUYA 5LKNA 1HHKA 4GAJL 4PB9H 3ARWA 4J8RA 4RGMC 3N1FC 4MD4A 4ODHH 1C08A 4P46A 2QTEA 3VI3E 4OBRA 1KLUA 3LN9A 1OT1A 4HMEA 5IEKA 4GW4B 3K46A 3QI9C 4XWOD 3KYNA 3B9DA 5LBSL 4HIEB 3CFDB 4FZ8L 3SGEI 4DGYH 4MAYA 1AXIB 3K81A 2ZNWA 2X1OA 3O6FA 3CFCH 4OCSL 3KPRE 2I07B 4YR6A 5KS9B 1DQLL 3HC3H 4QWWD 3R4DA 4HWBH 5TE6L 2HWZH 3QDJD 1RZ7H 1ERNA 2X1QA 2PYEE 1LO3H 2OMNA 1BX2A 4JQIH 1JF1B 4LAJH 4Y8DC 2WUBL 3LKRB 4GW4A 3LMJL 4MS8C 2A6JB 3OXRA 4G42A 4A2MA 5GRJL 1EAPA 4OZFG 1NCUA 4OZIB 3O6FB 3TA3B 2R0WL 4GMTL 1RI8A 2XN9E 4QHMA 4D9QD 3K8KA 1NANI 3DMMD 2FWOA 4FXGB 4HIHB 5T1DL 1P6AB 4HH9A 1Q9OA 5JPMB 3PL6C 1B3JA 1QBLL 4NKIL 4GKSA 3T0WA 4NT6B 4PJ9B 4TQEH 3U4BH 4E42A 2XRAH 4M4RA 3FFCE 2ORBH 4GRLC 1AI1H 4ZUSA 1F4XL 5J9PA 4QHLA 2E9BA 4PTTB 4LBEA 4E0RA 4OSUL 4LPUA 4LSTL 1P4LB 1QFUH 3GNML 4IOFC 5JHLH 4JM4L 4B53A 1AD0A 4JGJA 4U1IA 4HQQH 3DSFL 4M6OH 3KJ4B 4P46C 2ZCHH 4R4NC 3SKNA 1CXIA 3VFRA 2JJUA 4XZUB 3G5YB 5FOBA 5EZJA 3GMQB 1UB5A 1T83A 1WIUA 2B4CC 2ICWJ 4LPXA 2HJFB 4ZPVB 3PWJA 4QOKB 4HXAL 2R8SH 4O2EA 1UXWB 1UWXK 2V2XB 4D9LH 3EKCA 1HINH 3OKKA 1IKFL 2EC9T 5BOPA 2FATL 3N1QC 1CL7L 3VFRB 1X5LA 3HRZB 1MJJB 1MCLA 1C5DB 4C4KT 1T04B 1JI1A 4RFNC 2BY3A 2X1PA 1JRHI 4L4TA 5EC2A 2CKBA 2P43B 3AREB 3E6HA 4F57L 1T4KA 2AERT 5IW1A 1JHLH 3QIBD 4Z7QE 1BREA 5GZND 5ESVA 4YFEA 3KXFB 1AQDA 4ALAH 1RUQL 2VXQL 3VFWB 1C8PA 4HX1B 4PGDA 5LG1A 1ZHKB 1FYTA 3F8UB 4JJ5A 5DMIH 3MCG1 5JW4R 1AKJB 1FFRA 2D4FA 4MSWB 4Z78B 3N85L 2HLAA 3KJ6L 5T1LD 3VGBA 2Q87A 3IJSB 4DN4L 3WNKA 4WEBH 1Q0YL 1PZ5B 1KB5H 4HUUB 3U46A 4MCYA 4JE4B 5I16A 3BN9C 2B0SH 1HCFX 5GGVL 5HYFA 1YN6B 3NA9L 4AMKH 2IH1B 4R2GC 5BS0B 3B9KC 4LSQH 3PHSA 4HGKC 5DURB 3N9GL 1FLRL 2Q3AA 3GUTA 2F74A 3PHQB 1K4DA 2BP3A 3NPZB 4PJDA 5EN2A 5EU6A 2RFXB 3HZVA 2DL9A 4Q6YA 1U2CA 5DRZB 1LO4L 5CIPH 4R0LA 3VRLE 2ZOLA 4NBYB 5I8CA 3DNKA 1OGTB 5EUKB 3IU3B 1RV6X 4L9LB 1Q0XL 4Z95L 4NKMA 5I1GH 1GOGA 1O5DT 2KL6A 3FJTA 4Y1AB 1EEZA 5IBLC 4MJ2A 1IC4L 3QIBC 4DVBA 3VI4F 3LQZA 1JZ5A 1XGTB 4KI5D 1OOAA 1MQKH 5ACZA 2NMSA 2QSCL 3BD5A 1ZLUK 5EBLA 2BFVL 5ANME 2DD8L 1R5WB 1CFSB 2IQ9L 2J5LB 1YMMB 1UENA 4HKJA 3T0EB 1HI6B 5F9JA 2P5EB 5I8OL 3WFHB 3ULUF 2HFGH 1U3YA 1FRGL 1K2DB 3ZKNC 3QUMA 3LKNB 4ZUTB 3MA7B 4ESKA 1FG2A 5HYSG 5KSBA 3VFMA 4LCYB 4XVTL 3CK0H 2EYSB 4KI5E 5FUOL 4K9EC 1DJSA 5IVZA 1OSZB 5T3XE 1F5WA 1G9MC 3S96A 1E6JH 4JFFA 3S36L 2HN7A 5IM7A 4M5ZL 4NN5B 5IHBA 1NCAL 4CW1A 4X6DE 3CFKB 1QLEL 2ZKHH 5CJOL 1R3LB 2C4FT 1S7XB 2D7PA 1HKLL 4F7PB 4HLZG 4Y5YA 2C1PB 3QCVL 5I15L 2ILLA 4YIQA 4KRPD 2UZYB 3S36X 3OWEA 4TRPL 5DHVA 1A3LL 3CDYA 1C1EL 4WUUB 1EGJL 5EOCJ 4LP4A 3QDGE 4X6FA 1NKRA 1D9KD 4WWKB 1B6UA 3QQ3A 2HVKA 4Q6IA 4QGTA 5DJ2A 1KTKE 3RL1A 2N4IA 5AAWA 2VL5B 3X14A 5CP3H 1H3UA 4PJXF 4ZUUA 2W0KA 4BSWA 4LCUA 4UDTB 1U92A 3L5IA 2EDDA 5J6HB 4IS6A 3QDGD 4WUUA 3B9EA 4PJCA 3MBXL 1LEIA 1ZVSB 1YMMA 3U2SA 4EXPX 5F7HA 2R2BB 4JPVL 4HGWB 3FQXB 5SWSD 1SQ2N 2J8UB 1UWGL 4I9WD 3IDJA 2O5ZH 2BVOA 4J3UA 3PWUA 1SBSL 4I0PA 3SDXA 1OAXH 3D0LA 4FFZH 3CDGB 3H3PL 4YHML 3QZWB 3QIWB 3KYKL 1NC2D 2A6KB 3D39A 3NIGF 1A7PL 1F45A 1IAIM 4YGAB 5DQDH 5IV2A 2VDML 4P23C 2CO7B 2JB5H 2WINA 3DX8A 5H37G 4EUPG 1Q0YH 2FLBT 5EU6B 5ID0B 4YUEL 2ADIB 2J6EL 2V5YA 2X4UB 4QOKE 3KPTA 3UTSA 4AMKL 4A6YB 5HYQA 3KXFD 5DLML 5EWIL 5DD0H 2R2BA 4NFBA 1SYVA 3ZKSD 4HUXA 1YQ2A 4XCEB 4G8GB 1GPOH 1HOCA 1AKJD 1JWUB 3UZVB 4OD3L 3UYPA 1WCBB 4LMQI 2F58L 1TJGL 4I77H 2WINB 5JW4M 1J9CT 1IC7L 4WNQB 3AVEA 1QO3A 2N1KA 4M7KL 2EYTB 1TVBB 2E9IA 2X4OB 2XZCH 1DANT 1HE7A 1X44A 4KJYB 1T1ZB 2LE9A 1YDPA 5I73C 4IDJL 5B4MC 5D1ZA 1YNTB 5C07E 1P4BH 4PJBB 4X9FA 2FGWL 3X3GL 4KKBC 5IROA 4G6FB 5KVDL 3B5TA 4AM0A 4U33A 3MC0A 5AZEL 3TJHD 2H26B 1TZIA 3PHQA 1QLRB 4JPIA 4OQ1A 2C7UB 3MCLL 1RZGA 3BQUB 4PIRF 3MLPA 3S37H 3SE8H 3F5WB 4NN7C 5C2UB 1KPRA 4GJTB 1UJ3C 5CCKL 5FYJE 4G7YH 1QLFB 5JA8B 2YK1L 4XVSL 4P5MB 1UM4H 4K94H 2BNRA 1HH6B 1YYMH 2NY0C 1S5HB 2Q86A 1W72L 3C09B 1NAMA 2R4RL 1JYXA 1RZFL 3KXFA 5E99L 1YC8A 1CBVH 4F3FA 3KPRB 4CN4A 4M8VA 1L7TL 4OLVL 4LEOB 1T0PB 5CEXA 2VDPH 4CAGA 2W0LA 3RDTB 4D0CA 5ANMB 3MA9L 5D7LE 5GGVH 2XICA 1IKNA 4HT1H 5D7IF 3WNPA 1ADQA 1JK8B 3RVWD 3PWLB 1ZV5A 5L9DL 1N0LA 1I9RH 1I1YA 2LABA 1I1CA 4OFYA 1I75A 1LK2A 2X42A 3BIAX 3MUZ1 4CADA 5K9KA 3GMLA 4JB9H 1A9BB 4H20H 4OI7A 4JFZH 4PG9A 3L3KA 1MLCA 5LXGH 1FFOA 2I5YL 3P0YL 5IFJB 5FYLH 5D1ZB 4YHIA 2H8PA 5ABDE 1FZMB 2VDNL 3DECA 2DKSA 3DXAB 4F7EA 4KJYA 4J4PA 3QNZA 2EYRB 3G6AA 3MLSL 4HH8A 1X7QB 2R29H 4TUOB 1XGQB 4PJ9C 4QF1A 1NBZB 4U3HA 1IRAY 4OLWL 1ONQB 4JGMA 4NRZB 3B6SA 3E2HC 2PW2A 4I18B 2V9TA 4PRPB 1NMCC 3WL9B 3U0WH 1EFQA 4JO1L 4CNIA 5F9JB 4HIIA 4GMTH 4AH2B 3FN0L 2OXGA 4BH8B 1AGFA 1CLOL 4NNPL 3MACL 2I9TB 3CPLB 1H9VA 1G0XA 3VJ6A 4L3AA 4F80A 4PTUB 1C08B 4HHAA 2VR5A 4OZFH 4P46B 4X7TA 1S7UA 5EOTB 1IM9A 4NGHL 1CG9B 5SX5H 5I8KH 4PJIF 3FRUB 1NJ9A 4NQDE 1LEKA 1RZKL 4DVRL 4R4ND 5ERWA 4X5XB 4TSBH 5ICZB 5E9DA 3JVGA 1G7HA 5T1KB 3ZDZE 1BGXL 5C6PB 2DYPD 4WI2A 1GRWA 4F7TA 1MI5D 5HHOA 4DKFL 5GXBB 3HZVB 5B8CB 2P5WB 3MRIB 1N7ML 1OP5H 4Q9RH 2NY1C 3ZE0E 5ISZE 5DFTA 2G75A 1F8TH 4GLRH 2VLJD 4LLWB 1KCKA 4DW2H 3BEWA 1S9KC 3MZGB 1NUFA 1G7LB 3MR9B 5I1AA 1ORQB 1RULL 3VCLA 3RNQA 2WP3T 4JQIL 4GKNA 3AGVA 3VW3H 1ZGLM 5L2KA 4UV4H 3NFSH 3O6KH 1BQHB 2CLZA 2VB5A 3JWDL 4QRRE 4RAUB 4JKLA 4MAUL 4PB0H 4KI5C 5D8JL 4BA8A 5C08D 4N9GA 2FEDC 4QHKI 3ZTNH 4K7PX 3QAZB 1J0KA 3D9AL 5CUSH 2CLRA 1MFEH 3MX0A 3S8WA 3PV6A 5GRVL 4GH7B 3QO0A 5KANI 2DMKA 4JCLA 4RWHA 4LGRB 4U1GB 2WUBH 2YZ8A 3O3DB 4CMMA 4HFWB 3F12A 1KNOA 4LRNH 2YPVL 5D1QB 2W9LA 4R8WH 2CSPA 5GS0C 3LN4A 4K3EL 3O4LD 5F1IB 5DRXB 3PHOB 3GI8L 1E4KA 1RK1A 4P2QE 3OF6A 1L0YA 2BNQE 4BZ2H 3PQYD 1U36A 1R3JA 4X8JA 4NRXA 3RRQA 2OMBA 3N06B 1A6ZA 2M8XA 2CK0H 3HE7D 1UKQA 2DQFB 3WFCH 4DKEH 2BSRB 5F7FA 5T1LA 3GGWB 3I6GA 1XF4A 3B2VL 4LBEB 1WVZA 3M17A 5L9DH 4HWZB 4HK0B 1HHIB 2ICES 3MZTA 3GMNA 3Q0HA 1RIVH 2R1XB 4Z7OF 1FL5A 2BNQD 4OKVA 5A43C 3QIBA 1M7DA 3KPSD 3SQOH 4OIBA 2XZAH 3HI6L 2DQJH 2X4SA 2X4PB 3ZKMD 4I2XA 1RQ5A 3DO3A 1VFOA 3VFUA 4POUB 1MRCL 3A67L 4WY7L 4NCC2 4NQED 2CUHA 1MFEL 2WBKA 1R6VA 1H8NA 4BFIB 3CLEL 3RVTC 4AH2A 2IAMB 2BRRL 1Q1JL 3T3PF 2B1HL 1KELH 5CINL 1IGJA 1U8IA 1FC2D 4DK6A 4LCCA 2NZ9C 1Q9WB 4WFEE 5KVEH 3RL2B 3OMZA 3SGJA 1ITBB 4WTZA 5DRZA 5KSAA 4M7JL 3TBVB 4OM1L 2LU4A 4XNQB 3HUJA 3ISWA 5DK0B 3OZ9H 4GQ9L 1CFVH 3MCLH 4OTXH 3WUWB 2NY3C 1QFWI 4BFIA 5I66B 2CD0A 4JDZA 2GJZB 4D8PB 2BNQA 1JUFB 4NWUH 1Y6KR 2FEDD 1TCMA 4LASH 4PRPD 1CE6B 3AC0A 2AQ3A 4KPHL 5DT1L 3FTGA 4PJ7B 3PHOA 1Q72L 1P7HL 1II4E 1S8DB 2FSEB 1QSFD 1ZANH 5EFIA 2BC4A 3DXAE 4KZDL 3QEQB 4PJAA 1B9ZA 2J3SA 5D7IE 1J8HE 3HB3D 2H3NB 3QISA 2PYFA 1HXYB 5T1LB 4M5ZH 4FTVB 1WLHA 2BHYA 3EDJA 2BSRA 1JPGB 3KYOA 4LLYB 3R1GH 2VN7A 4GAYA 4FN0A 5IB1A 3O4LA 1AO7B 3IAPA 1CXLA 4KUZL 1LP9A 5D1XC 5CZVH 5FM5O 4FG6D 3RVXD 9CGTA 2YKLH 3I84A 3MRMA 4HH9B 3DBXB 1A7QH 3W0WA 4TRPH 3O0RL 4WUKH 5F1OB 4IMKC 5CWSA 3VRJB 5IQ9B 1P7KB 1F3JA 3BKML 1HEZB 1EAPB 5DJZB 5GS2H 4ERSL 2P49B 2FD6H 1GCFA 3BRDA 1D9KB 4YBLB 4DKDC 4KK9D 4S0SD 4S2SB 2YUVA 1J7VR 1JNHB 4PR5A 3BKCL 5IVNA 5D93C 1MY5A 4C58B 3AAZA 1BHGA 3MJ9A 4NOBA 4TVPE 2P5WE 1BFVL 1KIQA 3WJJC 3RL2A 4M7LT 1QR1A 5IK3B 3FZUC 2X4NA 4LCCB 2W60B 1MWAL 4WGVB 3AY4C 5KAQF 4WO4B 1LE9B 2ATPA 3VFPB 2VZUA 4TPRH 3KYNB 5J3HD 3JUYA 5DJDA 5EZIL 2NW2B 3LIZH 4TNWF 2NY6D 1JCKA 1NCBH 3RWDB 4ONFH 2KQMA 3RY5A 1TZHB 4PJGF 2AJUH 4FQLL 3OR7A 4L4TE 4EUPH 4UDUA 1EVTC 3RNKB 3FRUA 3JXAA 5DRNA 1P1ZB 1FL5B 2PYEA 5IESL 5D1XD 3CPLA 3I2CL 3PDDA 1G7MA 3R8BB 1O7SA 1HYSC 2ZOKA 4F7CA 2XQBH 5F9WC 2P7TA 1JGDB 2R1YB 5D5ME 1W72A 4D9RD 4D3CL 1HIMH 1C12A 2C3HA 3WFZA 5JA9A 3JWOH 5E8DH 2HFTA 3GMLB 6CGTA 1OB1A 4XPAL 5FO7B 1RK1B 2Q7NA 1KLUB 1G9EA 4XMKL 3MXVL 3T3MF 1Q9LA 1LP9B 3VWJC 5A3ID 1U8KB 4K9EH 3MGOB 2QSCH 2Q8BL 3QG7L 5CINH 3G6DL 4ALAL 2JTDA 4XP9H 1EEYA 2Z92A 1TXKA 3TPKA 1HINL 4ZG1A 1JPFB 4XNUH 1QVOA 4IS6B 1NL0H 4R97C 3HCVB 4F3FB 3BZEB 5F7LB 3VFVB 4HZLA 5DJ8A 5E00A 1CICA 1LD9A 2R23A 4FFVC 5DMKA 2XXCB 4WTWA 2PTTB 2H41A 1NMAH 2CRIA 5BVJA 4M62H 4HCRA 1F4WL 1G7QB 4UILH 3KPPB 4TUJB 3GNMH 3BEVB 1ZGLA 2QQNH 3H42L 4M43H 4NN7B 5AWNH 3MREA 1BBJA 2ZKHL 5CJOH 2HJKA 3TCLB 4P5TA 4PRHE 4KZDH 3NACH 1FGVL 4HPOL 4M48L 1NC2B 3GJFK 5FA4B 5HI3D 2Y5EA 4WU7B 1NEZB 5IMMB 1J10A 1G6VK 2OP4H 1B4JH 4FQCL 3LH2H 1H8OA 2FB4H 4HJGB 4DQOH 4XHJD 3UBXI 2VQ1A 4F9PC 1WSST 2Q86B 4FHBD 1FRGH 3RWCB 4W81A 4WNQA 1OSZA 4GQ9H 3HLAA 5B8CC 1IGIL 1F6AA 3LEXA 2I24N 2ZSWB 4S1SH 1VFAB 4EBQL 5TJWK 3ZKQD 3NCEB 3BH9B 1BJ1H 5JW5A 4IRJB 2DM7A 1I7TA 4PTUA 3WHXB 4ERSH 1DQLH 4E41A 3OR6B 2YD9A 5EO0B 1Q9KB 1HHIA 3NN8B 1A7NL 1A6WH 2ZP0T 3UROR 3HE7C 2QSVA 2UVEA 3DV6B 5FECA 2FL5B 2GAZB 4PJ9D 1KN4L 2QKIB 5FCSH 5HTSA 2AK4D 3H3BC 1KXQE 2C3XA 2AQ2A 1T7ZA 1WZ1H 1L9MA 3MYJA 4CVXA 3ZT5A 1R0AL 4FTVE 4FOMA 1TJIL 2VDKH 2LQRA 3N0PB 3STBA 5IV2B 3THML 1WBYA 5TE6H 4F8TA 2FHFA 1RJZA 4UT9L 2R2HA 4K3JL 1G84A 1F42A 1MCIA 2NY0D 5D5MA 3NCYP 3WD5L 1PKQA 2UYLA 3RWHA 4GG6E 1Q72H 4QRTB 3VFSB 1U8OA 1RU9L 5JHDE 3B83A 5D6DA 1H3PH 5GZNC 1FN4A 1RULH 1OTTD 1N3NA 1MRCH 1OHQA 1L6XA 1EXUB 3SO3B 3KHQA 4QRPD 4RDQG 15C8L 4Z7WF 3S35X 5JNYA 2BX5A 2DQIL 3CAFA 2KBGA 3BP5B 2JJSA 2CMRL 5LAXA 3BESR 4MNQE 3FQUA 2X41A 1F90L 1IKNC 2VQ1B 1A3RL 4U6HB 5HXMA 4LSTH 3D3VD 4LU5H 1KJMB 1T0MB 4H1LB 5C09B 2FATH 2O61B 1DBAL 5JOFA 2AW2A 3LHPH 2VLRD 3TBSA 3WEXA 5DXWA 1F4HA 4OCSH 4Z7WB 1T2QL 4JHAL 3IFLH 3O3AA 1UFUA 4JHBA 1CD1B 1YEGL 1YEEH 5DA0B 2Y23A 2R4SL 5DO2C 3O45A 5DMGD 5D8JH 2YEZA 1F3DJ 2VLMD 35C8L 4G8FA 5D70H 5D7SH 3BEVA 1V3LA 5HYSA 1K5NA 4P99A 1EFXB 5HVFB 2VZVA 2HJKB 4I13B 2EXWC 1V5JA 4QXWA 2VLRE 3MREB 1HHJA 1QBBA 2H32H 4OM0H 2WANA 1PYWA 1U3ZA 1NBYB 2X4OA 4G5ZL 1H3PL 3QQ9D 3V79C 3U1SH 1HHGA 4Q9CA 4QYOB 4UUJA 4YPGB 1J5OL 3TT3H 3MNZB 1L7TH 2JB6A 4KROC 5CD5D 1HQ4B 2OL3H 2Z92B 1S7WA 4NUJB 4U4BA 2YA0A 4PTTA 4JAMB 3BZEA 5IQ7H 2JJWA 3NVQA 2UV3A 2DYPB 4YGVA 3BD3A 3HUJF 2FB4L 4GKOA 3HR6A 1GSMA 4I3GA 2X6MA 3EYQD 3MLZH 3RVXC 1UZ8B 1BOGA 1VCAA 5CZKA 3IXTA 1BVZA 5I18L 1R5WA 1RUPH 4KAQH 4Y16B 3FB8B 4MWFA 2EC8A 3H6JA 4GS7B 5E6IC 1TENA 1EJOL 5I1CH 2X9XA 2YPLA 4LF3B 4PD4K 1T7YA 4EKXA 2J6EH 3ARBD 2MTPA 1YEEL 4P3CL 5D7IB 3F7RA 4EVNA 1KCRH 4KRPC 4NQDD 3ZE0F 3MYJB 5CCKH 5FO8B 4UILL 3TNNB 3OJMB 2UY6A 2YRPA 1ZHBA 4KRNA 4AIOA 1B88A 1IC5L 4OIIH 4I8DA 1Z6JT 2QQQA 2NZIA 4WI3A 3QI9D 2Y25A 5I30L 5L6YH 2A6DB 1ULVA 3HI1B 5SWZA 2RJMA 1U8QB 5TH2A 3H2WA 3IFOA 5TDOA 4OZIE 2G9HB 3H7LA 2F53E 1LE5A 5F97E 5ESVB 5E4IA 2J5LC 2CDGA 2R0ZL 5IW1B 3SDDA 1IGCH 3GBNH 3C6LA 1GPOL 1CVRA 1N5YL 3RL1B 3V8CA 4IOIA 4IRZH 2PETA 3F5WA 5CBEA 2EO1A 3FQNA 4Z9KB 3VWKB 2R4RH 4OD2B 4X6FB 1V7ML 4JJHA 4X9HA 1IC7H 3MJ8B 2G5BB 2GSIB 4L3ED 3V6OA 3IDIA 1MCSA 2YS4A 1G9NH 4FP8L 15C8H 1OAYH 4PJAE 4O2EB 5E6IA 5GGUA 4UT6L 1BOYA 2H9GA 3PGFL 4MMZC 1UGNA 1W0YT 3LH2L 4PP2A 2B1AL 4KMTH 4MB4A 4PRIE 4JRXD 5TQ0L 5IIEA 3BUTA 4X0KB 2V2XA 3V6BR 4M7LH 5I73B 2DI7A 5C0BB 1PZUB 1CLZL 2XOTA 3ARUA 3SDAA 5AUMB 1TJHL 3EUUA 1CDBA 3BUYA 4K71B 1SJHB 3KGRA 3CH1B 4ISVB 4JHWL 1BD2A 2PYFB 4UOJA 2Y4SA 1G7IA 1EJ6A 3AREA 4LSVL 5HGGS 5EC2B 1ZHBB 1CGXA 2MHAB 3KYOB 4LLYA 4RX4A 4YDJA 1TLKA 3V6OC 3C5SB 4ENED 4AY0A 5L88H 3TESA 4XVSH 1GIGL 4YDIL 2V2WB 3QWOB 5E2WL 4LHUB 4W6YB 3BE1L 3JV4B 1SBSH 2ADIA 2FBOJ 1P4IH 1ES0A 3BP7B 4XBEL 3IDXH 1J88A 1QQDB 1U58B 2IG2L 3FB6B 4RRPG 3SGDH 5EDXA 2B20A 3QNYA 1ITCA 2HTLC 4G8GD 2VISA 4HAFA 4R97B 4HG4J 25C8H 1AIFA 1WBXA 4YFDB 2VAAB 4NZJA 5D93B 1TPXC 3MLUL 3GO1H 1FNGA 4GSDH 1EHAA 3ARXA 3WIFB 2ICEB 4KI1A 5GIRA 5L2KB 1RJLA 3GMQA 3U9UA 3SDAC 4YUEH 4XXDA 2X2YA 1XF5B 1XGRB 5FUZH 4J23A 3LS5H 4XB7A 2JCCE 1YPZE 1JGEA 4LGSB 1CQYA 4YGVB 3BO8B 5GQBA 4OV6F 4LGPB 5EN2B 2JJTC 2BK8A 3QULA 2YUZA 4WHTA 3IVKB 3RQ3A 4NDMB 4XBGA 1CFTB 5K9JL 4YDVB 5D7JA 1A6AA 3VXMB 1G7HB 1JWSB 5CGYD 1IEHA 4J8RB 3GJFH 5JXEC 3HNSH 1SEBB 2G2RB 2JIXD 1DR9A 4PGDB 3ZE2F 3VFWA 4DK3A 1VACA 4PUBL 1CXEA 4WWKA 1A21A 4KVCL 5F93C 4PY8I 5E2TH 4M8QB 3GBML 5A16A 1UADC 4OF6A 2JB5L 2YA1A 4RZCA 3O6FD 4FQHA 3ARGC 1M1SA 4NCDA 4XMKH 25C8L 3BGMB 4DKAA 5ADPL 2APXA 1WK0A 2F53A 3BW9A 3B8SA 4JANB 1R3LA 2O5ZL 2DQEL 5C09A 2LVEA 1ZLWH 2VDRL 3QXWA 2AJSH 4PRAB 5EU5B 2VLKE 3X17A 5DJXA 3DO7A 2D31B 3QCTL 4KDVA 1MJ8L 2CDFA 3X3FH 3QNYB 1Y0LB 1MCRA 1UT9A 2BMKB 5E1AB 3U0PA 4YXHL 3HNTH 3K8LA 3IETA 4PRHB 3I2CH 1Z0NA 4GAYB 1RAMA 3QXDB 3HCVA 4KKLC 4L1DA 1YYLL 1MH5A 5J1TC 1AD0B 4FTVA 1UM6L 3HNTL 5DJAA 4LSUH 5BO1H 3STLA 2XA3A 5GRUH 2BMKA 5BRZB 2GITA 2YD3A 4UT6H 2PR4H 4EUPA 2OJEA 1EA9C 43C9B 4PPTA 1EZVY 4PGZA 4PJGE 2A9NL 3C2SA 1DQDL 3MRLB 1OARL 4U2YA 2IBGA 5DK2A 4C59B 1UWEH 1V7MH 2P8MA 4LSRH 5D96B 4N8CH 4D8PA 3W5NA 4LLVB 1XF3A 3VXNB 2A83A 4HPYL 1OM3H 4BQ6A 1BIIA 2GSIA 1K4DB 5ILTH 4UV7L 4LASL 1FNLA 1LNUA 1NAKH 5B3JE 1X5HA 2NXYC 3VXOB 4GO6B 1VESA 1BFTA 3NIDE 5CGMA 4KV5E 2XZAL 1F11B 4BH7B 1MWAH 2BSSA 2ZSWA 2YMXL 1F6AB 3GBLA 3LEXB 3TEUA 3WDIA 4F7TB 1YNLH 1IGYA 2VSDA 3G5ZA 5E56A 1FSKC 4YLQT 3F6IA 5E03A 1K6QL 3ARFB 5F88B 1K3IA 3IDMB 3NA9H 3T65B 4JZNB 3UPRB 2R2EA 1JPST 3GMMB 4PJGA 4XC1L 2BDNH 2NY2D 2GIYA 1JWSA 2BY1A 5E8PA 1SJVA 4P2OB 5IB4A 2FYYB 2CXKA 3VXMA 4U0RB 5J6GB 5I71C 4MXQD 1D7FA 3KWWA 4M1DH 4QT5B 3R06B 4HCRH 4L9DA 4NZRH 5D7LA 4Z95H 3EO0A 4MNQA 1YJDH 4G9FE 4FQ2L 4WFHD 4WV1B 3HPJB 3Q3GA 3U7YH 3GHBL 4YNYB 4XWGH 1KLGB 1GZQB 1IVLA 3FB8A 2OJEB 1VADA 4Y19A 5BVPL 1T5XB 5T1MA 2AEPL 5FV2A 3U9UB 1ZA3A 3MRLA 3CFBA 3VDBA 4OM1H 1A6UL 1OF2B 2BSTA 2DQDH 4HD9A 2VZTA 3WIIH 1RUAL 2QQKL 4WEMB 3QUXD 4WFHE 3RAJH 2R9HC 2YWZA 3CVHA 1RY7B 2HMID 3CVIH 2O5XH 3BKJL 3VXTA 3UJIH 3V5KA 4M7ZB 4FFWC 3MLVH 5A2LH 5CAYB 5EC1B 2AEQL 5L88L 3UDWC 3V2AR 3S7GA 3P30L 1D5ZB 2D7MA 3TJHC 3S3SA 1HH6A 3UTPD 3A6CL 5C07A 2R56H 4JN2B 4QY8B 4JG0H 5T1MB 2BJML 1CE6A 4OB5H 4XC3L 4M6OL 4HJJL 4HUMB 3RVTD 5MI0C 2ID5A 3BIKB 4O2CA 2BVPB 2DIJA 2A6JA 1GC1C 2NX5A 1J11A 2FJGA 5MEND 5EBWB 4Y0GA 2W65A 5I1JH 2NTSP 5JXAL 2NR6C 3QUML 2XFXA 3O11A 2FH6A 5A16B 5FYLL 5GGUB 1F02I 4NWTL 1NEZA 1I3VA 1MIML 2NNAA 1WT5A 4U6VL 4JVUA 1DVFD 4JR9H 3SKOA 3PG2A 3MV9B 4JM2B 1I3RB 3EO9L 5E8PB 4XRCA 1QLRA 4JPIB 1QTYT 2DF3A 2P5WA 3KLHD 1BQLL 3HR5B 5F8RC 5IF0A 3C60A 1ED3A 4DZBA 5LCVL 5ALCH 4QRPB 4M02A 1JHLL 5C0RL 1MCNA 3MGTB 4OSUH 2GK2A 4PV8A 4NNXB 1OP9A 1PG7H 3QDMD 5DVLA 2R69L 1CDHA 2E5EA 4S1RL 4OCMC 4I3SL 1FG2B 5DWUL 1ZLWK 5ISZB 3CX2A 5LCVH 5E08L 4PRNB 4L8DA 4HIIB 1DEEB 1QPXA 4KH2A 4UQ2A 5F7MC 4JN1L 1QSFB 4APQB 1REIA 4OQTH 1S7QB 5B39B 2VUOA 2Q76A 4K7FB 4KQ4H 5DUBA 3DRTA 1JHTB 1K85A 2HFEB 4JPKH 2AXFA 3WUZA 2VXTL 4NQDB 4N0CC 1BZQK 3QZWA 4ELME 1N0XH 1A4JB 1T1XB 3DETD 4X4YB 3RZWA 1NCCL 1KTDA 4UB0H 5SWQA 4HW6A 4PG9B 5L8KB 5F72S 2HTKD 1IL1A 1WJ3A 2FGWH 3CFJA 3DLQR 3MNWA 3TBWA 5DUPH 2PXYA 1IAOB 4RWYH 3RWJB 3RFZC 1DBKL 3FO0H 4NO5A 2GAZA 3ZDYE 2DQCL 2MQ3A 4MAUH 4PB0L 2X05A 4OFVA 3BXNB 1MIEL 4JREC 5HHMD 5JIPA 5EO0A 2H32A 4L29A 3ZDXF 3ARTA 3RTQB 5GGQH 4ZYKA 2AV7B 1KXTB 2Y5TA 5JQ6L 3DYPA 1LEIB 4Q6IC 3GHEH 2MKWA 4YE4H 5I1IH 3FTGB 4PFEA 5LWYL 3IF1A 1ZGLP 5B38G 1ZSDA 3WS3B 3SDXE 3TPUB 1CR9L 5FM4A 1QRND 1G0YR 2DRUA 2VLME 4GMSL 5IF0B 4G8IB 4ORGA 3U0WL 4H0GA 4QRUA 4EI6B 5HHME 3TYFA 5HDOA 2G5BA 4ZFOB 5GS3A 4KWUA 2JIXA 3S5LG 2CKBB 2KZWA 4OZGE 4WI8A 3TGXA 2E27H 1MPAL 2CUIA 3VRIA 1RZGB 5SX4H 1YN7B 1GOHA 5SV3A 4O9HH 2FZ3B 4BQ8A 1JGLH 2RIKA 4Q2ZA 4U49A 2IWGA 3PDOB 3I3DA 2H2PC 5EO1B 3BSZL 3P30H 1XT5A 4L9LC 4NC1E 5MEQA 2CKBH 3S88L 4MZ2A 3TCXA 4Z76A 1FAKT 2H6PB 4Z7UA 2WV3A 3RHWK 5IB3A 5FUCE 3RAJL 5JW3L 4F15C 4M7ZC 4LVOB 3UBXG 2IPUK 3GMNB 5E6YA 1BAFH 4KKAC 3C8HA 4HK3N 3BP4B 3MRDB 5GRVK 5I1JL 3M17B 4PJDF 4Y4KC 4CVZB 4X98B 1NQBA 1KB5A 1J0IA 1X5JA 1LO0H 1WQVT 5EB9A 3O3UN 5FV1L 1BZ9A 2OR9H 2ED7A 1WEJH 5DVMA 2X4QA 1S7RB 3DIFB 3EO9H 3DXAD 3PIQB 3W0WE 1U8KA 4GT7A 4IOFD 3DVNA 4PLJC 4Z0BL 1C5CH 5T5NF 3IXAB 1MCFA 4NO2B 4AL8L 1RIHH 4PREB 2JJSC 3KS0H 3IDYC 4Y16A 3SKJH 5K9OA 4O2FB 1NAML 1VGKA 3VH8G 4JY4B 3OPZH 1IC1A 4I5BB 2E7BA 4LF3A 4U6TA 1FYHB 4HBCL 3CNKA 5DJYB 4K9EL 3EFFA 4YNYA 4JM2D 2IMMA 1QSED 4F8QA 1K4CA 2R69H 3VGAC 3ECBB 2NY5H 4APQA 4GRWE 3TFKC 1IEBB 4JFEE 4PREA 3V5HB 1KB5B 3HUJB 3DV6A 1DLFH 3EOBB 4JKKA 3TN0C 1HHGB 3QUZB 2J8HA 5BW7A 1YN6A 3RWEB 5B22A 8CGTA 1AXSA 2EDLA 4P59H 1BQLH 5BJTB 1MFBH 2JIXB 1DUYA 3EOAB 4NM8H 3IJSA 2AS5M 2YOCA 3RY4A 4NZUL 2K1MA 4X5WB 3GB7B 1XF1A 2XQBL 2R2EB 1NEUA 4Z7UB 3NZHL 1NGWB 4L3EE 2Q8BH 1RIUL 3C60B 4P9HH 5EU4A 1IM3B 4Z76B 1TJGH 3D18B 4G43A 3ARDD 4OCRH 1SBBA 2ATPB 4EOWH 2HKHL 1GHFH 1YY9D 5E6IB 5IESH 1KCVH 1CN4A 1UH4A 3UJJL 4IDLA 2OXHA 5D2LF 3RWGA 1D9KC 1QFWH 5ITFB 4KZEH 1AE6H 4JFXB 2ZCLH 4AEFA 3OGCB 1FPTL 1KEMH 5EU3B 3BH8B 3R0MA 5ADPH 3U30C 1A7OH 3HG1B 1KIPB 1PLGL 2YUWA 4GBXA 2GJ6A 4XPGH 4LNVA 3WO4B 3DURA 5IQ9A 5GJSL 1FYTE 3TYFB 1J0HA 5LAXB 4KZEL 4KY1L 4APQC 1I9IL 5EZJB 3IDGB 1S7SB 4J1UB 2V5TA 4HHAB 1HWGB 5EOTA 3VMNA 3ALPA 1VENA 2EXYC 4BM7A 4MQ7B 3IS0X 4IRSD 4HZAA 4R4BA 1FO0L 5KJRH 3H3PH 1I9IH 1Y18A 5T3XH 2GSGB 1ZS8B 4NO5B 2A9MH 4WW2C 4YK4B 1JJUA 3CVHB 1DFBH 1AXSB 5D5MB 1DEDA 1KBGL 2NY4C 5FM5M 5ISZA 3GI9H 2ICCA 1WBYB 4QRTA 3VFSA 4Z7VA 2LTQB 4HKJB 4WV1C 5J9PB 2YRLA 2AJ3B 5F9WB 2OZ4L 3QEUA 4JM2C 3L3KB 5GGSB 1CQKA 1XGTA 3QHFL 5LQBL 4Y2DB 4PRAA 2Q20A 3P4OB 3QRFM 5H94A 5FYKL 1JGDA 2R1YA 1KEGH 3U83A 4JQVA 3U4EA 2DD8H 4TNVK 1I3RA 3WKNA 3D3VB 4H25B 4JFDE 5KSAB 3KPSB 4PLOB 3VFOB 5LQBH 2VR9A 4M7LL 3NFNA 4WENB 3U46B 1LO4H 3DYOA 4PJBE 3AS1A 3SQOL 4OLZL 3U7WL 2AJZA 4OLYL 5D71H 5DJ6B 4PRHD 2IPKA 3KJ4C 4UT7L 5HGBA 4NOFA 4ZMAT 4BZYA 1UH2A 5I1DA 1U0QA 1KJVB 1J1PL 4P2YA 3ARFA 2W9DH 3REWB 4KK5D 3MRBB 4I2XB 1KCUH 3EBAA 2DI8A 2VJXA 2NXYB 3OAUH 1ND0A 3CFEA 5DJDB 5C0CA 5FYLE 4KPHH 3I02B 1S9XA 1FVCB 5L8LB 4XPFH 5D4QA 1EMTL 1D5ZA 4RGNB 1F13A 2CGRL 4MXVF 3H7BB 1FL6A 3MUHL 4MCZB 4D0DB 4POZD 1ZTXH 5KN5B 4S11A 4WTZG 5J13C 2P45B 4AIZB 3UYRL 4HWUA 2VL4A 5E9DE 4PJIE 4G8EA 4Z7NF 3LKOA 4PJHB 2PCPB 1BZ7B 1FCGA 1E28A 4RAVA 5DO2D 3R1GL 3PUCA 5FYKD 4NZUH 1L9NA 2W65B 5CZVL 4QRUB 3T0DA 4OCXH 4KK9C 4NUGL 2VZOA 3V4UH 5CKAA 3ZTJG 1MHPL 4QOKA 3UTTA 1HEZA 4PLKC 3BPNB 1TVBA 1M05A 1VFBB 3GSNB 3LPFA 4PJHF 2FJFA 3QH3B 1C5BH 4KK5C 4MYWB 5ID1B 2P8PB 1NUGA 5GS1B 3SBWA 1MLBB 3RPKA 4RMUA 4HXBL 1JK8A 1N2RA 2AJUL 1MVUA 4U1HB 1J1OH 1URLA 3QAZC 4R3SA 3SE9L 3MV9E 4WWKC 1FIEA 3OTTA 4NT6A 1EVUA 2HVJB 2XY2A 1MCJA 3ULVH 1YEDA 1EEYB 3MXWL 3S34L 2P47B 2OCFD 1UB6A 4PGEB 4KQ3L 3DJ9A 3FN9A 3JV5A 1RURH 4W6XB 1FBIL 4AL8H 3GRWL 4BKLA 3MRBA 3VE0A 4C83A 5E2UH 5D70L 3UTTB 2E27L 4HV8A 2X09A 4HKZA 5DC9B 5I1DB 4X0KA 1GHFL 4TQEL 1MAML 1N7MH 3BT2L 1T0NB 1NDMB 1RZ7L 3VCLB 3MV9D 4XNMA 1NGQL 5E0QA 2ZOKB 5J1AA 5JR1L 3P4MB 2YD8A 3ULVE 2AXFB 1BVLB 1OTUD 4K8RC 1WAAE 4N0CD 2IBZY 5DFVC 5CIPA 3OKEA 2XZQL 2B2XH 2COQA 4L3CB 1NBVH 5C9JB 5I18H 3GUTB 3GIZL 2GFBA 1WTGT 1ODAA 2HG5A 3I6LD 4D0DA 4JFDA 3MJGX 5CBEB 3AMKA 5F7KC 2AABL 4KC3B 2OK0L 3LKPA 5HI3C 3P4MA 4MJIA 5IQ7L 4GAJH 1QNZL 1BBDL 4LRIC 1TIUA 1T0NA 4ODUB 3MGTA 1AHWA 5CEZE 1F4YH 5F89B 1IT9L 4WO4A 3UPRA 4NO0B 2EKSB 3D39E 5C0EA 1KCLA 5I2IA 1J05B 1A1MB 3QUMH 4OCWL 4ZFGL 2A0LC 5C0BE 1ZS8A 3MJ9L 4HC1H 1OP3H 1MHEA 5F96L 3WFCL 1N0XL 3TZVA 1EZVX 2B5IB 1QKZL 1CICC 3VGEA 4Y2DC 4UB0L 2Z91A 4NJ9L 2NY7H 5DMYA 5I1LA 1R3JB 4XBPA 4DZ8A 3MRCB 4LQFH 1N5AA 3LKSB 4O58L 5CWSB 4JO4L 2EYRA 3VRJA 3LRHA 5M95B 1RJYB 2IF7A 2X1XR 1DQQB 2YRZA 5HGDB 5T33H 2YC1B 3U0PB 3MBEB 5JDSB 1SM3H 1FVDB 4WHDA 4U1JA 5IGXL 4JFFB 5GGSA 5C0AD 1AGEB 5A40E 1FDLL 4D94A 2NY4B 5DYOA 5ETUA 5ENWA 4DTGL 3OKOB 3STZA 3U6RA 4NQCD 4WHYG 1NC4B 4NKIH 5HHMB 3LB6D 3BP7A 1T66C 3LKSA 1CBVL 5KW9L 1JZ4A 3ARFC 4ZS6C 2DQDL 1UKTA 3F7YB 3S35H 4I48A 1A1OA 4I0KA 2VDKL 2APVA 3B2UD 5IP4A 5I30H 2FX9H 3SHSA 5H37H 5CJXC 1VFBA 4QHLB 4F37K 1FNEA 4QGYA 3EFDL 4X6DB 1NLDL 4ZUSB 1INQB 2WP3O 4RGND 5GS1C 4ZXBB 3HTLX 3CVHL 6FABH 2YZ1A 1NCTA 4N0RA 5LGHL 2EDFA 1NBYA 2WIMA 4PJEE 5EU5A 1RUKL 5F89A 5IIEB 3X14B 1ZA3B 2EEDA 2DQHH 2W9EH 4LVHB 4M1DL 4P2OD 1ZTXL 3ZT6A 2D31A 1LO5A 4I2XE 4OLEA 4NN6B 5D96C 4DGIH 1F8TL 5D2NA 4BSVA 5EG6C 2BVQA 3BQUD 3RWFB 1CFTA 4GKNB 2RFXA 1P69B 3OX8B 3WBDA 4OIAA 5DJ0A 4AIZA 1FFNA 1PAMA 3HHRB 3EZJB 3UPCA 3ARGB 4X7CC 1FE8H 5BS0A 3C87A 1OCWH 3W82A 3BWAA 1VACB 1FCCA 1SM3L 2C3GA 5IVXA 3D1MC 5E9DB 4BSJA 1BQHG 4RZCB 3ZKMC 2WLYA 1X5AA 2PXYC 3HE6D 4N1HB 3K8MA 4HCRL 3GMMA 3Q1SL 2DMCA 3FCTB 1RJLB 3MRPA 2AAVA 2BNUA 1QD0A 4LDOB 1TZHA 3MLTB 4I4WA 3VXRB 1U42A 4CVWA 2ARJQ 4MXVE 4HUWB 4N8VA 1ZK9A 4HXBH 3QUZC 1MQ8A 3V4PH 4X5WA 4L8SB 4K94L 5JXED 1J0YA 3VXUE 1R24B 1GOFA 3HUJE 3QULB 3L1OH 3LQAH 1RZFH 4JCMA 2CJUL 5E7BA 5D7JB 1ZAGA 3GJFB 4N90E 5E2JA 2CKNA 1SYVB 2CH8A 4KKCD 4R3SB 3I75A 3BZ4A 1LNUB 3QHZL 4NNPH 3IJHB 3TM6A 5J0BA 4WHTB 3UTSB 3IVKA 3WNNA 4UNVA 2H1PL 2XTJB 4XXCA 1T21B 3OKDA 1CYGA 2PW2B 1QYGH 1OQOA 4Y5XC 3EIFA 1S9VA 3HZYA 2VWEC 5IFAL 3SDXF 4YAQA 3R0NA 1JV5A 4LLMB 3DX9A 2Y9RT 3U36A 1I8LC 1WZLA 2OL3L 4UBDC 3HZMA 4U05A 3ZE1F 4QKXB 2J8UA 4ODWA 4CJ0A 1OGTA 4NP4L 5EUKA 4URTB 2QADC 3P0YH 3WJLA 2VO5A 2MCPH 1NFIB 4ODBD 2VTFA 4YQXL 4P2QD 1LK2B 3GHBH 4RIRA 3LRSA 1MAMH 1U8JB 4Y5VC 3PGCB 5IR1A 1A4KB 1HHHB 3CLFL 3WXWL 4UTBL 1VDGA 2ATKA 2FHBA 4FQCH 4WJ5B 3SE3A 3BZFA 3PWPD 4RFEA 5FEBA 3QWRA 3W2DH 1FNFA 1PQZB 4YHMH 2B4CL 3VXSE 1S9XB 2Z93A 3CH1A 4ISVA 1HILB 1F58H 3BUYB 2DJ4A 2IGFL 1KGCD 3R8QA 1BFVH 3MLXL 3ULVF 5JLZB 2BNQB 5F3BA 1BQHA 1T83C 1WAAF 2CLZB 4LCWB 4PLKD 3UJIL 1WITA 4Z8FL 2A9ML 5BMFL 1MREL 1NMAL 1H15A 3WKML 3NIGE 2WQRA 1C16B 3PNWA 4IRSC 3VRIB 3E1F1 3MV8E 5ALBH 3SGEH 1CZ8L 3WUWG 2M1KA 2JE8A 3F58H 5HHQA 5IG7A 5TF0A 5KANG 5TDNA 3CCHA 4IM8A 1M71A 4YH6A 2DBJA 3QSKB 2H26A 5ERWB 3OKKB 4FA8A 2XZCL 5DVKA 4HKBB 3EGSB 1EDQA 2MPAL 3ZHKA 3DGGA 1DDHA 3REVB 3ALXA 3RKDD 3CSYB 3SE9H 1DFBL 5L2KE 3L7EA 4AK1A 3ARBA 1P4BL 1JFQH 2F8OA 1TVDA 1HHKB 3TIDA 4NFCA 4Y4HD 5MHSD 1KG0A 5AYUL 4GRWF 3TO2A 4H88L 4KK6C 1OARH 4P4KA 3JWOL 5E8DL 3QWQB 4X99A 4XHQA 5A2IH 3H9HB 3SY0A 1X7QA 1R5VB 4OZFA 4FQ2H 4LHUG 1IGTB 2W1NA 3IKCB 4XCEA 4XPGL 5TE7H 1UJ3B 4RBPK 1L7IL 3QIUA 4N8VB 2PR4L 43CAB 3O2WH 3CU1A 1M6OA 1J8HD 1WWCA 1U95B 1DDHB 3O3BA 4FFZL 5JIHA 1OD9A 5KOMC 3CSGA 4F7MB 1OSPL 5CEYA 3CK0L 3GMOA 4WHYH 4L9LA 2VR4A 4HS8H 4P2RD 2DBLL 4X6CE 2MQ0A 5C6TH 2HYMA 2N56A 3FO1A 2H6PA 5DI8A 1WBZB 3PXJA 1V3KA 1E6JL 3MRFB 4IMKA 4ZFFB 5DFVD 1K6QH 1ZVYA 3D0LB 2R0LL 4P4KC 5GISL 3TH4T 1KNOB 5B3NA 4OFIA 3FFCA 5ICXB 3FQRB 3MRJA 1MFAH 4LVOC 1PG7W 3OZ9L 3EDKA 4H1LH 3RUGF 2BVPA 2GTWB 3KPLB 3O2VL 4G7VH 3WDJA 3V6FA 3V0WH 4BQBA 1HQ4A 3D25A 3RU8L 4P5MA 4XMLL 1GGUA 2AJVL 4U2ZA 3E8UL 4L8CA 4YHLL 3UCRA 2D7TH 2BRQA 3EGSA 1INQA 4QXTB 5C0JA 5HHOD 3RWIA 2ENYA 5EOCL 3UZQA 4EEEA 4OF0A 5IT2L 3ILQD 4PJ7F 1JZ8A 1RZIB 3KPNB 4JY6A 4QRSB 4BUHA 5I1GL 5E5RB 5DZLA 3EHBD 3W9DB 2Q6WA 5DEZA 2IBZX 5IW6A 2EO9A 2OTWB 2W0PA 5CILL 2A6IA 4NN6C 4JFXA 1Z9LA