4N0CD

42f3 tcr pcpe3/h-2ld complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
b'AVTQSPRNKVTVTGGNVTLSCRQTNSHNYMYWYRQDTGHGLRLIHYSYGAGNLQIGDVPDGYKATRTTQEDFFLLLELASPSQTSLYFCASSDAPGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 54
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n0cD02
1FGVL 3B8YA 2R0KH 4WCYH 1EZVX 1EO7A 5FUCC 2IQ9L 3H3PL 4E0RA 2XYCA 1A21A 5JW4Q 3UTZA 1JPFA 2O5ZL 1FDLH 5T3ZL 3GSVB 5F44A 1C5DA 3QG7L 3DBXB 1HNFA 3FAWA 4OZGB 4YNYB 3OL2A 3WFDL 1AJ7L 1I1RA 2FECL 4YXKL 1J1OL 3JTSB 4XNXH 1INEL 1ZEAL 3BUYA 1RIUH 3T2NH 1I85A 1J0YA 5D2NC 1LEKB 2E6PA 2PYEB 4P49A 4WRLA 2J8UE 2NPLX 2G9HB 2VDMH 5IT2L 2YD7A 4NDMA 5L2KB 1OTSD 3FHQA 3KXFD 5I1IL 3KLSA 3D3VD 1A5FL 2C1OB 3U1SH 4RA3A 4AH2B 3NIDE 2A6KA 5E95B 5HYSB 1YEHL 3P4NA 5HHMD 3WHXB 4XVTL 2NY4B 4PJ7A 4ZYKA 4ODUB 3MV8A 4ZO9A 3RWCA 3X12A 1AP2B 4X83A 4OD1L 1NGZA 1UH2A 3F6IA 4P3DB 5IP4A 1IC7H 2FH8A 2GTWB 5FGBA 1JRHH 2IQAB 2V2TB 4HUUA 3FFCA 3VI4E 3LS5L 5AYQA 3KPRB 1AKJB 2RBLA 5DVNA 3X14A 3O2WL 1EERB 3MRDB 1C12A 2C5DC 4LCWE 2K7QA 2A0LD 2DLFL 1OOAA 4FMFA 3QUXD 4WWKD 3T2PA 1EHAA 1K4CA 4XVUC 3FCTA 4OGYH 1F4HA 2BNQA 1A6AA 2JCCF 4NO3B 1T1YA 2X2YA 3LS4L 1MWAL 3IKCB 2FZ3B 2ZCHL 4OCRH 1P9MA 6FABL 1WISA 4LLVB 3D18B 4S0SD 4QHMA 2HG5B 5D7IF 1X5KA 1CD0A 2PTVA 3I75A 3PL6A 2HH0H 4XRCA 5CJOH 1ACYL 1N7MH 2BSRA 2IJ0C 3O2VL 1XIWD 5BVPH 3DUUA 1RSFA 3LH2L 4F3FB 1B4JL 4KK9D 5D5MB 1RJLB 5EUOB 4F80A 4XCCL 4ZS6D 2EIDA 3IS0X 1N59B 3P4OA 3MV9B 4M8VA 2NY3D 3OKYA 4ETQB 5EZIL 5ILTL 1TETL 4HS8L 3HUJE 3MCLH 4OB5H 1T66C 2KL6A 4OLWL 3CXDH 3RDTA 4C59B 3WS3B 5TE7H 2XZAH 4Q74A 1YEIL 4PJAA 3NH7H 2EXWC 5J9PB 4HFWB 1QKZH 3V4VL 3QEQB 5DRNA 3K80A 4ZUTB 3QXVA 4EI5A 1I1AB 3MA9H 2VAAA 4NQEB 4UOW1 1PX4A 2XIDA 1GHFH 2HJKB 4L8DA 2FGWL 1FL5A 2EE6A 3QXTA 4DKFH 4U7SA 3DVGB 3V52L 2AK4B 4XPGH 3WDHA 4LSSL 4P2RE 1MRFL 5GRWA 1HXYA 1CXIA 1ED3A 4YO0B 1M6OA 4XP9H 2LTQB 3UJIL 3IFPA 5HJ3B 3D2UA 2V2WA 4HMCA 4P0DA 5EC2A 1AO7E 3U0PA 1IM9B 3VRJA 3NCEB 5LGHH 2FX9L 3OZ9L 1U93A 2QTEA 4KPHL 5J11B 4QOKB 4Y19D 5KG9B 3O6FD 2JELL 5MEQA 2OCFD 5GS2D 4U1GB 1KNOB 4NCC2 4PGDA 5FCSH 2CUIA 4YQXH 4IS6B 4Y4FD 4YGVB 5EU6B 1BJMA 2VLRD 1TNMA 4KKCC 1MIEL 4WFFD 3SDDC 1RK0B 1CGSH 4M93C 3DX6A 1E6OH 1OAYL 1HIML 4YZFF 3AROA 4ZO6A 4RMRA 2ZJSL 2A6DB 3DURA 4UZGA 1TMCB 1YMMA 4LKCB 5L8KB 3DJ9A 2I25N 2P5WD 5GRJH 1OB1A 1A8JH 1J11A 4JFED 1ZSDA 1P4IL 1CZ8L 4LQFL 4MDIB 4GG6A 3SPVB 1A9EA 4MCZA 4LASL 1BD2D 1NBZA 3S9DB 2AQ2A 1ULVA 2FLRT 3KYNA 1MLCB 2R1YA 4QF1B 1HHKA 4U7KA 5GIRB 4BA8A 1RURH 3NAAH 3WD5L 4CJ0A 2CDGA 1TPXB 2NY2B 3BYTA 4G8EB 1JNHA 1UENA 1PAMA 3O6KL 5E8EB 2VNCA 4QXTA 4K94L 4FQXB 1D5MA 4DW2L 5IG7A 5DZLA 3QUZB 4PJHE 3SDAC 1Z2KA 3IXTB 5IVZA 1EZVY 2F54A 5IB2B 1RJYA 1SY6L 5DS8B 3LEYL 3IDMA 4M4PA 4MJIB 3RJQB 5HYJD 2VDPH 2Q3AA 1ZLSL 4FQLL 3BP4A 4DCQA 1MCDA 1MJUH 3BEWB 2YZ1A 3BWAB 4LLUA 4K71B 1ZHNB 4OSUL 4I2XB 3B6SB 4U1NA 4L4TB 4XWOD 1TQBB 3O3BB 2VITB 3EBAA 3UC0L 1K85A 3D69B 2VLLB 5T1LA 5F1IA 1OP5H 1BFOA 2EO9A 3CX2A 5A43C 3GSWB 1ZGLP 1BX2A 5JUEH 4Q9CA 1N6QH 1D6EB 1GZPB 4X7FC 3DROB 1LDPH 1ERNA 4UT9H 1BWWA 4FP8L 2XKNA 2HYMA 1TJGL 2OL3A 3HZVB 4RFNC 2Z31A 4GAYB 3QXDA 4J1UA 1V05A 2Y7QB 1BPVA 1RUKH 3DVNB 4KRPD 3OB0H 2DD8L 1URLA 4TSCL 4K07A 4TNWF 1TZGL 2FD6L 4X6DB 1CFVL 1RZKH 4X98A 4L3AA 2ICEB 2IAMB 1MCWW 3EYVB 3TJHC 3F7PC 4XMLH 2X42A 4IMKC 3HG1A 4GRLD 1ZHLB 4HWEH 3H7LA 2ADFL 2DTML 2H1PH 1JCKA 4R4ND 3KXFB 4HZLB 5IROA 3RAJH 3D3VB 4K3DH 3ROLA 5HGGS 1WBZA 3VGDA 3Q6GL 5HHMB 1U3JA 1KJMA 1GSMA 2VABA 4NC2B 5I76B 1IAIM 2QSCH 5HHXH 1ND0A 4CW1B 3MBEA 4N0CD 1TVHB 3WFEH 5JHDB 4JKPL 4WGVB 1WJ3A 3O0RH 3RX5A 5I75C 4ZDHB 2HWZL 4HJ0D 3EDKA 1EK3A 5IWLA 4F15C 4ONGH 2ESVA 5KSAB 4JJ5B 2V5YA 3HC4H 3QUXB 4WWKB 3VXPB 4B0MM 1HKLL 2EDRA 4KROC 4X8JA 4XXDB 4JANB 1IBGH 1AGEB 3ZDXE 5DMJB 4Z7WF 4ZUWA 1JGUL 1FC2D 5F89B 2YK1H 4ZAKD 1FZOB 4LMQI 3RGVB 2EDKA 4J6RL 5H94A 5I1EH 2XG5A 2C1PA 4NUJA 4QLRA 1JV5A 1F6AA 3GSOB 5D6CB 5DHVB 1XIWB 5SWZD 4IRSD 1AI1H 4P23C 2BP3A 4HUWB 1DDHB 1W0YT 2JB5L 1MRDH 2GI7A 4XVJL 1BVLA 5D7LD 4JN2B 2Q8BL 4YXHH 4EBQH 5HGBA 2NY3B 2FX7L 4UBDD 5FV1L 3ULUF 4OD2B 5J06A 3NCMA 3KYOB 4PJGF 4WU7B 3W2DL 2H2PD 2HLFC 4CU8A 4OBRA 4LPXA 5EUOE 5GQBA 3GSXA 1UKSA 5E70A 3T77B 5I16A 2G2RA 1PD6A 5IHBA 4RMTA 1KN2L 1NGQH 2F53D 4BH7A 2FCBA 3MRQA 1UQSB 4MCYA 1RJZA 1FIGL 2UWEF 1A6TA 1G9EA 3G6DH 1MCPL 2FO4B 4M6NH 2GJ6A 1QQDA 4F9PA 1DBJH 3AS2A 4CBPA 3ME0A 5LGJB 1YEDB 5FO8A 1J8HD 4QWWC 1NCDL 5D2NE 4X5XA 3NFNA 3W39B 3TVMC 3QDJA 1CLYL 1WZKA 1LE5A 4ZTPL 1YYLL 1S7WA 4PRPE 2Y6SC 4JRYA 5C86A 4NQEE 4YHMH 3ECBB 5IVNA 1JGLH 3O11B 3O6FB 5ISZD 3V6FA 4Z18A 4NC1E 2WM0A 5DRWA 5MP6H 1AD9A 2AK4E 4PJCA 2DL9A 2FECI 1ZOXA 5I1GL 3FFDB 1B2WL 3IU4L 12E8L 4I3SH 4HHAB 5DJ6B 2Q20A 6CGTA 3FN0H 1VFBB 3IDIA 5CUSH 3E8UH 4Y4FB 3RL1A 1OAKH 1B6UA 1LE9B 2VLRB 1ZT4A 2P43B 3C8KA 5ABDE 1TQCC 2VLJB 3O2DL 4DTGH 1I3UA 4RGND 4ODXB 4MJ2A 3IJYA 1YEEH 2P5WB 3HPJA 2V5MA 4JFEB 5GPRA 2Z93A 1A6VL 4JRXD 5F1NA 5EU6E 5C92A 1A02N 3OTTA 2NY5C 3EFFA 1BD2B 5HYQB 1EIBA 2B20A 5J1TC 1E4WH 4TQEL 4LEXL 1G7PB 1IAII 1XR8B 2DQEL 1RZJH 3WLWC 1UVQB 3OX8B 1S5HB 3MNWA 3RQ3A 3SO5A 4URTB 4J3TA 1XF3B 4BKLB 4MB4A 3EOAA 2H9GB 3EO1A 5J6HB 1U91A 4HXAL 4MWFB 4UT6L 1I8MA 1AGDA 1P6FA 1MREH 3D0VA 4N0YH 2DQHH 2X41A 3AS3A 1UKQA 1WIUA 2EYRB 3TO2B 4S1DD 5BXFB 5GSVA 1B9ZA 3WXVL 3BAEH 5CKAA 1MFBH 5HYJB 3MV8D 2DKUA 4R0LA 3O3DB 2A77L 5DQ9A 3VWJC 5JOPD 5C0AA 5ICZA 1WICA 3MRFB 1EPFA 4P9ML 3BEVA 4KQ3H 4MXWL 2DLIA 4GG8B 3O4LD 3QQ3A 4YR6A 4GKNA 4G8FB 1LK2A 1TJIH 1NAML 4NPYB 4WUKL 2EDDA 2Q86B 1UYWH 3TT3L 1ZLUH 2BNQD 3UBXI 2YXMA 1VA9A 3DGGA 5J89A 2ZSWB 4LSDA 1FP5A 4KV5E 4PLJD 4KRPB 1Y18B 2E7LC 2CIIA 5L0QC 4QHNB 5ITBH 3PL6D 3OR6A 1K6QH 2PTTB 3S88H 2O93L 8CGTA 5DHXB 5GSRB 4PJEB 2Q8AH 1AGBA 4GKZA 4YWGL 1A9BB 3TM6A 5L2JA 2EDOA 1UJ3B 3KPSA 4G8GA 4GRLB 3H3KA 1QP1A 4OI7A 4LHUA 4X7SH 3QCUL 2FEEI 4X6BB 4CVXB 4P4KC 3VA6A 1SBSL 1KPVB 2I07A 3B83A 4PJBF 4PJ9A 4X6DE 4XMKL 2X7LB 3RDTD 4XCEB 1DQQA 1E28B 1IC1A 4M62L 3OKOB 2DWEA 2AJZA 4NZTL 4FXGA 2IBGA 4LVNC 5IFHL 3TCLA 4F33B 4EI5D 3KXFE 1DBAL 4I13B 1A6UL 1JK8A 3D3VE 1FVEA 3EW3B 1KJ2B 4OM1H 5DJ2B 4ZXBC 3ARXA 5HHME 5CEYA 2XTJC 4DGYL 3IXAB 5ALCH 1LNUA 1PQZB 4IHOB 1DUZA 3C6SA 2YBRB 1SJXA 4MHHG 2VXQL 5MHSD 3VFPB 1BFVL 1QHOA 3D2UD 4IDJH 5JHDE 5J13B 4E9LA 2C3WA 1BJ1J 1UCTA 1AXTH 1WBXA 2KZ1B 1NEUA 5F9AC 4ZAKB 2SEBA 4A6YH 4MA3B 1KJ3L 5DD3H 2BVEA 4M6AA 2XNAA 1VFAB 2EIBA 4PYGA 3KHOA 4CADB 1BQUA 3ET9F 4LCUA 3U2SA 2APTA 1FG2B 4YFDB 4IRSB 2EDHA 2DI7A 4PD4K 5IK3B 1LO3H 1PKOA 2YPKB 4TVPD 3EGSB 4IOFD 2XWBB 5F9OH 5IIEB 4JPKL 5IHUL 1NKRA 1KTDB 1S9VA 4P5TA 1ZA3B 1JGVL 5D7LB 3IDUA 5GS0H 2QADD 1X4XA 5IGXH 1NLDL 1RFDH 5EOQH 4X7TA 1DL7L 5GGSY 5CP3H 3KPPA 1S7RA 4FFVD 1YMMD 2LFGA 3DPBA 4WY7L 1KCRL 2WBJC 1WF5A 4NFBA 4Z7VB 4D9QD 1JF5A 3WIIL 1YN7B 1BOGA 2Y07L 3OKLA 4OCMC 4X6CA 2QBWA 3GO1L 4P4RA 1LEGB 2P49B 2F53B 3D1MC 4JM2F 4DOHE 4OFDA 4IOIB 1I7ZA 1R3IH 4UTBL 4QGTA 2H3NA 1FNEB 3R4DA 3SDXB 5MEOA 1BLNB 5KVFL 5C0JB 1V7MH 1RUQL 1P53A 2YUXA 2NMSA 2F54D 4UV4H 3SGJC 1I4FB 2VDQH 4ODHL 4GMSL 1XFPA 5K9QI 4M1CD 1CGYA 1Q9OB 4PP1C 1EGJA 5ISZB 1JHLL 1O0VA 2YD3A 1NSNL 3ARVA 4UIMA 4XC3L 3OGCB 5ETUB 4O02H 4HIIA 1CGXA 1U92A 1QA9B 5I74C 3ZMRA 5T1LD 3VGFA 4F58H 3OBAA 2V5SA 1RQ5A 4LBEB 4Q2ZB 1YQVH 5FDWB 5EN2A 3TO4C 1IFHH 4HBCL 4EN3A 5GHWH 5IBTL 2ZCLL 1ZHBB 3OKEB 4RGNB 3UTPD 3UTZB 1EJOH 5HSFA 1BVKA 2Z31D 3C87A 4GW1A 4FS0A 1C5DB 1T7WA 1VPOL 4QRUB 2RQ8A 5GGRY 3VFTA 4JRXB 3VXME 5DJAA 5ACZA 1DQDL 2B1HH 4R8WH 3X3FH 1IGYA 3V8CA 2VERN 2Y36H 4XVSL 4WFFE 2J6EL 3O9WC 5C6TH 2VLJE 1MCLA 5B39A 1IGFH 1K8DA 2DQUH 4QTHA 1LO0L 4NKIH 5C7XL 3QZWA 2P5WE 4NKMB 4DUWA 3HG1D 2QV2A 5T1KA 4MQSB 5FHBH 1KENL 4ZFOB 4O51A 5A3IC 3NPZB 1J8KA 4CUCA 1BF2A 4Z7NE 2QSTA 5HVGB 1T89C 4JZOB 2JJSC 1OARH 1SQ2N 2J5LB 5L88H 1RZ7H 5CD3A 3CJJA 2CLVA 4PJ7B 2RHEA 1N2RB 3MLPA 3MV8B 4QRRD 3RWCB 5A2IH 5FA4A 3X12B 4WNQA 1NGZB 3AXLA 3L3GB 3CFDA 5IKCA 3NABH 3MBED 4ODVH 3CDGA 4HUUB 5E2TL 3VXTA 4L8SC 3T65A 2L7UA 3SCMB 4OLUL 3GSNL 3ULUL 1FGVH 2NZ9C 1G0YR 3O4LB 2N7AA 4QKXB 4H1LA 4J3SA 2IQ9H 1H3XA 3H3PH 1N0XL 4OZGF 3JZ7A 1C12B 5HD8C 2O5ZH 2ESVD 1P84K 5T3ZH 1K4CB 2VR4A 4W81A 3SY0A 3FCTB 1CDUA 3QG7H 5F3BB 2BNQB 1KT2A 1T1YB 3HPLA 3WFDH 1AJ7H 1ZLVK 3BYYA 1A6WL 3BIAX 4YXKH 3RZWA 1J1OH 1ZEAH 4QHMB 4PRHE 2C3VA 2UZXB 4OFPA 4XT1C 3I75B 4Y4HC 5DD6A 1L6XA 1NANI 2BSRB 2OYPA 1HYSD 4YPJA 4MDJA 5IT2H 4CN6A 5BRZA 2HA1A 5I1IH 4GXUM 1A5FH 2AS5M 1LILA 1S7SA 1YEHH 5BCAA 5FYJE 4XVTH 4I0PA 4AG4L 1KCLA 1MAML 4LSRL 2B7DT 4OD1H 3L7EA 3KLHC 1W8NA 2WIIB 5JLZA 4HGWB 4WV1C 4KKAC 5DRNB 3V6ZA 4EI5B 3LS5H 4QY8B 4U3CA 4NBZB 3D25A 4Y5XC 3O2WH 4L8DB 5T5FL 3KJ6L 4LP4A 1FL5B 3ZL4L 1HCVA 5DR5L 2DLFH 1I8LA 1HHGA 1ZV5A 2YUVA 3U0TA 3B8SA 4ERSL 3GSUA 5INDA 3BSZL 5FEBA 3LS4H 2Z35B 3QDJD 1MWAH 1HXYB 32C2A 4R4FL 2ZCHH 4JO2L 4KVNL 1AR1D 3IFPB 6FABH 3D2UB 2V2WB 4JRYD 5EC2B 3U0PB 3KS0H 2XZZA 1KTKE 2V2XA 5D5MF 5T3XE 1ACYH 3SE8L 3O2VH 5MEQB 2ZUQC 1QUNA 3LH2H 1S7TA 4PGDB 1B4JH 2YPLD 5HI5D 3VXUB 3L3OB 4ZPTA 4XCCH 3MO1A 4BFGA 1X5ZA 3IETA 2KDGA 3QUMA 5FYLE 5EZIH 1KIRA 4JQXC 2IALA 4Y2DB 5ILTH 1TETH 4HS8H 1CGVA 2QADB 2DN7A 4OLWH 1R3LA 5GGUB 4JAMA 3T0BA 5K9OA 3PF2A 3VRLF 2WSKA 1YMMB 5C0IA 4TNWK 1YEIH 3F7RA 1OB1B 4JDTL 3AUVA 3V4VH 1TTGA 4KXZI 1A9EB 4MCZB 4EVNA 1NBZB 2Z4QB 1F11A 3KYNB 4RA0C 2R1YB 4RMVA 2FGWH 2CDGB 3VGHA 1G6RA 1KXQE 3V52H 1EUUA 1CD9B 4JHAH 4QXTB 1F4YL 5LGKA 4LSSH 1MRFH 1D5MB 5IG7B 2HRLA 3UJIH 3GEWB 4UINL 3G6AB 2FX9H 3BHBA 3OZ9H 3QWRA 4KPHH 1NUNB 1RJYB 1UT9A 1DN0A 1HHIA 3IDMB 2VE6B 2JELH 3OSKA 5KVDL 5JQ6L 1UM6L 3IDXL 2OJZL 5JOFA 3BP4B 1N5AA 4BK5A 2HT4D 3SDXE 5C0AD 4LLUB 2E7CA 3VFUA 4U1NB 2H8PA 3VH8A 4KZDL 3EYOA 3KR3L 4K9EC 1MIEH 5T1LB 5F1IB 3WL9A 3NIGF 4W6WB 1FCCA 3BD5A 1OAYH 1HIMH 3F7YB 3U46A 1BX2B 1H8SA 4HW6A 2ZJSH 1TIUA 1FYTA 3SJVA 3RZCC 3VWJA 5C9KA 3WUWG 1A6ZA 5FYKE 3MZGB 4NN6C 3MCKA 2XTJE 4XZUA 5GJSL 1P4IH 2X70A 3H7BA 1QO3A 1CZ8H 1RZKC 2XKNB 2OL3B 4LQFH 3MYZA 2Z31B 2H45A 3QXDB 4J1UB 4LASH 5GS1C 3BPNB 1O7SA 2OJEA 1CE1L 3EYSL 4UMGA 4V2CB 4XP6L 1R3JA 3NFPA 3MRGA 4XVUD 1CLCA 3RWJB 3WKNA 3WD5H 3RI5K 4C83A 1DVFA 3O6KH 4X98B 1UG9A 4RRPA 1ADQA 4RGNE 5JIPA 4YDKL 4K94H 2IBBA 4CJ1A 3ARDC 3ARZA 5D93C 4DW2H 5I1JL 3HG1B 4XNZB 3KPSD 4G8GD 4N90D 4XP1L 4LHUD 4JRXE 1VDGA 4F2MA 5FM5M 5D96B 1U2HA 1SY6H 3LEYH 3ROLB 2NNAA 1WBZB 3LKPA 4PJ9D 3F7VB 4MX7B 3E3QC 5T5NG 2OZ4A 3MNZA 1JYNA 1NMAL 3H8NA 3B3IA 4FQLH 5LKNA 1KJMB 2Q7YA 2G75B 4OGXL 3B9EA 1P2CA 4QRRB 2F8VA 3BMWA 1ND0B 4OSUH 3FRUA 1A1NA 3MBEB 3UC0H 2FL5B 4N8CL 3TWCL 5F1OB 3PHOA 4HXBL 3VGGA 3ZSTA 3BN9C 3WUWA 1W72A 3FO9A 5DJZA 2EXWD 4PJ7E 1X5LA 3P2TA 5I8OL 3DO7A 1YMHA 5JDSA 3MV8E 4FP8H 2ESVB 1TJGH 2FHCA 1YEGL 2PW2A 3DUSA 1U3ZA 2DD8H 4TSCH 4L8CA 5E5MA 4ZUWB 2E9JA 1CR9L 1DEEA 1X5HA 1TZGH 3O4LE 2FD6H 5F7HA 1NCWL 4XAKD 5H94B 1CFVH 2DKMA 5BMFL 4OZIA 4NUJB 1JV5B 1F6AB 4G3YL 4WGWB 3Q6FA 3SQOL 1KXTB 3SE3A 2ADFH 2DTMH 5HDLA 2BOCA 2NXYC 1GRWA 1U2CA 3RWEA 2DQDL 4EUPH 4ZNCD 1IGIL 4P5TD 1BVLB 4LOUD 1AD0A 3AY4C 3FQUA 3Q6GH 5HGBB 2EDEA 2YKLL 2GSIA 1OHQA 3AM8C 35C8L 1N3NA 4HV8A 3PJSA 3VXOA 4X4MA 3MLUL 3QYCA 4PLOB 3GSXB 2XT1B 5E8NA 3W81A 5I16B 2G2RB 4JKPH 3B9KC 3TBWA 1GGUA 4BH7B 3SE4A 1CTOA 4ZOCA 1S7VA 1OP9A 3MRQB 4MCYB 3KPNB 1A6TB 3RHWK 2LU4A 2HWZH 2D2OA 1OLLA 1QQDB 3STLA 5HVFB 5FO8B 1ITCA 1HKLH 1IQWL 2MKWA 3L5JA 4I5BB 2J3SA 3NFNB 3Q3GA 5DJ8A 1U8IA 3QDJB 3V0VA 5KANI 1LE5B 3IFNL 1S7WB 4JRYB 1JGUH 1MCBA 3T0XA 2R23A 2NZIA 4J6RH 4P46A 1SYVA 3FT3B 3V6FB 1GGCL 1AD9B 2IANB 1I1CA 1MRCL 4PJCB 5IM7A 3VXQA 2O61A 1AQDB 3SGJA 2YPLB 1E0OB 2JB5H 2ICWB 4I0CC 4Y7MA 3IDIB 3EHBD 3LQAL 2WV3A 4XVJH 4DVBA 4WO4A 2Y25A 2Q8BH 1WT5C 1HH9A 1ZT4B 4HKZA 4EN3D 3BE1L 2X9YA 2FX7H 5C07A 4GRWH 3L3HA 1BM3L 1NDMB 4YC2C 2P42B 3CLEL 3W2DH 4KI5C 1RZJC 3IJYB 4JZJC 4N5ED 1KJVA 1YEJL 4TPRL 4F9LC 3HPJB 3VXUE 4QYOB 4OLXL 5INCB 3GRWL 3VU2A 5F1NB 3TO4A 1NANH 1KN2H 3TNNB 1MUJA 2OTWB 3EFFB 2Q76A 4LPTA 1G7HA 5CIPH 1FIGH 3QI9A 5E7BA 1CL7L 1MCPH 3U30B 3STBA 5J4MA 1YEFL 2WBKA 1REIA 4ACPA 3WFZA 4M9OA 1JZ8A 4G7YL 4GLRI 1NCDH 3WNKA 4JFFE 4XHJD 5T1KD 3EOAB 3QB7C 1CLYH 3EO1B 3MRLA 1U91B 3HZYA 2R9HD 5DFVC 4AEIL 4JCMA 1AGDB 3D0VB 4ZTPH 1YYLH 4NZUL 1Z9LA 4K8RL 5GSVB 2AXGA 5D9SA 2IGFL 2NY1C 3CH1A 4M48L 1DZBA 4LDEB 4R0LB 4WW2A 1F2XK 2Q6WA 4CU7A 5I1GH 1B2WH 1VHPA 12E8H 3IU4H 4JLRB 5JNYB 1ACZA 4W4OC 1XAUA 5DQ9B 1NC4A 5C0AB 5HDBF 3MMEA 3ARRA 5ICZB 1MQ8A 3ABZA 3I50L 3QEHA 3BEVB 3SGEI 3BGFC 4OZ4B 5C0EA 3FQTA 1FSKB 1AHWC 3AU1A 3RVWC 3C6LC 1JPGB 3O2DH 5JOEA 1JPTL 5DGQA 4YR6B 1G1YA 4GKNB 1BEYL 4FXKA 4U1IA 4ZUUA 4L8SA 1BBJA 3PNWB 1X5FA 1A6VH 1EO8L 3J8F7 5E2UL 3BP7A 3T3PF 3RX7A 3U83A 2QQLL 4TQEH 5DI8A 4LEXH 4MNQE 2CIIB 1LD9A 2DQEH 3TC9A 3FN3A 4HGKC 3ULVF 3BDXA 3OR6B 4YHYB 3TZVA 5CFHA 2YEZA 1FORL 1AGBB 4GKZB 1TDQA 4HXAH 3GMMA 4UT6H 5BRZD 3TH3T 5L2JB 3KPSB 3AB0B 4OZHF 4LHUB 5GZOD 1M7XA 2VDKL 1QBAA 3ZE0F 2APFA 5KS9E 4XI5D 1A47A 2PN5A 5J6GA 4W70A 5C0DA 5E5RB 3WXVH 4NNXA 4DEPC 2OR9L 5C0NC 2CUMA 3TPKA 4PJ9B 3RVXD 4I0PD 1KB5B 3PV6A 2A77H 2DWEB 4KK5C 4M9PA 4P9MH 4FXGB 1NL0H 1NC2A 4MXWH 2DLTA 2Z8RA 4LLMA 1B0GA 3ZYOA 4QNPF 3RUGA 2HKHL 1JK8B 4Y8AA 2RFXA 3U4EA 1FVEB 2EYSB 4NKQB 1YC8A 4KHTL 2MCG1 3S98A 2DM7A 4G6AC 1BWMA 4LPUA 4WUKH 1PEWA 4QRRE 3TT3H 3C6SB 3BOVA 3LZFL 2KZWA 1F42A 3VDAA 4AL8L 4PJEF 1XCQA 4WTXA 3NCBB 4EEEA 1WBXB 3ZE1E 1LWRA 4QWWD 2SEBB 2XNAB 3GHEL 4LKXA 2NW2A 4YDIL 5GS0C 3DSNA 4LCUB 3U2SB 1GJIA 5ERWA 4YWGH 1RHFA 2VUOA 4EDXB 1NDGA 3DX7A 5KTEL 3LRSA 5D1QC 4X6FA 1T0PB 3QCUH 1T2QL 3ALWA 5I73C 3BO8A 1SBSH 1JWUA 4P5TB 5DHYA 1T3FA 4P2CG 1JWSA 4XMKH 1NUDA 1LMKA 4X7TB 1ZLVH 3SEPA 2FJGA 1JFQL 3L5XL 3LRGA 4M62H 1NFDF 2LAAA 4NZTH 5CWSB 4KVCL 1PGRB 5IFHH 3FB6A 1BOGB 1DBAH 3AMLA 1A6UH 4ONHB 3OKLB 4Z7UF 4X6CB 1LO5B 1JN6A 4P4RB 3QP3A 4TTGA 5DVMA 1FVCA 5HY9B 1OQXA 5D71L 3V95A 1NAKL 1CXFA 1NMCC 4DGYH 2H3NB 5CZKA 1RVFL 4M8QA 5EU5A 5MEOB 2VXQH 3QPXL 1VGKA 4XHQA 1BFVH 4M7LL 3BPOB 1NGWA 3B2VL 4M02A 3O4OB 3ZTNL 3UMTA 3ZE2E 4CGTA 2XPGB 1KJ3H 3HE7D 1J87A 4N0UA 4S2SB 2H6PA 4HAGA 4MD4A 1WLHA 2ED8A 3AS0A 5TE4L 4DGVL 1HH6A 4UIMB 3BVNA 4MS8C 4ZG1A 3MYJA 2W9DL 4MNGA 3QDJE 5EZJA 4HIIB 2BMKA 1FQ9C 4PYHA 3G5ZB 4JPKH 5IHUH 2Y06L 1BGXL 1JGVH 4OCXL 4Z7VF 5EN2B 4PY8I 3QO1A 1NLDH 3SJVD 1DL7H 1FYTD 4EN3B 3W9DB 2YD8A 2NCMA 2IANE 4WY7H 1KCRH 2AV1B 4RBPK 3WIIH 1BVKB 2YPLE 4EXPX 1ZT1A 2MTPA 4GW1B 2VZVA 4PGBA 3VFTB 4Q6IC 4DZ8A 5ACZB 4C4KT 3GO1H 3BQUA 3G5YA 1IGYB 5AAMA 4UTBH 4F7CA 1DVFD 1U8JB 1K8DB 2R0ZL 5K93A 3U7AA 4ZQKA 3QZWB 4M3KB 3SKJL 5KVFH 4NKOA 5T1KB 1RUQH 3WN5C 4RMQA 1UKTA 5E03A 3DETC 3CAFA 4ODHH 4GMSH 5IB4A 5EU7E 5CZXD 4X80H 5CD3B 3ARDA 1JHLH 4L4VA 1NSNH 4OT1L 4XC3H 3QG6B 4X4ZA 1G7JA 3AXLB 3CFDB 1T83C 3LQMA 3CDGB 3VXTB 1HZHL 4X0KB 3T65B 3MGTA 5B8CC 4JDZA 4MVBC 4HBCH 3KLAA 5IBTH 4H0IA 3STZA 2ZCLH 1KEML 3NIFF 3RTQC 4AIZB 5DDHA 4FZEL 1IC4L 3OKNA 4XWGL 3W82A 1MHCB 2FBOJ 3B2UC 3L9RA 3SY0B 5C0AE 1BJ8A 1GOHA 1VPOH 5SWSE 3UYOD 1KT2B 4FG6D 1R3KA 4NQVA 1IGCL 1DQDH 5BQ7A 2ZG3A 5HI4C 5HGDA 1T6VN 4XVSH 2J6EH 2CMRL 3ARPA 3M17B 3UTTA 2C3VB 3MGOA 4Z6AT 2W0FB 3EYFA 5IVXE 1LO0H 1BZQK 5DD6B 4HLZG 5C7XH 2D0FA 4MZ3A 5HVHB 5JTWA 4C56A 4AEFA 1PBYA 1Q9LB 2YRLA 1KENH 1W0VA 4L9LB 2WZPD 4HJJL 3RP1A 4RNRA 1S7SB 2W0PA 5E8OA 1N26A 2FWOA 2ZZUT 2O26U 4PJXB 3OJMB 4I0PB 3AFLA 3BIKA 5A16B 2B2XL 3L7EB 3EYQD 5JLZB 4JKKA 2X4PB 2GTZB 5E2TH 2DLHA 3GB7A 3V6ZB 3VGBA 4GLRH 4OLUH 3GSNH 2QQQA 3ULUH 5L6YL 3AM8A 4ZUVB 2VXUH 2WP3T 4RAVA 1N0XH 4OLZL 2F8OA 4YHNA 1HHGB 3U0TB 4HQQL 3B9KA 5INDB 1TXKA 32C2B 2VZSA 5D1ZC 1DQML 2CO7B 3R8QA 1A6WH 1I3RA 1LO4L 4GSDL 5K33A 3SN6N 4ELMF 4U33A 1IGTA 2V2XB 4NNPL 4P46D 3JUYA 1KUMA 1SBBA 3OJ2C 1QVOA 4ZPTB 3PWUA 1IM3A 3RIFF 5MI0C 4U0RC 3H42L 4NRXA 4N8PA 4WO4D 2EC9U 3QUMB 4CL7A 4OF0A 3T1FA 3NCYP 3LCYA 4GS7C 4PJAF 4C58B 1IEBA 5C07D 1P5UA 4X9HA 3QQNA 1ZGLM 4HUNB 5FKAA 2P8PA 1R3LB 4AG4H 1MAMH 4OGAC 1T4KB 5BW7C 4IIQC 4LSRH 5C0IB 3I9GL 3QUYA 1SYSB 2FYYA 3HC0A 4QCIA 4Y1AA 3WJJA 4MQXC 3LB6C 4FABL 5DA4A 3L5WA 1LP9A 3T09A 3QI9D 4KUCD 1DP0A 3WDIA 1MAJA 3TYFB 5T5FH 3ZL4H 3KJ6H 5DR5H 4F9LA 4Q7DA 4UB0L 1G6RB 1FZJB 5E24E 3C60C 3BZDA 4ERSH 3Q5TA 1FN4A 3BSZH 4R4FH 3VFMA 3UCRA 5C1MB 4JO2H 5ALBL 4KVNH 1TJHL 4ZSOA 3T1WA 3MRMA 3BHBB 3VD9A 3QIBC 5DO2C 3MLZL 4BFIA 1DN0B 1V7NL 3WLBA 3LIZL 2VWEC 5FECA 2DL2A 1YNTA 3HE7B 5GGVL 1N0LA 3LDBB 3SE8H 5JOFB 5HDOA 3W0WE 1N5AB 5IMKA 9CGTA 1F58L 1U95B 4HAFA 4XX1G 5F7DA 4HKJA 1NC4D 1J10A 3VFUB 4HK0A 2H8PB 2YD2A 5IESL 3EYOB 2P7TA 1C7SA 4M00A 4K3EL 3WL9B 1ONQA 3C5ZC 3U46B 3SJVB 4GG6F 1FYTB 1A6ZB 4MSWA 3MCKB 4JDTH 3HNSL 1CCZA 1QO3B 3H7BB 4LEOA 5ID0B 2D7PA 1WIPA 4Z7OE 3HB3D 1CTNA 3C6LA 3BH8A 2OJEB 4XB8A 4PJFA 5HD8D 3ARBA 3NFPB 3MRGB 4J12A 1RIHL 4NT6A 4C83B 3FB5A 3TZVD 4AQ1B 1DVFB 3KYMA 5C2BL 4WTWA 3B5HA 1F4YH 1X5GA 4M7ZB 3VFSA 1XGRA 5DJXA 4UINH 1EBPA 4K3JL 2W07A 2B1AL 2A2QT 5TF1L 4F2MB 2P24A 1J0JA 5JQ6H 3B9DA 2NNAB 4HUVA 1UM6H 3IDXH 3F5WA 2OJZH 2DJ4A 4CDHA 3B3IB 4HBQA 3HR5A 4J23A 2Q7YB 1YDPB 4CMMA 1U3HB 1UWGH 5GXBB 1OAUL 4KZDH 1A1NB 1X6NA 1F8TL 1SEQL 1NC2D 4NQUA 5GRZA 1SJHB 5LG1A 2NY6C 3KR3H 3P0GB 3PHOB 5K59F 2OMBA 1EV2E 4NCDA 2IH1A 3MRKB 3WUWB 3QNXA 4WI9A 4XXCA 3FO9B 5J56B 5DJZB 4MJ5A 1KJ2L 3TJEL 4KKAD 3DO7B 1YMHB 5GJSH 5JDSB 43CAA 4J3UA 4LSVL 5FKPA 3PUCA 3NGBB 2PW2B 3DUSB 1CE1H 4JVPA 3EYSH 4XP6H 4NN5C 1AFVL 4UOJA 3SOBL 3ZTJH 5M94B 1DEEB 2ZUYA 1PLGL 4Y2OA 4D3CL 2HVKA 7FABL 3KPQB 5IB3B 3KNBA 4OZIB 1IQDA 4YDKH 1MF2L 3PG2A 3Q6FB 2Y4SA 1F3RB 4XP1H 4U49A 3TESA 1QOKA 1QZ1A 2BOCB 3EDEA 1NLBL 4ZOEA 3SKOB 3RWEB 5ICXB 3RL2B 3MACL 3TLRA 4P3WA 1AD0B 4GW4A 3WIFB 2BOBA 2X89A 1NMAH 5CP3A 2GSIB 2RR3A 1ZAGA 1HQ4A 1JTTA 1Y6MR 4OGXH 4R4BA 5FF6A 1HN1A 4HV8B 2HFFA 3PJSB 1XGPA 2P8LA 4M7LT 4YBLB 3BPCA 4QRPA 4HUMB 5E8NB 4N8CH 1MCFA 4UDTA 3RWHB 3TWCH 5FOBB 4HXBH 3TBWB 1WK0A 1MHEA 5TE6L 3ZYZA 4FQ1L 4PJXE 1BHGA 3VFOA 2OM5A 5I8OH 2F19L 4HSQA 1I9JL 3U9UA 3E6FA 2XQYG 5I15L 3BZ4A 5JORA 1YEGH 1TTUA 3PIQA 3Q3GB 5DJ8B 4X9GA 2W9LA 3V0VB 4EXKA 4PRNA 2QQNL 3GSRA 4M61A 1CR9H 3LKQA 4TNVF 1NCWH 1RK1A 4P46B 5I6XB 1SYVB 2DYPA 3WEXA 5BMFH 1I7UB 4G3YH 3P77B 2Y5TA 4RFOL 1H3WM 4YBQD 5IM7B 3SQOH 2O61B 3MUGA 3UZVB 3H9SA 1CS6A 4R90L 4U2YA 5HHOE 2R4SL 3B9VA 2DQDH 5T3ZE 4UTAH 1IGIH 1UXWA 1J18A 2GKIA 4DVBB 4WO4B 1N4XL 2WWMD 1QRNA 1ZLWK 2YKLH 3QSKB 1HH9B 4HKZB 3MJ9L 2VZUA 5C07B 4I9WD 4JFDA 3L3HB 4XC1L 3D5OF 2B0SL 35C8H 3G6JA 3QIUC 1KJVB 3C2AL 4GXVL 3KS0J 1AE6L 1JI2A 1OD7A 2D4FA 3MFFA 1Q72L 1MUJB 3BQUD 4MAYA 2IF7A 3EOTL 1EO5A 2Q76B 5C08A 3QI9B 4EI6A 4FQ2L 1OTTC 5KOMC 3BXNA 5TDOA 3S35L 3BPLB 3TPUA 2CIKA 1CDGA 2APXA 1QSEA 5D6DA 2XXCB 2I9TA 3VA2C 3MRLB 4K7FA 3SBWC 3IFNH 1B0WA 4OJFH 3M1BA 4PJCF 3HMWL 1KIPA 5EWIL 1UACL 4KH2A 2AXGB 2I26N 4RAUB 3ARDD 5D9SB 3K1KC 4YHPA 1GGCH 3CH1B 4HWBA 3BRDA 1MRCH 1CXLA 2VZ3A 4WW2B 3EDJA 1SJEB 2BVOA 3QWOA 4IOSD 1MJ7L 1NC4B 2ICES 3MMEB 2WQ8A 2ZOLA 1QSZA 3UJTL 3LQAH 2VQ1A 5KSBE 5C0EB 3FQTB 2VDOL 3BE1H 4AM0B 4YDVB 1EEZB 2R15A 1BM3H 4NZDA 3CLEH 3PE9A 4RGMB 4OKDA 3GKWL 1T83A 1IE5A 4NHUA 4OF8A 1Q1JL 1YEJH 4TPRH 4U1IB 5F7MC 4ZUUB 4OLXH 3GRWH 5E9DE 3S8WA 5FAAA 3BP7B 3JTTB 2CQVA 1MHHA 2DQJL 4RSVA 1QBLH 3RTQA 1S9KC 3LQZB 5DI8B 1CL7H 1TZHA 3KWWA 3UTTD 1LD9B 1E4JA 1I3VA 1FYTE 1L0QA 1HHHA 1YEFH 4WEUD 1EEYA 3UDWA 3QNZA 4AK1A 3KDMA 3TZVB 2YEZB 4G7YH 4C56D 1IAOA 3SGDH 3IDYB 3W9EA 4AEIH 5JR1L 3GMMB 2P1YA 3ROOA 2AJ3B 4KKBC 5EBMA 5IFAL 4NZUH 4K8RH 1JGDA 3OJDA 5J6GB 5C0DB 4TTDD 4NNXB 1OW0C 2IGFH 4M48H 2IG2L 1GIGL 5D72L 4OUUA 2GYSA 3OF6A 1U8KB 5J57B 3PV6B 1HINL 5EZLA 1PKQA 3I50H 3NACL 4O2EB 1WBYA 1NC2B 1EJ6A 4JKMA 5EZOL 4CNIA 4LLMB 1B0GB 3TT1L 1X4YA 3CCHA 5HYSG 2RFXB 3U4EB 3S7GA 4Q9QL 3EDDA 1JPTH 1N6UA 1BEYH 3PXHA 1PDKA 1I8KA 3AREC 1T1ZA 3VCLA 5F3HA 3QDMD 3R0MA 1DJSA 5C6WH 1CIUA 4J4PD 1EO8H 4GOSA 2HTLD 2HFEB 5E2UH 1XH3B 1WVZA 4UUJA 3U48A 2APBA 2QQLH 1XCQB 3ZSSA 2W92A 4X6EA 1WWCA 3FONA 2VWEE 4LKXB 1PY4A 4M1DL 5D1ZA 1FORH 4XMPL 5ERWB 1HEZB 4R7DA 3QXAA 2A6IA 5J3HC 1QHPA 2VDKH 4X6FB 2JCCB 1JE6A 4LPYA 3LKSA 1QFWI 4JFHD 1JWUB 1RJCA 4NHCL 1VADA 2OR9H 1UZ6E 4TVPL 5DHYB 3LHPL 2IPTL 4NQCB 2FJGB 3QUYD 4K3HA 4XAWL 5KZCD 1ZHKA 2VDLL 3TIEA 3U4BL 4XBPA 1H3GA 5JO5B 3FB6B 4I4WB 3RNQA 4OFVA 2HKHH 2AJYL 3R1GL 4LVOB 4UV7L 3TNMA 1OTUC 4IEFB 2E7MA 5BW7A 1INQA 4OIAA 4KHTH 1CFTA 3MROB 1QR1B 3P9MA 2AXHA 5IOPA 1FNHA 1JNLL 5JMOC 4EJ1C 5AG9A 4U1HA 3PABB 5JPNB 4U3XA 3LZFH 1NAMB 1NGWB 4KKNA 4AL8H 3K3QA 2BVUA 5E7FA 3ILPA 1ORSA 4JZNA 3C60A 2VMFA 2OX5A 4Y4KC 1T5XB 3GHEH 4N0UB 4BH8B 2YMXL 4YDIH 1SVZA 2H6PB 2VLKE 1RPQA 5F6IC 2I24N 4MD4B 3B5TA 4E41E 4ZD3L 5KTEH 3BVNB 5J12C 2PO6A 4OBSA 4KDTC 3QIBA 4MNGB 4RIRB 4L3EB 2X5PA 5EZJB 2BMKB 5EOCL 1T2QH 2NY1D 3PWPE 3U9PL 2VB5A 1GGIL 3TP4A 2D7NA 1R5VB 3QO1B 2NY7L 5IJVB 2NXZB 4QXGL 1JFQH 3L5XH 4NFCA 4Q97A 4X6CF 4KVCH 2EKSA 3RVWD 3C6LD 2LAGB 2OL3L 2I5YL 3C5ZA 4PRIA 4DZ8B 3BQUB 3DMMC 2IFFL 3FTGA 3ARBD 5D71H 1NAKH 3NTCL 1OSZA 4KRMB 4F7CB 1KCVL 1UM4L 2AGJL 3IRZA 3LPGA 2VIRA 3UP1A 1RVFH 3QIWA 2DMKA 3R06A 5D2LA 3ZO0A 5D1XA 2EDTA 3QPXH 4Y16A 4ZQKB 5BV7B 5DRZA 4M7LH 3VRIA 4P2QA 1P7QA 4NKOB 2IC2A 3PWLA 3F58L 3B2VH 3RPIB 3ZTNH 4NO2A 2BNUB 5IB4B 3NCFB 2LE9A 4J3XA 3RVTD 1T1XA 3R8BB 1LVEA 5C3LD 2W65B 1TZIA 5DURD 5TE4H 1N6VA 1FCGA 2W9DH 4RMUA 3VXRA 2EXYC 3T0VA 2PXYC 3ETBF 1WIOA 1T7XA 3OQ3B 2FNBA 2E27L 3CZJA 2Y06H 1BGXH 4OCXH 2AAVA 4JDZB 3STZB 1IRAY 3ESVF 4KK5D 3K1DA 5CD5C 1C08A 5FHAL 4G5ZL 2ED7A 3GIZL 3NCCB 3K8KA 4H26A 1Q0XL 3OKNB 4HUXA 1CE6A 3FMGL 3HI5L 3L9RB 5I0DA 5KSVA 1MHPL 1WFTA 3MV11 1R3KB 4KTEL 3GMPA 4NQVB 2PUQT 5BQ7B 4J3VA 5ENWB 4G6AD 5HGDB 1QFOA 2LU7A 1X9QA 1X3DA 1G7IA 1ROWA 2EH7L 3HN3A 3UTTB 1S7XA 1CICC 3BD4A 4KJYA 2R0ZH 3MGOB 4N1CA 5D7KE 3EYFB 3VGAC 4JY4A 4NGHL 2EDQA 4O5LL 2R2CA 1A4JB 3SKJH 4C56B 4YHLL 3D0LA 4PGEA 3FO0L 5KVGH 1H15A 5IEKA 2GIYA 1EHXA 2HJFB 4JY6A 5E8OB 15C8L 1TCRA 2X89D 5F71A 4S11A 3DV6B 4GFTB 1WCQA 4OT1H 5DJ0A 4PFEA 1ZVYA 5FXCH 3CSBA 1MI5A 5C9JA 3WNLA 4QRPD 1CD8A 4BELD 1HZHH 3UJJL 3GB7B 3I3BA 5TPWL 1S9XA 4XTRD 2YD9A 1UB6A 5DD0L 2VLMD 1NGPL 1KEMH 3GBNL 1F02I 4RAVB 1JPST 2R1XA 4FZEH 1IC4H 5TJWK 2Z9TA 4XWGH 4YHNB 1J86A 3K7UA 1NJ9A 2BSSA 3QDMB 1QSFA 3FT4A 1IT9L 3DHJA 3ZKMC 3QA3B 1IGCH 1Q94A 4FRWA 4N9GA 1NCUA 3L5HA 2CMRH 2HRPL 1I1FB 1IGTB 3S3SA 5IR1B 1WZMA 2DYPD 5E1AB 2AQ1A 1X5XA 4R2GD 1K5NB 2YR3A 4FFZL 2A83A 2EDLA 5KJRL 4HIXL 2JJTC 5DHVH 1F5WA 3HHRB 3H9SD 3PWUB 1M7IA 4G43A 4HJJH 4KGLA 4NRXB 5I8KL 2JLLA 4LFHG 2E9IA 1KXVC 1PEZA 1QRND 3T1FB 4X4YA 1X5IA 4WU5A 2E3VA 1IEBB 4UNVA 5MEND 4MS8D 5FKAB 2P8PB 1P4BL 1A22B 2CDFA 2B2XH 3QUYB 3I3EA 3VXSA 5KZCB 3N1GC 2UYLB 2VSDA 1F45A 2FYYB 4QCIB 2JCCE 3S36L 3L5WB 4MAYD 1LP9B 1P6AB 5C08D 5L6YH 3BISA 4OLZH 1FJ1A 5D7IE 4NQCE 1QSED 1P84J 2L0DA 4HQQH 1FN4B 2MWCA 1U3YA 1IILE 3GJFB 2ZCKL 4HH9A 2GW5A 4P3CL 3VFMB 4KZEL 4JQVC 4ZSOB 1LO4H 4GSDH 5IBLD 4NNPH 1FFPA 2BY0A 4JM2D 4BFIB 2WWKO 3WLBB 5FECB 1A1OA 1FBIL 4L4JA 2FHFA 4JPVL 5IMKB 3RVUD 3OJVC 2NTFB 5F7DB 2JB6A 4HKJB 1MFEL 4XNUL 4AQOA 5GS2H 4HC1A 3I85A 4GBXA 3ULSA 5M7QA 4HK0B 3WDJA 3H42H 3VDCA 1P7HL 5I1CL 2P7TB 1PFCA 2AJSL 5HHQA 5D8JL 1ONQB 1JZ5A 4UAOC 2E7HA 3I9GH 4FZ8L 4GH7B 3UTSA 1FYHB 2OI9B 3SKNB 2HMID 2V7HA 4LEOB 4MD0A 4PTTB 4FABH 4L3EE 1YEKL 4HWUA 3C6LB 3J7HA 3BH8B 3CXHJ 3ARBB 1DBKL 1A3LL 4NT6B 4UB0H 1ORQA 1RZIA 5FO7A 4QGYA 2Z0BA 3ZKND 3UAJC 3KYMB 1QFWH 1ZLWH 3ZT7A 5HI4D 2X1OA 3MUZ1 4S1SL 5ALBH 1TJHH 3VFSB 1XGRB 5DJXB 4PJDA 4MXQC 5CLWA 1R5IA 2P24B 3MLZH 1F3DH 4QXWA 1V7NH 1A7QL 3LIZH 4HUVB 3MJGX 4P2OC 5GGVH 4L8BA 4AJ0A 3OF6D 4YZFE 3HR5B 3KJ4B 1F58H 4CMMB 5DURB 3SDYL 5K9KA 1KB5L 5F9JA 1I75A 4Y8DC 5IESH 2V9RA 1T20B 3UPAA 4K3EH 4PLKD 2XKSA 4JFOB 4QRSA 3OKMA 3VXNA 3QNXB 3OB0K 3QO0A 4MJ5B 4LCCA 3MLSL 3HNSH 5J8OA 4KJPD 1ZE3C 4G9FD 2VL5A 1BIHA 5FKPB 5CBAA 4B5EA 4HWNA 3C8HA 1EA9C 5E6YA 3HAEG 1KN4L 2R69L 3AREA 1RIHH 1YECL 1FV1B 4LLYA 5D70L 1RY7B 3MRCA 2HVKB 4QTIH 3GNML 5EIVA 2WLYA 5C2BH 3S4SG 5JMRA 1Y0LA 4HWZA 1IQDB 5D1ZD 4X5LA 1YA5A 3QFJA 4XP5L 3CFJA 3DRTB 5KVMC 4K3JH 2B1AH 5TF1H 4J8RA 2XN9A 1T22A 5I9QC 1JI1A 3U7YL 5E6IA 4GW4B 4F7PB 2VAJA 4OQTA 5C09A 2NLJA 1HQ4B 2P5ED 5HI3C 2D7QA 1U8OA 5FF6B 5JW3L 1OAUH 4C56E 2HFFB 1WWWX 3V2AR 1F8TH 1SEQH 1XGPB 3N1MC 2P8LB 4LDLB 5EULV 4L9DA 4IRJC 4QRPB 3RWGA 2FLBT 4OGAD 1B6DA 5GGTA 1FNGA 4AEHL 1MHEB 4AENB 2R1WB 1KJ2H 3RY6A 3TJEH 3T0EA 3LB6D 3U9UB 4BZ2L 2FJHA 2LVEA 4M03A 5BVJB 1S7QA 3JVGC 4K2UL 4LSVH 4N1HB 4OZIF 1JUFA 3BKYL 1AFVH 3S34L 4PJIA 3GSRB 4M61B 3SOBH 3LKQB 3C60D 1PLGH 1KPUA 1IAKA 1IEHA 1CFQB 3QDGA 1RK1B 4D3CH 2GEEA 2DYPB 3KPMA 1T2XA 3WEXB 4PGCB 4HDIA 1MF2H 1BFTA 5AD0B 5T5NF 3HNVL 4R2GB 1CF8L 3QDME 2PO6D 1EGJL 3MUGB 4WHYH 1S78D 5KSUB 3H9SB 1NLBH 3O8XC 2AV7B 1U42A 5IB5A 3MACH 3LKRA 1QRNB 3IFLL 3WIHA 5MENB 2QEJA 2W91A 3IF1A 2QLVB 3I2CL 1SM3L 3G6JB 4ODWB 3ARFC 1IC5L 4POZC 3MFFB 3C5ZD 4PRID 4MAYB 5D4QA 5TE6H 5C2UB 5C08B 4FQ1H 4Z7WE 1UZ8B 4EI6B 2CKBA 2EDJA 3MC0A 2F19H 3BXNB 1I9JH 2W60B 3QIWD 1MCIA 5TH2A 5I15H 3B9AA 5D1XD 3TPUB 4Y16D 2CIKB 5IV2A 1QSEB 4HPYL 4P2QD 1P7QD 4WI2A 3HTLX 3DMMA 1NFDA 5TFSL 2I9TB 4OLYL 3V4PL 1FLTX 1RAMA 1J1PH 3CX5J 4ISVB 4K7FB 2X9WA 4H5SB 2QQNH 2C4XA 2YHGA 2VXTL 3M1BB 4Z7UA 3S5LG 1QNZL 2FJFA 1KIPB 3H2WA 4D8PA 1XF2A 4AY0A 1NH6A 4JM2B 3PQYE 4YHPB 4R26L 1QLRA 4RFOH 3ULUE 2W59A 5FB8A 2XICA 3SDCC 4PJGE 3VXRD 3VI3F 4Z8FL 2ADIA 4R90H 2R4SH 4H25A 1O7VA 1BQHG 5F21B 5F88A 4BQCA 2I27N 1N4XH 3MRNA 2D7MA 1Z0MA 3NPSB 4XPTL 3MJ9H 4KMLB 1C8PA 3RWFA 4XC1H 2UWEE 4GAFB 5L7XL 2PXYA 1VKXA 2B0SH 2NY6D 3C2AH 2D31A 4GXVH 5CEZD 1AE6H 1S7UA 4KUCF 1P1ZA 1EFXD 2G5RA 1Q72H 4LVEA 4NZRL 3Q1SH 4NRYA 2GK2A 3EOTH 3VFNA 4WHTA 1VSCA 5ESQA 2ORBL 4FQ2H 3KWWB 1C16A 1CQYA 4K8RC 2FR4A 4RAHA 4MD5A 1EEYB 4NM8L 1VACA 3QNZB 3S35H 3KDMB 5HGAA 3V8OA 3CGTA 4FTVA 1IAOB 3W9EB 3ROOB 5MEPB 2NY4C 3S5LA 4RWYL 3MUJA 4MNHA 1CICA 2FEDD 3K74B 4LNVA 3HMWH 1JGDB 5EWIH 3OJDB 1UACH 3DXAA 3PDDA 4LSPL 2WK2A 2NX5A 2EC8A 4OUUB 5IB1A 1MI5D 3BGMA 1QEWA 2M26A 1U58A 1BQHA 1MJ7H 2NTSP 5EZLB 5EIQA 1PKQB 4HULB 1QD0A 1T7YA 3UJTH 4OFYA 3I6KA 3TN0B 4CNIB 1ZLUK 3BH9B 2VDOH 4ZNEA 2H2SC 1KFAL 2D0HA 1KPRA 1HDMA 4XX1E 5DXWA 4JFQA 4DAGL 1I8KB 1Q1JH 1T1ZB 2ICWI 5D7SL 3VCLB 5F3HB 4PJ5A 1MNUL 1VGEL 1HWHB 4LIQL 2HT2D 4G9FB 3ZDZF 2DQJH 4UUJB 2BCKA 4A2MA 2MJWA 1D3CA 3IU3A 3O6LL 4X6EB 5EU3B 4KJQD 3GMQB 2BVPA 3FONB 4WEMB 5CBEB 2BNRB 5D1ZB 4D9RE 3QAZB 2X40A 1MELA 4R7DB 2XA8L 4RCAA 3QXAB 3V5KA 5JR1H 2A6IB 5IFAH 4LNRA 3OHXB 3CVHA 5DVLA 3LKSB 4KKLC 2RJMA 4G42A 4JE4B 3TYGL 1G0DA 1VADB 3QUML 3QXUA 2IG2H 1GIGH 4KRLB 5D72H 2Z91A 3T8XB 1DQLL 1I1AC 3G08B 2P5EB 3RUGF 3VXSD 1HINH 3P9WB 4I18A 3PWVA 4RDQF 2WUCL 2DTSA 1FO0A 3NACH 4HPOL 1T04A 4JO4L 3VWKA 1MQKL 5EZOH 3RNQB 2FIRT 4NC1C 3TT1H 1F3JB 2ID5A 4KFZC 5D7JA 2EE9A 3TNMB 5H8DA 4JN1L 4Q9QH 3BJ91 4Z77A 1INQB 3GMLA 2EDXA 4ODSL 2LTQC 4PY8J 3T0AA 3P9MB 4F57L 4NC0B 1T0NA 3FO1A 2FB4L 4ORGB 4HMEA 1G6RL 4U1HB 5J11C 3O3EA 4QRPE 2NY5L 4FMKA 4U1GC 4LARL 3ILPB 5FUZL 1D7FA 1UH3A 4JO1L 2QJDA 3C60B 1K3ZA 5TQ2L 4PJBE 2P8MA 4M1DH 2FRGP 4XMPH 5SX5H 3V7AG 1FAIL 3U36A 2VUYA 4GBXD 4LFHD 2PO6B 3PWNB 3D39D 5EPMA 1IVLA 1UB5A 5ICYB 1B0RA 1EHLL 2KQMA 2R0WL 1F6FB 5F8QC 4M3JA 3BRFA 1U0QA 3N1QC 4NHCH 4TVPH 1R5WA 3LHPH 3QQ4A 4ELMA 5KN5A 2IPTH 3IT8D 3UTSD 4XAWH 2VDLH 3FB7A 3IYLW 3U4BH 5FYJU 2EKSB 4DN3L 2J8UA 5CJXC 5CGMA 1TPXC 2D7TL 1QBBA 2NY2C 2AJYH 3R1GH 2OSLB 4UV7H 4PRIB 4WFEE 3EAKA 3HE6A 5JW5B 3FTGB 3P0VL 2HT3C 1QRNE 4FQXC 3MGAA 2IEPA 3QUZC 1OSZB 2YC1B 5MENE 3JWOH 4LSTL 2VIRB 3H9HA 3QIWB 5DD5L 1A14L 5D2LB 5D1XB 5EA0L 4Y16B 2N56A 4P2QB 1P7QB 3GIVA 3V5HB 4PBWD 1PYWA 4NO2B 3TA3D 5C08E 4PP2A 3BZFA 5EH1A 4K71C 1NUGA 4G9DA 1YUHA 4JREB 4GW5B 4U6HB 2YMXH 2OXGA 3TBSA 1TQBC 1T1XB 2BRRL 3L3KA 3HRZA 2OZ4L 3V0AC 4ZD3H 4LCWA 4KWUA 4NQXA 4R97B 3FAXA 3VXRB 5KBNC 4XPAL 5EOCH 4P2OA 3U9PH 4P5KB 1GGIH 5HHPB 2YS4A 3JBG7 4KMQA 2AW2A 1C7TA 2NY7H 5C0BD 4QXGH 4FA8A 1DUYB 4N0RA 1C08B 3MXVL 4H26B 1W72L 3UXFA 4HUXB 1CE6B 4QXUL 4CDGC 5KSVB 4XNMB 3RIAK 1EFXB 1FIEA 2OL3H 2IPKA 2I5YH 3GMPB 5E8PB 4PS4L 3VGEA 2IAMC 2IFFH 5JXEC 3ARED 2XTLA 3NTCH 1G7IB 3G04B 3WNNA 1TLKA 3RWIA 1S7XB 4KJYB 1KCVH 1UM4H 2AGJH 5CSZA 2JE8A 4JY4B 3QFJD 4EKXA 3U82B 1DANU 1WSST 1EXUA 1A0QL 3F58H 2XKUA 4PGEB 2XN9D 3EJZD 2HVJB 4JY6B 4L3CA 3T0WA 1K9TA 1JYXA 5E6ID 3ARGA 1TCRB 4MQTB 4MHHI 5C09D 3ULVD 3BT2L 3MREB 1WWBX 2GAZB 4F7MB 2ILLA 4FQQB 3K81A 1M7DA 1NCNA 4L1HA 1MI5B 5C9JB 2PW1B 1G1CA 3CSYA 4EQ3A 1WV7T 1B3JA 4P2RA 2E27H 5GGQL 1S9XB 2A0LC 5KSAC 3QUXC 4WWKC 5EO9A 3LD8B 1AO7A 2DQGL 1J05A 5FHAH 4G5ZH 1P5VA 3T0ED 2R1XB 3GIZH 5EIIA 3W5NA 5IFJA 1Q0XH 3FQXA 3FMGH 3HI5H 1NJ9B 3L3IA 1MHPH 1HSBA 4O2FA 1PKQE 3RGVC 4KTEH 4C55A 1Q94B 3JV0A 1KOAA 4N9GB 4AYFA 1XIWC 3QPQD 5LWYL 3QCVL 1T0MA 4U1KA 2EH7H 3QDGD 4KK9C 4D94A 5T1DL 2CK0L 5ADPL 4S1RL 4NGHH 4ZS6C 4O5LH 1CXHA 5BS0A 1IGJA 4CMHB 3Q2CA 4YHLH 3MRPA 3U7WL 3CMOL 1G0XA 2NY3C 1YPZF 3FO0H 4G9FE 4QRQA 5AUMA 1M7IB 4G43B 2ICCA 15C8H 3REWA 4X7EC 4NKDA 4DKEL 1KTLA 4X4YB 2X4QA 4YEFA 2GFBA 2ZOKA 5F72S 2BNRE 3QT2A 4OZGE 2CDFB 3O8XA 5EO1A 1JZ6A 3VXSB 3FRPA 3Q48A 1CI5A 5HPMA 2K1MA 3JV6B 1BBDL 4YDLB 3UJJH 5TPWH 4Q0XL 3W5MA 3E0GA 3OR7B 4PJHA 5DD0H 2PYEE 1NGPH 3GBNH 3I02A 4KJWC 1GOFA 3FOMB 4B7IA 5F9DC 1FJ1B 5ANMA 1CLZL 5L2KE 4HK3N 3HR6A 2P5EE 4MXVF 4PB0L 1JTPA 2FH6A 4JG0L 3WV0A 1IT9H 3DMMD 1E4KC 4HH9B 3TBTB 3O6FC 2CRYA 1QFUL 2HRPH 1KLUA 1A1OB 4UIKL 4Y4FC 1K8IA 3IVKB 2ARJA 4LRIA 4FFZH 5F7NC 4J7RA 5KJRH 4HIXH 4R96A 3VFGL 2JB6B 2JKXA 1JGEA 1XGQB 4HG4K 4GBXB 3KPRE 4U0QB 3ULSB 3D39B 3GI8L 2CLZB 2EIEA 5I8KH 5AWNL 1JRHL 3UX9B 5HHQB 3NN8A 1CG9A 5EFIA 4NJ9L 4APQA 1P4BH 5DUML 1LP9F 5AZEL 3U4AA 3UTSB 2R29L 2V7HB 3NA4A 4KI5F 3H6JA 3DWTA 3EOBA 2RCSL 3ZZ1A 4DQOL 3S36H 3DBXA 4Y5VA 4ZFFA 2NYYD 3ZT6A 5D5ME 3JTSA 3GI9L 4KDVA 1ORQB 5FO7B 4HJGA 3FQWA 1OT2A 5CJOL 4FTVD 1IGML 5AEAA 2ZCKH 3MV9E 1LEKA 4O4YL 4P3CH 5ITFB 4M4RA 4KZEH 1CDCA 2A6JA 1IJ9A 4PJDB 3WE6A 1R5IB 4MAUL 2R56L 2VN4A 1NPUA 3TA3B 3D9AL 1JBJA 1H9VA 2JJVA 1FBIH 4M7JL 4L8BB 3RKDD 4XWOC 2NX5D 5FCUL 1J1XL 4JPVH 3QEQE 3LVEA 4ODUA 3A6BL 3VRLE 1MFEH 1X44A 1YN6A 4XNUH 3DUHA 2HP4A 3ILQD 1H5BA 3NZHL 4P2QE 1GXEA 1T7ZA 3K46A 2YD4A 5I1CH 4Y19B 2IQAA 2ATPA 2DJUA 3I3DA 2AJSH 4Y5YB 5D8JH 5DJCB 4QRSB 3OKMB 3VXNB 2PR4L 3NCYS 5C0BB 3IAGC 1GGYA 4PJ8D 4FZ8H 4LCCB 4KRPC 4PJ5D 3MRDA 4PJFF 4QEGA 1JL8A 1PY9A 1ZT7B 1YEKH 2VL5B 4NSKA 4QOKE 5CBAB 3K8MA 3IKCA 2FZ3A 4HS6B 1WFUA 4GO6B 1DBKH 3QNYB 1HQRB 3AREB 1A3LH 5E00B 1UJ3C 3L3DA 4GRLC 4LLYB 1JNNL 3MRCB 2HG5A 2VQTA 4U1MB 3GMNA 4R4NC 5B38A 3QFJB 2QR0B 3CFJB 1HXMA 2VISA 4S1SH 4F7EA 5CEZE 4F3FA 1W8OA 3CUPA 1RJLA 5EUOA 1WQVT 2XN9B 1T22B 3O3UN 1OGAA 4KK8D 1L0XA 1A7QH 4FQIL 5E6IB 2GUOA 2OR8A 3NIGE 4ETQA 5C09B 4N0CC 3SDYH 2MCPL 1KB5H 3TBYA 3EFDH 2FGZA 3M07A 4LHUG 4MA7L 3VWKD 5CZVL 5D2NA 1IMHC 4XB7A 3RWGB 5J9PA 4HJ0C 3DOSA 1BQSA 5D7JD 4OZHB 3DVIA 4ZUTA 3EO0A 1FNGB 1CXKA 4TSAL 2JTDA 4PRPA 3CMGA 3F7QA 4NQEA 1F4XL 3TFKC 5J13C 3EJYD 3T0EB 3MLSH 3FFCD 2BK8A 2NQCA 2FJHB 1DLFL 2AK4A 3DI3B 4ZAKC 1S7QB 3V6OC 5FUOL 1ZWIB 3HAEB 4C57C 4MJIE 4YO0A 1VB9A 3S97C 4QHLA 2VZ1A 5CILL 5HJ3A 1KN4H 2R69H 4IRSC 1YECH 1KPUB 3S4SB 5D70H 3QDGB 4PREA 2C4FU 3GNMH 4I2XE 5E8DH 4HDIB 4L4TE 3GMRA 1NBVL 3SKUD 4XP5H 4N5UA 5E4EB 3BD3A 1WITA 5A2LH 4X7DC 1YYML 4UBDC 3RBGA 2V6HA 5IB5B 3U7YH 3A6OA 5GZND 2H2PC 3LKRB 4FXLA 4I77L 4LHJB 3ARTA 1RK0A 5CP7A 1ZGLA 3C08L 1MJ8L 2Y72A 5I71B 2VR5A 3P30L 4TULL 4KK6D 5JW3H 5E08L 1R6VA 1CK0L 4LKCA 2R8SL 5BZDA 4PRDB 1LDPL 2Y23A 4UNTA 2BHZA 2GT9A 4MDIA 4K9EL 5BO1L 3SPVA 3HE6D 1A2YB 5DEGA 4B53A 4AEHH 1NCTA 4H20L 4JG1L 4DUXA 1DSFL 2CKBB 3CD4A 3V4UL 5GIRA 2A9NH 4OF7A 4BZ2H 5TH2B 3CNKA 2AEWA 5IV2B 4K2UH 2I9LA 1NFDB 1GGTA 1QLFB 3BKYH 5BV7L 3S34H 4KAQL 5BOZG 4LP5A 4Z7UB 2FJFB 4D8PB 1XF2B 2QKIB 5DS8A 4DWHA 1JNJA 2OMNA 3QJHA 1QLRB 3HNVH 2FIKA 1CF8H 4LCWD 5HGHA 1EGJH 4YHIA 4ELKA 2IPUG 1U8MA 2ADIB 2DQFA 4H25B 4RGNC 5F88B 4WFHD 2F5BL 3G6JF 3D69A 2VLLA 3ZLQC 1ZANL 4JPWL 5SWZB 4PG9A 3IFLH 3RWFB 3GSWA 3QR2A 3MRJB 1SM3H 3I2CH 3X13A 1IC5H 1GZPA 2D31B 3KGRA 1S7UB 2D9QB 4POUB 5DWUL 4HGMA 3D39E 1I85C 3RNKA 2PNDA 3ZT5A 4N0FA 2Y7QA 4QHKI 3DVNA 5ESQB 1X7QA 4EDWL 1C16B 1MPAL 2KQNA 5GGVY 2FR4B 2M2DA 4MD5B 2IMNA 4NQSA 4X6DA 1VACB 2HJLA 3SDDA 5HGAB 2RB8A 3UTSE 5B4MC 4OCSL 4S1DC 4NQDA 2ICEA 2J5LC 4FTVB 2IAMA 5TFSH 4OLYH 1J88A 3V4PH 2ITCA 5C8JB 5IVOA 5JXEA 4DKAA 3S35X 4RISL 3S5LB 1OSPL 1YZZA 4MA1B 4MNHB 2VXTH 4GKOA 2PF6A 3ARGD 3UZEA 1QNZH 4HZLA 1ZS8A 5B39G 5FGBC 1J8HB 1D5BA 4R26H 2AXFA 4PGJA 3RFZC 2NX5B 2UUDK 3SCMC 3QZWG 1BJ1H 4WJ5A 1MY5A 3OAUL 3BGMB 1QEWB 3QHZL 4HK3J 5JW4N 1U58B 1BQHB 4Z8FH 1UWXK 2PETA 2XZQL 4P2RD 5IUSA 4YAQA 3I6KB 3S6CA 3ARSA 1VFUA 1TVHA 4Y0GA 4YK4C 1AO7D 3OKDA 4IJ3B 5JHDA 4DK3A 3IGAB 4XPTH 5KAQG 3SDAA 1NGQL 2FX8L 1KPRB 2APWA 1UM5L 5L7XH 4JFQB 4PLJC 4G7VL 4PJ8B 2NR6D 3BKJL 4PJ5B 2QQKL 2E7BA 5KSAA 3I6GB 3QUXA 1PZ5A 4NNYA 4YHKL 3VXPA 3P9LA 4JGMA 4NZRH 4Y19E 4XXDA 3WFBL 1PG7W 4E0RB 2BCKB 2ORBH 2BSED 4H1LG 3VG9B 1JPFB 4GT7A 2F74A 5C0BE 1FZOA 1CYGA 2BVPB 4NM8H 2ZP0T 3RGVA 1KGCD 5DMGD 2ZKHL 5BS0D 1YJDL 1R24A 5D6CA 3GSOA 4OIBA 3V5KB 2VLRE 3V5DA 2CPCA 2AJVL 4RWYH 5CCKL 4LNRB 5HDBE 5L9DL 3BUYB 4FQCL 4HUWA 1DDHA 3CVHB 4OZFG 4R7NA 1YY9D 2H32A 4G42B 3DTXA 5DVKA 2ERJB 4JN2A 4LSPH 4JFEE 2ITDA 4NDMB 2V9QA 4EI5C 1BD2E 4I18B 2RGSA 3PWVB 1FO0B 3T2QA 4H0GA 2A6KB 4EIZC 3VWKB 1D5ZA 3A67L 3O6ML 3P4NB 3VJ6A 2XN9E 1KG0A 4IMKA 1QPXA 3T77A 3T3PE 4ZYKB 5D7JB 1KFAH 4OF6A 4Z77B 4NP4L 2KKQA 3GMLB 4XGZA 1UQSA 3ULVE 4U1SA 3ZKXB 4DAGH 3MJ7A 5D7SH 3EYUL 2VH5L 1MNUH 3A0OA 3FFCB 1VGEH 4I48A 5DK2A 4PBVC 1T0NB 3FO1B 4LIQH 1YEDA 2YSSA 3O3EB 1ZXQA 3HI1A 3W39A 1HOCA 4ENED 3CVIL 4JR9L 4OZHE 1S3KL 3X14B 5HYJE 3ZE0E 3O6LH 1CDIA 2DQHL 4Q6YA 1A6AB 4IOFC 2P8MB 5DVOA 2XA8H 4Y2DC 2GSGA 3MRHA 4OZFA 3EOYG 1INDL 3FN9A 3DVFA 2QADC 3C09B 1INEH 3QULA 2QL1A 5EPMB 1CVSC 1UB5B 4F37F 2F58L 1VFBA 3PL6B 3NOIA 4XRCB 4GAJL 3TYGH 4Y4FA 3VXMA 4QNPE 5DT1L 3QUMH 1LE9A 3QQ4B 3DUUB 4ELMB 4APQD 3KVQA 2UY6A 3WMSA 1DQLH 3T4YA 2VLJA 4OLEA 3H9ZA 3FB7B 2WUCH 3P4OB 3JWOC 4HPOH 4JO4H 2P5WA 1MQKH 2GCYA 5F1SA 5F97E 3VFRA 3NMEA 1T03L 4P23A 3HE6B 4JN1H 3RDTB 1IAMA 3F12A 4Z7QF 4PJEE 4ODSH 5IHLB 1G7PA 3JV5A 4PJAB 4F57H 3FZUD 3MRRA 2XZCL 3H9HB 2FB4H 1G6RH 2VAAB 3DLQR 5IHZA 4BKLA 4M1CC 3GIVB 1Y6KR 2NY5H 5GGSA 4I0KA 4LARH 5FUZH 2GJ6D 4ESKA 5HTSA 2OTPA 4JO1H 3DYPA 4G9DB 4HF5L 2Q3ZA 5AYUL 5TQ2H 4YHZL 3TBSB 4G80A 1ED3B 1M6OB 1GZQA 3L3KB 1FAIH 1Q9KA 4LCWB 3K2UL 3Q5YA 3VRJB 4NQXB 4Z9KB 3MRIA 1NFDE 1U93B 3T3MF 4XNQA 4DZBA 1EHLH 5FV2A 3RX8A 1YQ2A 1MCJA 4Z7UE 1XF4A 3TVMA 1P4LA 3WO4B 3QEGL 2D03L 2Z31C 3WFCL 3LAFA 3BPNC 4PRHA 3O41A 4TOYL 3VH8G 4DN3H 3HFML 1AR2A 3UZQA 1I7TA 4UQ3A 2D7TH 4ALAL 3DX6B 2IPKB 3V6OE 2EZ0D 4RZCA 3IFOA 3P0VH 3DURB 5D2LF 4OCWL 4XNZC 5SWZE 1ZSDB 4Z0XA 3RWIB 4ZPVA 5CSZB 2L4OA 1MCHA 4GG6B 5D96C 5DD5H 1A14H 4KU1A 5EA0H 2LQRA 2Q1EA 3FKUS 4BSJA 1RZGA 1EXUB 5D7LE 5F7UA 1HHKB 1OGAD 4L3CB 1JNHB 2K7PA 2EDNA 3ARGB 1MH5A 1QLEL 3HMXA 4Z7VE 1LHZA 3MBEC 4RRPG 5F7WC 5GGRA 5C0FA 2BRRH 4LCYA 2OZ4H 5IVZB 1M7DB 5DFWH 1FNFA 4KKLD 2F54B 2F53E 4XPAH 3OKOA 2Y1VA 3CSYB 4P2RB 3AVEA 3OWEA 4LVHB 4DCQB 4PRPD 5EO9B 2DQIL 4NQED 4XPBL 1J8HE 5IFJB 5EIIB 5GRUL 3VD3A 3MXVH 4UILL 1W72H 3FQXB 2BVQA 1CGTA 4QXUH 3L3IB 1HSBB 4O2FB 1BFOB 2J4WL 3K2MC 4NN7B 1QYGL 3PP3H 4PS4H 4PY7A 5AAWA 2X4OA 1T0MB 4BYHA 5ISZE 4C54A 2JK5A 1KYOK 4L29A 1HYSC 4U1KB 5I1DA 3HZKA 5CSGA 4ZAKA 4MA3A 1CT8A 2YD1A 5BS0B 1IGJB 1T21A 5IF0A 4OM0L 3MRPB 1A0QH 2OLDA 5IMMA 3CFKA 3QWQB 4QRQB 2VSCA 5AUMB 3MR9A 3REWB 5IIEA 2X4QB 3BT2H 5IQ7L 5F8RC 3SHSA 2ZOKB 2E7LA 1RIVL 3ARUA 3NIFE 1DTUA 3GJFK 4BZ1L 3NZ8A 4JGJA 5EO0A 4PLNC 1QFHA 1VEMA 3MJ8A 4WHCA 5GGQH 1YN7A 4F9PC 1ZLSH 2DQGH 4BSVA 1HILA 2VABB 1LEGA 4R8WL 4I3GA 4IOIA 4U7MA 5ANMB 4P4KA 2VN7A 4OQ1A 2CUHA 1T66D 5F9WB 1GGBL 1D5IL 3SDXA 1I7RA 2R39A 2C26A 5LWYH 3QCVH 2F9BT 5E0QA 4HIEA 4WFGD 4TRPL 1BIIA 5HI5C 5T1DH 5ESVA 4Z78A 2CK0H 1D5XA 5ADPH 4S1RH 5JOPE 4X8JB 1RUAL 3PHSA 1Q9OA 3FB8A 4YHOL 1G7MA 3FFCE 2ARJB 4ZXBA 4H8WL 3U7WH 2UVFA 3CMOH 2BDNL 4HWBL 1H8OA 5FO9A 4LLWA 1V3MA 5ETUA 1S5IL 4W68A 2C1PB 1BZ9A 3O45A 4DKEH 3NN8B 4Y88A 4BUGA 4XCNA 4QRTA 1Q38A 4LBEA 4HCRL 2HLAA 4APQB 3K4AA 2ADJA 2BNQE 1G9NL 2DJSA 1ZHBA 3OKEA 5EU7C 1DQJA 1BBDH 1SMAA 3KG5A 5E1HB 3U30C 3BN3B 3EOBB 4Q0XH 3WUZA 4QRUA 4JRXA 4Y5VB 4ZFFB 4ELME 3S36X 1JZ4A 4KKCD 1CLZH 2DQCL 3SDDD 3NFSL 4PB0H 4HJGB 3FQWB 1M71A 4JG0H 3SO3B 5C70A 4NQDD 2IAMD 5JXED 4NKMA 1RJZB 2A6JB 2WBJA 3WE6B 2D9CA 4ZFOA 4R0LC 1QFUH 2HT4C 2GJ6B 4YFLF 4LLDA 4JZOA 1FL6A 4Z95L 2VO5A 2YA1A 4PJAE 4UIKH 3OMZA 2YWZA 4X5XB 1FSKC 4PV8A 5DLML 3VFGH 1N2RA 1YN6B 3ZDYF 1H5BB 3GI8H 3LN9A 3L3GA 1IAIL 5AWNH 4J2XA 2ATPB 2B5IB 4M1GL 5JHDD 5DRWB 3CC5A 3SCMA 3SDAD 4NJ9H 4YDJA 2VZTA 1RHHA 3V7AE 2DIAA 3O4LA 5DUMH 5AZEH 5MHSE 2JJWA 1CD1A 2R29H 5KSAD 3RL1B 2VRAA 2RCSH 2X4SA 1B88A 4DQOH 4NSKB 4YHYC 3C8KB 5F3BA 4I1NB 4WFHE 4V1DA 4N1EA 4M6ML 3GI9H 3L3DB 3AB0C 3WO3B 3RGVD 3BKCL 4PJDF 2Z93B 3S96A 1L7IL 3MCG1 3GMNB 4TVPE 5EOCJ 1IGMH 5B38B 5F70A 4N8VG 4NWTL 4KQ4L 1HXMB 2VISB 4O4YH 4F7EB 3O81A 4PJ9C 1OF2A 4X9FA 3CUPB 4TN9A 4HIJA 3DYMA 4MAUH 4XCFL 2R56H 3MNWB 1OGAB 3RWDA 1YMME 3D9AH 4HT1L 2BX5A 2GUOB 4M7JH 5FCUH 2C3GA 1J1XH 2YOCA 4D9QE 1FE8L 3LEXA 1I8MB 4GG6E 4JEGB 3A6BH 4YEEA 3OG4B 1M1SA 1ZK9A 3O9WA 5F7FA 3NZHH 3TBYB 4ODTL 3TJHD 2WIIA 5D2NB 4HGWA 5L8LB 4FQHA 3T08A 3EO0B 2PR4H 4PRPB 4QY8A 4XH2A 4WTZG 3GBLA 1T89A 2JJSA 4LGPB 3LV3A 3X3GL 2F54E 2FEEL 4JHAL 4NOFA 2UUDH 5FGCB 2Z35A 4JQIL 4KJWD 3QQ3B 5F93C 4QHLB 4BQ6A 5I18L 1UWXH 2ATKA 1LK2B 4RDQG 5DMKA 1XF5A 3KPOA 4YIQA 1B4RA 1JNNH 4PREB 1J0KA 3UPCA 4N8VA 2UV3A 3GMRB 3DGGB 2GK0A 4P5TC 4LOUC 1OVZA 8FABA 3VXUA 1WZ1L 3L3OA 4KROD 3VXMD 4FOMA 1N5YL 4FQIH 2XQYK 5K59E 3UTPE 3FL7A 4Y2DA 5CP7B 1ZGLB 2VLJD 4G8GB 2W1NA 1FG9C 1MVUA 1KGCE 2MCPH 5GGUA 5BS0E 1KELL 4Y4HA 3QEUA 5BZDB 4MA7H 5CZVH 3W11C 4JFFA 2I07B 2GT9B 3DSFL 4WTZA 4P23D 1AC0A 5DEGB 1DQQB 2DAVA 4TSAH 2Z4QA 3TCXA 4CKVX 1F4XH 3BPOC 4LPCA 3HG1E 2AJZB 3PWJA 5EDXA 1FFNA 3O4OC 3HRPA 1GVIA 3TCLB 4PJIF 1DLFH 3JWDL 2CDEA 2UZYB 5FUOH 2HAZA 2I9LB 4NBXB 5TGBA 2HLFD 4A2LA 5CILH 4JKWA 5CEYB 1C5BL 1NAMH 4HS3A 3G6AA 4WV1A 4WEBL 1LNUB 1X5AA 3CH8A 5DC9B 1DUZB 3TEUA 1IARB 2VE6A 5ANME 1NBVH 4M5YL 3QJHB 3EHBC 2FIKB 2X4TA 4ONFL 3IDJA 3VW3L 4Y5XA 5HGHB 4JHZA 4YHIB 4ELKB 1HYRC 4EN3C 1YYMH 4IDLA 4U1JA 1U8MB 1Y6NR 2DQFB 1XGUA 4XP4L 4D0DA 2N7BA 5DUPL 3TVMD 4OF5A 4N5EC 1JWMA 2ESVE 4I77H 4TSBL 2Y6SD 4MNQA 3C08H 4PG9B 1MJ8H 4PRHD 3F7YA 4HLJA 3P30H 4TULH 2ZUWA 5H37H 5E08H 3BZEA 1CK0H 2R8SH 3X13B 3P73A 3TBVA 4PTUA 1S9VB 2CXKA 3WXWL 3RNKB 4K9EH 5BO1H 4N0FB 2EDFA 1UJTA 5CEZL 1NBQA 3DGCR 3KPPB 1S7RB 1QSVA 4H20H 5KS9A 4JG1H 5H37G 1X7QB 2LV4A 4JFZL 4XHJC 1DSFH 3S37L 3MOAL 1M05A 3V4UH 2R9HC 5FYJD 3RWJA 4NQSB 4JQXA 3SDDB 2HJLB 3JUZA 4M93B 3N9GL 5TDPA 1JZ3A 2DMBA 4M7KL 2ICWJ 4NQDB 4HX1A 3CK0L 2ITCB 1CVRA 5BV7H 1HK6A 1JZ7A 1I7ZB 5KVEL 4KAQH 1U8LA 5J1AA 1NCCL 3REVA 1VEOA 1ZS8B 3R0NA 1GC1L 1D5BB 3F7VA 4MX7A 2AXFB 1OP3K 2WLZA 3F6LA 3FQRA 4WJ5B 3MRBA 3WLWD 3WS6C 2G75A 2QSQA 2EEDA 3QWRD 4OAWA 1Z9SA 5HBBA 4QRRA 2EECA 2IFGA 1UH4A 4YAQB 4S10A 3QHTC 2F5BH 2DI8A 4OI9A 2FL5A 3F65A 2GJ6E 2J7LA 3OKDB 1ZANH 1YY8A 4CU6A 4JPWH 2XV6B 3V6BR 3IAQA 3SDAB 4WI3A 4KI1A 5T3XD 1U92B 3DHMA 5GS3A 4W6YB 4JRYE 5DWUH 1PZ5B 4NNYB 2MQ0A 3P9LB 3PDOA 3VWJD 5CAYB 4NRZA 3TFKD 5LXGL 5HVHC 4PIRF 4EDWH 4PJCE 4F37K 1MPAH 5FYLD 2EDBA 4L9LC 4YH6A 2F74B 1BVZA 5GZOC 2Y07H 1LO2L 4P48A 4OCSH 4XI5C 1R24B 5DJAB 4G6FD 3RZCA 1J0ZA 3V5DB 4CAGA 1BZ7A 1T80A 4RISH 3RVXC 1OSPH 4I0PC 5B39B 4QTHB 3E1F1 4R7NB 4RFNB 3RI5F 2H32B 3PP4L 5GS1A 3DTXB 4DOHB 2ITDB 4JB9L 4HEME 4O51B 3VFVA 3OAUH 3QHZH 4X8XA 2GITA 1FFQA 5FUCE 2F15A 2G5BA 2XZQH 2B4CL 1FC1A 1D5ZB 1I8LC 5HDQL 3VJ6B 1KG0B 1OGAE 2CLVB 1KTRL 2FX8H 1K2DA 5FA4B 4WNQB 4XGZB 1UM5H 1OCWL 5DZNA 3KPNA 4U1SB 4P4KD 5IKCB 3MJ7B 3MSPA 4G7VH 3BKJH 2OK0L 4WIQA 2QQKH 4I48B 1JMZA 5DK2B 4YHKH 3GHBL 2DM2A 2YSSB 1AQKL 2X10A 4I5BA 3HI1B 3WFBH 4H1LB 1HOCB 1FZMA 2ADGA 3WBDA 5DGRA 1CIDA 3EIFA 1FZKA 2H26A 3L1OL 2ZKHH 1H0DA 4HLZH 5JXAL 2N4IA 1YJDH 2VDNL 3HPLB 4ZXBD 3FT3A 5FYKD 5I75B 3T04D 2IANA 2XTJD 5DD1L 2DLGA 2GSGB 3MRHB 4OZFB 2AJVH 4N68A 5CCKH 4F15B 1AQDA 5FGCE 2YPLA 5L9DH 3QULB 4FQCH 1EX0A 2ICWA 3DX8A 4HC1L 4KROB 1ES0A 1EAJA 3VXMB 3TH2T 1BOYA 2DRUA 2E6JA 4MDJB 2ZNWA 4MZ2A 3T4YB 5IQ9A 2W0KA 5BRZB 5LQBL 4R6UA 1NDMA 4NIKB 1WAAF 4LPWA 1U6AL 1UWEL 3O6MH 3A67H 4QYOA 1YPZA 2GCYB 2A74A 5INCA 4IMLA 3VFRB 4KDWA 3HCVA 3AMKA 3TNNA 4P23B 5HYIA 3DO3A 2OTWA 4FFYL 3F12B 4NP4H 2CK2A 4BUHA 1UGNA 4P5MA 4O2CA 1IZJA 3MRRB 3QRGL 3KPSE 4G8GE 4N90E 3EYUH 2VH5H 3AY4A 5DF0A 1OAZL 5KW9L 5SWQA 5B3JF 2ZUVA 4AIOA 1JVKA 1H3UA 5IHZB 3HE7C 2XA3A 3LDBC 4IRZL 3D25B 4JY5L 2WBJD 3OAYH 5GGSB 3GJFH 5F6HI 1QR4A 3CVIH 4JR9H 1HWGB 1S3KH 1V5JA 1Z5LA 3SE9L 3RHWF 1XGYL 2WW8A 4X99A