4N0WA

X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
416
structure length
416
Chain Sequence
SMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title X-ray crystal structure of a serine hydroxymethyltransferase from Burkholderia cenocepacia with covalently attached pyridoxal phosphate
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
total genus 162
structure length 416
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0wA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4n0wA02
1LC7A 3PGYA 3WY7A 1QGNA 1V72A 2BWNA 5HDMA 1OXPA 2VMVA 1J32A 1S07A 5EAAA 5BJ3A 2ZYJA 4OCAA 1KL1A 2OKJA 2VLFA 1JF9A 3K28A 3LG0A 1ZOBA 2YKYA 2W7DA 2PO3A 2CH1A 3FCRA 3PA9A 2VGUA 2AY4A 3NTJA 2Z1YA 3ASAA 1TPLA 2C44A 4BHDA 1CQ8A 1BQDA 3AELA 1VP4A 4WB0B 2AY9A 2EH6A 5LHAA 2EPJA 4EFFA 1IBJA 1SFFA 1CZEA 1IVRA 3E77A 2Z61A 3HMUA 1S09A 3BV0A 3CBFA 1AHFA 2W7KA 3AEJC 4E77A 2O7CA 2Z20A 2FNIA 5M46A 3EI5A 4IYOA 3USFA 2AY6A 4ZDPA 2OGAA 4IXOA 1IUGA 3EIAA 4WYEA 2BKWA 1XI9A 2VMYA 3PJ0A 1ELUA 1C4KA 1UKJA 2CSTA 2D63A 3AENA 5K8BA 4DBCA 3NX3A 3EI6A 1X29A 1AAWA 1QJ5A 3DC1A 3QPGA 4GE9A 4RJYA 4F5IA 2ZC0A 5F9SA 3IF2A 2BIGA 4IXZA 1LW4A 2ZY4A 1UU1A 3MAUA 1X28A 5IWQA 1X2AA 1BJOA 2D61A 4LNLA 1KKJA 3HL2A 2Z67A 3KE3A 2D65A 4EMYA 4F5GA 7AATA 2BYLA 1T3IA 3WGCA 2W7LA 4A6UA 1ASCA 1M32A 3FFHA 4ADEA 3K40A 1TOKA 2CANA 2YRRA 5FT8A 2JJFA 2R2NA 2W8TA 2X5DA 1PFFA 3FVXA 2E7UA 1WSTA 4FL0A 1GC3A 5E5IA 1TARA 1DJEA 2XH1A 3PAAA 5D5SA 3BWNA 4QGRA 4DGTA 4W5KA 1YIZA 1WYVB 4K2MA 4JE5D 1AMSA 3I5TA 1WYTA 2EGYA 3LWSA 1MAQA 1C0NA 4W1VA 3TFTA 3GBXA 1PMMA 4GE4A 2ZY2A 1OHVA 8AATA 2CJDA 3FDBA 2WK7A 3RBFA 3GZCA 2G6WA 3DR7A 4WD2A 3F9TA 1FC4A 2NMPA 3DR4A 3FZ8A 4W8IA 4BA5A 1SZKA 2DGKA 3GZDA 2AATA 4P3MA 1BJWA 4M2JA 1D7VA 4XJLA 3NU8A 1TOGA 3GETA 3PPLA 1Z7DA 1DFOA 4IXSA 4ADDA 5TF5A 1N8PA 4XQ2A 2W7IA 3DU4A 5EFSA 4ADCA 4P7YA 3IHJA 3JWBA 3WKSA 2QMAA 1YJSA 1B4XA 3T32A 4Y0IA 4OTLA 3D6KA 3VP6A 4JEYA 4RKDA 1IX7A 1B9IA 3LY1A 1ASEA 3OP7A 2W8UA 2AY2A 1N31A 4W91A 3HLMA 4RM1A 5J8QA 3QHXA 2Z9UA 3FKDA 4ADBA 4A0RA 2VI9A 2JISA 3MAFA 3ZRPA 2OGEA 3BN1A 2W8VA 5G4JA 3P6KA 1AIBA 2W7GA 5EUNA 4WYGA 3CQ4A 1ARSA 3LVJA 1KMJA 2E7JA 1XEYA 3N5MA 3WGBA 2HOYA 1TASA 2YKVA 4ZAHA 3RUYA 2VMUA 2JJEA 3G0TA 4RIZA 2VMXA 4CVQA 3N0LA 4OMAA 2TPLA 4GDYA 4R2NA 1IJIA 4WYCA 2WK9A 1EJIA 4J8LA 1RVUA 1ECXA 2RFVA 2Q7WA 4ZLVA 1M0PA 3A9ZA 1BKGA 2FM1A 5EIGA 2AEUA 1CJ0A 4AO4A 1BJNA 1W7MA 1W7LA 3LVKA 1YAAA 4R5ZA 3RCHA 3NYSA 3P1TA 3JZLA 2JJGA 3QBOA 2BHXA 2W8JA 2HORA 4A72A 4B9BA 3B8XA 1MDOA 1D2FA 1MDXA 1AKCA 2EO5A 3MC6C 3LV2A 4Q75A 1IAXA 3FRKA 3E2YA 5FT6A 1YJZA 5DB5A 5BJ4A 2QLRA 1V2DA 2HZPA 4WYAA 4JE5A 2D7YA 2BYJA 4LNMA 4PVFA 1C9CA 1YOOA 3NRAA 4LNJA 1CS1A 3EI7A 2BWPA 2Z9VA 3ELPA 4E3QA 2AY1A 3EI9A 2BI9A 5HXXA 3NUBA 2CINA 1V2FA 3BS8A 1N2TA 4PFFA 3I16A 3ZRRA 1AKAA 2D5YA 2JGTA 3CAIA 1JS3A 3MBBA 4NOGA 3VAXA 1TOIA 4F5JA 2VMPA 1GC0A 1AICA 1YNUA 1G4VA 3FQ7A 4MQQA 4M2KA 2DOUA 4WB0A 3HT4A 4B98A 2C0RA 4ITGA 1O69A 2C81A 4IYOB 3RQ1A 1GC4A 4ZDLA 4MQRA 1ORDA 4N0WA 5G2QA 1ASGA 1WKHA 2HP1A 3AEMA 2W7MA 3VK2A 1BT4A 3HDOA 3LVLB 3AENB 4IX8A 3QI6A 1E5FA 5EUEA 3B46A 3HVYA 4K2IA 1MDZA 5G4IA 4LC3A 4WLHA 4F5MA 3FDDA 1B9HA 1QZ9A 3JU7A 4ZASA 1G7WA 1QIRA 4ZWVA 1FG7A 3W1IA 1BJOB 2CTZA 3BC8A 3KGWA 4CBSA 1S06A 5FT4A 4F4EA 3KKIA 4KXKA 4AZKA 2Z9WA 4TMRA 2HP2A 2CB1A 2QA3A 4ZM3A 1S08A 3FSLA 3TFUA 1J04A 1ARTA 4MKJA 3E2FA 1M0OA 1LW5A 5EQCA 1I43A 1KMKA 1AMRA 1ASBA 2CH2A 3N75A 4ZSYA 3ZZKA 2W7EA 1SF2A 1Z3ZA 4F5HA 1M4NA 5FT5A 1TOEA 1CQ6A 3FZ6A 3NU7A 3ASBA 1AKBA 1U08A 2D7ZA 3B1CA 4AZJA 1WYTB 2BI2A 4WXFA 4XJOA 4MKKA 4CBRA 3FVUA 3VK3A 4MY5A 4F5KA 2HOXA 3M5UA 1ARIA 2VGTA 1MLYA 4PFNA 1WYUB 1AHGA 1GDEA 4FFCA 1P3WA 1D7UA 1GC2A 3DRDA 2D64A 1PMOA 1WYVA 3HBXA 4A00A 4EB7A 2CJHA 4TN4A 4UHOA 1ARGA 1QITA 2R5EA 5DX5A 1GBNA 1S0AA 1IX6A 2E7IA 5M49A 2VMNA 2R5CA 2FYFA 2EZ2A 2R0TA 3BWOA 1LK9A 2YCNA 2BIEA 2ORDA 1B5OA 1MAPA 2VMSA 4BA4A 1X0MA 1AJRA 1RVYA 3DXVA 4OYTA 3ACZA 4JF0A 3WKRA 2YCTA 2W8WA 4JF1A 1W23A 1I48A 1GEXA 3FZ7A 4A6RA 5HHYA 1CL1A 2O0RA 1SVVA 4ZSWA 4UQVA 1C7OA 4A0HA 4DQ6A 4E3RA 3CQ5A 5EAVA 4LW2A 1ELQA 2CFBA 4RLGA 1BQAA 4JEVA 2ZSMA 4RITA 4L0OA 4EU1A 2ZUKA 1ASFA 3PDXA 4OT8A 1GEWA 4A6TA 1AHXA 2XBNA 2Z9XA 1AJSB 1M7YA 3AOWA 3MAFB 2DR1A 2AY3A 3GZDC 4BQ0A 1OXOA 2YKUA 4GRXA 3KGXA 1ZC9A 3JTXA 2QBTA 3NDNA 4RKCA 2AY8A 4I8AA 4ITXA 4HVKA 3H14A 3L8AA 3Q8NA 4EB5A 1AY5A 4WXGA 3E9KA 2DKBA 1AMAA 1DGEA 4GE7A 4XJPA 1TATA 4JEZA 2DGLA 1C7NA 2V1PA 2ZSLA 3EUCA 3VK4A 1GD9A 4ISYA 3A9YA 1ASLA 4RJ0A 1LC5A 1ARHA 5EIGB 4U1TA 2GMUA 3RCHB 3K7YA 1FG3A 4Y0HA 1RV4A 3E2ZA 3AEPA 1ASAA 2CJGA 2E54A 2D66A 5EUDA 2VGSA 3FTBA 2X8UA 1O61A 3PDBB 1AHYA 1ASNA 1GCKA 2YHKA 3FVSA 1JS6A 5E3KA 3AEJA 3TATA 3EIBA 1O62A 3II0A 1AIAA 4OBUA 1TOJA 3F6TA 3GJUA 2HOZA 1B5PA 1MGVA 3PD6A 2HUUA 4Q76A 3QN6A 4BMKA 9AATA 4IW7A 1DKAA 5E4ZA 3RBLA 1W3UA 1KKPA 3AOVA 4HF8A 1AAMA 1LS3A 1ASMA 2VIBA 2GQNA 2VIAA 4LW4A 3DXWA 3A8UX 5F8VA 1JG8A 1SZSA 3B1EA 3L44A 4OBVA 4ATQA 1RV3A 3TQXA 2HUFA 4ZDOA 4IY7A 4CXQA 4K2BA 2QB3A 3G8MA 2O1BA 2YOBA 2X3LA 3ZZJA 1ASDA 2Z1ZA 1E5EA 1W7NA 1M6SA 2OQXA 3ATHA 4F5LA 2BI1A 5LH9A 1DTYA 1QJ3A 3F0HA 2HUIA 2OKKA 1KL2A 2CY8A 2ZY3A 1AX4A 1EG5A 2JG2A 1CZCA 2YKXA 4TV7A 4XEWA 5D95A 3FD0A 3GR9A 3CQ6A 1H1CA 4MQPA 2YCPA 3DYDA 4PIWA 5G09A 3VOMA 3FQAA 3WCOA 2F8JA 1WKGA 2AY5A 4KAMA 1D7RA 3UAKA 4J5UA 3B1DA 3OKSA 4UOYA 1SZUA 1LKCA 1QISA 2BI3A 2DKJA 2VLHA 1D7SA 3QM2A 5JAYA 1YIYA 3BCBA 2W7FA 2VMZA 3FFRA 4WBTA 2GB3A 4Q6RA 4U2HA 1BS0A 2ZJGA 4XK1A 4AH3A 3LVMA 4N0BA 3MEBA 3PIUA 3NYTA 1GEYA 3WLXA 3AEMC 2JJHA 3HQTA 3FQ8A 4AO9A 2BI5A 3WX9A 3H7FA 4R5FA 2VGWA 3NUIA 4W1WA 4E1OA 3A9XA 4F5FA 1VEFA 3ECDA 3JWAA 1EQBA 2QB2A 3G7QA 2VMOA 3W1JA 1CQ7A 3AATA 2FNUA 4ZM4A 2GSAA 1VJOA 1OATA 2PB2A 1AY8A 2ZY5A 3WZFA 1H0CA 1CL2A 2BWOA 4JEWA 5G0AA 5AX8A 4AOAA 2VMWA 1V2EA 2WK8A 3GSBA 2R5CB 1PG8A 3BWNC 1YJYA 3RI6A 1WYUA 5M4BA 3ELEA 5DJ1A 4WYFA 1IX8A 1O4SA 4ZWMA 4Y0DA 2W7HA 3NYUA 1BW0A 1AHEA 4GSAA 2YRIA 1SPAA 3R4TA 4MGRA 3GWPA 3R9AA 5G2PA 1UU2A 4W1XA 2VGZA 4WLJA 5C6UA 4JEXA 3W1HA 3ZRQA 1M0QA 2EZ1A 2VI8A 3MKJA 2BIAA 4GEBA 1Y4IA 2VGVA 2ZP7A 3JW9A 5I92A 3DZZA 4ATPA 3TCMA 2VMTA 3I4JA 4UHNA 3ISLA 3QGUA 4UHMA 1AMQA 2OATA 1DGDA 2V0YA 5DJ9A 3BCXA 2W7JA 3WCNA 4A0GA 2FQ6A 3NNKA 1AJSA 1UU0A 2GMSA 2VYCA 1DJUA 2DGMA 2PB0A 3MC6A 3BB8A 3EI8A 4OC9A 3COGA 3AEOA 1C7GA 3DODA 4M2MA 2AY7A 4CXRA 4WYDA 2C7TA 2VMQA 2WKAA 1G7XA 1IAYA 1M0NA 3EZ1A 4R8DA 4O6ZA 4Q31A 1AY4A 3UWCA 3A2BA 2X5FA 3E2ZB 1OHYA 4WP0A 5M4DA 4RAEA 1DJ9A 4XAUA 3UE8A 1ZODA 2FN6A 1BJ4A 3BCAA 3AV7A 4A0FA 4H51A 1G4XA 1B8GA 3MADA 3EZSA 4XJMA 1MLZA 1I29A 4WXBA 4KYOA 2VMRA 2AEVA 1OHWA 3E6GA 1LC8A 3PD6B 4MSOA 3PDBA 1I41A
chains in the Genus database with same CATH superfamily
1LC7A 3PGYA 3WY7A 1QGNA 1V72A 2BWNA 5HDMA 1OXPA 2VMVA 1J32A 1S07A 5EAAA 5BJ3A 2ZYJA 4OCAA 1KL1A 2OKJA 2VLFA 1JF9A 3K28A 3LG0A 1ZOBA 2YKYA 2W7DA 2PO3A 2CH1A 3FCRA 3PA9A 2VGUA 2AY4A 3NTJA 2Z1YA 3ASAA 1TPLA 2C44A 4BHDA 1CQ8A 4H63Q 1BQDA 3AELA 1VP4A 4WB0B 2AY9A 2EH6A 5LHAA 2EPJA 4EFFA 1IBJA 2G7JA 1SFFA 1CZEA 1IVRA 3E77A 2Z61A 3HMUA 1S09A 3BV0A 3CBFA 1AHFA 2W7KA 3AEJC 4E77A 2O7CA 2Z20A 2FNIA 5M46A 3EI5A 4IYOA 3USFA 4K05A 2AY6A 4ZDPA 2OGAA 4IXOA 1IUGA 3EIAA 4WYEA 2BKWA 1XI9A 2VMYA 3H9XA 3PJ0A 1ELUA 1C4KA 1UKJA 2CSTA 2D63A 3AENA 5K8BA 4DBCA 3NX3A 3EI6A 1X29A 1AAWA 1QJ5A 3DC1A 3QPGA 4GE9A 4RJYA 4F5IA 2ZC0A 5F9SA 3IF2A 2BIGA 4IXZA 1LW4A 2ZY4A 1UU1A 3MAUA 1X28A 5IWQA 1X2AA 1BJOA 2D61A 4LNLA 1KKJA 3HL2A 2Z67A 3KE3A 2D65A 4EMYA 4F5GA 7AATA 2BYLA 1T3IA 3WGCA 2W7LA 4A6UA 1ASCA 1M32A 3FFHA 4ADEA 3K40A 1TOKA 2CANA 2YRRA 5FT8A 2JJFA 2R2NA 2W8TA 2X5DA 1PFFA 3FVXA 2E7UA 1WSTA 4FL0A 1GC3A 5E5IA 1TARA 2QSRA 1DJEA 2XH1A 3PAAA 5D5SA 3BWNA 4QGRA 4DGTA 4W5KA 1YIZA 1WYVB 4K2MA 4JE5D 1AMSA 3I5TA 1WYTA 2EGYA 3LWSA 1MAQA 1C0NA 4W1VA 3TFTA 3GBXA 1PMMA 4GE4A 2ZY2A 1OHVA 8AATA 2CJDA 3FDBA 2WK7A 3RBFA 3GZCA 2G6WA 3DR7A 4WD2A 3F9TA 1FC4A 2NMPA 3DR4A 3FZ8A 4W8IA 4BA5A 1SZKA 2DGKA 3GZDA 2AATA 4P3MA 1BJWA 4M2JA 1D7VA 4XJLA 3NU8A 1TOGA 3GETA 3PPLA 1Z7DA 1DFOA 4IXSA 4ADDA 5TF5A 1N8PA 4XQ2A 2W7IA 3DU4A 5EFSA 4ADCA 4P7YA 3IHJA 3JWBA 3WKSA 2QMAA 1YJSA 1B4XA 3T32A 4Y0IA 4OTLA 3D6KA 3VP6A 4JEYA 4RKDA 1IX7A 1B9IA 3LY1A 1ASEA 3OP7A 2W8UA 2AY2A 1N31A 4W91A 3HLMA 4RM1A 5J8QA 3QHXA 2Z9UA 3FKDA 4ADBA 4A0RA 2VI9A 2JISA 3MAFA 3ZRPA 2OGEA 3BN1A 2W8VA 5G4JA 3P6KA 1AIBA 2W7GA 5EUNA 4WYGA 3CQ4A 1ARSA 3LVJA 1KMJA 2E7JA 1XEYA 3N5MA 3WGBA 2HOYA 1TASA 2YKVA 4ZAHA 3RUYA 2VMUA 2JJEA 3G0TA 4RIZA 2VMXA 4CVQA 3N0LA 4OMAA 2TPLA 4GDYA 4R2NA 1IJIA 4WYCA 2WK9A 1EJIA 4J8LA 1RVUA 1ECXA 2RFVA 2Q7WA 4ZLVA 1M0PA 3A9ZA 1BKGA 2FM1A 5EIGA 2AEUA 1CJ0A 4AO4A 1BJNA 1W7MA 1W7LA 3LVKA 1YAAA 4R5ZA 3RCHA 3NYSA 3P1TA 3JZLA 2JJGA 3QBOA 2BHXA 2W8JA 2HORA 4A72A 4B9BA 3B8XA 1MDOA 1D2FA 1MDXA 1AKCA 2EO5A 3MC6C 3LV2A 4Q75A 1IAXA 3FRKA 3E2YA 5FT6A 1YJZA 5DB5A 5BJ4A 2QLRA 1V2DA 2HZPA 4WYAA 4JE5A 2D7YA 2BYJA 4LNMA 4PVFA 1C9CA 1YOOA 3NRAA 4LNJA 1CS1A 3EI7A 2BWPA 2Z9VA 3ELPA 4E3QA 2AY1A 3EI9A 2BI9A 5HXXA 3NUBA 2CINA 1V2FA 3BS8A 1N2TA 4PFFA 3I16A 3ZRRA 1AKAA 2D5YA 2JGTA 3CAIA 1JS3A 3MBBA 4NOGA 3VAXA 1TOIA 4F5JA 2VMPA 1GC0A 1AICA 1YNUA 1G4VA 3FQ7A 4MQQA 4M2KA 2DOUA 4WB0A 3HT4A 4B98A 2C0RA 4ITGA 1O69A 2C81A 4IYOB 3RQ1A 1GC4A 4ZDLA 4MQRA 1ORDA 4N0WA 5G2QA 1ASGA 1WKHA 2HP1A 3AEMA 2W7MA 3VK2A 1BT4A 3HDOA 3LVLB 3AENB 4IX8A 3QI6A 1E5FA 5EUEA 3B46A 3HVYA 4K2IA 1MDZA 5G4IA 4LC3A 4WLHA 4F5MA 3FDDA 1B9HA 1QZ9A 3JU7A 4ZASA 1G7WA 2A1VA 1QIRA 4ZWVA 1FG7A 3W1IA 1BJOB 2CTZA 3BC8A 3KGWA 4CBSA 1S06A 5FT4A 4F4EA 3KKIA 4KXKA 4AZKA 2Z9WA 4TMRA 2HP2A 2CB1A 2QA3A 4ZM3A 1KAFA 1S08A 3FSLA 3TFUA 1J04A 1ARTA 4MKJA 3E2FA 1M0OA 1LW5A 5EQCA 1I43A 1KMKA 1AMRA 1ASBA 2CH2A 3N75A 4ZSYA 3ZZKA 2W7EA 1SF2A 1Z3ZA 4F5HA 1M4NA 5FT5A 1TOEA 2WB6A 1CQ6A 3FZ6A 3NU7A 3ASBA 1AKBA 1U08A 2D7ZA 3B1CA 4AZJA 1WYTB 2BI2A 4WXFA 4XJOA 4MKKA 4CBRA 3FVUA 3VK3A 4MY5A 4F5KA 2HOXA 3M5UA 1ARIA 2VGTA 1MLYA 4PFNA 1WYUB 1AHGA 1GDEA 4FFCA 1P3WA 1D7UA 1GC2A 3DRDA 2D64A 1PMOA 1WYVA 3HBXA 4A00A 4EB7A 2CJHA 4TN4A 4UHOA 1ARGA 1QITA 2R5EA 5DX5A 1GBNA 1S0AA 1IX6A 2E7IA 5M49A 2VMNA 2R5CA 2FYFA 2EZ2A 2R0TA 3BWOA 1LK9A 2YCNA 2BIEA 2ORDA 1B5OA 1MAPA 2VMSA 4BA4A 1X0MA 1AJRA 1RVYA 3DXVA 4OYTA 3ACZA 4JF0A 3WKRA 2YCTA 2W8WA 4JF1A 1W23A 1I48A 1GEXA 3FZ7A 4A6RA 5HHYA 1CL1A 2O0RA 1SVVA 4ZSWA 4UQVA 1C7OA 4A0HA 4DQ6A 4E3RA 3CQ5A 5EAVA 4LW2A 1ELQA 2CFBA 4RLGA 1BQAA 4JEVA 2ZSMA 4RITA 4L0OA 4EU1A 2ZUKA 1ASFA 3PDXA 4OT8A 1GEWA 4A6TA 1AHXA 2XBNA 2Z9XA 1AJSB 1M7YA 3AOWA 3MAFB 2DR1A 2AY3A 3GZDC 4BQ0A 1OXOA 2YKUA 4GRXA 5KTBA 3KGXA 1ZC9A 3JTXA 2QBTA 3NDNA 4RKCA 2AY8A 4I8AA 4ITXA 4HVKA 3H14A 3L8AA 3Q8NA 4EB5A 1AY5A 4WXGA 3E9KA 2DKBA 1AMAA 1DGEA 4GE7A 4XJPA 1TATA 4JEZA 2DGLA 1C7NA 2EYQA 2V1PA 2ZSLA 3EUCA 3VK4A 1GD9A 4ISYA 3A9YA 1ASLA 4RJ0A 1LC5A 1ARHA 5EIGB 4U1TA 2GMUA 3RCHB 3K7YA 1FG3A 4Y0HA 1RV4A 3E2ZA 3AEPA 1ASAA 2CJGA 2E54A 2D66A 5EUDA 2VGSA 3FTBA 2X8UA 1O61A 3PDBB 1AHYA 1ASNA 1GCKA 2YHKA 3FVSA 1JS6A 5E3KA 3AEJA 3TATA 3EIBA 1O62A 3II0A 1AIAA 4OBUA 1TOJA 3F6TA 3GJUA 2KFPA 2HOZA 1B5PA 1MGVA 3PD6A 2HUUA 4Q76A 3QN6A 4BMKA 9AATA 4IW7A 1DKAA 5E4ZA 3RBLA 1W3UA 1KKPA 3AOVA 4HF8A 1AAMA 1LS3A 1ASMA 2VIBA 2GQNA 2VIAA 4LW4A 3DXWA 3A8UX 5F8VA 1JG8A 1SZSA 3B1EA 3L44A 4OBVA 4ATQA 1RV3A 3TQXA 2HUFA 4ZDOA 4IY7A 4CXQA 4K2BA 2QB3A 3G8MA 2O1BA 2YOBA 2X3LA 3ZZJA 1ASDA 2Z1ZA 1E5EA 1W7NA 1M6SA 2OQXA 3ATHA 4F5LA 2BI1A 5LH9A 1DTYA 1QJ3A 3F0HA 2HUIA 2OKKA 1KL2A 2CY8A 2ZY3A 1AX4A 1EG5A 2JG2A 1CZCA 2YKXA 4TV7A 4XEWA 5D95A 3FD0A 3GR9A 3CQ6A 1H1CA 4MQPA 2YCPA 3DYDA 4PIWA 5G09A 3VOMA 3FQAA 3WCOA 2F8JA 1WKGA 2AY5A 4KAMA 1D7RA 3UAKA 4J5UA 3B1DA 3OKSA 4UOYA 1SZUA 3N7NA 1LKCA 1QISA 2BI3A 2DKJA 2VLHA 1D7SA 3QM2A 5JAYA 1YIYA 3BCBA 2W7FA 2VMZA 3FFRA 4WBTA 2GB3A 4Q6RA 4U2HA 1BS0A 2ZJGA 4XK1A 4AH3A 3LVMA 4N0BA 3MEBA 3PIUA 3NYTA 1GEYA 3WLXA 3AEMC 2JJHA 3HQTA 3FQ8A 4AO9A 2BI5A 3WX9A 3H7FA 4R5FA 2VGWA 3NUIA 4W1WA 4E1OA 3A9XA 4F5FA 1VEFA 3ECDA 3JWAA 1EQBA 2QB2A 3G7QA 2VMOA 3W1JA 1CQ7A 3AATA 2FNUA 4ZM4A 2GSAA 1VJOA 1OATA 2PB2A 3N4RA 1AY8A 2ZY5A 3WZFA 1H0CA 1CL2A 2BWOA 4JEWA 5G0AA 5AX8A 4AOAA 2VMWA 1V2EA 2WK8A 3GSBA 2R5CB 1PG8A 3BWNC 1YJYA 3RI6A 1WYUA 5M4BA 3ELEA 5DJ1A 4WYFA 1IX8A 1O4SA 4ZWMA 2FKIA 4Y0DA 2W7HA 3NYUA 1BW0A 1AHEA 4GSAA 2YRIA 1SPAA 3N4SA 3R4TA 4MGRA 3GWPA 3R9AA 5G2PA 1UU2A 4W1XA 2VGZA 4WLJA 5C6UA 4JEXA 3W1HA 3ZRQA 1M0QA 2EZ1A 2VI8A 3MKJA 2BIAA 4GEBA 1Y4IA 2VGVA 2ZP7A 3JW9A 5I92A 3DZZA 4ATPA 3TCMA 2VMTA 3I4JA 4UHNA 3ISLA 3QGUA 4UHMA 1AMQA 2OATA 1DGDA 2V0YA 5DJ9A 3BCXA 2W7JA 3WCNA 4A0GA 2FQ6A 3NNKA 1AJSA 1UU0A 2GMSA 2VYCA 1DJUA 2DGMA 2PB0A 3MC6A 3BB8A 3EI8A 4OC9A 3COGA 3AEOA 1C7GA 3DODA 3N4XA 4M2MA 2AY7A 4CXRA 4WYDA 2C7TA 2VMQA 2WKAA 1G7XA 1IAYA 1M0NA 3EZ1A 4R8DA 4O6ZA 4Q31A 1AY4A 3UWCA 3A2BA 2X5FA 3E2ZB 1OHYA 4WP0A 5M4DA 4RAEA 1DJ9A 4XAUA 3UE8A 1ZODA 2FN6A 1BJ4A 3BCAA 3AV7A 4A0FA 4H51A 1G4XA 1B8GA 3MADA 3EZSA 4XJMA 1MLZA 1I29A 4WXBA 4KYOA 2VMRA 2AEVA 1OHWA 3E6GA 1LC8A 3PD6B 4MSOA 3PDBA 1I41A
chains in the Genus database with same CATH topology
1LC7A 3PGYA 3WY7A 1QGNA 1V72A 2BWNA 5HDMA 1OXPA 2VMVA 1J32A 1S07A 5EAAA 5BJ3A 2ZYJA 4OCAA 1KL1A 2OKJA 2VLFA 1JF9A 3K28A 3LG0A 1ZOBA 2YKYA 2W7DA 2PO3A 2CH1A 3FCRA 3PA9A 2VGUA 2AY4A 3NTJA 2Z1YA 3ASAA 1TPLA 2C44A 4BHDA 1CQ8A 4H63Q 1BQDA 3AELA 1VP4A 4WB0B 2AY9A 2EH6A 5LHAA 2EPJA 4EFFA 1IBJA 2G7JA 1SFFA 1CZEA 1IVRA 3E77A 2Z61A 3HMUA 1S09A 3BV0A 3CBFA 1AHFA 2W7KA 3AEJC 4E77A 2O7CA 2Z20A 2FNIA 5M46A 3EI5A 4IYOA 3USFA 4K05A 2AY6A 4ZDPA 2OGAA 4IXOA 1IUGA 3EIAA 4WYEA 2BKWA 1XI9A 2VMYA 3H9XA 3PJ0A 1ELUA 1C4KA 1UKJA 2CSTA 2D63A 3AENA 5K8BA 4DBCA 3NX3A 3EI6A 1X29A 1AAWA 1QJ5A 3DC1A 3QPGA 4GE9A 4RJYA 4F5IA 2ZC0A 5F9SA 3IF2A 2BIGA 4IXZA 1LW4A 2ZY4A 1UU1A 3MAUA 1X28A 5IWQA 1X2AA 1BJOA 2D61A 4LNLA 1KKJA 3HL2A 2Z67A 3KE3A 2D65A 4EMYA 4F5GA 7AATA 2BYLA 1T3IA 3WGCA 2W7LA 4A6UA 1ASCA 1M32A 3FFHA 4ADEA 3K40A 1TOKA 2CANA 2YRRA 5FT8A 2JJFA 2R2NA 2W8TA 2X5DA 1PFFA 3FVXA 2E7UA 1WSTA 4FL0A 1GC3A 5E5IA 1TARA 2QSRA 1DJEA 2XH1A 3PAAA 5D5SA 3BWNA 4QGRA 4DGTA 4W5KA 1YIZA 1WYVB 4K2MA 4JE5D 1AMSA 3I5TA 1WYTA 2EGYA 3LWSA 1MAQA 1C0NA 4W1VA 3TFTA 3GBXA 1PMMA 4GE4A 2ZY2A 1OHVA 8AATA 2CJDA 3FDBA 2WK7A 3RBFA 3GZCA 2G6WA 3DR7A 4WD2A 3F9TA 1FC4A 2NMPA 3DR4A 3FZ8A 4W8IA 4BA5A 1SZKA 2DGKA 3GZDA 2AATA 4P3MA 1BJWA 4M2JA 1D7VA 4XJLA 3NU8A 1TOGA 3GETA 3PPLA 1Z7DA 1DFOA 4IXSA 4ADDA 5TF5A 1N8PA 4XQ2A 2W7IA 3DU4A 5EFSA 4ADCA 4P7YA 3IHJA 3JWBA 3WKSA 2QMAA 1YJSA 1B4XA 3T32A 4Y0IA 4OTLA 3D6KA 3VP6A 4JEYA 4RKDA 1IX7A 1B9IA 3LY1A 1ASEA 3OP7A 2W8UA 2AY2A 1N31A 4W91A 3HLMA 4RM1A 5J8QA 3QHXA 2Z9UA 3FKDA 4ADBA 4A0RA 2VI9A 2JISA 3MAFA 3ZRPA 2OGEA 3BN1A 2W8VA 5G4JA 3P6KA 1AIBA 2W7GA 5EUNA 4WYGA 3CQ4A 1ARSA 3LVJA 1KMJA 2E7JA 1XEYA 3N5MA 3WGBA 2HOYA 1TASA 2YKVA 4ZAHA 3RUYA 2VMUA 2JJEA 3G0TA 4RIZA 2VMXA 4CVQA 3N0LA 4OMAA 2TPLA 4GDYA 4R2NA 1IJIA 4WYCA 2WK9A 1EJIA 4J8LA 1RVUA 1ECXA 2RFVA 2Q7WA 4ZLVA 1M0PA 3A9ZA 1BKGA 2FM1A 5EIGA 2AEUA 1CJ0A 4AO4A 1BJNA 1W7MA 1W7LA 3LVKA 1YAAA 4R5ZA 3RCHA 3NYSA 3P1TA 3JZLA 2JJGA 3QBOA 2BHXA 2W8JA 2HORA 4A72A 4B9BA 3B8XA 1MDOA 1D2FA 1MDXA 1AKCA 2EO5A 3MC6C 3LV2A 4Q75A 1IAXA 3FRKA 3E2YA 5FT6A 1YJZA 5DB5A 5BJ4A 2QLRA 1V2DA 2HZPA 4WYAA 4JE5A 2D7YA 2BYJA 4LNMA 4PVFA 1C9CA 1YOOA 3NRAA 4LNJA 1CS1A 3EI7A 2BWPA 2Z9VA 3ELPA 4E3QA 2AY1A 3EI9A 2BI9A 5HXXA 3NUBA 2CINA 1V2FA 3BS8A 1N2TA 4PFFA 3I16A 3ZRRA 1AKAA 2D5YA 2JGTA 3CAIA 1JS3A 3MBBA 4NOGA 3VAXA 1TOIA 4F5JA 2VMPA 1GC0A 1AICA 1YNUA 1G4VA 3FQ7A 4MQQA 4M2KA 2DOUA 4WB0A 3HT4A 4B98A 2C0RA 4ITGA 1O69A 2C81A 4IYOB 3RQ1A 1GC4A 4ZDLA 4MQRA 1ORDA 4N0WA 5G2QA 1ASGA 1WKHA 2HP1A 3AEMA 2W7MA 3VK2A 1BT4A 3HDOA 3LVLB 3AENB 4IX8A 3QI6A 1E5FA 5EUEA 3B46A 3HVYA 4K2IA 1MDZA 5G4IA 4LC3A 4WLHA 4F5MA 3FDDA 1B9HA 1QZ9A 3JU7A 4ZASA 1G7WA 2A1VA 1QIRA 4ZWVA 1FG7A 3W1IA 1BJOB 2CTZA 3BC8A 3KGWA 4CBSA 1S06A 5FT4A 4F4EA 3KKIA 4KXKA 4AZKA 2Z9WA 4TMRA 2HP2A 2CB1A 2QA3A 4ZM3A 1S08A 3FSLA 3TFUA 1J04A 1ARTA 4MKJA 3E2FA 1M0OA 1LW5A 5EQCA 1I43A 1KMKA 1AMRA 1ASBA 2CH2A 3N75A 4ZSYA 3ZZKA 2W7EA 1SF2A 1Z3ZA 4F5HA 1M4NA 5FT5A 1TOEA 2WB6A 1CQ6A 3FZ6A 3NU7A 3ASBA 1AKBA 1U08A 2D7ZA 3B1CA 4AZJA 1WYTB 2BI2A 4WXFA 4XJOA 4MKKA 4CBRA 3FVUA 3VK3A 4MY5A 4F5KA 2HOXA 3M5UA 1ARIA 2VGTA 1MLYA 4PFNA 1WYUB 1AHGA 1GDEA 4FFCA 1P3WA 1D7UA 1GC2A 3DRDA 2D64A 1PMOA 1WYVA 3HBXA 4A00A 4EB7A 2CJHA 4TN4A 4UHOA 1ARGA 1QITA 2R5EA 5DX5A 1GBNA 1S0AA 1IX6A 2E7IA 5M49A 2VMNA 2R5CA 2FYFA 2EZ2A 2R0TA 3BWOA 1LK9A 2YCNA 2BIEA 2ORDA 1B5OA 1MAPA 2VMSA 4BA4A 1X0MA 1AJRA 1RVYA 3DXVA 4OYTA 3ACZA 4JF0A 3WKRA 2YCTA 2W8WA 4JF1A 1W23A 1I48A 1GEXA 3FZ7A 4A6RA 5HHYA 1CL1A 2O0RA 1SVVA 4ZSWA 4UQVA 1C7OA 4A0HA 4DQ6A 4E3RA 3CQ5A 5EAVA 4LW2A 1ELQA 2CFBA 4RLGA 1BQAA 4JEVA 2ZSMA 4RITA 4L0OA 4EU1A 2ZUKA 1ASFA 3PDXA 4OT8A 1GEWA 4A6TA 1AHXA 2XBNA 2Z9XA 1AJSB 1M7YA 3AOWA 3MAFB 2DR1A 2AY3A 3GZDC 4BQ0A 1OXOA 2YKUA 4GRXA 5KTBA 3KGXA 1ZC9A 3JTXA 2QBTA 3NDNA 4RKCA 2AY8A 4I8AA 4ITXA 4HVKA 3H14A 3L8AA 3Q8NA 4EB5A 1AY5A 4WXGA 3E9KA 2DKBA 1AMAA 1DGEA 4GE7A 4XJPA 1TATA 4JEZA 2DGLA 1C7NA 2EYQA 2V1PA 2ZSLA 3EUCA 3VK4A 1GD9A 4ISYA 3A9YA 1ASLA 4RJ0A 1LC5A 1ARHA 5EIGB 4U1TA 2GMUA 3RCHB 3K7YA 1FG3A 4Y0HA 1RV4A 3E2ZA 3AEPA 1ASAA 2CJGA 2E54A 2D66A 5EUDA 2VGSA 3FTBA 2X8UA 1O61A 3PDBB 1AHYA 1ASNA 1GCKA 2YHKA 3FVSA 1JS6A 5E3KA 3AEJA 3TATA 3EIBA 1O62A 3II0A 1AIAA 4OBUA 1TOJA 3F6TA 3GJUA 2KFPA 2HOZA 1B5PA 1MGVA 3PD6A 2HUUA 4Q76A 3QN6A 4BMKA 9AATA 4IW7A 1DKAA 5E4ZA 3RBLA 1W3UA 1KKPA 3AOVA 4HF8A 1AAMA 1LS3A 1ASMA 2VIBA 2GQNA 2VIAA 4LW4A 3DXWA 3A8UX 5F8VA 1JG8A 1SZSA 3B1EA 3L44A 4OBVA 4ATQA 1RV3A 3TQXA 2HUFA 4ZDOA 4IY7A 4CXQA 4K2BA 2QB3A 3G8MA 2O1BA 2YOBA 2X3LA 3ZZJA 1ASDA 2Z1ZA 1E5EA 1W7NA 1M6SA 2OQXA 3ATHA 4F5LA 2BI1A 5LH9A 1DTYA 1QJ3A 3F0HA 2HUIA 2OKKA 1KL2A 2CY8A 2ZY3A 1AX4A 1EG5A 2JG2A 1CZCA 2YKXA 4TV7A 4XEWA 5D95A 3FD0A 3GR9A 3CQ6A 1H1CA 4MQPA 2YCPA 3DYDA 4PIWA 5G09A 3VOMA 3FQAA 3WCOA 2F8JA 1WKGA 2AY5A 4KAMA 1D7RA 3UAKA 4J5UA 3B1DA 3OKSA 4UOYA 1SZUA 3N7NA 1LKCA 1QISA 2BI3A 2DKJA 2VLHA 1D7SA 3QM2A 5JAYA 1YIYA 3BCBA 2W7FA 2VMZA 3FFRA 4WBTA 2GB3A 4Q6RA 4U2HA 1BS0A 2ZJGA 4XK1A 4AH3A 3LVMA 4N0BA 3MEBA 3PIUA 3NYTA 1GEYA 3WLXA 3AEMC 2JJHA 3HQTA 3FQ8A 4AO9A 2BI5A 3WX9A 3H7FA 4R5FA 2VGWA 3NUIA 4W1WA 4E1OA 3A9XA 4F5FA 1VEFA 3ECDA 3JWAA 1EQBA 2QB2A 3G7QA 2VMOA 3W1JA 1CQ7A 3AATA 2FNUA 4ZM4A 2GSAA 1VJOA 1OATA 2PB2A 3N4RA 1AY8A 2ZY5A 3WZFA 1H0CA 1CL2A 2BWOA 4JEWA 5G0AA 5AX8A 4AOAA 2VMWA 1V2EA 2WK8A 3GSBA 2R5CB 1PG8A 3BWNC 1YJYA 3RI6A 1WYUA 5M4BA 3ELEA 5DJ1A 4WYFA 1IX8A 1O4SA 4ZWMA 2FKIA 4Y0DA 2W7HA 3NYUA 1BW0A 1AHEA 4GSAA 2YRIA 1SPAA 3N4SA 3R4TA 4MGRA 3GWPA 3R9AA 5G2PA 1UU2A 4W1XA 2VGZA 4WLJA 5C6UA 4JEXA 3W1HA 3ZRQA 1M0QA 2EZ1A 2VI8A 3MKJA 2BIAA 4GEBA 1Y4IA 2VGVA 2ZP7A 3JW9A 5I92A 3DZZA 4ATPA 3TCMA 2VMTA 3I4JA 4UHNA 3ISLA 3QGUA 4UHMA 1AMQA 2OATA 1DGDA 2V0YA 5DJ9A 3BCXA 2W7JA 3WCNA 4A0GA 2FQ6A 3NNKA 1AJSA 1UU0A 2GMSA 2VYCA 1DJUA 2DGMA 2PB0A 3MC6A 3BB8A 3EI8A 4OC9A 3COGA 3AEOA 1C7GA 3DODA 3N4XA 4M2MA 2AY7A 4CXRA 4WYDA 2C7TA 2VMQA 2WKAA 1G7XA 1IAYA 1M0NA 3EZ1A 4R8DA 4O6ZA 4Q31A 1AY4A 3UWCA 3A2BA 2X5FA 3E2ZB 1OHYA 4WP0A 5M4DA 4RAEA 1DJ9A 4XAUA 3UE8A 1ZODA 2FN6A 1BJ4A 3BCAA 3AV7A 4A0FA 4H51A 1G4XA 1B8GA 3MADA 3EZSA 4XJMA 1MLZA 1I29A 4WXBA 4KYOA 2VMRA 2AEVA 1OHWA 3E6GA 1LC8A 3PD6B 4MSOA 3PDBA 1I41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LC7 A;  3PGY A;  3WY7 A;  1QGN A;  1V72 A;  2BWN A;  5HDM A;  1OXP A;  2VMV A;  1J32 A;  1S07 A;  5EAA A;  5BJ3 A;  2ZYJ A;  4OCA A;  1KL1 A;  2OKJ A;  2VLF A;  1JF9 A;  3K28 A;  3LG0 A;  1ZOB A;  2YKY A;  2W7D A;  2PO3 A;  2CH1 A;  3FCR A;  3PA9 A;  2VGU A;  2AY4 A;  3NTJ A;  2Z1Y A;  3ASA A;  1TPL A;  2C44 A;  4BHD A;  1CQ8 A;  1BQD A;  3AEL A;  1VP4 A;  4WB0 B;  2AY9 A;  2EH6 A;  5LHA A;  2EPJ A;  4EFF A;  1IBJ A;  1SFF A;  1CZE A;  1IVR A;  3E77 A;  2Z61 A;  3HMU A;  1S09 A;  3BV0 A;  3CBF A;  1AHF A;  2W7K A;  3AEJ C;  4E77 A;  2O7C A;  2Z20 A;  2FNI A;  5M46 A;  3EI5 A;  4IYO A;  3USF A;  2AY6 A;  4ZDP A;  2OGA A;  4IXO A;  1IUG A;  3EIA A;  4WYE A;  2BKW A;  1XI9 A;  2VMY A;  3PJ0 A;  1ELU A;  1C4K A;  1UKJ A;  2CST A;  2D63 A;  3AEN A;  5K8B A;  4DBC A;  3NX3 A;  3EI6 A;  1X29 A;  1AAW A;  1QJ5 A;  3DC1 A;  3QPG A;  4GE9 A;  4RJY A;  4F5I A;  2ZC0 A;  5F9S A;  3IF2 A;  2BIG A;  4IXZ A;  1LW4 A;  2ZY4 A;  1UU1 A;  3MAU A;  1X28 A;  5IWQ A;  1X2A A;  1BJO A;  2D61 A;  4LNL A;  1KKJ A;  3HL2 A;  2Z67 A;  3KE3 A;  2D65 A;  4EMY A;  4F5G A;  7AAT A;  2BYL A;  1T3I A;  3WGC A;  2W7L A;  4A6U A;  1ASC A;  1M32 A;  3FFH A;  4ADE A;  3K40 A;  1TOK A;  2CAN A;  2YRR A;  5FT8 A;  2JJF A;  2R2N A;  2W8T A;  2X5D A;  1PFF A;  3FVX A;  2E7U A;  1WST A;  4FL0 A;  1GC3 A;  5E5I A;  1TAR A;  1DJE A;  2XH1 A;  3PAA A;  5D5S A;  3BWN A;  4QGR A;  4DGT A;  4W5K A;  1YIZ A;  1WYV B;  4K2M A;  4JE5 D;  1AMS A;  3I5T A;  1WYT A;  2EGY A;  3LWS A;  1MAQ A;  1C0N A;  4W1V A;  3TFT A;  3GBX A;  1PMM A;  4GE4 A;  2ZY2 A;  1OHV A;  8AAT A;  2CJD A;  3FDB A;  2WK7 A;  3RBF A;  3GZC A;  2G6W A;  3DR7 A;  4WD2 A;  3F9T A;  1FC4 A;  2NMP A;  3DR4 A;  3FZ8 A;  4W8I A;  4BA5 A;  1SZK A;  2DGK A;  3GZD A;  2AAT A;  4P3M A;  1BJW A;  4M2J A;  1D7V A;  4XJL A;  3NU8 A;  1TOG A;  3GET A;  3PPL A;  1Z7D A;  1DFO A;  4IXS A;  4ADD A;  5TF5 A;  1N8P A;  4XQ2 A;  2W7I A;  3DU4 A;  5EFS A;  4ADC A;  4P7Y A;  3IHJ A;  3JWB A;  3WKS A;  2QMA A;  1YJS A;  1B4X A;  3T32 A;  4Y0I A;  4OTL A;  3D6K A;  3VP6 A;  4JEY A;  4RKD A;  1IX7 A;  1B9I A;  3LY1 A;  1ASE A;  3OP7 A;  2W8U A;  2AY2 A;  1N31 A;  4W91 A;  3HLM A;  4RM1 A;  5J8Q A;  3QHX A;  2Z9U A;  3FKD A;  4ADB A;  4A0R A;  2VI9 A;  2JIS A;  3MAF A;  3ZRP A;  2OGE A;  3BN1 A;  2W8V A;  5G4J A;  3P6K A;  1AIB A;  2W7G A;  5EUN A;  4WYG A;  3CQ4 A;  1ARS A;  3LVJ A;  1KMJ A;  2E7J A;  1XEY A;  3N5M A;  3WGB A;  2HOY A;  1TAS A;  2YKV A;  4ZAH A;  3RUY A;  2VMU A;  2JJE A;  3G0T A;  4RIZ A;  2VMX A;  4CVQ A;  3N0L A;  4OMA A;  2TPL A;  4GDY A;  4R2N A;  1IJI A;  4WYC A;  2WK9 A;  1EJI A;  4J8L A;  1RVU A;  1ECX A;  2RFV A;  2Q7W A;  4ZLV A;  1M0P A;  3A9Z A;  1BKG A;  2FM1 A;  5EIG A;  2AEU A;  1CJ0 A;  4AO4 A;  1BJN A;  1W7M A;  1W7L A;  3LVK A;  1YAA A;  4R5Z A;  3RCH A;  3NYS A;  3P1T A;  3JZL A;  2JJG A;  3QBO A;  2BHX A;  2W8J A;  2HOR A;  4A72 A;  4B9B A;  3B8X A;  1MDO A;  1D2F A;  1MDX A;  1AKC A;  2EO5 A;  3MC6 C;  3LV2 A;  4Q75 A;  1IAX A;  3FRK A;  3E2Y A;  5FT6 A;  1YJZ A;  5DB5 A;  5BJ4 A;  2QLR A;  1V2D A;  2HZP A;  4WYA A;  4JE5 A;  2D7Y A;  2BYJ A;  4LNM A;  4PVF A;  1C9C A;  1YOO A;  3NRA A;  4LNJ A;  1CS1 A;  3EI7 A;  2BWP A;  2Z9V A;  3ELP A;  4E3Q A;  2AY1 A;  3EI9 A;  2BI9 A;  5HXX A;  3NUB A;  2CIN A;  1V2F A;  3BS8 A;  1N2T A;  4PFF A;  3I16 A;  3ZRR A;  1AKA A;  2D5Y A;  2JGT A;  3CAI A;  1JS3 A;  3MBB A;  4NOG A;  3VAX A;  1TOI A;  4F5J A;  2VMP A;  1GC0 A;  1AIC A;  1YNU A;  1G4V A;  3FQ7 A;  4MQQ A;  4M2K A;  2DOU A;  4WB0 A;  3HT4 A;  4B98 A;  2C0R A;  4ITG A;  1O69 A;  2C81 A;  4IYO B;  3RQ1 A;  1GC4 A;  4ZDL A;  4MQR A;  1ORD A;  4N0W A;  5G2Q A;  1ASG A;  1WKH A;  2HP1 A;  3AEM A;  2W7M A;  3VK2 A;  1BT4 A;  3HDO A;  3LVL B;  3AEN B;  4IX8 A;  3QI6 A;  1E5F A;  5EUE A;  3B46 A;  3HVY A;  4K2I A;  1MDZ A;  5G4I A;  4LC3 A;  4WLH A;  4F5M A;  3FDD A;  1B9H A;  1QZ9 A;  3JU7 A;  4ZAS A;  1G7W A;  1QIR A;  4ZWV A;  1FG7 A;  3W1I A;  1BJO B;  2CTZ A;  3BC8 A;  3KGW A;  4CBS A;  1S06 A;  5FT4 A;  4F4E A;  3KKI A;  4KXK A;  4AZK A;  2Z9W A;  4TMR A;  2HP2 A;  2CB1 A;  2QA3 A;  4ZM3 A;  1S08 A;  3FSL A;  3TFU A;  1J04 A;  1ART A;  4MKJ A;  3E2F A;  1M0O A;  1LW5 A;  5EQC A;  1I43 A;  1KMK A;  1AMR A;  1ASB A;  2CH2 A;  3N75 A;  4ZSY A;  3ZZK A;  2W7E A;  1SF2 A;  1Z3Z A;  4F5H A;  1M4N A;  5FT5 A;  1TOE A;  1CQ6 A;  3FZ6 A;  3NU7 A;  3ASB A;  1AKB A;  1U08 A;  2D7Z A;  3B1C A;  4AZJ A;  1WYT B;  2BI2 A;  4WXF A;  4XJO A;  4MKK A;  4CBR A;  3FVU A;  3VK3 A;  4MY5 A;  4F5K A;  2HOX A;  3M5U A;  1ARI A;  2VGT A;  1MLY A;  4PFN A;  1WYU B;  1AHG A;  1GDE A;  4FFC A;  1P3W A;  1D7U A;  1GC2 A;  3DRD A;  2D64 A;  1PMO A;  1WYV A;  3HBX A;  4A00 A;  4EB7 A;  2CJH A;  4TN4 A;  4UHO A;  1ARG A;  1QIT A;  2R5E A;  5DX5 A;  1GBN A;  1S0A A;  1IX6 A;  2E7I A;  5M49 A;  2VMN A;  2R5C A;  2FYF A;  2EZ2 A;  2R0T A;  3BWO A;  1LK9 A;  2YCN A;  2BIE A;  2ORD A;  1B5O A;  1MAP A;  2VMS A;  4BA4 A;  1X0M A;  1AJR A;  1RVY A;  3DXV A;  4OYT A;  3ACZ A;  4JF0 A;  3WKR A;  2YCT A;  2W8W A;  4JF1 A;  1W23 A;  1I48 A;  1GEX A;  3FZ7 A;  4A6R A;  5HHY A;  1CL1 A;  2O0R A;  1SVV A;  4ZSW A;  4UQV A;  1C7O A;  4A0H A;  4DQ6 A;  4E3R A;  3CQ5 A;  5EAV A;  4LW2 A;  1ELQ A;  2CFB A;  4RLG A;  1BQA A;  4JEV A;  2ZSM A;  4RIT A;  4L0O A;  4EU1 A;  2ZUK A;  1ASF A;  3PDX A;  4OT8 A;  1GEW A;  4A6T A;  1AHX A;  2XBN A;  2Z9X A;  1AJS B;  1M7Y A;  3AOW A;  3MAF B;  2DR1 A;  2AY3 A;  3GZD C;  4BQ0 A;  1OXO A;  2YKU A;  4GRX A;  3KGX A;  1ZC9 A;  3JTX A;  2QBT A;  3NDN A;  4RKC A;  2AY8 A;  4I8A A;  4ITX A;  4HVK A;  3H14 A;  3L8A A;  3Q8N A;  4EB5 A;  1AY5 A;  4WXG A;  3E9K A;  2DKB A;  1AMA A;  1DGE A;  4GE7 A;  4XJP A;  1TAT A;  4JEZ A;  2DGL A;  1C7N A;  2V1P A;  2ZSL A;  3EUC A;  3VK4 A;  1GD9 A;  4ISY A;  3A9Y A;  1ASL A;  4RJ0 A;  1LC5 A;  1ARH A;  5EIG B;  4U1T A;  2GMU A;  3RCH B;  3K7Y A;  1FG3 A;  4Y0H A;  1RV4 A;  3E2Z A;  3AEP A;  1ASA A;  2CJG A;  2E54 A;  2D66 A;  5EUD A;  2VGS A;  3FTB A;  2X8U A;  1O61 A;  3PDB B;  1AHY A;  1ASN A;  1GCK A;  2YHK A;  3FVS A;  1JS6 A;  5E3K A;  3AEJ A;  3TAT A;  3EIB A;  1O62 A;  3II0 A;  1AIA A;  4OBU A;  1TOJ A;  3F6T A;  3GJU A;  2HOZ A;  1B5P A;  1MGV A;  3PD6 A;  2HUU A;  4Q76 A;  3QN6 A;  4BMK A;  9AAT A;  4IW7 A;  1DKA A;  5E4Z A;  3RBL A;  1W3U A;  1KKP A;  3AOV A;  4HF8 A;  1AAM A;  1LS3 A;  1ASM A;  2VIB A;  2GQN A;  2VIA A;  4LW4 A;  3DXW A;  3A8U X;  5F8V A;  1JG8 A;  1SZS A;  3B1E A;  3L44 A;  4OBV A;  4ATQ A;  1RV3 A;  3TQX A;  2HUF A;  4ZDO A;  4IY7 A;  4CXQ A;  4K2B A;  2QB3 A;  3G8M A;  2O1B A;  2YOB A;  2X3L A;  3ZZJ A;  1ASD A;  2Z1Z A;  1E5E A;  1W7N A;  1M6S A;  2OQX A;  3ATH A;  4F5L A;  2BI1 A;  5LH9 A;  1DTY A;  1QJ3 A;  3F0H A;  2HUI A;  2OKK A;  1KL2 A;  2CY8 A;  2ZY3 A;  1AX4 A;  1EG5 A;  2JG2 A;  1CZC A;  2YKX A;  4TV7 A;  4XEW A;  5D95 A;  3FD0 A;  3GR9 A;  3CQ6 A;  1H1C A;  4MQP A;  2YCP A;  3DYD A;  4PIW A;  5G09 A;  3VOM A;  3FQA A;  3WCO A;  2F8J A;  1WKG A;  2AY5 A;  4KAM A;  1D7R A;  3UAK A;  4J5U A;  3B1D A;  3OKS A;  4UOY A;  1SZU A;  1LKC A;  1QIS A;  2BI3 A;  2DKJ A;  2VLH A;  1D7S A;  3QM2 A;  5JAY A;  1YIY A;  3BCB A;  2W7F A;  2VMZ A;  3FFR A;  4WBT A;  2GB3 A;  4Q6R A;  4U2H A;  1BS0 A;  2ZJG A;  4XK1 A;  4AH3 A;  3LVM A;  4N0B A;  3MEB A;  3PIU A;  3NYT A;  1GEY A;  3WLX A;  3AEM C;  2JJH A;  3HQT A;  3FQ8 A;  4AO9 A;  2BI5 A;  3WX9 A;  3H7F A;  4R5F A;  2VGW A;  3NUI A;  4W1W A;  4E1O A;  3A9X A;  4F5F A;  1VEF A;  3ECD A;  3JWA A;  1EQB A;  2QB2 A;  3G7Q A;  2VMO A;  3W1J A;  1CQ7 A;  3AAT A;  2FNU A;  4ZM4 A;  2GSA A;  1VJO A;  1OAT A;  2PB2 A;  1AY8 A;  2ZY5 A;  3WZF A;  1H0C A;  1CL2 A;  2BWO A;  4JEW A;  5G0A A;  5AX8 A;  4AOA A;  2VMW A;  1V2E A;  2WK8 A;  3GSB A;  2R5C B;  1PG8 A;  3BWN C;  1YJY A;  3RI6 A;  1WYU A;  5M4B A;  3ELE A;  5DJ1 A;  4WYF A;  1IX8 A;  1O4S A;  4ZWM A;  4Y0D A;  2W7H A;  3NYU A;  1BW0 A;  1AHE A;  4GSA A;  2YRI A;  1SPA A;  3R4T A;  4MGR A;  3GWP A;  3R9A A;  5G2P A;  1UU2 A;  4W1X A;  2VGZ A;  4WLJ A;  5C6U A;  4JEX A;  3W1H A;  3ZRQ A;  1M0Q A;  2EZ1 A;  2VI8 A;  3MKJ A;  2BIA A;  4GEB A;  1Y4I A;  2VGV A;  2ZP7 A;  3JW9 A;  5I92 A;  3DZZ A;  4ATP A;  3TCM A;  2VMT A;  3I4J A;  4UHN A;  3ISL A;  3QGU A;  4UHM A;  1AMQ A;  2OAT A;  1DGD A;  2V0Y A;  5DJ9 A;  3BCX A;  2W7J A;  3WCN A;  4A0G A;  2FQ6 A;  3NNK A;  1AJS A;  1UU0 A;  2GMS A;  2VYC A;  1DJU A;  2DGM A;  2PB0 A;  3MC6 A;  3BB8 A;  3EI8 A;  4OC9 A;  3COG A;  3AEO A;  1C7G A;  3DOD A;  4M2M A;  2AY7 A;  4CXR A;  4WYD A;  2C7T A;  2VMQ A;  2WKA A;  1G7X A;  1IAY A;  1M0N A;  3EZ1 A;  4R8D A;  4O6Z A;  4Q31 A;  1AY4 A;  3UWC A;  3A2B A;  2X5F A;  3E2Z B;  1OHY A;  4WP0 A;  5M4D A;  4RAE A;  1DJ9 A;  4XAU A;  3UE8 A;  1ZOD A;  2FN6 A;  1BJ4 A;  3BCA A;  3AV7 A;  4A0F A;  4H51 A;  1G4X A;  1B8G A;  3MAD A;  3EZS A;  4XJM A;  1MLZ A;  1I29 A;  4WXB A;  4KYO A;  2VMR A;  2AEV A;  1OHW A;  3E6G A;  1LC8 A;  3PD6 B;  4MSO A;  3PDB A;  1I41 A; 
#chains in the Genus database with same CATH topology
 1LC7 A;  3PGY A;  3WY7 A;  1QGN A;  1V72 A;  2BWN A;  5HDM A;  1OXP A;  2VMV A;  1J32 A;  1S07 A;  5EAA A;  5BJ3 A;  2ZYJ A;  4OCA A;  1KL1 A;  2OKJ A;  2VLF A;  1JF9 A;  3K28 A;  3LG0 A;  1ZOB A;  2YKY A;  2W7D A;  2PO3 A;  2CH1 A;  3FCR A;  3PA9 A;  2VGU A;  2AY4 A;  3NTJ A;  2Z1Y A;  3ASA A;  1TPL A;  2C44 A;  4BHD A;  1CQ8 A;  4H63 Q;  1BQD A;  3AEL A;  1VP4 A;  4WB0 B;  2AY9 A;  2EH6 A;  5LHA A;  2EPJ A;  4EFF A;  1IBJ A;  2G7J A;  1SFF A;  1CZE A;  1IVR A;  3E77 A;  2Z61 A;  3HMU A;  1S09 A;  3BV0 A;  3CBF A;  1AHF A;  2W7K A;  3AEJ C;  4E77 A;  2O7C A;  2Z20 A;  2FNI A;  5M46 A;  3EI5 A;  4IYO A;  3USF A;  4K05 A;  2AY6 A;  4ZDP A;  2OGA A;  4IXO A;  1IUG A;  3EIA A;  4WYE A;  2BKW A;  1XI9 A;  2VMY A;  3H9X A;  3PJ0 A;  1ELU A;  1C4K A;  1UKJ A;  2CST A;  2D63 A;  3AEN A;  5K8B A;  4DBC A;  3NX3 A;  3EI6 A;  1X29 A;  1AAW A;  1QJ5 A;  3DC1 A;  3QPG A;  4GE9 A;  4RJY A;  4F5I A;  2ZC0 A;  5F9S A;  3IF2 A;  2BIG A;  4IXZ A;  1LW4 A;  2ZY4 A;  1UU1 A;  3MAU A;  1X28 A;  5IWQ A;  1X2A A;  1BJO A;  2D61 A;  4LNL A;  1KKJ A;  3HL2 A;  2Z67 A;  3KE3 A;  2D65 A;  4EMY A;  4F5G A;  7AAT A;  2BYL A;  1T3I A;  3WGC A;  2W7L A;  4A6U A;  1ASC A;  1M32 A;  3FFH A;  4ADE A;  3K40 A;  1TOK A;  2CAN A;  2YRR A;  5FT8 A;  2JJF A;  2R2N A;  2W8T A;  2X5D A;  1PFF A;  3FVX A;  2E7U A;  1WST A;  4FL0 A;  1GC3 A;  5E5I A;  1TAR A;  2QSR A;  1DJE A;  2XH1 A;  3PAA A;  5D5S A;  3BWN A;  4QGR A;  4DGT A;  4W5K A;  1YIZ A;  1WYV B;  4K2M A;  4JE5 D;  1AMS A;  3I5T A;  1WYT A;  2EGY A;  3LWS A;  1MAQ A;  1C0N A;  4W1V A;  3TFT A;  3GBX A;  1PMM A;  4GE4 A;  2ZY2 A;  1OHV A;  8AAT A;  2CJD A;  3FDB A;  2WK7 A;  3RBF A;  3GZC A;  2G6W A;  3DR7 A;  4WD2 A;  3F9T A;  1FC4 A;  2NMP A;  3DR4 A;  3FZ8 A;  4W8I A;  4BA5 A;  1SZK A;  2DGK A;  3GZD A;  2AAT A;  4P3M A;  1BJW A;  4M2J A;  1D7V A;  4XJL A;  3NU8 A;  1TOG A;  3GET A;  3PPL A;  1Z7D A;  1DFO A;  4IXS A;  4ADD A;  5TF5 A;  1N8P A;  4XQ2 A;  2W7I A;  3DU4 A;  5EFS A;  4ADC A;  4P7Y A;  3IHJ A;  3JWB A;  3WKS A;  2QMA A;  1YJS A;  1B4X A;  3T32 A;  4Y0I A;  4OTL A;  3D6K A;  3VP6 A;  4JEY A;  4RKD A;  1IX7 A;  1B9I A;  3LY1 A;  1ASE A;  3OP7 A;  2W8U A;  2AY2 A;  1N31 A;  4W91 A;  3HLM A;  4RM1 A;  5J8Q A;  3QHX A;  2Z9U A;  3FKD A;  4ADB A;  4A0R A;  2VI9 A;  2JIS A;  3MAF A;  3ZRP A;  2OGE A;  3BN1 A;  2W8V A;  5G4J A;  3P6K A;  1AIB A;  2W7G A;  5EUN A;  4WYG A;  3CQ4 A;  1ARS A;  3LVJ A;  1KMJ A;  2E7J A;  1XEY A;  3N5M A;  3WGB A;  2HOY A;  1TAS A;  2YKV A;  4ZAH A;  3RUY A;  2VMU A;  2JJE A;  3G0T A;  4RIZ A;  2VMX A;  4CVQ A;  3N0L A;  4OMA A;  2TPL A;  4GDY A;  4R2N A;  1IJI A;  4WYC A;  2WK9 A;  1EJI A;  4J8L A;  1RVU A;  1ECX A;  2RFV A;  2Q7W A;  4ZLV A;  1M0P A;  3A9Z A;  1BKG A;  2FM1 A;  5EIG A;  2AEU A;  1CJ0 A;  4AO4 A;  1BJN A;  1W7M A;  1W7L A;  3LVK A;  1YAA A;  4R5Z A;  3RCH A;  3NYS A;  3P1T A;  3JZL A;  2JJG A;  3QBO A;  2BHX A;  2W8J A;  2HOR A;  4A72 A;  4B9B A;  3B8X A;  1MDO A;  1D2F A;  1MDX A;  1AKC A;  2EO5 A;  3MC6 C;  3LV2 A;  4Q75 A;  1IAX A;  3FRK A;  3E2Y A;  5FT6 A;  1YJZ A;  5DB5 A;  5BJ4 A;  2QLR A;  1V2D A;  2HZP A;  4WYA A;  4JE5 A;  2D7Y A;  2BYJ A;  4LNM A;  4PVF A;  1C9C A;  1YOO A;  3NRA A;  4LNJ A;  1CS1 A;  3EI7 A;  2BWP A;  2Z9V A;  3ELP A;  4E3Q A;  2AY1 A;  3EI9 A;  2BI9 A;  5HXX A;  3NUB A;  2CIN A;  1V2F A;  3BS8 A;  1N2T A;  4PFF A;  3I16 A;  3ZRR A;  1AKA A;  2D5Y A;  2JGT A;  3CAI A;  1JS3 A;  3MBB A;  4NOG A;  3VAX A;  1TOI A;  4F5J A;  2VMP A;  1GC0 A;  1AIC A;  1YNU A;  1G4V A;  3FQ7 A;  4MQQ A;  4M2K A;  2DOU A;  4WB0 A;  3HT4 A;  4B98 A;  2C0R A;  4ITG A;  1O69 A;  2C81 A;  4IYO B;  3RQ1 A;  1GC4 A;  4ZDL A;  4MQR A;  1ORD A;  4N0W A;  5G2Q A;  1ASG A;  1WKH A;  2HP1 A;  3AEM A;  2W7M A;  3VK2 A;  1BT4 A;  3HDO A;  3LVL B;  3AEN B;  4IX8 A;  3QI6 A;  1E5F A;  5EUE A;  3B46 A;  3HVY A;  4K2I A;  1MDZ A;  5G4I A;  4LC3 A;  4WLH A;  4F5M A;  3FDD A;  1B9H A;  1QZ9 A;  3JU7 A;  4ZAS A;  1G7W A;  2A1V A;  1QIR A;  4ZWV A;  1FG7 A;  3W1I A;  1BJO B;  2CTZ A;  3BC8 A;  3KGW A;  4CBS A;  1S06 A;  5FT4 A;  4F4E A;  3KKI A;  4KXK A;  4AZK A;  2Z9W A;  4TMR A;  2HP2 A;  2CB1 A;  2QA3 A;  4ZM3 A;  1KAF A;  1S08 A;  3FSL A;  3TFU A;  1J04 A;  1ART A;  4MKJ A;  3E2F A;  1M0O A;  1LW5 A;  5EQC A;  1I43 A;  1KMK A;  1AMR A;  1ASB A;  2CH2 A;  3N75 A;  4ZSY A;  3ZZK A;  2W7E A;  1SF2 A;  1Z3Z A;  4F5H A;  1M4N A;  5FT5 A;  1TOE A;  2WB6 A;  1CQ6 A;  3FZ6 A;  3NU7 A;  3ASB A;  1AKB A;  1U08 A;  2D7Z A;  3B1C A;  4AZJ A;  1WYT B;  2BI2 A;  4WXF A;  4XJO A;  4MKK A;  4CBR A;  3FVU A;  3VK3 A;  4MY5 A;  4F5K A;  2HOX A;  3M5U A;  1ARI A;  2VGT A;  1MLY A;  4PFN A;  1WYU B;  1AHG A;  1GDE A;  4FFC A;  1P3W A;  1D7U A;  1GC2 A;  3DRD A;  2D64 A;  1PMO A;  1WYV A;  3HBX A;  4A00 A;  4EB7 A;  2CJH A;  4TN4 A;  4UHO A;  1ARG A;  1QIT A;  2R5E A;  5DX5 A;  1GBN A;  1S0A A;  1IX6 A;  2E7I A;  5M49 A;  2VMN A;  2R5C A;  2FYF A;  2EZ2 A;  2R0T A;  3BWO A;  1LK9 A;  2YCN A;  2BIE A;  2ORD A;  1B5O A;  1MAP A;  2VMS A;  4BA4 A;  1X0M A;  1AJR A;  1RVY A;  3DXV A;  4OYT A;  3ACZ A;  4JF0 A;  3WKR A;  2YCT A;  2W8W A;  4JF1 A;  1W23 A;  1I48 A;  1GEX A;  3FZ7 A;  4A6R A;  5HHY A;  1CL1 A;  2O0R A;  1SVV A;  4ZSW A;  4UQV A;  1C7O A;  4A0H A;  4DQ6 A;  4E3R A;  3CQ5 A;  5EAV A;  4LW2 A;  1ELQ A;  2CFB A;  4RLG A;  1BQA A;  4JEV A;  2ZSM A;  4RIT A;  4L0O A;  4EU1 A;  2ZUK A;  1ASF A;  3PDX A;  4OT8 A;  1GEW A;  4A6T A;  1AHX A;  2XBN A;  2Z9X A;  1AJS B;  1M7Y A;  3AOW A;  3MAF B;  2DR1 A;  2AY3 A;  3GZD C;  4BQ0 A;  1OXO A;  2YKU A;  4GRX A;  5KTB A;  3KGX A;  1ZC9 A;  3JTX A;  2QBT A;  3NDN A;  4RKC A;  2AY8 A;  4I8A A;  4ITX A;  4HVK A;  3H14 A;  3L8A A;  3Q8N A;  4EB5 A;  1AY5 A;  4WXG A;  3E9K A;  2DKB A;  1AMA A;  1DGE A;  4GE7 A;  4XJP A;  1TAT A;  4JEZ A;  2DGL A;  1C7N A;  2EYQ A;  2V1P A;  2ZSL A;  3EUC A;  3VK4 A;  1GD9 A;  4ISY A;  3A9Y A;  1ASL A;  4RJ0 A;  1LC5 A;  1ARH A;  5EIG B;  4U1T A;  2GMU A;  3RCH B;  3K7Y A;  1FG3 A;  4Y0H A;  1RV4 A;  3E2Z A;  3AEP A;  1ASA A;  2CJG A;  2E54 A;  2D66 A;  5EUD A;  2VGS A;  3FTB A;  2X8U A;  1O61 A;  3PDB B;  1AHY A;  1ASN A;  1GCK A;  2YHK A;  3FVS A;  1JS6 A;  5E3K A;  3AEJ A;  3TAT A;  3EIB A;  1O62 A;  3II0 A;  1AIA A;  4OBU A;  1TOJ A;  3F6T A;  3GJU A;  2KFP A;  2HOZ A;  1B5P A;  1MGV A;  3PD6 A;  2HUU A;  4Q76 A;  3QN6 A;  4BMK A;  9AAT A;  4IW7 A;  1DKA A;  5E4Z A;  3RBL A;  1W3U A;  1KKP A;  3AOV A;  4HF8 A;  1AAM A;  1LS3 A;  1ASM A;  2VIB A;  2GQN A;  2VIA A;  4LW4 A;  3DXW A;  3A8U X;  5F8V A;  1JG8 A;  1SZS A;  3B1E A;  3L44 A;  4OBV A;  4ATQ A;  1RV3 A;  3TQX A;  2HUF A;  4ZDO A;  4IY7 A;  4CXQ A;  4K2B A;  2QB3 A;  3G8M A;  2O1B A;  2YOB A;  2X3L A;  3ZZJ A;  1ASD A;  2Z1Z A;  1E5E A;  1W7N A;  1M6S A;  2OQX A;  3ATH A;  4F5L A;  2BI1 A;  5LH9 A;  1DTY A;  1QJ3 A;  3F0H A;  2HUI A;  2OKK A;  1KL2 A;  2CY8 A;  2ZY3 A;  1AX4 A;  1EG5 A;  2JG2 A;  1CZC A;  2YKX A;  4TV7 A;  4XEW A;  5D95 A;  3FD0 A;  3GR9 A;  3CQ6 A;  1H1C A;  4MQP A;  2YCP A;  3DYD A;  4PIW A;  5G09 A;  3VOM A;  3FQA A;  3WCO A;  2F8J A;  1WKG A;  2AY5 A;  4KAM A;  1D7R A;  3UAK A;  4J5U A;  3B1D A;  3OKS A;  4UOY A;  1SZU A;  3N7N A;  1LKC A;  1QIS A;  2BI3 A;  2DKJ A;  2VLH A;  1D7S A;  3QM2 A;  5JAY A;  1YIY A;  3BCB A;  2W7F A;  2VMZ A;  3FFR A;  4WBT A;  2GB3 A;  4Q6R A;  4U2H A;  1BS0 A;  2ZJG A;  4XK1 A;  4AH3 A;  3LVM A;  4N0B A;  3MEB A;  3PIU A;  3NYT A;  1GEY A;  3WLX A;  3AEM C;  2JJH A;  3HQT A;  3FQ8 A;  4AO9 A;  2BI5 A;  3WX9 A;  3H7F A;  4R5F A;  2VGW A;  3NUI A;  4W1W A;  4E1O A;  3A9X A;  4F5F A;  1VEF A;  3ECD A;  3JWA A;  1EQB A;  2QB2 A;  3G7Q A;  2VMO A;  3W1J A;  1CQ7 A;  3AAT A;  2FNU A;  4ZM4 A;  2GSA A;  1VJO A;  1OAT A;  2PB2 A;  3N4R A;  1AY8 A;  2ZY5 A;  3WZF A;  1H0C A;  1CL2 A;  2BWO A;  4JEW A;  5G0A A;  5AX8 A;  4AOA A;  2VMW A;  1V2E A;  2WK8 A;  3GSB A;  2R5C B;  1PG8 A;  3BWN C;  1YJY A;  3RI6 A;  1WYU A;  5M4B A;  3ELE A;  5DJ1 A;  4WYF A;  1IX8 A;  1O4S A;  4ZWM A;  2FKI A;  4Y0D A;  2W7H A;  3NYU A;  1BW0 A;  1AHE A;  4GSA A;  2YRI A;  1SPA A;  3N4S A;  3R4T A;  4MGR A;  3GWP A;  3R9A A;  5G2P A;  1UU2 A;  4W1X A;  2VGZ A;  4WLJ A;  5C6U A;  4JEX A;  3W1H A;  3ZRQ A;  1M0Q A;  2EZ1 A;  2VI8 A;  3MKJ A;  2BIA A;  4GEB A;  1Y4I A;  2VGV A;  2ZP7 A;  3JW9 A;  5I92 A;  3DZZ A;  4ATP A;  3TCM A;  2VMT A;  3I4J A;  4UHN A;  3ISL A;  3QGU A;  4UHM A;  1AMQ A;  2OAT A;  1DGD A;  2V0Y A;  5DJ9 A;  3BCX A;  2W7J A;  3WCN A;  4A0G A;  2FQ6 A;  3NNK A;  1AJS A;  1UU0 A;  2GMS A;  2VYC A;  1DJU A;  2DGM A;  2PB0 A;  3MC6 A;  3BB8 A;  3EI8 A;  4OC9 A;  3COG A;  3AEO A;  1C7G A;  3DOD A;  3N4X A;  4M2M A;  2AY7 A;  4CXR A;  4WYD A;  2C7T A;  2VMQ A;  2WKA A;  1G7X A;  1IAY A;  1M0N A;  3EZ1 A;  4R8D A;  4O6Z A;  4Q31 A;  1AY4 A;  3UWC A;  3A2B A;  2X5F A;  3E2Z B;  1OHY A;  4WP0 A;  5M4D A;  4RAE A;  1DJ9 A;  4XAU A;  3UE8 A;  1ZOD A;  2FN6 A;  1BJ4 A;  3BCA A;  3AV7 A;  4A0F A;  4H51 A;  1G4X A;  1B8G A;  3MAD A;  3EZS A;  4XJM A;  1MLZ A;  1I29 A;  4WXB A;  4KYO A;  2VMR A;  2AEV A;  1OHW A;  3E6G A;  1LC8 A;  3PD6 B;  4MSO A;  3PDB A;  1I41 A; 
#chains in the Genus database with same CATH homology
 1LC7 A;  3PGY A;  3WY7 A;  1QGN A;  1V72 A;  2BWN A;  5HDM A;  1OXP A;  2VMV A;  1J32 A;  1S07 A;  5EAA A;  5BJ3 A;  2ZYJ A;  4OCA A;  1KL1 A;  2OKJ A;  2VLF A;  1JF9 A;  3K28 A;  3LG0 A;  1ZOB A;  2YKY A;  2W7D A;  2PO3 A;  2CH1 A;  3FCR A;  3PA9 A;  2VGU A;  2AY4 A;  3NTJ A;  2Z1Y A;  3ASA A;  1TPL A;  2C44 A;  4BHD A;  1CQ8 A;  4H63 Q;  1BQD A;  3AEL A;  1VP4 A;  4WB0 B;  2AY9 A;  2EH6 A;  5LHA A;  2EPJ A;  4EFF A;  1IBJ A;  2G7J A;  1SFF A;  1CZE A;  1IVR A;  3E77 A;  2Z61 A;  3HMU A;  1S09 A;  3BV0 A;  3CBF A;  1AHF A;  2W7K A;  3AEJ C;  4E77 A;  2O7C A;  2Z20 A;  2FNI A;  5M46 A;  3EI5 A;  4IYO A;  3USF A;  4K05 A;  2AY6 A;  4ZDP A;  2OGA A;  4IXO A;  1IUG A;  3EIA A;  4WYE A;  2BKW A;  1XI9 A;  2VMY A;  3H9X A;  3PJ0 A;  1ELU A;  1C4K A;  1UKJ A;  2CST A;  2D63 A;  3AEN A;  5K8B A;  4DBC A;  3NX3 A;  3EI6 A;  1X29 A;  1AAW A;  1QJ5 A;  3DC1 A;  3QPG A;  4GE9 A;  4RJY A;  4F5I A;  2ZC0 A;  5F9S A;  3IF2 A;  2BIG A;  4IXZ A;  1LW4 A;  2ZY4 A;  1UU1 A;  3MAU A;  1X28 A;  5IWQ A;  1X2A A;  1BJO A;  2D61 A;  4LNL A;  1KKJ A;  3HL2 A;  2Z67 A;  3KE3 A;  2D65 A;  4EMY A;  4F5G A;  7AAT A;  2BYL A;  1T3I A;  3WGC A;  2W7L A;  4A6U A;  1ASC A;  1M32 A;  3FFH A;  4ADE A;  3K40 A;  1TOK A;  2CAN A;  2YRR A;  5FT8 A;  2JJF A;  2R2N A;  2W8T A;  2X5D A;  1PFF A;  3FVX A;  2E7U A;  1WST A;  4FL0 A;  1GC3 A;  5E5I A;  1TAR A;  2QSR A;  1DJE A;  2XH1 A;  3PAA A;  5D5S A;  3BWN A;  4QGR A;  4DGT A;  4W5K A;  1YIZ A;  1WYV B;  4K2M A;  4JE5 D;  1AMS A;  3I5T A;  1WYT A;  2EGY A;  3LWS A;  1MAQ A;  1C0N A;  4W1V A;  3TFT A;  3GBX A;  1PMM A;  4GE4 A;  2ZY2 A;  1OHV A;  8AAT A;  2CJD A;  3FDB A;  2WK7 A;  3RBF A;  3GZC A;  2G6W A;  3DR7 A;  4WD2 A;  3F9T A;  1FC4 A;  2NMP A;  3DR4 A;  3FZ8 A;  4W8I A;  4BA5 A;  1SZK A;  2DGK A;  3GZD A;  2AAT A;  4P3M A;  1BJW A;  4M2J A;  1D7V A;  4XJL A;  3NU8 A;  1TOG A;  3GET A;  3PPL A;  1Z7D A;  1DFO A;  4IXS A;  4ADD A;  5TF5 A;  1N8P A;  4XQ2 A;  2W7I A;  3DU4 A;  5EFS A;  4ADC A;  4P7Y A;  3IHJ A;  3JWB A;  3WKS A;  2QMA A;  1YJS A;  1B4X A;  3T32 A;  4Y0I A;  4OTL A;  3D6K A;  3VP6 A;  4JEY A;  4RKD A;  1IX7 A;  1B9I A;  3LY1 A;  1ASE A;  3OP7 A;  2W8U A;  2AY2 A;  1N31 A;  4W91 A;  3HLM A;  4RM1 A;  5J8Q A;  3QHX A;  2Z9U A;  3FKD A;  4ADB A;  4A0R A;  2VI9 A;  2JIS A;  3MAF A;  3ZRP A;  2OGE A;  3BN1 A;  2W8V A;  5G4J A;  3P6K A;  1AIB A;  2W7G A;  5EUN A;  4WYG A;  3CQ4 A;  1ARS A;  3LVJ A;  1KMJ A;  2E7J A;  1XEY A;  3N5M A;  3WGB A;  2HOY A;  1TAS A;  2YKV A;  4ZAH A;  3RUY A;  2VMU A;  2JJE A;  3G0T A;  4RIZ A;  2VMX A;  4CVQ A;  3N0L A;  4OMA A;  2TPL A;  4GDY A;  4R2N A;  1IJI A;  4WYC A;  2WK9 A;  1EJI A;  4J8L A;  1RVU A;  1ECX A;  2RFV A;  2Q7W A;  4ZLV A;  1M0P A;  3A9Z A;  1BKG A;  2FM1 A;  5EIG A;  2AEU A;  1CJ0 A;  4AO4 A;  1BJN A;  1W7M A;  1W7L A;  3LVK A;  1YAA A;  4R5Z A;  3RCH A;  3NYS A;  3P1T A;  3JZL A;  2JJG A;  3QBO A;  2BHX A;  2W8J A;  2HOR A;  4A72 A;  4B9B A;  3B8X A;  1MDO A;  1D2F A;  1MDX A;  1AKC A;  2EO5 A;  3MC6 C;  3LV2 A;  4Q75 A;  1IAX A;  3FRK A;  3E2Y A;  5FT6 A;  1YJZ A;  5DB5 A;  5BJ4 A;  2QLR A;  1V2D A;  2HZP A;  4WYA A;  4JE5 A;  2D7Y A;  2BYJ A;  4LNM A;  4PVF A;  1C9C A;  1YOO A;  3NRA A;  4LNJ A;  1CS1 A;  3EI7 A;  2BWP A;  2Z9V A;  3ELP A;  4E3Q A;  2AY1 A;  3EI9 A;  2BI9 A;  5HXX A;  3NUB A;  2CIN A;  1V2F A;  3BS8 A;  1N2T A;  4PFF A;  3I16 A;  3ZRR A;  1AKA A;  2D5Y A;  2JGT A;  3CAI A;  1JS3 A;  3MBB A;  4NOG A;  3VAX A;  1TOI A;  4F5J A;  2VMP A;  1GC0 A;  1AIC A;  1YNU A;  1G4V A;  3FQ7 A;  4MQQ A;  4M2K A;  2DOU A;  4WB0 A;  3HT4 A;  4B98 A;  2C0R A;  4ITG A;  1O69 A;  2C81 A;  4IYO B;  3RQ1 A;  1GC4 A;  4ZDL A;  4MQR A;  1ORD A;  4N0W A;  5G2Q A;  1ASG A;  1WKH A;  2HP1 A;  3AEM A;  2W7M A;  3VK2 A;  1BT4 A;  3HDO A;  3LVL B;  3AEN B;  4IX8 A;  3QI6 A;  1E5F A;  5EUE A;  3B46 A;  3HVY A;  4K2I A;  1MDZ A;  5G4I A;  4LC3 A;  4WLH A;  4F5M A;  3FDD A;  1B9H A;  1QZ9 A;  3JU7 A;  4ZAS A;  1G7W A;  2A1V A;  1QIR A;  4ZWV A;  1FG7 A;  3W1I A;  1BJO B;  2CTZ A;  3BC8 A;  3KGW A;  4CBS A;  1S06 A;  5FT4 A;  4F4E A;  3KKI A;  4KXK A;  4AZK A;  2Z9W A;  4TMR A;  2HP2 A;  2CB1 A;  2QA3 A;  4ZM3 A;  1S08 A;  3FSL A;  3TFU A;  1J04 A;  1ART A;  4MKJ A;  3E2F A;  1M0O A;  1LW5 A;  5EQC A;  1I43 A;  1KMK A;  1AMR A;  1ASB A;  2CH2 A;  3N75 A;  4ZSY A;  3ZZK A;  2W7E A;  1SF2 A;  1Z3Z A;  4F5H A;  1M4N A;  5FT5 A;  1TOE A;  2WB6 A;  1CQ6 A;  3FZ6 A;  3NU7 A;  3ASB A;  1AKB A;  1U08 A;  2D7Z A;  3B1C A;  4AZJ A;  1WYT B;  2BI2 A;  4WXF A;  4XJO A;  4MKK A;  4CBR A;  3FVU A;  3VK3 A;  4MY5 A;  4F5K A;  2HOX A;  3M5U A;  1ARI A;  2VGT A;  1MLY A;  4PFN A;  1WYU B;  1AHG A;  1GDE A;  4FFC A;  1P3W A;  1D7U A;  1GC2 A;  3DRD A;  2D64 A;  1PMO A;  1WYV A;  3HBX A;  4A00 A;  4EB7 A;  2CJH A;  4TN4 A;  4UHO A;  1ARG A;  1QIT A;  2R5E A;  5DX5 A;  1GBN A;  1S0A A;  1IX6 A;  2E7I A;  5M49 A;  2VMN A;  2R5C A;  2FYF A;  2EZ2 A;  2R0T A;  3BWO A;  1LK9 A;  2YCN A;  2BIE A;  2ORD A;  1B5O A;  1MAP A;  2VMS A;  4BA4 A;  1X0M A;  1AJR A;  1RVY A;  3DXV A;  4OYT A;  3ACZ A;  4JF0 A;  3WKR A;  2YCT A;  2W8W A;  4JF1 A;  1W23 A;  1I48 A;  1GEX A;  3FZ7 A;  4A6R A;  5HHY A;  1CL1 A;  2O0R A;  1SVV A;  4ZSW A;  4UQV A;  1C7O A;  4A0H A;  4DQ6 A;  4E3R A;  3CQ5 A;  5EAV A;  4LW2 A;  1ELQ A;  2CFB A;  4RLG A;  1BQA A;  4JEV A;  2ZSM A;  4RIT A;  4L0O A;  4EU1 A;  2ZUK A;  1ASF A;  3PDX A;  4OT8 A;  1GEW A;  4A6T A;  1AHX A;  2XBN A;  2Z9X A;  1AJS B;  1M7Y A;  3AOW A;  3MAF B;  2DR1 A;  2AY3 A;  3GZD C;  4BQ0 A;  1OXO A;  2YKU A;  4GRX A;  5KTB A;  3KGX A;  1ZC9 A;  3JTX A;  2QBT A;  3NDN A;  4RKC A;  2AY8 A;  4I8A A;  4ITX A;  4HVK A;  3H14 A;  3L8A A;  3Q8N A;  4EB5 A;  1AY5 A;  4WXG A;  3E9K A;  2DKB A;  1AMA A;  1DGE A;  4GE7 A;  4XJP A;  1TAT A;  4JEZ A;  2DGL A;  1C7N A;  2EYQ A;  2V1P A;  2ZSL A;  3EUC A;  3VK4 A;  1GD9 A;  4ISY A;  3A9Y A;  1ASL A;  4RJ0 A;  1LC5 A;  1ARH A;  5EIG B;  4U1T A;  2GMU A;  3RCH B;  3K7Y A;  1FG3 A;  4Y0H A;  1RV4 A;  3E2Z A;  3AEP A;  1ASA A;  2CJG A;  2E54 A;  2D66 A;  5EUD A;  2VGS A;  3FTB A;  2X8U A;  1O61 A;  3PDB B;  1AHY A;  1ASN A;  1GCK A;  2YHK A;  3FVS A;  1JS6 A;  5E3K A;  3AEJ A;  3TAT A;  3EIB A;  1O62 A;  3II0 A;  1AIA A;  4OBU A;  1TOJ A;  3F6T A;  3GJU A;  2KFP A;  2HOZ A;  1B5P A;  1MGV A;  3PD6 A;  2HUU A;  4Q76 A;  3QN6 A;  4BMK A;  9AAT A;  4IW7 A;  1DKA A;  5E4Z A;  3RBL A;  1W3U A;  1KKP A;  3AOV A;  4HF8 A;  1AAM A;  1LS3 A;  1ASM A;  2VIB A;  2GQN A;  2VIA A;  4LW4 A;  3DXW A;  3A8U X;  5F8V A;  1JG8 A;  1SZS A;  3B1E A;  3L44 A;  4OBV A;  4ATQ A;  1RV3 A;  3TQX A;  2HUF A;  4ZDO A;  4IY7 A;  4CXQ A;  4K2B A;  2QB3 A;  3G8M A;  2O1B A;  2YOB A;  2X3L A;  3ZZJ A;  1ASD A;  2Z1Z A;  1E5E A;  1W7N A;  1M6S A;  2OQX A;  3ATH A;  4F5L A;  2BI1 A;  5LH9 A;  1DTY A;  1QJ3 A;  3F0H A;  2HUI A;  2OKK A;  1KL2 A;  2CY8 A;  2ZY3 A;  1AX4 A;  1EG5 A;  2JG2 A;  1CZC A;  2YKX A;  4TV7 A;  4XEW A;  5D95 A;  3FD0 A;  3GR9 A;  3CQ6 A;  1H1C A;  4MQP A;  2YCP A;  3DYD A;  4PIW A;  5G09 A;  3VOM A;  3FQA A;  3WCO A;  2F8J A;  1WKG A;  2AY5 A;  4KAM A;  1D7R A;  3UAK A;  4J5U A;  3B1D A;  3OKS A;  4UOY A;  1SZU A;  3N7N A;  1LKC A;  1QIS A;  2BI3 A;  2DKJ A;  2VLH A;  1D7S A;  3QM2 A;  5JAY A;  1YIY A;  3BCB A;  2W7F A;  2VMZ A;  3FFR A;  4WBT A;  2GB3 A;  4Q6R A;  4U2H A;  1BS0 A;  2ZJG A;  4XK1 A;  4AH3 A;  3LVM A;  4N0B A;  3MEB A;  3PIU A;  3NYT A;  1GEY A;  3WLX A;  3AEM C;  2JJH A;  3HQT A;  3FQ8 A;  4AO9 A;  2BI5 A;  3WX9 A;  3H7F A;  4R5F A;  2VGW A;  3NUI A;  4W1W A;  4E1O A;  3A9X A;  4F5F A;  1VEF A;  3ECD A;  3JWA A;  1EQB A;  2QB2 A;  3G7Q A;  2VMO A;  3W1J A;  1CQ7 A;  3AAT A;  2FNU A;  4ZM4 A;  2GSA A;  1VJO A;  1OAT A;  2PB2 A;  3N4R A;  1AY8 A;  2ZY5 A;  3WZF A;  1H0C A;  1CL2 A;  2BWO A;  4JEW A;  5G0A A;  5AX8 A;  4AOA A;  2VMW A;  1V2E A;  2WK8 A;  3GSB A;  2R5C B;  1PG8 A;  3BWN C;  1YJY A;  3RI6 A;  1WYU A;  5M4B A;  3ELE A;  5DJ1 A;  4WYF A;  1IX8 A;  1O4S A;  4ZWM A;  2FKI A;  4Y0D A;  2W7H A;  3NYU A;  1BW0 A;  1AHE A;  4GSA A;  2YRI A;  1SPA A;  3N4S A;  3R4T A;  4MGR A;  3GWP A;  3R9A A;  5G2P A;  1UU2 A;  4W1X A;  2VGZ A;  4WLJ A;  5C6U A;  4JEX A;  3W1H A;  3ZRQ A;  1M0Q A;  2EZ1 A;  2VI8 A;  3MKJ A;  2BIA A;  4GEB A;  1Y4I A;  2VGV A;  2ZP7 A;  3JW9 A;  5I92 A;  3DZZ A;  4ATP A;  3TCM A;  2VMT A;  3I4J A;  4UHN A;  3ISL A;  3QGU A;  4UHM A;  1AMQ A;  2OAT A;  1DGD A;  2V0Y A;  5DJ9 A;  3BCX A;  2W7J A;  3WCN A;  4A0G A;  2FQ6 A;  3NNK A;  1AJS A;  1UU0 A;  2GMS A;  2VYC A;  1DJU A;  2DGM A;  2PB0 A;  3MC6 A;  3BB8 A;  3EI8 A;  4OC9 A;  3COG A;  3AEO A;  1C7G A;  3DOD A;  3N4X A;  4M2M A;  2AY7 A;  4CXR A;  4WYD A;  2C7T A;  2VMQ A;  2WKA A;  1G7X A;  1IAY A;  1M0N A;  3EZ1 A;  4R8D A;  4O6Z A;  4Q31 A;  1AY4 A;  3UWC A;  3A2B A;  2X5F A;  3E2Z B;  1OHY A;  4WP0 A;  5M4D A;  4RAE A;  1DJ9 A;  4XAU A;  3UE8 A;  1ZOD A;  2FN6 A;  1BJ4 A;  3BCA A;  3AV7 A;  4A0F A;  4H51 A;  1G4X A;  1B8G A;  3MAD A;  3EZS A;  4XJM A;  1MLZ A;  1I29 A;  4WXB A;  4KYO A;  2VMR A;  2AEV A;  1OHW A;  3E6G A;  1LC8 A;  3PD6 B;  4MSO A;  3PDB A;  1I41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...