4N0WA

X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
416
structure length
416
Chain Sequence
SMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of a serine hydroxymethyltransferase from Burkholderia cenocepacia with covalently attached pyridoxal phosphate
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
molecule keywords Serine hydroxymethyltransferase
total genus 162
structure length 416
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0wA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4n0wA02
2VI9A 1OHYA 1MAQA 3FVXA 2AY7A 5EQCA 2AY5A 2C7TA 1I43A 2EH6A 1GC0A 2YHKA 3F9TA 4HVKA 2ZY5A 1I29A 5LHAA 4RITA 1GC4A 5I92A 2EZ2A 2R5CB 4BA4A 3BWNA 1WKHA 1BJOA 3KE3A 4OBUA 3EIAA 3JWAA 4JEXA 5J8QA 1WKGA 1IAXA 5TF5A 3B1CA 3H7FA 4R5ZA 2CH1A 3N0LA 4UHNA 2BHXA 1OXOA 4IYOB 3F0HA 2DKJA 2YKYA 3VK4A 4ZWVA 3IF2A 2WK8A 3PD6A 3VK2A 4GE4A 4NOGA 1H1CA 2CTZA 3NU8A 1C7OA 3UE8A 1DJ9A 4ZLVA 1O4SA 1QISA 1WYUA 1OHWA 2XBNA 2ZUKA 3DZZA 3FTBA 3HQTA 3JW9A 3LVKA 4JEZA 5F9SA 3NUBA 1M32A 3KGWA 1SZKA 4ZSYA 2DOUA 3NX3A 2WK9A 3W1IA 4W91A 1ARTA 1UU2A 3WKSA 4P7YA 2AY9A 3QI6A 4MQRA 2VMNA 4A6UA 4WP0A 2BWOA 1E5EA 5M4DA 4MKKA 3Q8NA 1CQ6A 1ASLA 2BYJA 3ASBA 2JJEA 4P3MA 3FZ7A 2VMZA 1DGDA 2E7IA 1BQAA 2BI9A 2VMXA 4OC9A 4RJYA 3VP6A 5FT8A 3EI5A 2O1BA 1SPAA 2JJGA 4MY5A 2FQ6A 2VYCA 4LNJA 1UKJA 4U2HA 5EIGB 3FKDA 2ZY4A 2YCNA 2BWNA 1AY5A 1GBNA 5JAYA 2W7DA 1TOGA 4XQ2A 4MSOA 1W7MA 3I16A 2JISA 5AX8A 1WYTB 3D6KA 1WYUB 1TOKA 2BI3A 4E3RA 3JZLA 3KKIA 4F5LA 2OKJA 1ASEA 3BC8A 4K2MA 3MADA 1W7NA 3PD6B 3QHXA 3TATA 1EJIA 5D5SA 3RUYA 3AV7A 4UOYA 2AEUA 1PFFA 2Z1ZA 2AY6A 4XK1A 4OMAA 4QGRA 2CJDA 3LWSA 3B1EA 1DJUA 3FDBA 3ISLA 2AY3A 4F5KA 4XJPA 1IX6A 1N8PA 2CH2A 1IBJA 1LKCA 1WSTA 3ACZA 3OP7A 4A0HA 2R5CA 3NDNA 1P3WA 5EUEA 2DGMA 3UWCA 3CAIA 4CBSA 3N5MA 2VGSA 4AOAA 2CANA 4ZDPA 4RAEA 3MC6A 2BI1A 3MAFA 3WY7A 1ARSA 1ZOBA 1JS6A 3AOWA 3MEBA 4TMRA 4K2BA 2D7ZA 4OBVA 4JE5A 3HMUA 4TN4A 2BIEA 3CQ6A 1TOIA 2BI2A 5DJ9A 4ADBA 2GMSA 7AATA 3NUIA 1ASCA 3LY1A 2VIBA 5E4ZA 2VLHA 2W7MA 1M7YA 9AATA 5HXXA 2W8VA 2OGEA 1V2DA 4WBTA 3H14A 2ZY2A 4Y0DA 1AHGA 1GC3A 4Q31A 4OT8A 2VMQA 1V2FA 1WYTA 1LW5A 3FD0A 1AIAA 5E5IA 2JG2A 3QPGA 2WKAA 5M4BA 1BJNA 2CJGA 5D95A 1BQDA 3A9ZA 2QMAA 1GEYA 2DGLA 2HOXA 2NMPA 3AEPA 2VGVA 3EUCA 3ELPA 3FRKA 5EIGA 4A0RA 3B8XA 3EI6A 3RQ1A 3WCOA 4B98A 3AEJA 5M49A 4M2MA 2JJHA 1B4XA 3BCAA 3KGXA 1AKBA 1GCKA 1XEYA 4E3QA 2X5FA 1AAMA 1ARIA 1LW4A 3EZSA 4WLJA 5G2PA 5IWQA 1M0QA 3ZRPA 2ZJGA 4LNLA 2FNUA 5F8VA 2Z9XA 4ZAHA 4RLGA 1KKPA 4JF1A 2VGUA 4BQ0A 3CQ4A 1C4KA 4O6ZA 2G6WA 4U1TA 1AHXA 1G4VA 1CZCA 1S0AA 1YOOA 3N75A 1G7WA 3LVLB 3WLXA 1VP4A 2C0RA 1KKJA 2VI8A 1AY4A 3E2FA 1YAAA 2GMUA 3GBXA 4UQVA 4N0BA 2Z20A 4ISYA 3L8AA 1PMMA 1AKCA 2E7JA 3WKRA 3VAXA 3AEJC 4N0WA 4A0GA 1QJ5A 4BHDA 4CXRA 3CQ5A 4KAMA 1EG5A 1ECXA 1TATA 2Z9UA 3FVSA 2VLFA 1J32A 3TFTA 3FQAA 2WK7A 3BV0A 2QLRA 1IVRA 2XH1A 5K8BA 3AOVA 3DYDA 3PDBB 1ASAA 3A2BA 1D7SA 3HL2A 2ZY3A 1JS3A 4IY7A 2HP2A 4EFFA 2YOBA 2D64A 1CQ7A 1AIBA 3WGCA 2X5DA 2Z67A 3EI9A 2D65A 4DBCA 1IJIA 1MGVA 2VMTA 2YCPA 1AICA 4ZWMA 2DKBA 3W1JA 3A9XA 4E77A 1OHVA 2YKXA 3RCHA 2CY8A 2JJFA 4RJ0A 4W1WA 3HVYA 1SF2A 2VGTA 1YJYA 2Z9WA 2AEVA 3AENB 2W7JA 1CQ8A 2ORDA 1KL2A 1AMRA 1MAPA 4Q75A 1TARA 1KMKA 2QA3A 5FT5A 1I48A 4EU1A 1AHFA 3LVMA 2D63A 3PA9A 1TOJA 4OTLA 5E3KA 4AO9A 4RIZA 2QB2A 4OCAA 3ECDA 3FZ8A 1IUGA 3AEMC 4WXGA 2ZP7A 1YIYA 4W1VA 2GQNA 4ZM4A 4XJMA 4W1XA 3PIUA 1QGNA 1S09A 3FFRA 3HBXA 4UHMA 3DXVA 2R0TA 2ZC0A 2AY1A 4L0OA 2BIAA 2YKUA 3FFHA 4KXKA 3LG0A 3RI6A 2VMYA 3WX9A 4GRXA 2HOZA 3E77A 1M6SA 4UHOA 1AHYA 4A6RA 3TQXA 4WXBA 5G0AA 3FDDA 4ZDOA 2W7KA 3I4JA 5HDMA 4XAUA 1KMJA 1ASNA 3B1DA 2FM1A 1G4XA 1S07A 3AEOA 4ADEA 4JF0A 1IX8A 3MAFB 1CJ0A 3LVJA 3FCRA 1SZUA 2Z9VA 3FQ7A 8AATA 2BKWA 3AELA 4LNMA 5BJ3A 2OGAA 2CJHA 1YJZA 3MBBA 1C7NA 2AATA 4WXFA 1TPLA 3E9KA 3G0TA 4F5JA 1VEFA 4GEBA 4EB5A 1AX4A 2CSTA 5FT6A 1VJOA 1O62A 1E5FA 3EIBA 2BI5A 1YNUA 3CBFA 5M46A 3NRAA 4GE9A 3DRDA 4IW7A 4JEWA 1G7XA 3DC1A 3PJ0A 2EGYA 2HUFA 2VMPA 1PMOA 3QBOA 2YRRA 2W7LA 1RVUA 4E1OA 3A8UX 4GDYA 4OYTA 3TCMA 3TFUA 5DJ1A 3ZRQA 3COGA 4IXZA 1M4NA 4KYOA 1AMQA 4WB0A 4IXOA 1DTYA 3BN1A 4R8DA 1MDOA 1S08A 2CB1A 3NTJA 4BA5A 1FG3A 4AO4A 4ADDA 1SFFA 1V2EA 4A72A 4DGTA 3L44A 4CBRA 4FFCA 4ITXA 1AJSB 1DGEA 4PFFA 3DODA 4WD2A 3IHJA 3NYTA 4W5KA 4TV7A 4WYGA 1N31A 2PB0A 1D2FA 1LK9A 2W7HA 1YJSA 3FSLA 1AJSA 1U08A 2HORA 5EUDA 4DQ6A 2EZ1A 4JEYA 4Q76A 1D7RA 1C9CA 2W8WA 2C44A 4MKJA 1O61A 4ATPA 1C0NA 4WB0B 3NNKA 4MGRA 1IX7A 4WLHA 1ZODA 3BS8A 2OATA 3EI8A 2JGTA 2BWPA 4PIWA 4RKCA 2EPJA 2V0YA 3JU7A 4R2NA 1RV3A 2CFBA 2AY4A 3GWPA 1S06A 1YIZA 3GZDC 3PGYA 5FT4A 1MDXA 1X28A 1AHEA 3I5TA 4XEWA 5BJ4A 5HHYA 2DGKA 1OXPA 2FNIA 1TASA 1BS0A 3GSBA 2DR1A 2X8UA 3MC6C 2VMRA 1Y4IA 4XJLA 2GB3A 3E2YA 5DB5A 4MQPA 4AZJA 1GEXA 5EAVA 1M0PA 3BCBA 1DFOA 1ORDA 1BJOB 4Y0HA 2Z1YA 3OKSA 3GJUA 1B9HA 3HDOA 4LW4A 1LC8A 4ZASA 1ARHA 3B46A 1ASGA 2FN6A 2FYFA 3DR7A 4XJOA 1X0MA 2QBTA 1W23A 2TPLA 1O69A 2ZYJA 1X2AA 4GE7A 3WCNA 3NU7A 4WYCA 5EAAA 3QGUA 1UU0A 1B5PA 3GZDA 1BJ4A 1D7UA 3GETA 3M5UA 3PPLA 3ZZJA 1UU1A 2CINA 2VGZA 4WYAA 1B8GA 2VMUA 3FVUA 1FC4A 1W3UA 3RBLA 1ELQA 2W8JA 3P1TA 5G09A 3DXWA 4F5IA 2HZPA 2W7GA 1V72A 1Z3ZA 3K7YA 3E6GA 3ASAA 1ELUA 2BIGA 3HT4A 3RBFA 2D5YA 4K2IA 1D7VA 2W8TA 5G4IA 3K40A 2PB2A 4MQQA 2VGWA 3PAAA 1AAWA 4H51A 4M2JA 2HUUA 1JG8A 4GSAA 1Z7DA 3EZ1A 1BJWA 2V1PA 5LH9A 3A9YA 4EMYA 4Y0IA 2C81A 2HOYA 2D61A 2Q7WA 3DU4A 1B5OA 1WYVA 2EO5A 4A0FA 4IX8A 2AY8A 1DKAA 1ASBA 1GD9A 4LW2A 3UAKA 1WYVB 2R2NA 2PO3A 2VMWA 3BWOA 4AZKA 1MDZA 1T3IA 2D7YA 3BWNC 3ELEA 4J8LA 4F5GA 1TOEA 2ZSMA 2O7CA 2D66A 3NYUA 2BYLA 1AMAA 3FQ8A 4EB7A 4ZDLA 3QM2A 3ZZKA 3F6TA 2HP1A 1GDEA 4CXQA 2Z61A 1DJEA 5G2QA 1QITA 2YKVA 1ARGA 4AH3A 4F5HA 1ASFA 1ASDA 4RM1A 3VK3A 1IAYA 3FZ6A 1AKAA 4WYFA 3USFA 3PDBA 2X3LA 1X29A 1JF9A 3R9AA 1H0CA 5G4JA 4ZM3A 1QJ3A 3AEMA 3P6KA 3GR9A 5EFSA 3WZFA 3AENA 3EI7A 4F5FA 1RV4A 1BW0A 1SZSA 2VIAA 3BB8A 3DR4A 2HUIA 1AY8A 1W7LA 4F5MA 3RCHB 2E7UA 4LC3A 4WYEA 3T32A 1BKGA 1GEWA 1FG7A 2W7FA 1XI9A 3JWBA 1LC7A 2ZSLA 4ADCA 2E54A 1CZEA 1N2TA 1OATA 2QB3A 3K28A 1J04A 3PDXA 2O0RA 4A00A 3JTXA 1BT4A 1MLZA 2VMOA 4F4EA 4I8AA 5C6UA 4W8IA 4ZSWA 1MLYA 2OQXA 4FL0A 3ZRRA 3QN6A 4R5FA 4B9BA 4RKDA 3MKJA 2OKKA 2RFVA 3E2ZA 1PG8A 1CL1A 2YRIA 3WGBA 4CVQA 1B9IA 1RVYA 1M0OA 5DX5A 2W7IA 5EUNA 1LC5A 3NYSA 1GC2A 2VMSA 4HF8A 4WYDA 3II0A 1CS1A 3GZCA 3LV2A 2YCTA 1KL1A 4JEVA 1QZ9A 3R4TA 4A6TA 3G8MA 3BCXA 2F8JA 2GSAA 2AY2A 2W7EA 3AATA 1AMSA 4J5UA 4ATQA 3MAUA 1ASMA 1EQBA 2VMVA 4M2KA 1C7GA 1LS3A 4PVFA 4PFNA 3ATHA 4BMKA 2R5EA 4IXSA 3W1HA 3VOMA 3E2ZB 1SVVA 1ZC9A 1CL2A 1QIRA 1M0NA 2W8UA 3G7QA 1AJRA 1I41A 3HLMA 4IYOA 4JE5D 4ITGA 4Q6RA
chains in the Genus database with same CATH superfamily
2VI9A 1OHYA 1MAQA 3FVXA 2AY7A 5EQCA 2AY5A 2C7TA 1I43A 2EH6A 1GC0A 2YHKA 3F9TA 4HVKA 2ZY5A 1I29A 5LHAA 4RITA 1GC4A 5I92A 2EZ2A 2R5CB 4BA4A 3BWNA 1WKHA 1BJOA 3KE3A 4OBUA 3EIAA 3JWAA 4JEXA 5J8QA 1WKGA 1IAXA 5TF5A 3B1CA 3H7FA 4R5ZA 2CH1A 3N0LA 4UHNA 2BHXA 1OXOA 4IYOB 3F0HA 2DKJA 2YKYA 3VK4A 4ZWVA 3IF2A 2WK8A 3PD6A 3VK2A 4GE4A 4NOGA 1H1CA 2CTZA 3NU8A 1C7OA 3UE8A 1DJ9A 4ZLVA 1O4SA 1QISA 1WYUA 1OHWA 2XBNA 2ZUKA 3DZZA 3FTBA 3HQTA 3JW9A 3LVKA 4JEZA 5F9SA 3NUBA 1M32A 3KGWA 1SZKA 4ZSYA 2DOUA 3NX3A 2WK9A 3W1IA 4W91A 1ARTA 1UU2A 3WKSA 4P7YA 2AY9A 3QI6A 4MQRA 2VMNA 4A6UA 4WP0A 2BWOA 1E5EA 5M4DA 4MKKA 3Q8NA 1CQ6A 3N4SA 1ASLA 2BYJA 3ASBA 2JJEA 4P3MA 3FZ7A 2VMZA 1DGDA 2E7IA 1BQAA 2BI9A 2VMXA 4OC9A 4RJYA 3VP6A 5FT8A 3EI5A 2O1BA 1SPAA 2JJGA 4MY5A 2FQ6A 2VYCA 4LNJA 1UKJA 4U2HA 5EIGB 3FKDA 2ZY4A 2YCNA 2BWNA 1AY5A 1GBNA 5JAYA 2W7DA 1TOGA 2A1VA 4XQ2A 4MSOA 1W7MA 3I16A 2JISA 5AX8A 1WYTB 3D6KA 1WYUB 1TOKA 2BI3A 4E3RA 3JZLA 3KKIA 4F5LA 2OKJA 1ASEA 3BC8A 4K2MA 3MADA 1W7NA 3PD6B 3QHXA 3TATA 1EJIA 5D5SA 3RUYA 3AV7A 4UOYA 2AEUA 1PFFA 2Z1ZA 2AY6A 4XK1A 4OMAA 4QGRA 2CJDA 3LWSA 3B1EA 1DJUA 3FDBA 3ISLA 2AY3A 4F5KA 4XJPA 1IX6A 1N8PA 2CH2A 1IBJA 1LKCA 1WSTA 3ACZA 3OP7A 4A0HA 2R5CA 3NDNA 1P3WA 5EUEA 2DGMA 3UWCA 3CAIA 4CBSA 3N5MA 2VGSA 4AOAA 2CANA 4ZDPA 4RAEA 3MC6A 2BI1A 3H9XA 3MAFA 3WY7A 1ARSA 1ZOBA 1JS6A 3AOWA 3MEBA 4TMRA 4K2BA 2D7ZA 4OBVA 4H63Q 4JE5A 3HMUA 4TN4A 2BIEA 3CQ6A 1TOIA 2QSRA 2BI2A 5DJ9A 4ADBA 2GMSA 7AATA 3NUIA 1ASCA 3LY1A 2VIBA 5E4ZA 2VLHA 2W7MA 1M7YA 9AATA 5HXXA 2W8VA 2OGEA 1V2DA 4WBTA 3H14A 2ZY2A 4Y0DA 1AHGA 1GC3A 4Q31A 4OT8A 2VMQA 1V2FA 1WYTA 1LW5A 3FD0A 1AIAA 5E5IA 2JG2A 3QPGA 2WKAA 5M4BA 1BJNA 2CJGA 5D95A 1BQDA 3A9ZA 2QMAA 1GEYA 2DGLA 2HOXA 2NMPA 3AEPA 2VGVA 3EUCA 3ELPA 3FRKA 5EIGA 4A0RA 3B8XA 3EI6A 3RQ1A 3WCOA 4B98A 3AEJA 5M49A 4M2MA 2JJHA 1B4XA 3BCAA 3KGXA 1AKBA 1GCKA 1XEYA 4E3QA 2X5FA 1AAMA 1ARIA 1LW4A 3EZSA 4WLJA 5G2PA 5IWQA 1M0QA 3ZRPA 2ZJGA 4LNLA 2FNUA 5F8VA 2Z9XA 2WB6A 4ZAHA 4RLGA 1KKPA 4JF1A 2VGUA 4BQ0A 3CQ4A 1C4KA 4O6ZA 2G6WA 4U1TA 5KTBA 1AHXA 1G4VA 1CZCA 1S0AA 1YOOA 3N75A 1G7WA 3LVLB 3WLXA 1VP4A 2C0RA 1KKJA 2VI8A 1AY4A 3E2FA 1YAAA 2GMUA 3GBXA 4UQVA 4N0BA 2Z20A 4ISYA 3L8AA 1PMMA 1AKCA 2E7JA 3WKRA 3VAXA 3AEJC 4N0WA 4A0GA 1QJ5A 4BHDA 4CXRA 3CQ5A 4KAMA 1EG5A 1ECXA 1TATA 2Z9UA 3FVSA 2VLFA 1J32A 3TFTA 3FQAA 2WK7A 3BV0A 2QLRA 1IVRA 2XH1A 5K8BA 3AOVA 3DYDA 3PDBB 1ASAA 3A2BA 1D7SA 3HL2A 4K05A 2ZY3A 1JS3A 4IY7A 2HP2A 4EFFA 2YOBA 2D64A 1CQ7A 1AIBA 3WGCA 2X5DA 2Z67A 3EI9A 2D65A 4DBCA 1IJIA 1MGVA 2VMTA 2YCPA 1AICA 4ZWMA 2DKBA 3W1JA 3A9XA 4E77A 1OHVA 2YKXA 3RCHA 2CY8A 2JJFA 4RJ0A 4W1WA 3HVYA 1SF2A 2VGTA 1YJYA 2Z9WA 2AEVA 3AENB 2W7JA 1CQ8A 2ORDA 1KL2A 1AMRA 1MAPA 4Q75A 1TARA 1KMKA 2QA3A 5FT5A 1I48A 4EU1A 1AHFA 3LVMA 2D63A 3PA9A 1TOJA 4OTLA 5E3KA 4AO9A 4RIZA 2QB2A 4OCAA 3ECDA 3FZ8A 1IUGA 3AEMC 1KAFA 4WXGA 2ZP7A 1YIYA 4W1VA 2GQNA 4ZM4A 4XJMA 4W1XA 3PIUA 1QGNA 1S09A 3FFRA 3HBXA 4UHMA 3DXVA 2R0TA 2ZC0A 2AY1A 4L0OA 2BIAA 2YKUA 3FFHA 4KXKA 3LG0A 3RI6A 2VMYA 3WX9A 4GRXA 2HOZA 3E77A 1M6SA 4UHOA 1AHYA 4A6RA 3TQXA 4WXBA 5G0AA 3FDDA 4ZDOA 2W7KA 3I4JA 5HDMA 4XAUA 1KMJA 1ASNA 3B1DA 2FM1A 2G7JA 1G4XA 1S07A 3AEOA 4ADEA 4JF0A 1IX8A 3MAFB 1CJ0A 3LVJA 3FCRA 1SZUA 2Z9VA 3FQ7A 8AATA 2BKWA 3AELA 4LNMA 5BJ3A 2OGAA 2CJHA 1YJZA 3MBBA 1C7NA 2AATA 4WXFA 1TPLA 3E9KA 3G0TA 4F5JA 1VEFA 4GEBA 2KFPA 4EB5A 1AX4A 2CSTA 5FT6A 1VJOA 1O62A 1E5FA 3EIBA 2BI5A 1YNUA 3CBFA 5M46A 3NRAA 4GE9A 3DRDA 4IW7A 4JEWA 1G7XA 3DC1A 3PJ0A 2EGYA 2HUFA 2VMPA 1PMOA 3QBOA 2YRRA 2W7LA 1RVUA 4E1OA 3A8UX 4GDYA 4OYTA 3TCMA 3TFUA 5DJ1A 3ZRQA 3COGA 4IXZA 2FKIA 1M4NA 4KYOA 1AMQA 4WB0A 4IXOA 1DTYA 3BN1A 4R8DA 1MDOA 1S08A 2CB1A 3NTJA 4BA5A 1FG3A 4AO4A 4ADDA 1SFFA 1V2EA 4A72A 4DGTA 3L44A 4CBRA 4FFCA 4ITXA 1AJSB 1DGEA 4PFFA 3DODA 4WD2A 3IHJA 3NYTA 4W5KA 4TV7A 4WYGA 1N31A 2PB0A 1D2FA 1LK9A 2W7HA 1YJSA 3FSLA 3N4RA 1AJSA 1U08A 2HORA 5EUDA 4DQ6A 2EZ1A 4JEYA 4Q76A 1D7RA 1C9CA 2W8WA 2C44A 4MKJA 1O61A 4ATPA 1C0NA 4WB0B 3NNKA 4MGRA 1IX7A 4WLHA 1ZODA 3BS8A 2OATA 3EI8A 2JGTA 2BWPA 4PIWA 4RKCA 2EPJA 2V0YA 3JU7A 4R2NA 1RV3A 2CFBA 2AY4A 3GWPA 1S06A 1YIZA 3GZDC 3PGYA 5FT4A 1MDXA 1X28A 1AHEA 3I5TA 4XEWA 5BJ4A 5HHYA 2DGKA 1OXPA 2FNIA 1TASA 1BS0A 3GSBA 2DR1A 2X8UA 3MC6C 2VMRA 1Y4IA 4XJLA 2GB3A 3E2YA 5DB5A 4MQPA 4AZJA 1GEXA 5EAVA 1M0PA 3BCBA 1DFOA 1ORDA 1BJOB 4Y0HA 2Z1YA 3OKSA 3GJUA 1B9HA 3HDOA 4LW4A 1LC8A 4ZASA 1ARHA 3B46A 1ASGA 2FN6A 2FYFA 3DR7A 4XJOA 1X0MA 2QBTA 1W23A 2TPLA 1O69A 2ZYJA 1X2AA 4GE7A 3WCNA 3NU7A 4WYCA 5EAAA 3QGUA 1UU0A 1B5PA 3GZDA 1BJ4A 1D7UA 3GETA 3M5UA 3PPLA 3ZZJA 1UU1A 2CINA 2VGZA 4WYAA 1B8GA 2VMUA 3FVUA 1FC4A 1W3UA 3RBLA 1ELQA 2W8JA 3P1TA 5G09A 3DXWA 4F5IA 2HZPA 2W7GA 1V72A 1Z3ZA 3K7YA 3E6GA 3ASAA 1ELUA 2BIGA 3HT4A 3RBFA 2D5YA 4K2IA 1D7VA 2W8TA 5G4IA 3K40A 2PB2A 4MQQA 2VGWA 3PAAA 1AAWA 4H51A 4M2JA 2HUUA 1JG8A 4GSAA 1Z7DA 3EZ1A 1BJWA 2V1PA 5LH9A 3A9YA 4EMYA 4Y0IA 2C81A 2HOYA 2D61A 2Q7WA 3DU4A 1B5OA 1WYVA 2EO5A 4A0FA 4IX8A 2AY8A 1DKAA 1ASBA 1GD9A 4LW2A 3UAKA 1WYVB 2R2NA 2PO3A 2VMWA 3BWOA 4AZKA 1MDZA 1T3IA 2D7YA 3BWNC 3ELEA 4J8LA 4F5GA 1TOEA 2ZSMA 2O7CA 2D66A 3NYUA 2BYLA 1AMAA 3FQ8A 4EB7A 4ZDLA 3QM2A 3ZZKA 3F6TA 2HP1A 1GDEA 4CXQA 2Z61A 1DJEA 5G2QA 1QITA 2YKVA 1ARGA 4AH3A 4F5HA 1ASFA 1ASDA 4RM1A 3VK3A 1IAYA 3FZ6A 1AKAA 4WYFA 3USFA 3PDBA 2X3LA 1X29A 1JF9A 3R9AA 1H0CA 3N7NA 5G4JA 4ZM3A 1QJ3A 3AEMA 3P6KA 3GR9A 5EFSA 3WZFA 3AENA 3EI7A 4F5FA 1RV4A 1BW0A 1SZSA 2VIAA 3BB8A 3DR4A 2HUIA 1AY8A 1W7LA 4F5MA 3RCHB 2E7UA 2EYQA 4LC3A 4WYEA 3T32A 1BKGA 1GEWA 1FG7A 2W7FA 1XI9A 3JWBA 1LC7A 2ZSLA 4ADCA 2E54A 1CZEA 1N2TA 1OATA 2QB3A 3K28A 1J04A 3PDXA 2O0RA 4A00A 3JTXA 1BT4A 1MLZA 2VMOA 4F4EA 4I8AA 5C6UA 4W8IA 4ZSWA 1MLYA 2OQXA 4FL0A 3ZRRA 3QN6A 4R5FA 4B9BA 4RKDA 3MKJA 2OKKA 2RFVA 3E2ZA 1PG8A 1CL1A 2YRIA 3WGBA 4CVQA 1B9IA 1RVYA 1M0OA 5DX5A 2W7IA 5EUNA 1LC5A 3NYSA 1GC2A 2VMSA 4HF8A 4WYDA 3II0A 1CS1A 3GZCA 3LV2A 3N4XA 2YCTA 1KL1A 4JEVA 1QZ9A 3R4TA 4A6TA 3G8MA 3BCXA 2F8JA 2GSAA 2AY2A 2W7EA 3AATA 1AMSA 4J5UA 4ATQA 3MAUA 1ASMA 1EQBA 2VMVA 4M2KA 1C7GA 1LS3A 4PVFA 4PFNA 3ATHA 4BMKA 2R5EA 4IXSA 3W1HA 3VOMA 3E2ZB 1SVVA 1ZC9A 1CL2A 1QIRA 1M0NA 2W8UA 3G7QA 1AJRA 1I41A 3HLMA 4IYOA 4JE5D 4ITGA 4Q6RA
chains in the Genus database with same CATH topology
2VI9A 1OHYA 1MAQA 3FVXA 2AY7A 5EQCA 2AY5A 2C7TA 1I43A 2EH6A 1GC0A 2YHKA 3F9TA 4HVKA 2ZY5A 1I29A 5LHAA 4RITA 1GC4A 5I92A 2EZ2A 2R5CB 4BA4A 3BWNA 1WKHA 1BJOA 3KE3A 4OBUA 3EIAA 3JWAA 4JEXA 5J8QA 1WKGA 1IAXA 5TF5A 3B1CA 3H7FA 4R5ZA 2CH1A 3N0LA 4UHNA 2BHXA 1OXOA 4IYOB 3F0HA 2DKJA 2YKYA 3VK4A 4ZWVA 3IF2A 2WK8A 3PD6A 3VK2A 4GE4A 4NOGA 1H1CA 2CTZA 3NU8A 1C7OA 3UE8A 1DJ9A 4ZLVA 1O4SA 1QISA 1WYUA 1OHWA 2XBNA 2ZUKA 3DZZA 3FTBA 3HQTA 3JW9A 3LVKA 4JEZA 5F9SA 3NUBA 1M32A 3KGWA 1SZKA 4ZSYA 2DOUA 3NX3A 2WK9A 3W1IA 4W91A 1ARTA 1UU2A 3WKSA 4P7YA 2AY9A 3QI6A 4MQRA 2VMNA 4A6UA 4WP0A 2BWOA 1E5EA 5M4DA 4MKKA 3Q8NA 1CQ6A 3N4SA 1ASLA 2BYJA 3ASBA 2JJEA 4P3MA 3FZ7A 2VMZA 1DGDA 2E7IA 1BQAA 2BI9A 2VMXA 4OC9A 4RJYA 3VP6A 5FT8A 3EI5A 2O1BA 1SPAA 2JJGA 4MY5A 2FQ6A 2VYCA 4LNJA 1UKJA 4U2HA 5EIGB 3FKDA 2ZY4A 2YCNA 2BWNA 1AY5A 1GBNA 5JAYA 2W7DA 1TOGA 2A1VA 4XQ2A 4MSOA 1W7MA 3I16A 2JISA 5AX8A 1WYTB 3D6KA 1WYUB 1TOKA 2BI3A 4E3RA 3JZLA 3KKIA 4F5LA 2OKJA 1ASEA 3BC8A 4K2MA 3MADA 1W7NA 3PD6B 3QHXA 3TATA 1EJIA 5D5SA 3RUYA 3AV7A 4UOYA 2AEUA 1PFFA 2Z1ZA 2AY6A 4XK1A 4OMAA 4QGRA 2CJDA 3LWSA 3B1EA 1DJUA 3FDBA 3ISLA 2AY3A 4F5KA 4XJPA 1IX6A 1N8PA 2CH2A 1IBJA 1LKCA 1WSTA 3ACZA 3OP7A 4A0HA 2R5CA 3NDNA 1P3WA 5EUEA 2DGMA 3UWCA 3CAIA 4CBSA 3N5MA 2VGSA 4AOAA 2CANA 4ZDPA 4RAEA 3MC6A 2BI1A 3H9XA 3MAFA 3WY7A 1ARSA 1ZOBA 1JS6A 3AOWA 3MEBA 4TMRA 4K2BA 2D7ZA 4OBVA 4H63Q 4JE5A 3HMUA 4TN4A 2BIEA 3CQ6A 1TOIA 2QSRA 2BI2A 5DJ9A 4ADBA 2GMSA 7AATA 3NUIA 1ASCA 3LY1A 2VIBA 5E4ZA 2VLHA 2W7MA 1M7YA 9AATA 5HXXA 2W8VA 2OGEA 1V2DA 4WBTA 3H14A 2ZY2A 4Y0DA 1AHGA 1GC3A 4Q31A 4OT8A 2VMQA 1V2FA 1WYTA 1LW5A 3FD0A 1AIAA 5E5IA 2JG2A 3QPGA 2WKAA 5M4BA 1BJNA 2CJGA 5D95A 1BQDA 3A9ZA 2QMAA 1GEYA 2DGLA 2HOXA 2NMPA 3AEPA 2VGVA 3EUCA 3ELPA 3FRKA 5EIGA 4A0RA 3B8XA 3EI6A 3RQ1A 3WCOA 4B98A 3AEJA 5M49A 4M2MA 2JJHA 1B4XA 3BCAA 3KGXA 1AKBA 1GCKA 1XEYA 4E3QA 2X5FA 1AAMA 1ARIA 1LW4A 3EZSA 4WLJA 5G2PA 5IWQA 1M0QA 3ZRPA 2ZJGA 4LNLA 2FNUA 5F8VA 2Z9XA 2WB6A 4ZAHA 4RLGA 1KKPA 4JF1A 2VGUA 4BQ0A 3CQ4A 1C4KA 4O6ZA 2G6WA 4U1TA 5KTBA 1AHXA 1G4VA 1CZCA 1S0AA 1YOOA 3N75A 1G7WA 3LVLB 3WLXA 1VP4A 2C0RA 1KKJA 2VI8A 1AY4A 3E2FA 1YAAA 2GMUA 3GBXA 4UQVA 4N0BA 2Z20A 4ISYA 3L8AA 1PMMA 1AKCA 2E7JA 3WKRA 3VAXA 3AEJC 4N0WA 4A0GA 1QJ5A 4BHDA 4CXRA 3CQ5A 4KAMA 1EG5A 1ECXA 1TATA 2Z9UA 3FVSA 2VLFA 1J32A 3TFTA 3FQAA 2WK7A 3BV0A 2QLRA 1IVRA 2XH1A 5K8BA 3AOVA 3DYDA 3PDBB 1ASAA 3A2BA 1D7SA 3HL2A 4K05A 2ZY3A 1JS3A 4IY7A 2HP2A 4EFFA 2YOBA 2D64A 1CQ7A 1AIBA 3WGCA 2X5DA 2Z67A 3EI9A 2D65A 4DBCA 1IJIA 1MGVA 2VMTA 2YCPA 1AICA 4ZWMA 2DKBA 3W1JA 3A9XA 4E77A 1OHVA 2YKXA 3RCHA 2CY8A 2JJFA 4RJ0A 4W1WA 3HVYA 1SF2A 2VGTA 1YJYA 2Z9WA 2AEVA 3AENB 2W7JA 1CQ8A 2ORDA 1KL2A 1AMRA 1MAPA 4Q75A 1TARA 1KMKA 2QA3A 5FT5A 1I48A 4EU1A 1AHFA 3LVMA 2D63A 3PA9A 1TOJA 4OTLA 5E3KA 4AO9A 4RIZA 2QB2A 4OCAA 3ECDA 3FZ8A 1IUGA 3AEMC 4WXGA 2ZP7A 1YIYA 4W1VA 2GQNA 4ZM4A 4XJMA 4W1XA 3PIUA 1QGNA 1S09A 3FFRA 3HBXA 4UHMA 3DXVA 2R0TA 2ZC0A 2AY1A 4L0OA 2BIAA 2YKUA 3FFHA 4KXKA 3LG0A 3RI6A 2VMYA 3WX9A 4GRXA 2HOZA 3E77A 1M6SA 4UHOA 1AHYA 4A6RA 3TQXA 4WXBA 5G0AA 3FDDA 4ZDOA 2W7KA 3I4JA 5HDMA 4XAUA 1KMJA 1ASNA 3B1DA 2FM1A 2G7JA 1G4XA 1S07A 3AEOA 4ADEA 4JF0A 1IX8A 3MAFB 1CJ0A 3LVJA 3FCRA 1SZUA 2Z9VA 3FQ7A 8AATA 2BKWA 3AELA 4LNMA 5BJ3A 2OGAA 2CJHA 1YJZA 3MBBA 1C7NA 2AATA 4WXFA 1TPLA 3E9KA 3G0TA 4F5JA 1VEFA 4GEBA 2KFPA 4EB5A 1AX4A 2CSTA 5FT6A 1VJOA 1O62A 1E5FA 3EIBA 2BI5A 1YNUA 3CBFA 5M46A 3NRAA 4GE9A 3DRDA 4IW7A 4JEWA 1G7XA 3DC1A 3PJ0A 2EGYA 2HUFA 2VMPA 1PMOA 3QBOA 2YRRA 2W7LA 1RVUA 4E1OA 3A8UX 4GDYA 4OYTA 3TCMA 3TFUA 5DJ1A 3ZRQA 3COGA 4IXZA 2FKIA 1M4NA 4KYOA 1AMQA 4WB0A 4IXOA 1DTYA 3BN1A 4R8DA 1MDOA 1S08A 2CB1A 3NTJA 4BA5A 1FG3A 4AO4A 4ADDA 1SFFA 1V2EA 4A72A 4DGTA 3L44A 4CBRA 4FFCA 4ITXA 1AJSB 1DGEA 4PFFA 3DODA 4WD2A 3IHJA 3NYTA 4W5KA 4TV7A 4WYGA 1N31A 2PB0A 1D2FA 1LK9A 2W7HA 1YJSA 3FSLA 3N4RA 1AJSA 1U08A 2HORA 5EUDA 4DQ6A 2EZ1A 4JEYA 4Q76A 1D7RA 1C9CA 2W8WA 2C44A 4MKJA 1O61A 4ATPA 1C0NA 4WB0B 3NNKA 4MGRA 1IX7A 4WLHA 1ZODA 3BS8A 2OATA 3EI8A 2JGTA 2BWPA 4PIWA 4RKCA 2EPJA 2V0YA 3JU7A 4R2NA 1RV3A 2CFBA 2AY4A 3GWPA 1S06A 1YIZA 3GZDC 3PGYA 5FT4A 1MDXA 1X28A 1AHEA 3I5TA 4XEWA 5BJ4A 5HHYA 2DGKA 1OXPA 2FNIA 1TASA 1BS0A 3GSBA 2DR1A 2X8UA 3MC6C 2VMRA 1Y4IA 4XJLA 2GB3A 3E2YA 5DB5A 4MQPA 4AZJA 1GEXA 5EAVA 1M0PA 3BCBA 1DFOA 1ORDA 1BJOB 4Y0HA 2Z1YA 3OKSA 3GJUA 1B9HA 3HDOA 4LW4A 1LC8A 4ZASA 1ARHA 3B46A 1ASGA 2FN6A 2FYFA 3DR7A 4XJOA 1X0MA 2QBTA 1W23A 2TPLA 1O69A 2ZYJA 1X2AA 4GE7A 3WCNA 3NU7A 4WYCA 5EAAA 3QGUA 1UU0A 1B5PA 3GZDA 1BJ4A 1D7UA 3GETA 3M5UA 3PPLA 3ZZJA 1UU1A 2CINA 2VGZA 4WYAA 1B8GA 2VMUA 3FVUA 1FC4A 1W3UA 3RBLA 1ELQA 2W8JA 3P1TA 5G09A 3DXWA 4F5IA 2HZPA 2W7GA 1V72A 1Z3ZA 3K7YA 3E6GA 3ASAA 1ELUA 2BIGA 3HT4A 3RBFA 2D5YA 4K2IA 1D7VA 2W8TA 5G4IA 3K40A 2PB2A 4MQQA 2VGWA 3PAAA 1AAWA 4H51A 4M2JA 2HUUA 1JG8A 4GSAA 1Z7DA 3EZ1A 1BJWA 2V1PA 5LH9A 3A9YA 4EMYA 4Y0IA 2C81A 2HOYA 2D61A 2Q7WA 3DU4A 1B5OA 1WYVA 2EO5A 4A0FA 4IX8A 2AY8A 1DKAA 1ASBA 1GD9A 4LW2A 3UAKA 1WYVB 2R2NA 2PO3A 2VMWA 3BWOA 4AZKA 1MDZA 1T3IA 2D7YA 3BWNC 3ELEA 4J8LA 4F5GA 1TOEA 2ZSMA 2O7CA 2D66A 3NYUA 2BYLA 1AMAA 3FQ8A 4EB7A 4ZDLA 3QM2A 3ZZKA 3F6TA 2HP1A 1GDEA 4CXQA 2Z61A 1DJEA 5G2QA 1QITA 2YKVA 1ARGA 4AH3A 4F5HA 1ASFA 1ASDA 4RM1A 3VK3A 1IAYA 3FZ6A 1AKAA 4WYFA 3USFA 3PDBA 2X3LA 1X29A 1JF9A 3R9AA 1H0CA 3N7NA 5G4JA 4ZM3A 1QJ3A 3AEMA 3P6KA 3GR9A 5EFSA 3WZFA 3AENA 3EI7A 4F5FA 1RV4A 1BW0A 1SZSA 2VIAA 3BB8A 3DR4A 2HUIA 1AY8A 1W7LA 4F5MA 3RCHB 2E7UA 2EYQA 4LC3A 4WYEA 3T32A 1BKGA 1GEWA 1FG7A 2W7FA 1XI9A 3JWBA 1LC7A 2ZSLA 4ADCA 2E54A 1CZEA 1N2TA 1OATA 2QB3A 3K28A 1J04A 3PDXA 2O0RA 4A00A 3JTXA 1BT4A 1MLZA 2VMOA 4F4EA 4I8AA 5C6UA 4W8IA 4ZSWA 1MLYA 2OQXA 4FL0A 3ZRRA 3QN6A 4R5FA 4B9BA 4RKDA 3MKJA 2OKKA 2RFVA 3E2ZA 1PG8A 1CL1A 2YRIA 3WGBA 4CVQA 1B9IA 1RVYA 1M0OA 5DX5A 2W7IA 5EUNA 1LC5A 3NYSA 1GC2A 2VMSA 4HF8A 4WYDA 3II0A 1CS1A 3GZCA 3LV2A 3N4XA 2YCTA 1KL1A 4JEVA 1QZ9A 3R4TA 4A6TA 3G8MA 3BCXA 2F8JA 2GSAA 2AY2A 2W7EA 3AATA 1AMSA 4J5UA 4ATQA 3MAUA 1ASMA 1EQBA 2VMVA 4M2KA 1C7GA 1LS3A 4PVFA 4PFNA 3ATHA 4BMKA 2R5EA 4IXSA 3W1HA 3VOMA 3E2ZB 1SVVA 1ZC9A 1CL2A 1QIRA 1M0NA 2W8UA 3G7QA 1AJRA 1I41A 3HLMA 4IYOA 4JE5D 4ITGA 4Q6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VI9 A;  1OHY A;  1MAQ A;  3FVX A;  2AY7 A;  5EQC A;  2AY5 A;  2C7T A;  1I43 A;  2EH6 A;  1GC0 A;  2YHK A;  3F9T A;  4HVK A;  2ZY5 A;  1I29 A;  5LHA A;  4RIT A;  1GC4 A;  5I92 A;  2EZ2 A;  2R5C B;  4BA4 A;  3BWN A;  1WKH A;  1BJO A;  3KE3 A;  4OBU A;  3EIA A;  3JWA A;  4JEX A;  5J8Q A;  1WKG A;  1IAX A;  5TF5 A;  3B1C A;  3H7F A;  4R5Z A;  2CH1 A;  3N0L A;  4UHN A;  2BHX A;  1OXO A;  4IYO B;  3F0H A;  2DKJ A;  2YKY A;  3VK4 A;  4ZWV A;  3IF2 A;  2WK8 A;  3PD6 A;  3VK2 A;  4GE4 A;  4NOG A;  1H1C A;  2CTZ A;  3NU8 A;  1C7O A;  3UE8 A;  1DJ9 A;  4ZLV A;  1O4S A;  1QIS A;  1WYU A;  1OHW A;  2XBN A;  2ZUK A;  3DZZ A;  3FTB A;  3HQT A;  3JW9 A;  3LVK A;  4JEZ A;  5F9S A;  3NUB A;  1M32 A;  3KGW A;  1SZK A;  4ZSY A;  2DOU A;  3NX3 A;  2WK9 A;  3W1I A;  4W91 A;  1ART A;  1UU2 A;  3WKS A;  4P7Y A;  2AY9 A;  3QI6 A;  4MQR A;  2VMN A;  4A6U A;  4WP0 A;  2BWO A;  1E5E A;  5M4D A;  4MKK A;  3Q8N A;  1CQ6 A;  1ASL A;  2BYJ A;  3ASB A;  2JJE A;  4P3M A;  3FZ7 A;  2VMZ A;  1DGD A;  2E7I A;  1BQA A;  2BI9 A;  2VMX A;  4OC9 A;  4RJY A;  3VP6 A;  5FT8 A;  3EI5 A;  2O1B A;  1SPA A;  2JJG A;  4MY5 A;  2FQ6 A;  2VYC A;  4LNJ A;  1UKJ A;  4U2H A;  5EIG B;  3FKD A;  2ZY4 A;  2YCN A;  2BWN A;  1AY5 A;  1GBN A;  5JAY A;  2W7D A;  1TOG A;  4XQ2 A;  4MSO A;  1W7M A;  3I16 A;  2JIS A;  5AX8 A;  1WYT B;  3D6K A;  1WYU B;  1TOK A;  2BI3 A;  4E3R A;  3JZL A;  3KKI A;  4F5L A;  2OKJ A;  1ASE A;  3BC8 A;  4K2M A;  3MAD A;  1W7N A;  3PD6 B;  3QHX A;  3TAT A;  1EJI A;  5D5S A;  3RUY A;  3AV7 A;  4UOY A;  2AEU A;  1PFF A;  2Z1Z A;  2AY6 A;  4XK1 A;  4OMA A;  4QGR A;  2CJD A;  3LWS A;  3B1E A;  1DJU A;  3FDB A;  3ISL A;  2AY3 A;  4F5K A;  4XJP A;  1IX6 A;  1N8P A;  2CH2 A;  1IBJ A;  1LKC A;  1WST A;  3ACZ A;  3OP7 A;  4A0H A;  2R5C A;  3NDN A;  1P3W A;  5EUE A;  2DGM A;  3UWC A;  3CAI A;  4CBS A;  3N5M A;  2VGS A;  4AOA A;  2CAN A;  4ZDP A;  4RAE A;  3MC6 A;  2BI1 A;  3MAF A;  3WY7 A;  1ARS A;  1ZOB A;  1JS6 A;  3AOW A;  3MEB A;  4TMR A;  4K2B A;  2D7Z A;  4OBV A;  4JE5 A;  3HMU A;  4TN4 A;  2BIE A;  3CQ6 A;  1TOI A;  2BI2 A;  5DJ9 A;  4ADB A;  2GMS A;  7AAT A;  3NUI A;  1ASC A;  3LY1 A;  2VIB A;  5E4Z A;  2VLH A;  2W7M A;  1M7Y A;  9AAT A;  5HXX A;  2W8V A;  2OGE A;  1V2D A;  4WBT A;  3H14 A;  2ZY2 A;  4Y0D A;  1AHG A;  1GC3 A;  4Q31 A;  4OT8 A;  2VMQ A;  1V2F A;  1WYT A;  1LW5 A;  3FD0 A;  1AIA A;  5E5I A;  2JG2 A;  3QPG A;  2WKA A;  5M4B A;  1BJN A;  2CJG A;  5D95 A;  1BQD A;  3A9Z A;  2QMA A;  1GEY A;  2DGL A;  2HOX A;  2NMP A;  3AEP A;  2VGV A;  3EUC A;  3ELP A;  3FRK A;  5EIG A;  4A0R A;  3B8X A;  3EI6 A;  3RQ1 A;  3WCO A;  4B98 A;  3AEJ A;  5M49 A;  4M2M A;  2JJH A;  1B4X A;  3BCA A;  3KGX A;  1AKB A;  1GCK A;  1XEY A;  4E3Q A;  2X5F A;  1AAM A;  1ARI A;  1LW4 A;  3EZS A;  4WLJ A;  5G2P A;  5IWQ A;  1M0Q A;  3ZRP A;  2ZJG A;  4LNL A;  2FNU A;  5F8V A;  2Z9X A;  4ZAH A;  4RLG A;  1KKP A;  4JF1 A;  2VGU A;  4BQ0 A;  3CQ4 A;  1C4K A;  4O6Z A;  2G6W A;  4U1T A;  1AHX A;  1G4V A;  1CZC A;  1S0A A;  1YOO A;  3N75 A;  1G7W A;  3LVL B;  3WLX A;  1VP4 A;  2C0R A;  1KKJ A;  2VI8 A;  1AY4 A;  3E2F A;  1YAA A;  2GMU A;  3GBX A;  4UQV A;  4N0B A;  2Z20 A;  4ISY A;  3L8A A;  1PMM A;  1AKC A;  2E7J A;  3WKR A;  3VAX A;  3AEJ C;  4N0W A;  4A0G A;  1QJ5 A;  4BHD A;  4CXR A;  3CQ5 A;  4KAM A;  1EG5 A;  1ECX A;  1TAT A;  2Z9U A;  3FVS A;  2VLF A;  1J32 A;  3TFT A;  3FQA A;  2WK7 A;  3BV0 A;  2QLR A;  1IVR A;  2XH1 A;  5K8B A;  3AOV A;  3DYD A;  3PDB B;  1ASA A;  3A2B A;  1D7S A;  3HL2 A;  2ZY3 A;  1JS3 A;  4IY7 A;  2HP2 A;  4EFF A;  2YOB A;  2D64 A;  1CQ7 A;  1AIB A;  3WGC A;  2X5D A;  2Z67 A;  3EI9 A;  2D65 A;  4DBC A;  1IJI A;  1MGV A;  2VMT A;  2YCP A;  1AIC A;  4ZWM A;  2DKB A;  3W1J A;  3A9X A;  4E77 A;  1OHV A;  2YKX A;  3RCH A;  2CY8 A;  2JJF A;  4RJ0 A;  4W1W A;  3HVY A;  1SF2 A;  2VGT A;  1YJY A;  2Z9W A;  2AEV A;  3AEN B;  2W7J A;  1CQ8 A;  2ORD A;  1KL2 A;  1AMR A;  1MAP A;  4Q75 A;  1TAR A;  1KMK A;  2QA3 A;  5FT5 A;  1I48 A;  4EU1 A;  1AHF A;  3LVM A;  2D63 A;  3PA9 A;  1TOJ A;  4OTL A;  5E3K A;  4AO9 A;  4RIZ A;  2QB2 A;  4OCA A;  3ECD A;  3FZ8 A;  1IUG A;  3AEM C;  4WXG A;  2ZP7 A;  1YIY A;  4W1V A;  2GQN A;  4ZM4 A;  4XJM A;  4W1X A;  3PIU A;  1QGN A;  1S09 A;  3FFR A;  3HBX A;  4UHM A;  3DXV A;  2R0T A;  2ZC0 A;  2AY1 A;  4L0O A;  2BIA A;  2YKU A;  3FFH A;  4KXK A;  3LG0 A;  3RI6 A;  2VMY A;  3WX9 A;  4GRX A;  2HOZ A;  3E77 A;  1M6S A;  4UHO A;  1AHY A;  4A6R A;  3TQX A;  4WXB A;  5G0A A;  3FDD A;  4ZDO A;  2W7K A;  3I4J A;  5HDM A;  4XAU A;  1KMJ A;  1ASN A;  3B1D A;  2FM1 A;  1G4X A;  1S07 A;  3AEO A;  4ADE A;  4JF0 A;  1IX8 A;  3MAF B;  1CJ0 A;  3LVJ A;  3FCR A;  1SZU A;  2Z9V A;  3FQ7 A;  8AAT A;  2BKW A;  3AEL A;  4LNM A;  5BJ3 A;  2OGA A;  2CJH A;  1YJZ A;  3MBB A;  1C7N A;  2AAT A;  4WXF A;  1TPL A;  3E9K A;  3G0T A;  4F5J A;  1VEF A;  4GEB A;  4EB5 A;  1AX4 A;  2CST A;  5FT6 A;  1VJO A;  1O62 A;  1E5F A;  3EIB A;  2BI5 A;  1YNU A;  3CBF A;  5M46 A;  3NRA A;  4GE9 A;  3DRD A;  4IW7 A;  4JEW A;  1G7X A;  3DC1 A;  3PJ0 A;  2EGY A;  2HUF A;  2VMP A;  1PMO A;  3QBO A;  2YRR A;  2W7L A;  1RVU A;  4E1O A;  3A8U X;  4GDY A;  4OYT A;  3TCM A;  3TFU A;  5DJ1 A;  3ZRQ A;  3COG A;  4IXZ A;  1M4N A;  4KYO A;  1AMQ A;  4WB0 A;  4IXO A;  1DTY A;  3BN1 A;  4R8D A;  1MDO A;  1S08 A;  2CB1 A;  3NTJ A;  4BA5 A;  1FG3 A;  4AO4 A;  4ADD A;  1SFF A;  1V2E A;  4A72 A;  4DGT A;  3L44 A;  4CBR A;  4FFC A;  4ITX A;  1AJS B;  1DGE A;  4PFF A;  3DOD A;  4WD2 A;  3IHJ A;  3NYT A;  4W5K A;  4TV7 A;  4WYG A;  1N31 A;  2PB0 A;  1D2F A;  1LK9 A;  2W7H A;  1YJS A;  3FSL A;  1AJS A;  1U08 A;  2HOR A;  5EUD A;  4DQ6 A;  2EZ1 A;  4JEY A;  4Q76 A;  1D7R A;  1C9C A;  2W8W A;  2C44 A;  4MKJ A;  1O61 A;  4ATP A;  1C0N A;  4WB0 B;  3NNK A;  4MGR A;  1IX7 A;  4WLH A;  1ZOD A;  3BS8 A;  2OAT A;  3EI8 A;  2JGT A;  2BWP A;  4PIW A;  4RKC A;  2EPJ A;  2V0Y A;  3JU7 A;  4R2N A;  1RV3 A;  2CFB A;  2AY4 A;  3GWP A;  1S06 A;  1YIZ A;  3GZD C;  3PGY A;  5FT4 A;  1MDX A;  1X28 A;  1AHE A;  3I5T A;  4XEW A;  5BJ4 A;  5HHY A;  2DGK A;  1OXP A;  2FNI A;  1TAS A;  1BS0 A;  3GSB A;  2DR1 A;  2X8U A;  3MC6 C;  2VMR A;  1Y4I A;  4XJL A;  2GB3 A;  3E2Y A;  5DB5 A;  4MQP A;  4AZJ A;  1GEX A;  5EAV A;  1M0P A;  3BCB A;  1DFO A;  1ORD A;  1BJO B;  4Y0H A;  2Z1Y A;  3OKS A;  3GJU A;  1B9H A;  3HDO A;  4LW4 A;  1LC8 A;  4ZAS A;  1ARH A;  3B46 A;  1ASG A;  2FN6 A;  2FYF A;  3DR7 A;  4XJO A;  1X0M A;  2QBT A;  1W23 A;  2TPL A;  1O69 A;  2ZYJ A;  1X2A A;  4GE7 A;  3WCN A;  3NU7 A;  4WYC A;  5EAA A;  3QGU A;  1UU0 A;  1B5P A;  3GZD A;  1BJ4 A;  1D7U A;  3GET A;  3M5U A;  3PPL A;  3ZZJ A;  1UU1 A;  2CIN A;  2VGZ A;  4WYA A;  1B8G A;  2VMU A;  3FVU A;  1FC4 A;  1W3U A;  3RBL A;  1ELQ A;  2W8J A;  3P1T A;  5G09 A;  3DXW A;  4F5I A;  2HZP A;  2W7G A;  1V72 A;  1Z3Z A;  3K7Y A;  3E6G A;  3ASA A;  1ELU A;  2BIG A;  3HT4 A;  3RBF A;  2D5Y A;  4K2I A;  1D7V A;  2W8T A;  5G4I A;  3K40 A;  2PB2 A;  4MQQ A;  2VGW A;  3PAA A;  1AAW A;  4H51 A;  4M2J A;  2HUU A;  1JG8 A;  4GSA A;  1Z7D A;  3EZ1 A;  1BJW A;  2V1P A;  5LH9 A;  3A9Y A;  4EMY A;  4Y0I A;  2C81 A;  2HOY A;  2D61 A;  2Q7W A;  3DU4 A;  1B5O A;  1WYV A;  2EO5 A;  4A0F A;  4IX8 A;  2AY8 A;  1DKA A;  1ASB A;  1GD9 A;  4LW2 A;  3UAK A;  1WYV B;  2R2N A;  2PO3 A;  2VMW A;  3BWO A;  4AZK A;  1MDZ A;  1T3I A;  2D7Y A;  3BWN C;  3ELE A;  4J8L A;  4F5G A;  1TOE A;  2ZSM A;  2O7C A;  2D66 A;  3NYU A;  2BYL A;  1AMA A;  3FQ8 A;  4EB7 A;  4ZDL A;  3QM2 A;  3ZZK A;  3F6T A;  2HP1 A;  1GDE A;  4CXQ A;  2Z61 A;  1DJE A;  5G2Q A;  1QIT A;  2YKV A;  1ARG A;  4AH3 A;  4F5H A;  1ASF A;  1ASD A;  4RM1 A;  3VK3 A;  1IAY A;  3FZ6 A;  1AKA A;  4WYF A;  3USF A;  3PDB A;  2X3L A;  1X29 A;  1JF9 A;  3R9A A;  1H0C A;  5G4J A;  4ZM3 A;  1QJ3 A;  3AEM A;  3P6K A;  3GR9 A;  5EFS A;  3WZF A;  3AEN A;  3EI7 A;  4F5F A;  1RV4 A;  1BW0 A;  1SZS A;  2VIA A;  3BB8 A;  3DR4 A;  2HUI A;  1AY8 A;  1W7L A;  4F5M A;  3RCH B;  2E7U A;  4LC3 A;  4WYE A;  3T32 A;  1BKG A;  1GEW A;  1FG7 A;  2W7F A;  1XI9 A;  3JWB A;  1LC7 A;  2ZSL A;  4ADC A;  2E54 A;  1CZE A;  1N2T A;  1OAT A;  2QB3 A;  3K28 A;  1J04 A;  3PDX A;  2O0R A;  4A00 A;  3JTX A;  1BT4 A;  1MLZ A;  2VMO A;  4F4E A;  4I8A A;  5C6U A;  4W8I A;  4ZSW A;  1MLY A;  2OQX A;  4FL0 A;  3ZRR A;  3QN6 A;  4R5F A;  4B9B A;  4RKD A;  3MKJ A;  2OKK A;  2RFV A;  3E2Z A;  1PG8 A;  1CL1 A;  2YRI A;  3WGB A;  4CVQ A;  1B9I A;  1RVY A;  1M0O A;  5DX5 A;  2W7I A;  5EUN A;  1LC5 A;  3NYS A;  1GC2 A;  2VMS A;  4HF8 A;  4WYD A;  3II0 A;  1CS1 A;  3GZC A;  3LV2 A;  2YCT A;  1KL1 A;  4JEV A;  1QZ9 A;  3R4T A;  4A6T A;  3G8M A;  3BCX A;  2F8J A;  2GSA A;  2AY2 A;  2W7E A;  3AAT A;  1AMS A;  4J5U A;  4ATQ A;  3MAU A;  1ASM A;  1EQB A;  2VMV A;  4M2K A;  1C7G A;  1LS3 A;  4PVF A;  4PFN A;  3ATH A;  4BMK A;  2R5E A;  4IXS A;  3W1H A;  3VOM A;  3E2Z B;  1SVV A;  1ZC9 A;  1CL2 A;  1QIR A;  1M0N A;  2W8U A;  3G7Q A;  1AJR A;  1I41 A;  3HLM A;  4IYO A;  4JE5 D;  4ITG A;  4Q6R A; 
#chains in the Genus database with same CATH topology
 2VI9 A;  1OHY A;  1MAQ A;  3FVX A;  2AY7 A;  5EQC A;  2AY5 A;  2C7T A;  1I43 A;  2EH6 A;  1GC0 A;  2YHK A;  3F9T A;  4HVK A;  2ZY5 A;  1I29 A;  5LHA A;  4RIT A;  1GC4 A;  5I92 A;  2EZ2 A;  2R5C B;  4BA4 A;  3BWN A;  1WKH A;  1BJO A;  3KE3 A;  4OBU A;  3EIA A;  3JWA A;  4JEX A;  5J8Q A;  1WKG A;  1IAX A;  5TF5 A;  3B1C A;  3H7F A;  4R5Z A;  2CH1 A;  3N0L A;  4UHN A;  2BHX A;  1OXO A;  4IYO B;  3F0H A;  2DKJ A;  2YKY A;  3VK4 A;  4ZWV A;  3IF2 A;  2WK8 A;  3PD6 A;  3VK2 A;  4GE4 A;  4NOG A;  1H1C A;  2CTZ A;  3NU8 A;  1C7O A;  3UE8 A;  1DJ9 A;  4ZLV A;  1O4S A;  1QIS A;  1WYU A;  1OHW A;  2XBN A;  2ZUK A;  3DZZ A;  3FTB A;  3HQT A;  3JW9 A;  3LVK A;  4JEZ A;  5F9S A;  3NUB A;  1M32 A;  3KGW A;  1SZK A;  4ZSY A;  2DOU A;  3NX3 A;  2WK9 A;  3W1I A;  4W91 A;  1ART A;  1UU2 A;  3WKS A;  4P7Y A;  2AY9 A;  3QI6 A;  4MQR A;  2VMN A;  4A6U A;  4WP0 A;  2BWO A;  1E5E A;  5M4D A;  4MKK A;  3Q8N A;  1CQ6 A;  3N4S A;  1ASL A;  2BYJ A;  3ASB A;  2JJE A;  4P3M A;  3FZ7 A;  2VMZ A;  1DGD A;  2E7I A;  1BQA A;  2BI9 A;  2VMX A;  4OC9 A;  4RJY A;  3VP6 A;  5FT8 A;  3EI5 A;  2O1B A;  1SPA A;  2JJG A;  4MY5 A;  2FQ6 A;  2VYC A;  4LNJ A;  1UKJ A;  4U2H A;  5EIG B;  3FKD A;  2ZY4 A;  2YCN A;  2BWN A;  1AY5 A;  1GBN A;  5JAY A;  2W7D A;  1TOG A;  2A1V A;  4XQ2 A;  4MSO A;  1W7M A;  3I16 A;  2JIS A;  5AX8 A;  1WYT B;  3D6K A;  1WYU B;  1TOK A;  2BI3 A;  4E3R A;  3JZL A;  3KKI A;  4F5L A;  2OKJ A;  1ASE A;  3BC8 A;  4K2M A;  3MAD A;  1W7N A;  3PD6 B;  3QHX A;  3TAT A;  1EJI A;  5D5S A;  3RUY A;  3AV7 A;  4UOY A;  2AEU A;  1PFF A;  2Z1Z A;  2AY6 A;  4XK1 A;  4OMA A;  4QGR A;  2CJD A;  3LWS A;  3B1E A;  1DJU A;  3FDB A;  3ISL A;  2AY3 A;  4F5K A;  4XJP A;  1IX6 A;  1N8P A;  2CH2 A;  1IBJ A;  1LKC A;  1WST A;  3ACZ A;  3OP7 A;  4A0H A;  2R5C A;  3NDN A;  1P3W A;  5EUE A;  2DGM A;  3UWC A;  3CAI A;  4CBS A;  3N5M A;  2VGS A;  4AOA A;  2CAN A;  4ZDP A;  4RAE A;  3MC6 A;  2BI1 A;  3H9X A;  3MAF A;  3WY7 A;  1ARS A;  1ZOB A;  1JS6 A;  3AOW A;  3MEB A;  4TMR A;  4K2B A;  2D7Z A;  4OBV A;  4H63 Q;  4JE5 A;  3HMU A;  4TN4 A;  2BIE A;  3CQ6 A;  1TOI A;  2QSR A;  2BI2 A;  5DJ9 A;  4ADB A;  2GMS A;  7AAT A;  3NUI A;  1ASC A;  3LY1 A;  2VIB A;  5E4Z A;  2VLH A;  2W7M A;  1M7Y A;  9AAT A;  5HXX A;  2W8V A;  2OGE A;  1V2D A;  4WBT A;  3H14 A;  2ZY2 A;  4Y0D A;  1AHG A;  1GC3 A;  4Q31 A;  4OT8 A;  2VMQ A;  1V2F A;  1WYT A;  1LW5 A;  3FD0 A;  1AIA A;  5E5I A;  2JG2 A;  3QPG A;  2WKA A;  5M4B A;  1BJN A;  2CJG A;  5D95 A;  1BQD A;  3A9Z A;  2QMA A;  1GEY A;  2DGL A;  2HOX A;  2NMP A;  3AEP A;  2VGV A;  3EUC A;  3ELP A;  3FRK A;  5EIG A;  4A0R A;  3B8X A;  3EI6 A;  3RQ1 A;  3WCO A;  4B98 A;  3AEJ A;  5M49 A;  4M2M A;  2JJH A;  1B4X A;  3BCA A;  3KGX A;  1AKB A;  1GCK A;  1XEY A;  4E3Q A;  2X5F A;  1AAM A;  1ARI A;  1LW4 A;  3EZS A;  4WLJ A;  5G2P A;  5IWQ A;  1M0Q A;  3ZRP A;  2ZJG A;  4LNL A;  2FNU A;  5F8V A;  2Z9X A;  2WB6 A;  4ZAH A;  4RLG A;  1KKP A;  4JF1 A;  2VGU A;  4BQ0 A;  3CQ4 A;  1C4K A;  4O6Z A;  2G6W A;  4U1T A;  5KTB A;  1AHX A;  1G4V A;  1CZC A;  1S0A A;  1YOO A;  3N75 A;  1G7W A;  3LVL B;  3WLX A;  1VP4 A;  2C0R A;  1KKJ A;  2VI8 A;  1AY4 A;  3E2F A;  1YAA A;  2GMU A;  3GBX A;  4UQV A;  4N0B A;  2Z20 A;  4ISY A;  3L8A A;  1PMM A;  1AKC A;  2E7J A;  3WKR A;  3VAX A;  3AEJ C;  4N0W A;  4A0G A;  1QJ5 A;  4BHD A;  4CXR A;  3CQ5 A;  4KAM A;  1EG5 A;  1ECX A;  1TAT A;  2Z9U A;  3FVS A;  2VLF A;  1J32 A;  3TFT A;  3FQA A;  2WK7 A;  3BV0 A;  2QLR A;  1IVR A;  2XH1 A;  5K8B A;  3AOV A;  3DYD A;  3PDB B;  1ASA A;  3A2B A;  1D7S A;  3HL2 A;  4K05 A;  2ZY3 A;  1JS3 A;  4IY7 A;  2HP2 A;  4EFF A;  2YOB A;  2D64 A;  1CQ7 A;  1AIB A;  3WGC A;  2X5D A;  2Z67 A;  3EI9 A;  2D65 A;  4DBC A;  1IJI A;  1MGV A;  2VMT A;  2YCP A;  1AIC A;  4ZWM A;  2DKB A;  3W1J A;  3A9X A;  4E77 A;  1OHV A;  2YKX A;  3RCH A;  2CY8 A;  2JJF A;  4RJ0 A;  4W1W A;  3HVY A;  1SF2 A;  2VGT A;  1YJY A;  2Z9W A;  2AEV A;  3AEN B;  2W7J A;  1CQ8 A;  2ORD A;  1KL2 A;  1AMR A;  1MAP A;  4Q75 A;  1TAR A;  1KMK A;  2QA3 A;  5FT5 A;  1I48 A;  4EU1 A;  1AHF A;  3LVM A;  2D63 A;  3PA9 A;  1TOJ A;  4OTL A;  5E3K A;  4AO9 A;  4RIZ A;  2QB2 A;  4OCA A;  3ECD A;  3FZ8 A;  1IUG A;  3AEM C;  1KAF A;  4WXG A;  2ZP7 A;  1YIY A;  4W1V A;  2GQN A;  4ZM4 A;  4XJM A;  4W1X A;  3PIU A;  1QGN A;  1S09 A;  3FFR A;  3HBX A;  4UHM A;  3DXV A;  2R0T A;  2ZC0 A;  2AY1 A;  4L0O A;  2BIA A;  2YKU A;  3FFH A;  4KXK A;  3LG0 A;  3RI6 A;  2VMY A;  3WX9 A;  4GRX A;  2HOZ A;  3E77 A;  1M6S A;  4UHO A;  1AHY A;  4A6R A;  3TQX A;  4WXB A;  5G0A A;  3FDD A;  4ZDO A;  2W7K A;  3I4J A;  5HDM A;  4XAU A;  1KMJ A;  1ASN A;  3B1D A;  2FM1 A;  2G7J A;  1G4X A;  1S07 A;  3AEO A;  4ADE A;  4JF0 A;  1IX8 A;  3MAF B;  1CJ0 A;  3LVJ A;  3FCR A;  1SZU A;  2Z9V A;  3FQ7 A;  8AAT A;  2BKW A;  3AEL A;  4LNM A;  5BJ3 A;  2OGA A;  2CJH A;  1YJZ A;  3MBB A;  1C7N A;  2AAT A;  4WXF A;  1TPL A;  3E9K A;  3G0T A;  4F5J A;  1VEF A;  4GEB A;  2KFP A;  4EB5 A;  1AX4 A;  2CST A;  5FT6 A;  1VJO A;  1O62 A;  1E5F A;  3EIB A;  2BI5 A;  1YNU A;  3CBF A;  5M46 A;  3NRA A;  4GE9 A;  3DRD A;  4IW7 A;  4JEW A;  1G7X A;  3DC1 A;  3PJ0 A;  2EGY A;  2HUF A;  2VMP A;  1PMO A;  3QBO A;  2YRR A;  2W7L A;  1RVU A;  4E1O A;  3A8U X;  4GDY A;  4OYT A;  3TCM A;  3TFU A;  5DJ1 A;  3ZRQ A;  3COG A;  4IXZ A;  2FKI A;  1M4N A;  4KYO A;  1AMQ A;  4WB0 A;  4IXO A;  1DTY A;  3BN1 A;  4R8D A;  1MDO A;  1S08 A;  2CB1 A;  3NTJ A;  4BA5 A;  1FG3 A;  4AO4 A;  4ADD A;  1SFF A;  1V2E A;  4A72 A;  4DGT A;  3L44 A;  4CBR A;  4FFC A;  4ITX A;  1AJS B;  1DGE A;  4PFF A;  3DOD A;  4WD2 A;  3IHJ A;  3NYT A;  4W5K A;  4TV7 A;  4WYG A;  1N31 A;  2PB0 A;  1D2F A;  1LK9 A;  2W7H A;  1YJS A;  3FSL A;  3N4R A;  1AJS A;  1U08 A;  2HOR A;  5EUD A;  4DQ6 A;  2EZ1 A;  4JEY A;  4Q76 A;  1D7R A;  1C9C A;  2W8W A;  2C44 A;  4MKJ A;  1O61 A;  4ATP A;  1C0N A;  4WB0 B;  3NNK A;  4MGR A;  1IX7 A;  4WLH A;  1ZOD A;  3BS8 A;  2OAT A;  3EI8 A;  2JGT A;  2BWP A;  4PIW A;  4RKC A;  2EPJ A;  2V0Y A;  3JU7 A;  4R2N A;  1RV3 A;  2CFB A;  2AY4 A;  3GWP A;  1S06 A;  1YIZ A;  3GZD C;  3PGY A;  5FT4 A;  1MDX A;  1X28 A;  1AHE A;  3I5T A;  4XEW A;  5BJ4 A;  5HHY A;  2DGK A;  1OXP A;  2FNI A;  1TAS A;  1BS0 A;  3GSB A;  2DR1 A;  2X8U A;  3MC6 C;  2VMR A;  1Y4I A;  4XJL A;  2GB3 A;  3E2Y A;  5DB5 A;  4MQP A;  4AZJ A;  1GEX A;  5EAV A;  1M0P A;  3BCB A;  1DFO A;  1ORD A;  1BJO B;  4Y0H A;  2Z1Y A;  3OKS A;  3GJU A;  1B9H A;  3HDO A;  4LW4 A;  1LC8 A;  4ZAS A;  1ARH A;  3B46 A;  1ASG A;  2FN6 A;  2FYF A;  3DR7 A;  4XJO A;  1X0M A;  2QBT A;  1W23 A;  2TPL A;  1O69 A;  2ZYJ A;  1X2A A;  4GE7 A;  3WCN A;  3NU7 A;  4WYC A;  5EAA A;  3QGU A;  1UU0 A;  1B5P A;  3GZD A;  1BJ4 A;  1D7U A;  3GET A;  3M5U A;  3PPL A;  3ZZJ A;  1UU1 A;  2CIN A;  2VGZ A;  4WYA A;  1B8G A;  2VMU A;  3FVU A;  1FC4 A;  1W3U A;  3RBL A;  1ELQ A;  2W8J A;  3P1T A;  5G09 A;  3DXW A;  4F5I A;  2HZP A;  2W7G A;  1V72 A;  1Z3Z A;  3K7Y A;  3E6G A;  3ASA A;  1ELU A;  2BIG A;  3HT4 A;  3RBF A;  2D5Y A;  4K2I A;  1D7V A;  2W8T A;  5G4I A;  3K40 A;  2PB2 A;  4MQQ A;  2VGW A;  3PAA A;  1AAW A;  4H51 A;  4M2J A;  2HUU A;  1JG8 A;  4GSA A;  1Z7D A;  3EZ1 A;  1BJW A;  2V1P A;  5LH9 A;  3A9Y A;  4EMY A;  4Y0I A;  2C81 A;  2HOY A;  2D61 A;  2Q7W A;  3DU4 A;  1B5O A;  1WYV A;  2EO5 A;  4A0F A;  4IX8 A;  2AY8 A;  1DKA A;  1ASB A;  1GD9 A;  4LW2 A;  3UAK A;  1WYV B;  2R2N A;  2PO3 A;  2VMW A;  3BWO A;  4AZK A;  1MDZ A;  1T3I A;  2D7Y A;  3BWN C;  3ELE A;  4J8L A;  4F5G A;  1TOE A;  2ZSM A;  2O7C A;  2D66 A;  3NYU A;  2BYL A;  1AMA A;  3FQ8 A;  4EB7 A;  4ZDL A;  3QM2 A;  3ZZK A;  3F6T A;  2HP1 A;  1GDE A;  4CXQ A;  2Z61 A;  1DJE A;  5G2Q A;  1QIT A;  2YKV A;  1ARG A;  4AH3 A;  4F5H A;  1ASF A;  1ASD A;  4RM1 A;  3VK3 A;  1IAY A;  3FZ6 A;  1AKA A;  4WYF A;  3USF A;  3PDB A;  2X3L A;  1X29 A;  1JF9 A;  3R9A A;  1H0C A;  3N7N A;  5G4J A;  4ZM3 A;  1QJ3 A;  3AEM A;  3P6K A;  3GR9 A;  5EFS A;  3WZF A;  3AEN A;  3EI7 A;  4F5F A;  1RV4 A;  1BW0 A;  1SZS A;  2VIA A;  3BB8 A;  3DR4 A;  2HUI A;  1AY8 A;  1W7L A;  4F5M A;  3RCH B;  2E7U A;  2EYQ A;  4LC3 A;  4WYE A;  3T32 A;  1BKG A;  1GEW A;  1FG7 A;  2W7F A;  1XI9 A;  3JWB A;  1LC7 A;  2ZSL A;  4ADC A;  2E54 A;  1CZE A;  1N2T A;  1OAT A;  2QB3 A;  3K28 A;  1J04 A;  3PDX A;  2O0R A;  4A00 A;  3JTX A;  1BT4 A;  1MLZ A;  2VMO A;  4F4E A;  4I8A A;  5C6U A;  4W8I A;  4ZSW A;  1MLY A;  2OQX A;  4FL0 A;  3ZRR A;  3QN6 A;  4R5F A;  4B9B A;  4RKD A;  3MKJ A;  2OKK A;  2RFV A;  3E2Z A;  1PG8 A;  1CL1 A;  2YRI A;  3WGB A;  4CVQ A;  1B9I A;  1RVY A;  1M0O A;  5DX5 A;  2W7I A;  5EUN A;  1LC5 A;  3NYS A;  1GC2 A;  2VMS A;  4HF8 A;  4WYD A;  3II0 A;  1CS1 A;  3GZC A;  3LV2 A;  3N4X A;  2YCT A;  1KL1 A;  4JEV A;  1QZ9 A;  3R4T A;  4A6T A;  3G8M A;  3BCX A;  2F8J A;  2GSA A;  2AY2 A;  2W7E A;  3AAT A;  1AMS A;  4J5U A;  4ATQ A;  3MAU A;  1ASM A;  1EQB A;  2VMV A;  4M2K A;  1C7G A;  1LS3 A;  4PVF A;  4PFN A;  3ATH A;  4BMK A;  2R5E A;  4IXS A;  3W1H A;  3VOM A;  3E2Z B;  1SVV A;  1ZC9 A;  1CL2 A;  1QIR A;  1M0N A;  2W8U A;  3G7Q A;  1AJR A;  1I41 A;  3HLM A;  4IYO A;  4JE5 D;  4ITG A;  4Q6R A; 
#chains in the Genus database with same CATH homology
 2VI9 A;  1OHY A;  1MAQ A;  3FVX A;  2AY7 A;  5EQC A;  2AY5 A;  2C7T A;  1I43 A;  2EH6 A;  1GC0 A;  2YHK A;  3F9T A;  4HVK A;  2ZY5 A;  1I29 A;  5LHA A;  4RIT A;  1GC4 A;  5I92 A;  2EZ2 A;  2R5C B;  4BA4 A;  3BWN A;  1WKH A;  1BJO A;  3KE3 A;  4OBU A;  3EIA A;  3JWA A;  4JEX A;  5J8Q A;  1WKG A;  1IAX A;  5TF5 A;  3B1C A;  3H7F A;  4R5Z A;  2CH1 A;  3N0L A;  4UHN A;  2BHX A;  1OXO A;  4IYO B;  3F0H A;  2DKJ A;  2YKY A;  3VK4 A;  4ZWV A;  3IF2 A;  2WK8 A;  3PD6 A;  3VK2 A;  4GE4 A;  4NOG A;  1H1C A;  2CTZ A;  3NU8 A;  1C7O A;  3UE8 A;  1DJ9 A;  4ZLV A;  1O4S A;  1QIS A;  1WYU A;  1OHW A;  2XBN A;  2ZUK A;  3DZZ A;  3FTB A;  3HQT A;  3JW9 A;  3LVK A;  4JEZ A;  5F9S A;  3NUB A;  1M32 A;  3KGW A;  1SZK A;  4ZSY A;  2DOU A;  3NX3 A;  2WK9 A;  3W1I A;  4W91 A;  1ART A;  1UU2 A;  3WKS A;  4P7Y A;  2AY9 A;  3QI6 A;  4MQR A;  2VMN A;  4A6U A;  4WP0 A;  2BWO A;  1E5E A;  5M4D A;  4MKK A;  3Q8N A;  1CQ6 A;  3N4S A;  1ASL A;  2BYJ A;  3ASB A;  2JJE A;  4P3M A;  3FZ7 A;  2VMZ A;  1DGD A;  2E7I A;  1BQA A;  2BI9 A;  2VMX A;  4OC9 A;  4RJY A;  3VP6 A;  5FT8 A;  3EI5 A;  2O1B A;  1SPA A;  2JJG A;  4MY5 A;  2FQ6 A;  2VYC A;  4LNJ A;  1UKJ A;  4U2H A;  5EIG B;  3FKD A;  2ZY4 A;  2YCN A;  2BWN A;  1AY5 A;  1GBN A;  5JAY A;  2W7D A;  1TOG A;  2A1V A;  4XQ2 A;  4MSO A;  1W7M A;  3I16 A;  2JIS A;  5AX8 A;  1WYT B;  3D6K A;  1WYU B;  1TOK A;  2BI3 A;  4E3R A;  3JZL A;  3KKI A;  4F5L A;  2OKJ A;  1ASE A;  3BC8 A;  4K2M A;  3MAD A;  1W7N A;  3PD6 B;  3QHX A;  3TAT A;  1EJI A;  5D5S A;  3RUY A;  3AV7 A;  4UOY A;  2AEU A;  1PFF A;  2Z1Z A;  2AY6 A;  4XK1 A;  4OMA A;  4QGR A;  2CJD A;  3LWS A;  3B1E A;  1DJU A;  3FDB A;  3ISL A;  2AY3 A;  4F5K A;  4XJP A;  1IX6 A;  1N8P A;  2CH2 A;  1IBJ A;  1LKC A;  1WST A;  3ACZ A;  3OP7 A;  4A0H A;  2R5C A;  3NDN A;  1P3W A;  5EUE A;  2DGM A;  3UWC A;  3CAI A;  4CBS A;  3N5M A;  2VGS A;  4AOA A;  2CAN A;  4ZDP A;  4RAE A;  3MC6 A;  2BI1 A;  3H9X A;  3MAF A;  3WY7 A;  1ARS A;  1ZOB A;  1JS6 A;  3AOW A;  3MEB A;  4TMR A;  4K2B A;  2D7Z A;  4OBV A;  4H63 Q;  4JE5 A;  3HMU A;  4TN4 A;  2BIE A;  3CQ6 A;  1TOI A;  2QSR A;  2BI2 A;  5DJ9 A;  4ADB A;  2GMS A;  7AAT A;  3NUI A;  1ASC A;  3LY1 A;  2VIB A;  5E4Z A;  2VLH A;  2W7M A;  1M7Y A;  9AAT A;  5HXX A;  2W8V A;  2OGE A;  1V2D A;  4WBT A;  3H14 A;  2ZY2 A;  4Y0D A;  1AHG A;  1GC3 A;  4Q31 A;  4OT8 A;  2VMQ A;  1V2F A;  1WYT A;  1LW5 A;  3FD0 A;  1AIA A;  5E5I A;  2JG2 A;  3QPG A;  2WKA A;  5M4B A;  1BJN A;  2CJG A;  5D95 A;  1BQD A;  3A9Z A;  2QMA A;  1GEY A;  2DGL A;  2HOX A;  2NMP A;  3AEP A;  2VGV A;  3EUC A;  3ELP A;  3FRK A;  5EIG A;  4A0R A;  3B8X A;  3EI6 A;  3RQ1 A;  3WCO A;  4B98 A;  3AEJ A;  5M49 A;  4M2M A;  2JJH A;  1B4X A;  3BCA A;  3KGX A;  1AKB A;  1GCK A;  1XEY A;  4E3Q A;  2X5F A;  1AAM A;  1ARI A;  1LW4 A;  3EZS A;  4WLJ A;  5G2P A;  5IWQ A;  1M0Q A;  3ZRP A;  2ZJG A;  4LNL A;  2FNU A;  5F8V A;  2Z9X A;  2WB6 A;  4ZAH A;  4RLG A;  1KKP A;  4JF1 A;  2VGU A;  4BQ0 A;  3CQ4 A;  1C4K A;  4O6Z A;  2G6W A;  4U1T A;  5KTB A;  1AHX A;  1G4V A;  1CZC A;  1S0A A;  1YOO A;  3N75 A;  1G7W A;  3LVL B;  3WLX A;  1VP4 A;  2C0R A;  1KKJ A;  2VI8 A;  1AY4 A;  3E2F A;  1YAA A;  2GMU A;  3GBX A;  4UQV A;  4N0B A;  2Z20 A;  4ISY A;  3L8A A;  1PMM A;  1AKC A;  2E7J A;  3WKR A;  3VAX A;  3AEJ C;  4N0W A;  4A0G A;  1QJ5 A;  4BHD A;  4CXR A;  3CQ5 A;  4KAM A;  1EG5 A;  1ECX A;  1TAT A;  2Z9U A;  3FVS A;  2VLF A;  1J32 A;  3TFT A;  3FQA A;  2WK7 A;  3BV0 A;  2QLR A;  1IVR A;  2XH1 A;  5K8B A;  3AOV A;  3DYD A;  3PDB B;  1ASA A;  3A2B A;  1D7S A;  3HL2 A;  4K05 A;  2ZY3 A;  1JS3 A;  4IY7 A;  2HP2 A;  4EFF A;  2YOB A;  2D64 A;  1CQ7 A;  1AIB A;  3WGC A;  2X5D A;  2Z67 A;  3EI9 A;  2D65 A;  4DBC A;  1IJI A;  1MGV A;  2VMT A;  2YCP A;  1AIC A;  4ZWM A;  2DKB A;  3W1J A;  3A9X A;  4E77 A;  1OHV A;  2YKX A;  3RCH A;  2CY8 A;  2JJF A;  4RJ0 A;  4W1W A;  3HVY A;  1SF2 A;  2VGT A;  1YJY A;  2Z9W A;  2AEV A;  3AEN B;  2W7J A;  1CQ8 A;  2ORD A;  1KL2 A;  1AMR A;  1MAP A;  4Q75 A;  1TAR A;  1KMK A;  2QA3 A;  5FT5 A;  1I48 A;  4EU1 A;  1AHF A;  3LVM A;  2D63 A;  3PA9 A;  1TOJ A;  4OTL A;  5E3K A;  4AO9 A;  4RIZ A;  2QB2 A;  4OCA A;  3ECD A;  3FZ8 A;  1IUG A;  3AEM C;  4WXG A;  2ZP7 A;  1YIY A;  4W1V A;  2GQN A;  4ZM4 A;  4XJM A;  4W1X A;  3PIU A;  1QGN A;  1S09 A;  3FFR A;  3HBX A;  4UHM A;  3DXV A;  2R0T A;  2ZC0 A;  2AY1 A;  4L0O A;  2BIA A;  2YKU A;  3FFH A;  4KXK A;  3LG0 A;  3RI6 A;  2VMY A;  3WX9 A;  4GRX A;  2HOZ A;  3E77 A;  1M6S A;  4UHO A;  1AHY A;  4A6R A;  3TQX A;  4WXB A;  5G0A A;  3FDD A;  4ZDO A;  2W7K A;  3I4J A;  5HDM A;  4XAU A;  1KMJ A;  1ASN A;  3B1D A;  2FM1 A;  2G7J A;  1G4X A;  1S07 A;  3AEO A;  4ADE A;  4JF0 A;  1IX8 A;  3MAF B;  1CJ0 A;  3LVJ A;  3FCR A;  1SZU A;  2Z9V A;  3FQ7 A;  8AAT A;  2BKW A;  3AEL A;  4LNM A;  5BJ3 A;  2OGA A;  2CJH A;  1YJZ A;  3MBB A;  1C7N A;  2AAT A;  4WXF A;  1TPL A;  3E9K A;  3G0T A;  4F5J A;  1VEF A;  4GEB A;  2KFP A;  4EB5 A;  1AX4 A;  2CST A;  5FT6 A;  1VJO A;  1O62 A;  1E5F A;  3EIB A;  2BI5 A;  1YNU A;  3CBF A;  5M46 A;  3NRA A;  4GE9 A;  3DRD A;  4IW7 A;  4JEW A;  1G7X A;  3DC1 A;  3PJ0 A;  2EGY A;  2HUF A;  2VMP A;  1PMO A;  3QBO A;  2YRR A;  2W7L A;  1RVU A;  4E1O A;  3A8U X;  4GDY A;  4OYT A;  3TCM A;  3TFU A;  5DJ1 A;  3ZRQ A;  3COG A;  4IXZ A;  2FKI A;  1M4N A;  4KYO A;  1AMQ A;  4WB0 A;  4IXO A;  1DTY A;  3BN1 A;  4R8D A;  1MDO A;  1S08 A;  2CB1 A;  3NTJ A;  4BA5 A;  1FG3 A;  4AO4 A;  4ADD A;  1SFF A;  1V2E A;  4A72 A;  4DGT A;  3L44 A;  4CBR A;  4FFC A;  4ITX A;  1AJS B;  1DGE A;  4PFF A;  3DOD A;  4WD2 A;  3IHJ A;  3NYT A;  4W5K A;  4TV7 A;  4WYG A;  1N31 A;  2PB0 A;  1D2F A;  1LK9 A;  2W7H A;  1YJS A;  3FSL A;  3N4R A;  1AJS A;  1U08 A;  2HOR A;  5EUD A;  4DQ6 A;  2EZ1 A;  4JEY A;  4Q76 A;  1D7R A;  1C9C A;  2W8W A;  2C44 A;  4MKJ A;  1O61 A;  4ATP A;  1C0N A;  4WB0 B;  3NNK A;  4MGR A;  1IX7 A;  4WLH A;  1ZOD A;  3BS8 A;  2OAT A;  3EI8 A;  2JGT A;  2BWP A;  4PIW A;  4RKC A;  2EPJ A;  2V0Y A;  3JU7 A;  4R2N A;  1RV3 A;  2CFB A;  2AY4 A;  3GWP A;  1S06 A;  1YIZ A;  3GZD C;  3PGY A;  5FT4 A;  1MDX A;  1X28 A;  1AHE A;  3I5T A;  4XEW A;  5BJ4 A;  5HHY A;  2DGK A;  1OXP A;  2FNI A;  1TAS A;  1BS0 A;  3GSB A;  2DR1 A;  2X8U A;  3MC6 C;  2VMR A;  1Y4I A;  4XJL A;  2GB3 A;  3E2Y A;  5DB5 A;  4MQP A;  4AZJ A;  1GEX A;  5EAV A;  1M0P A;  3BCB A;  1DFO A;  1ORD A;  1BJO B;  4Y0H A;  2Z1Y A;  3OKS A;  3GJU A;  1B9H A;  3HDO A;  4LW4 A;  1LC8 A;  4ZAS A;  1ARH A;  3B46 A;  1ASG A;  2FN6 A;  2FYF A;  3DR7 A;  4XJO A;  1X0M A;  2QBT A;  1W23 A;  2TPL A;  1O69 A;  2ZYJ A;  1X2A A;  4GE7 A;  3WCN A;  3NU7 A;  4WYC A;  5EAA A;  3QGU A;  1UU0 A;  1B5P A;  3GZD A;  1BJ4 A;  1D7U A;  3GET A;  3M5U A;  3PPL A;  3ZZJ A;  1UU1 A;  2CIN A;  2VGZ A;  4WYA A;  1B8G A;  2VMU A;  3FVU A;  1FC4 A;  1W3U A;  3RBL A;  1ELQ A;  2W8J A;  3P1T A;  5G09 A;  3DXW A;  4F5I A;  2HZP A;  2W7G A;  1V72 A;  1Z3Z A;  3K7Y A;  3E6G A;  3ASA A;  1ELU A;  2BIG A;  3HT4 A;  3RBF A;  2D5Y A;  4K2I A;  1D7V A;  2W8T A;  5G4I A;  3K40 A;  2PB2 A;  4MQQ A;  2VGW A;  3PAA A;  1AAW A;  4H51 A;  4M2J A;  2HUU A;  1JG8 A;  4GSA A;  1Z7D A;  3EZ1 A;  1BJW A;  2V1P A;  5LH9 A;  3A9Y A;  4EMY A;  4Y0I A;  2C81 A;  2HOY A;  2D61 A;  2Q7W A;  3DU4 A;  1B5O A;  1WYV A;  2EO5 A;  4A0F A;  4IX8 A;  2AY8 A;  1DKA A;  1ASB A;  1GD9 A;  4LW2 A;  3UAK A;  1WYV B;  2R2N A;  2PO3 A;  2VMW A;  3BWO A;  4AZK A;  1MDZ A;  1T3I A;  2D7Y A;  3BWN C;  3ELE A;  4J8L A;  4F5G A;  1TOE A;  2ZSM A;  2O7C A;  2D66 A;  3NYU A;  2BYL A;  1AMA A;  3FQ8 A;  4EB7 A;  4ZDL A;  3QM2 A;  3ZZK A;  3F6T A;  2HP1 A;  1GDE A;  4CXQ A;  2Z61 A;  1DJE A;  5G2Q A;  1QIT A;  2YKV A;  1ARG A;  4AH3 A;  4F5H A;  1ASF A;  1ASD A;  4RM1 A;  3VK3 A;  1IAY A;  3FZ6 A;  1AKA A;  4WYF A;  3USF A;  3PDB A;  2X3L A;  1X29 A;  1JF9 A;  3R9A A;  1H0C A;  3N7N A;  5G4J A;  4ZM3 A;  1QJ3 A;  3AEM A;  3P6K A;  3GR9 A;  5EFS A;  3WZF A;  3AEN A;  3EI7 A;  4F5F A;  1RV4 A;  1BW0 A;  1SZS A;  2VIA A;  3BB8 A;  3DR4 A;  2HUI A;  1AY8 A;  1W7L A;  4F5M A;  3RCH B;  2E7U A;  2EYQ A;  4LC3 A;  4WYE A;  3T32 A;  1BKG A;  1GEW A;  1FG7 A;  2W7F A;  1XI9 A;  3JWB A;  1LC7 A;  2ZSL A;  4ADC A;  2E54 A;  1CZE A;  1N2T A;  1OAT A;  2QB3 A;  3K28 A;  1J04 A;  3PDX A;  2O0R A;  4A00 A;  3JTX A;  1BT4 A;  1MLZ A;  2VMO A;  4F4E A;  4I8A A;  5C6U A;  4W8I A;  4ZSW A;  1MLY A;  2OQX A;  4FL0 A;  3ZRR A;  3QN6 A;  4R5F A;  4B9B A;  4RKD A;  3MKJ A;  2OKK A;  2RFV A;  3E2Z A;  1PG8 A;  1CL1 A;  2YRI A;  3WGB A;  4CVQ A;  1B9I A;  1RVY A;  1M0O A;  5DX5 A;  2W7I A;  5EUN A;  1LC5 A;  3NYS A;  1GC2 A;  2VMS A;  4HF8 A;  4WYD A;  3II0 A;  1CS1 A;  3GZC A;  3LV2 A;  3N4X A;  2YCT A;  1KL1 A;  4JEV A;  1QZ9 A;  3R4T A;  4A6T A;  3G8M A;  3BCX A;  2F8J A;  2GSA A;  2AY2 A;  2W7E A;  3AAT A;  1AMS A;  4J5U A;  4ATQ A;  3MAU A;  1ASM A;  1EQB A;  2VMV A;  4M2K A;  1C7G A;  1LS3 A;  4PVF A;  4PFN A;  3ATH A;  4BMK A;  2R5E A;  4IXS A;  3W1H A;  3VOM A;  3E2Z B;  1SVV A;  1ZC9 A;  1CL2 A;  1QIR A;  1M0N A;  2W8U A;  3G7Q A;  1AJR A;  1I41 A;  3HLM A;  4IYO A;  4JE5 D;  4ITG A;  4Q6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...