4N0WA

X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
416
structure length
416
Chain Sequence
SMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine hydroxymethyltransferase
publication title X-ray crystal structure of a serine hydroxymethyltransferase from Burkholderia cenocepacia with covalently attached pyridoxal phosphate
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
total genus 162
structure length 416
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0wA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4n0wA02
1VP4A 3CQ4A 2CY8A 1LW4A 4AZKA 2Z1YA 2CINA 4GEBA 4IYOA 4UHMA 2W7DA 3R4TA 2W8WA 1GEYA 4MGRA 1YNUA 1OXOA 2GB3A 4WB0A 4OYTA 2YCTA 2W7FA 3RQ1A 2JJFA 1MLZA 1C7NA 2ZSLA 2VLFA 3P6KA 3N75A 2D65A 4LNMA 1S07A 1C4KA 2EGYA 4ISYA 4WBTA 5DB5A 2VMXA 4AO9A 1M0OA 4ZM4A 4ZDLA 3UWCA 2Q7WA 3L8AA 3Q8NA 1MDZA 3DC1A 1EJIA 3DR4A 5BJ3A 1LKCA 1WYTA 3BWNC 2CJDA 2VGWA 4GRXA 2EO5A 5G2QA 1G4VA 1LK9A 2FNIA 5J8QA 1ORDA 3HBXA 1QITA 3II0A 1P3WA 4R2NA 4IW7A 5FT6A 4A0HA 2Z9XA 1GC2A 2ZY5A 1O61A 2CJHA 1ARGA 4MQPA 3JTXA 4WYGA 2GMUA 3DRDA 4WXFA 1S08A 4AOAA 1JG8A 4IX8A 2WK9A 4TV7A 2FYFA 3QGUA 4BMKA 4GE9A 1GD9A 2DGMA 3BB8A 3QHXA 4CVQA 1E5EA 2BHXA 2HZPA 3GZDC 1UKJA 4EB5A 3AV7A 1BQDA 2D63A 2GQNA 4ZWMA 3K40A 2PO3A 3ZRRA 4EMYA 3BCAA 3AEJC 4XAUA 4XK1A 4Q31A 1XEYA 5EIGA 1AJSB 3ASAA 3NYUA 1AHGA 1DJ9A 1KMKA 1SZSA 3MC6C 4M2MA 3EI8A 2YKYA 2XBNA 2YCNA 4L0OA 1CS1A 1M7YA 3NNKA 5M4BA 5LHAA 3FSLA 1DJUA 5JAYA 1V72A 3A8UX 1YIYA 2CB1A 3WGCA 3H14A 3TFTA 2JJGA 2D61A 4EFFA 3AOVA 2D7YA 4LC3A 2AY3A 1UU2A 4DQ6A 3B1DA 1D2FA 3GSBA 2AEVA 3VK3A 4F5GA 1S09A 3BWNA 4XJPA 5G2PA 1Y4IA 2W8VA 1IX6A 4P7YA 3FDDA 3GZCA 4GSAA 2VYCA 1AKCA 4MSOA 4XJOA 1RVYA 1TOGA 2HP1A 2VIAA 4W8IA 1AAMA 1TPLA 3NYSA 4NOGA 1TASA 3NUIA 2TPLA 3JWAA 4WXGA 1I41A 4FL0A 1CJ0A 4PFFA 4F4EA 4IY7A 3ZZJA 1AY8A 3HMUA 1GC4A 4JEWA 4RAEA 1M0PA 4RM1A 2OGEA 3GZDA 4UHOA 2E7JA 2YHKA 2GMSA 3LG0A 3RUYA 4OTLA 1GEWA 3TQXA 1KMJA 2YOBA 3A2BA 4OCAA 1JS6A 3PDBB 4F5FA 7AATA 3NX3A 4B98A 3EZ1A 1B5OA 1GEXA 2VGTA 3W1JA 2X3LA 4W1XA 1DKAA 1KL1A 4A6UA 1ARTA 2VMYA 1VJOA 4RITA 2HP2A 3MC6A 1PMOA 1SZUA 1X28A 2D64A 2R5EA 2VMUA 4RJYA 5DJ9A 4ZSYA 3AEPA 4A0GA 3FQAA 2OKKA 1WSTA 4A6RA 4TMRA 1B9HA 1M4NA 2ZUKA 3ECDA 4J5UA 1D7UA 5D95A 4BA4A 2VGZA 3EIAA 3VK4A 2D5YA 1FG7A 4OC9A 2CANA 3FVSA 1AJSA 2VI9A 2BIAA 3LVLB 3ZZKA 3AEMC 4JEZA 5HXXA 2W7HA 4U2HA 4XEWA 4O6ZA 1BW0A 2PB2A 4B9BA 4OMAA 3WZFA 4Q6RA 2V1PA 1TARA 3HQTA 2BI1A 1BQAA 5BJ4A 2CTZA 3ISLA 3EI9A 1MGVA 2HOXA 1IX7A 4WLJA 1GCKA 1DJEA 3DYDA 3KE3A 4ZWVA 1AX4A 4KYOA 2Z9WA 2CFBA 2WKAA 4EB7A 1T3IA 4LNLA 3JZLA 3EI6A 4MKKA 2ZY4A 1WYVB 2VMWA 1QJ3A 3GETA 3HT4A 4F5HA 3F6TA 3I5TA 1M6SA 4I8AA 1ARIA 2R5CB 4ZDOA 1KKJA 2CJGA 4RKCA 4UOYA 4A0RA 1C7OA 1LW5A 5EFSA 3E9KA 3MEBA 4A00A 2ORDA 1CL2A 3PDXA 3IF2A 3TATA 1IAYA 4LW4A 3B1CA 3FFHA 5G0AA 1SFFA 2E7UA 2VMQA 3W1HA 3FZ8A 3K7YA 4WXBA 3W1IA 2X5DA 4PIWA 3EI7A 1OHVA 1X29A 2Z67A 2HUFA 3PDBA 4MQQA 3MAFB 2AY8A 4Q76A 4RIZA 3VP6A 2EPJA 1TOIA 1AHXA 2BWNA 1S06A 1AICA 1ASMA 1IBJA 3AEMA 3NUBA 1FG3A 4K2BA 1J32A 4M2KA 2BYLA 4Q75A 4XJLA 1W7LA 1BKGA 2VMOA 2YKXA 3USFA 3UAKA 4F5LA 2C44A 2GSAA 2D7ZA 3RBLA 2W7LA 5TF5A 1S0AA 2DKJA 4E3QA 1QISA 3IHJA 2VGUA 3E2YA 2QA3A 4J8LA 2FQ6A 2Z61A 4CBSA 2YRRA 4FFCA 5EUDA 4ZDPA 3DXVA 3G0TA 3ACZA 3NRAA 3WKRA 1PMMA 2V0YA 1W7MA 2VGVA 3R9AA 5FT8A 3FQ7A 5HHYA 4BHDA 3BV0A 3NYTA 4ITXA 1I29A 3CQ6A 3GR9A 3K28A 4M2JA 2ZJGA 3ELEA 4QGRA 1E5FA 1AY5A 3QBOA 4MQRA 2D66A 1WYVA 1WYUB 4AZJA 1ECXA 1W7NA 1RV3A 2AY7A 2W7MA 4F5JA 1ARSA 2W8TA 4BA5A 2QLRA 1GDEA 5M46A 1SZKA 1Z7DA 1ASGA 4CXQA 2R5CA 4HVKA 3WCNA 1ASFA 2OGAA 5DX5A 1H1CA 3FD0A 2AY5A 3UE8A 1JS3A 3WX9A 2W7KA 3LVJA 2DOUA 1BJ4A 1G4XA 5EUEA 2DKBA 3VK2A 1QGNA 1UU0A 2W7IA 2FNUA 3BWOA 4ADCA 3OP7A 4GDYA 2Z9UA 4F5IA 1C7GA 4EU1A 3WKSA 4E1OA 2QB3A 1DFOA 2O1BA 1OATA 3PAAA 2VMNA 1QZ9A 2BYJA 1ASAA 1C9CA 3AENB 3BCXA 4RJ0A 3DODA 4ZASA 3MAFA 2RFVA 5E5IA 4UHNA 1SPAA 2ZC0A 4ZM3A 2F8JA 1DGDA 1AKAA 4OBVA 5G4JA 2AY9A 1O62A 4A6TA 1SVVA 2VMTA 3DU4A 4RLGA 4A0FA 5DJ1A 1OHWA 3PD6B 3EZSA 1PG8A 3EIBA 1AJRA 1M0QA 3BC8A 4PFNA 1BJOB 2FM1A 4CXRA 3A9YA 3T32A 2R2NA 5EQCA 5FT5A 3P1TA 2HUUA 3G8MA 1GBNA 3VOMA 3NU8A 1MDXA 1TATA 1TOEA 1WKHA 2CH2A 2QBTA 2AATA 1AIAA 3I4JA 2VMZA 2C0RA 3FCRA 1TOJA 1YAAA 4JE5A 3RI6A 2W7EA 1AMSA 3PJ0A 1V2FA 3KGWA 2Z9VA 1ELQA 1OHYA 1RVUA 1BJNA 2JGTA 5F9SA 1ARHA 2CH1A 2BI5A 1YIZA 1ZOBA 3MADA 1IAXA 4JEVA 3FDBA 1YOOA 2O7CA 3BN1A 3LWSA 3E6GA 3OKSA 2OQXA 1WYUA 1CQ8A 1YJZA 4OT8A 1B8GA 2BWOA 3COGA 3G7QA 2ZY3A 2E7IA 4R5FA 2W8UA 5EUNA 1D7VA 1MDOA 2C81A 2AY2A 5F8VA 1QIRA 2EH6A 4W5KA 3MBBA 3GJUA 4ZLVA 4HF8A 3CBFA 4F5MA 1GC3A 2VLHA 3NTJA 4BQ0A 5HDMA 1IX8A 3FTBA 3H7FA 3F9TA 3HLMA 4DBCA 3GWPA 2Z1ZA 3AENA 2YCPA 2HORA 4WYDA 3EI5A 5AX8A 2EZ1A 2G6WA 1M0NA 2DR1A 2DGLA 1IVRA 3F0HA 3M5UA 2VMVA 3LVKA 3FZ7A 3BS8A 3FKDA 3LY1A 4Y0HA 3VAXA 4JEYA 5E4ZA 1CZEA 3DR7A 4MKJA 4ZSWA 2WK7A 3LVMA 2ZYJA 1EQBA 1O4SA 4E3RA 2HOYA 3QI6A 3PD6A 1LC8A 1B9IA 1QJ5A 3HL2A 1M32A 3E2ZB 4W1VA 2AY4A 2VGSA 1WKGA 1DTYA 1N2TA 4GE7A 4ZAHA 3HVYA 3A9XA 1IJIA 1BJOA 4TN4A 3RCHB 1LS3A 3MAUA 1CZCA 1LC5A 3A9ZA 2JISA 1C0NA 3TCMA 2JJEA 4OBUA 3HDOA 3CAIA 4LW2A 3E2FA 1AHFA 1AHYA 1B5PA 5EAAA 5C6UA 3DZZA 4AO4A 2VMSA 1B4XA 3JW9A 4CBRA 4JF1A 3PPLA 4MY5A 4ATPA 1I48A 1FC4A 4JEXA 1ASLA 4WLHA 4DGTA 3QM2A 4K2MA 3NU7A 1AIBA 2W7GA 1MAPA 3ATHA 4IXSA 4XJMA 3ZRQA 4E77A 3PGYA 1W3UA 4W91A 4WYAA 2O0RA 1PFFA 2E54A 2BI3A 3GBXA 2BIGA 2JJHA 1BS0A 3RBFA 1ASEA 5G09A 1CL1A 1LC7A 3N0LA 2ZP7A 4LNJA 4WP0A 4ATQA 1GC0A 2YKVA 1G7XA 1O69A 2VI8A 3ASBA 5I92A 8AATA 3N5MA 3LV2A 1KL2A 2BWPA 2X8UA 3JU7A 4WYEA 4XQ2A 4IXOA 1V2DA 1UU1A 2EZ2A 3FRKA 5IWQA 2XH1A 4ADBA 3B8XA 1N31A 3WGBA 3KGXA 1AHEA 3MKJA 4W1WA 1ASDA 5EAVA 3ELPA 2Z20A 4A72A 2VMRA 1BJWA 4IXZA 3WLXA 2C7TA 1ASCA 2FN6A 4IYOB 1ZODA 1RV4A 2BI9A 4U1TA 4WB0B 1J04A 4R8DA 1ELUA 1YJYA 2VMPA 2JG2A 2QB2A 3E77A 2ZSMA 1X0MA 1AMRA 4ITGA 5LH9A 3WCOA 1SF2A 5M4DA 5FT4A 4JF0A 2WK8A 1YJSA 3E2ZA 3KKIA 2YRIA 3BCBA 3FVXA 2W7JA 2CSTA 3JWBA 4JE5D 2W8JA 4Y0IA 3RCHA 1CQ6A 1JF9A 2DGKA 3TFUA 2OKJA 4H51A 1ASNA 1Z3ZA 2HOZA 1WYTB 5G4IA 1I43A 3AOWA 5K8BA 2NMPA 4KAMA 5M49A 1AAWA 2AY1A 3WY7A 2VIBA 4ADEA 3PIUA 1BT4A 2OATA 3AEJA 4P3MA 1N8PA 4RKDA 1H0CA 1D7SA 3D6KA 4N0BA 4AH3A 3I16A 4WYFA 1CQ7A 1EG5A 3B46A 3AATA 3FVUA 3ZRPA 4R5ZA 5D5SA 9AATA 1W23A 2R0TA 2BIEA 4GE4A 1DGEA 1MLYA 4WYCA 4Y0DA 3FFRA 1AMAA 4ADDA 3DXWA 3FZ6A 2YKUA 1V2EA 2PB0A 2HUIA 4PVFA 1AY4A 4UQVA 1VEFA 4K2IA 1ZC9A 3FQ8A 3EUCA 5EIGB 4N0WA 4F5KA 3B1EA 1G7WA 5E3KA 2BKWA 1TOKA 1X2AA 3AELA 1KKPA 3NDNA 2AEUA 2QMAA 1D7RA 1U08A 3QN6A 3L44A 3QPGA 2AY6A 2BI2A 3CQ5A 1IUGA 1AMQA 3AEOA 2X5FA 1AKBA 1MAQA 1OXPA 4KXKA 2ZY2A 4WD2A 1XI9A 1ASBA 3PA9A
chains in the Genus database with same CATH superfamily
1VP4A 3CQ4A 2CY8A 1LW4A 4AZKA 2Z1YA 2CINA 4GEBA 4IYOA 4UHMA 2W7DA 3R4TA 2W8WA 1GEYA 4MGRA 1YNUA 1OXOA 2GB3A 4WB0A 4OYTA 2YCTA 2W7FA 3RQ1A 2JJFA 1MLZA 1C7NA 2ZSLA 2VLFA 3P6KA 3N75A 2D65A 4LNMA 1S07A 1C4KA 2EGYA 4ISYA 4WBTA 5DB5A 2VMXA 4AO9A 1M0OA 4ZM4A 4ZDLA 3UWCA 2Q7WA 3L8AA 3Q8NA 1MDZA 3DC1A 1EJIA 3DR4A 5BJ3A 1LKCA 1WYTA 3BWNC 2CJDA 2VGWA 4GRXA 2EO5A 3N4RA 5G2QA 1G4VA 1LK9A 2FNIA 5J8QA 1ORDA 3HBXA 1QITA 3II0A 1P3WA 4R2NA 4IW7A 5FT6A 4A0HA 2Z9XA 1GC2A 2ZY5A 1O61A 2CJHA 1ARGA 4MQPA 3JTXA 4WYGA 2GMUA 3DRDA 4WXFA 1S08A 4AOAA 1JG8A 4IX8A 2WK9A 4TV7A 2FYFA 3QGUA 4BMKA 4GE9A 1GD9A 2DGMA 3BB8A 3QHXA 4CVQA 1E5EA 2BHXA 2HZPA 3GZDC 1UKJA 4EB5A 3AV7A 1BQDA 2D63A 2GQNA 4ZWMA 3K40A 2PO3A 3ZRRA 4EMYA 3BCAA 3AEJC 4XAUA 4XK1A 4Q31A 1XEYA 5EIGA 1AJSB 3ASAA 3NYUA 1AHGA 1DJ9A 1KMKA 1SZSA 3MC6C 4M2MA 3EI8A 2YKYA 2XBNA 2YCNA 4L0OA 1CS1A 1M7YA 3NNKA 5M4BA 5LHAA 2EYQA 3FSLA 1DJUA 5JAYA 1V72A 3A8UX 1YIYA 2CB1A 3WGCA 3H14A 3TFTA 2JJGA 2D61A 4EFFA 3AOVA 2D7YA 4LC3A 2AY3A 1UU2A 4DQ6A 3B1DA 1D2FA 3GSBA 2AEVA 3VK3A 4F5GA 1S09A 3BWNA 4XJPA 5G2PA 1Y4IA 2W8VA 1IX6A 4P7YA 3FDDA 3GZCA 4GSAA 2VYCA 1AKCA 4MSOA 4XJOA 1RVYA 1TOGA 2HP1A 2VIAA 4W8IA 1AAMA 1TPLA 3NYSA 4NOGA 1TASA 3NUIA 2TPLA 3JWAA 4WXGA 1I41A 4FL0A 1CJ0A 4PFFA 4F4EA 4IY7A 3ZZJA 1AY8A 3HMUA 1GC4A 4JEWA 4RAEA 1M0PA 4RM1A 2OGEA 3GZDA 4UHOA 2E7JA 2YHKA 2GMSA 3LG0A 3RUYA 3N7NA 4OTLA 1GEWA 3TQXA 1KMJA 2YOBA 3A2BA 4OCAA 1JS6A 3PDBB 4F5FA 7AATA 3NX3A 4B98A 3EZ1A 1B5OA 1GEXA 2VGTA 4K05A 3W1JA 2X3LA 4W1XA 1DKAA 1KL1A 4A6UA 1ARTA 2VMYA 1VJOA 4RITA 2HP2A 3MC6A 1PMOA 1SZUA 1X28A 2D64A 2R5EA 2VMUA 4RJYA 5DJ9A 4ZSYA 3AEPA 4A0GA 3FQAA 2OKKA 1WSTA 4A6RA 4TMRA 1B9HA 1M4NA 2ZUKA 3ECDA 4J5UA 1D7UA 5D95A 4BA4A 2VGZA 3EIAA 3VK4A 2D5YA 1FG7A 4OC9A 2CANA 3FVSA 1AJSA 2VI9A 2BIAA 3LVLB 3ZZKA 3AEMC 4JEZA 5HXXA 2W7HA 4U2HA 4XEWA 4O6ZA 1BW0A 2PB2A 4B9BA 4OMAA 3WZFA 4Q6RA 2V1PA 1TARA 3HQTA 2BI1A 1BQAA 5BJ4A 2CTZA 3ISLA 3EI9A 1MGVA 2HOXA 1IX7A 4WLJA 1GCKA 1DJEA 3DYDA 3KE3A 4ZWVA 1AX4A 4KYOA 2Z9WA 2CFBA 2WKAA 4EB7A 1T3IA 4LNLA 3JZLA 3EI6A 4MKKA 2FKIA 2ZY4A 1WYVB 2VMWA 1QJ3A 3GETA 3HT4A 4F5HA 3F6TA 3I5TA 1M6SA 4I8AA 1ARIA 2R5CB 4ZDOA 1KKJA 2CJGA 4RKCA 4UOYA 4A0RA 1C7OA 1LW5A 5EFSA 3E9KA 3MEBA 4A00A 2ORDA 1CL2A 3PDXA 3IF2A 3TATA 1IAYA 4LW4A 3B1CA 3FFHA 5G0AA 1SFFA 2E7UA 2VMQA 3W1HA 3FZ8A 3K7YA 4WXBA 3W1IA 2X5DA 4PIWA 3EI7A 1OHVA 1X29A 2Z67A 2HUFA 3PDBA 4MQQA 3MAFB 2AY8A 4Q76A 4RIZA 3VP6A 2EPJA 1TOIA 1AHXA 2BWNA 1S06A 1AICA 1ASMA 2A1VA 1IBJA 3AEMA 3NUBA 1FG3A 4K2BA 1J32A 4M2KA 2BYLA 4Q75A 4XJLA 1W7LA 1BKGA 2VMOA 1KAFA 2YKXA 3USFA 3UAKA 4F5LA 2C44A 2GSAA 2D7ZA 3RBLA 2W7LA 5TF5A 1S0AA 2DKJA 4E3QA 1QISA 3IHJA 2VGUA 3E2YA 2QA3A 4J8LA 2FQ6A 2Z61A 4CBSA 2YRRA 4FFCA 5EUDA 4ZDPA 3DXVA 3G0TA 3ACZA 3NRAA 3WKRA 1PMMA 2V0YA 1W7MA 2VGVA 3R9AA 5FT8A 3FQ7A 5HHYA 4BHDA 3BV0A 3NYTA 4ITXA 1I29A 3CQ6A 3GR9A 3K28A 4M2JA 2ZJGA 3ELEA 4QGRA 1E5FA 1AY5A 3QBOA 4MQRA 2D66A 1WYVA 3H9XA 1WYUB 4AZJA 1ECXA 1W7NA 1RV3A 2AY7A 2W7MA 4F5JA 1ARSA 2W8TA 4BA5A 2QLRA 1GDEA 5M46A 1SZKA 1Z7DA 1ASGA 4CXQA 2R5CA 4HVKA 3WCNA 3N4SA 1ASFA 2OGAA 5DX5A 1H1CA 3FD0A 2AY5A 3UE8A 1JS3A 3WX9A 2W7KA 3LVJA 2DOUA 1BJ4A 1G4XA 5EUEA 2DKBA 3VK2A 1QGNA 1UU0A 2W7IA 2FNUA 3BWOA 4ADCA 3OP7A 4GDYA 2Z9UA 4F5IA 1C7GA 4EU1A 3WKSA 4E1OA 2QB3A 1DFOA 2O1BA 1OATA 3PAAA 2VMNA 1QZ9A 2BYJA 1ASAA 1C9CA 3AENB 3BCXA 4RJ0A 3DODA 4ZASA 3MAFA 2RFVA 5E5IA 4UHNA 1SPAA 2ZC0A 4ZM3A 2F8JA 1DGDA 1AKAA 4OBVA 5G4JA 2AY9A 1O62A 4A6TA 1SVVA 2VMTA 3DU4A 4RLGA 4A0FA 5DJ1A 1OHWA 3PD6B 3EZSA 1PG8A 3EIBA 1AJRA 1M0QA 3BC8A 4PFNA 1BJOB 2FM1A 4CXRA 3A9YA 3T32A 2R2NA 5EQCA 5FT5A 3P1TA 2HUUA 3G8MA 1GBNA 3VOMA 3NU8A 1MDXA 1TATA 1TOEA 1WKHA 2CH2A 2QBTA 2AATA 1AIAA 3I4JA 2VMZA 2C0RA 3FCRA 1TOJA 1YAAA 4JE5A 3RI6A 2W7EA 1AMSA 3PJ0A 1V2FA 3KGWA 2Z9VA 1ELQA 1OHYA 1RVUA 1BJNA 2JGTA 5F9SA 1ARHA 2CH1A 2BI5A 1YIZA 1ZOBA 3MADA 1IAXA 4JEVA 3FDBA 1YOOA 2O7CA 3BN1A 3LWSA 3E6GA 3OKSA 2OQXA 1WYUA 1CQ8A 1YJZA 4OT8A 1B8GA 2BWOA 3COGA 3G7QA 2ZY3A 2E7IA 4R5FA 2W8UA 5EUNA 1D7VA 1MDOA 2C81A 2AY2A 5F8VA 1QIRA 2EH6A 4W5KA 3MBBA 3GJUA 4ZLVA 4HF8A 3CBFA 5KTBA 4F5MA 1GC3A 2VLHA 3NTJA 4BQ0A 5HDMA 1IX8A 3FTBA 3H7FA 3F9TA 3HLMA 4DBCA 3GWPA 2Z1ZA 3AENA 2YCPA 2HORA 4WYDA 3EI5A 5AX8A 2EZ1A 2G6WA 1M0NA 2DR1A 2DGLA 1IVRA 3F0HA 3M5UA 2VMVA 3LVKA 3FZ7A 3BS8A 3FKDA 3LY1A 4Y0HA 3VAXA 4JEYA 5E4ZA 1CZEA 3DR7A 4MKJA 4ZSWA 2WK7A 3LVMA 2ZYJA 1EQBA 1O4SA 4E3RA 2HOYA 3QI6A 3PD6A 1LC8A 1B9IA 1QJ5A 3HL2A 1M32A 3E2ZB 4W1VA 2AY4A 2VGSA 1WKGA 1DTYA 1N2TA 4GE7A 4ZAHA 3HVYA 3A9XA 1IJIA 1BJOA 4TN4A 3RCHB 1LS3A 3MAUA 1CZCA 1LC5A 3A9ZA 2JISA 1C0NA 3TCMA 2JJEA 4OBUA 3HDOA 3CAIA 4LW2A 4H63Q 3E2FA 2QSRA 1AHFA 1AHYA 1B5PA 5EAAA 5C6UA 3DZZA 4AO4A 2VMSA 1B4XA 3JW9A 4CBRA 4JF1A 3PPLA 4MY5A 4ATPA 1I48A 1FC4A 4JEXA 1ASLA 4WLHA 4DGTA 3QM2A 4K2MA 3NU7A 1AIBA 2W7GA 1MAPA 3ATHA 4IXSA 4XJMA 3ZRQA 4E77A 3PGYA 1W3UA 4W91A 4WYAA 2O0RA 1PFFA 2E54A 2BI3A 3GBXA 2BIGA 2JJHA 1BS0A 3RBFA 1ASEA 5G09A 1CL1A 1LC7A 3N0LA 2ZP7A 4LNJA 4WP0A 4ATQA 1GC0A 2YKVA 1G7XA 1O69A 2VI8A 3ASBA 5I92A 8AATA 3N4XA 3N5MA 3LV2A 1KL2A 2BWPA 2X8UA 3JU7A 4WYEA 4XQ2A 4IXOA 1V2DA 1UU1A 2EZ2A 3FRKA 5IWQA 2G7JA 2XH1A 4ADBA 3B8XA 1N31A 3WGBA 3KGXA 1AHEA 3MKJA 4W1WA 1ASDA 5EAVA 3ELPA 2Z20A 4A72A 2VMRA 1BJWA 4IXZA 3WLXA 2C7TA 1ASCA 2FN6A 4IYOB 1ZODA 1RV4A 2BI9A 4U1TA 4WB0B 1J04A 4R8DA 1ELUA 1YJYA 2VMPA 2JG2A 2QB2A 3E77A 2ZSMA 1X0MA 1AMRA 4ITGA 5LH9A 3WCOA 1SF2A 5M4DA 5FT4A 4JF0A 2WK8A 1YJSA 3E2ZA 3KKIA 2WB6A 2YRIA 3BCBA 3FVXA 2W7JA 2CSTA 3JWBA 4JE5D 2W8JA 4Y0IA 3RCHA 1CQ6A 1JF9A 2DGKA 3TFUA 2OKJA 4H51A 1ASNA 1Z3ZA 2HOZA 1WYTB 5G4IA 1I43A 3AOWA 5K8BA 2NMPA 4KAMA 5M49A 1AAWA 2AY1A 3WY7A 2VIBA 4ADEA 3PIUA 1BT4A 2OATA 3AEJA 4P3MA 1N8PA 4RKDA 1H0CA 1D7SA 3D6KA 4N0BA 4AH3A 3I16A 4WYFA 1CQ7A 1EG5A 3B46A 3AATA 3FVUA 3ZRPA 4R5ZA 5D5SA 9AATA 1W23A 2R0TA 2BIEA 4GE4A 1DGEA 1MLYA 4WYCA 4Y0DA 3FFRA 1AMAA 4ADDA 3DXWA 3FZ6A 2YKUA 1V2EA 2PB0A 2HUIA 4PVFA 1AY4A 4UQVA 1VEFA 4K2IA 1ZC9A 3FQ8A 3EUCA 5EIGB 4N0WA 4F5KA 3B1EA 1G7WA 5E3KA 2BKWA 1TOKA 1X2AA 3AELA 1KKPA 3NDNA 2AEUA 2QMAA 1D7RA 1U08A 3QN6A 3L44A 3QPGA 2AY6A 2BI2A 3CQ5A 1IUGA 1AMQA 3AEOA 2KFPA 2X5FA 1AKBA 1MAQA 1OXPA 4KXKA 2ZY2A 4WD2A 1XI9A 1ASBA 3PA9A
chains in the Genus database with same CATH topology
1VP4A 3CQ4A 2CY8A 1LW4A 4AZKA 2Z1YA 2CINA 4GEBA 4IYOA 4UHMA 2W7DA 3R4TA 2W8WA 1GEYA 4MGRA 1YNUA 1OXOA 2GB3A 4WB0A 4OYTA 2YCTA 2W7FA 3RQ1A 2JJFA 1MLZA 1C7NA 2ZSLA 2VLFA 3P6KA 3N75A 2D65A 4LNMA 1S07A 1C4KA 2EGYA 4ISYA 4WBTA 5DB5A 2VMXA 4AO9A 1M0OA 4ZM4A 4ZDLA 3UWCA 2Q7WA 3L8AA 3Q8NA 1MDZA 3DC1A 1EJIA 3DR4A 5BJ3A 1LKCA 1WYTA 3BWNC 2CJDA 2VGWA 4GRXA 2EO5A 3N4RA 5G2QA 1G4VA 1LK9A 2FNIA 5J8QA 1ORDA 3HBXA 1QITA 3II0A 1P3WA 4R2NA 4IW7A 5FT6A 4A0HA 2Z9XA 1GC2A 2ZY5A 1O61A 2CJHA 1ARGA 4MQPA 3JTXA 4WYGA 2GMUA 3DRDA 4WXFA 1S08A 4AOAA 1JG8A 4IX8A 2WK9A 4TV7A 2FYFA 3QGUA 4BMKA 4GE9A 1GD9A 2DGMA 3BB8A 3QHXA 4CVQA 1E5EA 2BHXA 2HZPA 3GZDC 1UKJA 4EB5A 3AV7A 1BQDA 2D63A 2GQNA 4ZWMA 3K40A 2PO3A 3ZRRA 4EMYA 3BCAA 3AEJC 4XAUA 4XK1A 4Q31A 1XEYA 5EIGA 1AJSB 3ASAA 3NYUA 1AHGA 1DJ9A 1KMKA 1SZSA 3MC6C 4M2MA 3EI8A 2YKYA 2XBNA 2YCNA 4L0OA 1CS1A 1M7YA 3NNKA 5M4BA 5LHAA 2EYQA 3FSLA 1DJUA 5JAYA 1V72A 3A8UX 1YIYA 2CB1A 3WGCA 3H14A 3TFTA 2JJGA 2D61A 4EFFA 3AOVA 2D7YA 4LC3A 2AY3A 1UU2A 4DQ6A 3B1DA 1D2FA 3GSBA 2AEVA 3VK3A 4F5GA 1S09A 3BWNA 4XJPA 5G2PA 1Y4IA 2W8VA 1IX6A 4P7YA 3FDDA 3GZCA 4GSAA 2VYCA 1AKCA 4MSOA 4XJOA 1RVYA 1TOGA 2HP1A 2VIAA 4W8IA 1AAMA 1TPLA 3NYSA 4NOGA 1TASA 3NUIA 2TPLA 3JWAA 4WXGA 1I41A 4FL0A 1CJ0A 4PFFA 4F4EA 4IY7A 3ZZJA 1AY8A 3HMUA 1GC4A 4JEWA 4RAEA 1M0PA 4RM1A 2OGEA 3GZDA 4UHOA 2E7JA 2YHKA 2GMSA 3LG0A 3RUYA 3N7NA 4OTLA 1GEWA 3TQXA 1KMJA 2YOBA 3A2BA 4OCAA 1JS6A 3PDBB 4F5FA 7AATA 3NX3A 4B98A 3EZ1A 1B5OA 1GEXA 2VGTA 4K05A 3W1JA 2X3LA 4W1XA 1DKAA 1KL1A 4A6UA 1ARTA 2VMYA 1VJOA 4RITA 2HP2A 3MC6A 1PMOA 1SZUA 1X28A 2D64A 2R5EA 2VMUA 4RJYA 5DJ9A 4ZSYA 3AEPA 4A0GA 3FQAA 2OKKA 1WSTA 4A6RA 4TMRA 1B9HA 1M4NA 2ZUKA 3ECDA 4J5UA 1D7UA 5D95A 4BA4A 2VGZA 3EIAA 3VK4A 2D5YA 1FG7A 4OC9A 2CANA 3FVSA 1AJSA 2VI9A 2BIAA 3LVLB 3ZZKA 3AEMC 4JEZA 5HXXA 2W7HA 4U2HA 4XEWA 4O6ZA 1BW0A 2PB2A 4B9BA 4OMAA 3WZFA 4Q6RA 2V1PA 1TARA 3HQTA 2BI1A 1BQAA 5BJ4A 2CTZA 3ISLA 3EI9A 1MGVA 2HOXA 1IX7A 4WLJA 1GCKA 1DJEA 3DYDA 3KE3A 4ZWVA 1AX4A 4KYOA 2Z9WA 2CFBA 2WKAA 4EB7A 1T3IA 4LNLA 3JZLA 3EI6A 4MKKA 2FKIA 2ZY4A 1WYVB 2VMWA 1QJ3A 3GETA 3HT4A 4F5HA 3F6TA 3I5TA 1M6SA 4I8AA 1ARIA 2R5CB 4ZDOA 1KKJA 2CJGA 4RKCA 4UOYA 4A0RA 1C7OA 1LW5A 5EFSA 3E9KA 3MEBA 4A00A 2ORDA 1CL2A 3PDXA 3IF2A 3TATA 1IAYA 4LW4A 3B1CA 3FFHA 5G0AA 1SFFA 2E7UA 2VMQA 3W1HA 3FZ8A 3K7YA 4WXBA 3W1IA 2X5DA 4PIWA 3EI7A 1OHVA 1X29A 2Z67A 2HUFA 3PDBA 4MQQA 3MAFB 2AY8A 4Q76A 4RIZA 3VP6A 2EPJA 1TOIA 1AHXA 2BWNA 1S06A 1AICA 1ASMA 2A1VA 1IBJA 3AEMA 3NUBA 1FG3A 4K2BA 1J32A 4M2KA 2BYLA 4Q75A 4XJLA 1W7LA 1BKGA 2VMOA 2YKXA 3USFA 3UAKA 4F5LA 2C44A 2GSAA 2D7ZA 3RBLA 2W7LA 5TF5A 1S0AA 2DKJA 4E3QA 1QISA 3IHJA 2VGUA 3E2YA 2QA3A 4J8LA 2FQ6A 2Z61A 4CBSA 2YRRA 4FFCA 5EUDA 4ZDPA 3DXVA 3G0TA 3ACZA 3NRAA 3WKRA 1PMMA 2V0YA 1W7MA 2VGVA 3R9AA 5FT8A 3FQ7A 5HHYA 4BHDA 3BV0A 3NYTA 4ITXA 1I29A 3CQ6A 3GR9A 3K28A 4M2JA 2ZJGA 3ELEA 4QGRA 1E5FA 1AY5A 3QBOA 4MQRA 2D66A 1WYVA 3H9XA 1WYUB 4AZJA 1ECXA 1W7NA 1RV3A 2AY7A 2W7MA 4F5JA 1ARSA 2W8TA 4BA5A 2QLRA 1GDEA 5M46A 1SZKA 1Z7DA 1ASGA 4CXQA 2R5CA 4HVKA 3WCNA 3N4SA 1ASFA 2OGAA 5DX5A 1H1CA 3FD0A 2AY5A 3UE8A 1JS3A 3WX9A 2W7KA 3LVJA 2DOUA 1BJ4A 1G4XA 5EUEA 2DKBA 3VK2A 1QGNA 1UU0A 2W7IA 2FNUA 3BWOA 4ADCA 3OP7A 4GDYA 2Z9UA 4F5IA 1C7GA 4EU1A 3WKSA 4E1OA 2QB3A 1DFOA 2O1BA 1OATA 3PAAA 2VMNA 1QZ9A 2BYJA 1ASAA 1C9CA 3AENB 3BCXA 4RJ0A 3DODA 4ZASA 3MAFA 2RFVA 5E5IA 4UHNA 1SPAA 2ZC0A 4ZM3A 2F8JA 1DGDA 1AKAA 4OBVA 5G4JA 2AY9A 1O62A 4A6TA 1SVVA 2VMTA 3DU4A 4RLGA 4A0FA 5DJ1A 1OHWA 3PD6B 3EZSA 1PG8A 3EIBA 1AJRA 1M0QA 3BC8A 4PFNA 1BJOB 2FM1A 4CXRA 3A9YA 3T32A 2R2NA 5EQCA 5FT5A 3P1TA 2HUUA 3G8MA 1GBNA 3VOMA 3NU8A 1MDXA 1TATA 1TOEA 1WKHA 2CH2A 2QBTA 2AATA 1AIAA 3I4JA 2VMZA 2C0RA 3FCRA 1TOJA 1YAAA 4JE5A 3RI6A 2W7EA 1AMSA 3PJ0A 1V2FA 3KGWA 2Z9VA 1ELQA 1OHYA 1RVUA 1BJNA 2JGTA 5F9SA 1ARHA 2CH1A 2BI5A 1YIZA 1ZOBA 3MADA 1IAXA 4JEVA 3FDBA 1YOOA 2O7CA 3BN1A 3LWSA 3E6GA 3OKSA 2OQXA 1WYUA 1CQ8A 1YJZA 4OT8A 1B8GA 2BWOA 3COGA 3G7QA 2ZY3A 2E7IA 4R5FA 2W8UA 5EUNA 1D7VA 1MDOA 2C81A 2AY2A 5F8VA 1QIRA 2EH6A 4W5KA 3MBBA 3GJUA 4ZLVA 4HF8A 3CBFA 5KTBA 4F5MA 1GC3A 2VLHA 3NTJA 4BQ0A 5HDMA 1IX8A 3FTBA 3H7FA 3F9TA 3HLMA 4DBCA 3GWPA 2Z1ZA 3AENA 2YCPA 2HORA 4WYDA 3EI5A 5AX8A 2EZ1A 2G6WA 1M0NA 2DR1A 2DGLA 1IVRA 3F0HA 3M5UA 2VMVA 3LVKA 3FZ7A 3BS8A 3FKDA 3LY1A 4Y0HA 3VAXA 4JEYA 5E4ZA 1CZEA 3DR7A 4MKJA 4ZSWA 2WK7A 3LVMA 2ZYJA 1EQBA 1O4SA 4E3RA 2HOYA 3QI6A 3PD6A 1LC8A 1B9IA 1QJ5A 3HL2A 1M32A 3E2ZB 4W1VA 2AY4A 2VGSA 1WKGA 1DTYA 1N2TA 4GE7A 4ZAHA 3HVYA 3A9XA 1IJIA 1BJOA 4TN4A 3RCHB 1LS3A 3MAUA 1CZCA 1LC5A 3A9ZA 2JISA 1C0NA 3TCMA 2JJEA 4OBUA 3HDOA 3CAIA 4LW2A 4H63Q 3E2FA 2QSRA 1AHFA 1AHYA 1B5PA 5EAAA 5C6UA 3DZZA 4AO4A 2VMSA 1B4XA 3JW9A 4CBRA 4JF1A 3PPLA 4MY5A 4ATPA 1I48A 1FC4A 4JEXA 1ASLA 4WLHA 4DGTA 3QM2A 4K2MA 3NU7A 1AIBA 2W7GA 1MAPA 3ATHA 4IXSA 4XJMA 3ZRQA 4E77A 3PGYA 1W3UA 4W91A 4WYAA 2O0RA 1PFFA 2E54A 2BI3A 3GBXA 2BIGA 2JJHA 1BS0A 3RBFA 1ASEA 5G09A 1CL1A 1LC7A 3N0LA 2ZP7A 4LNJA 4WP0A 4ATQA 1GC0A 2YKVA 1G7XA 1O69A 2VI8A 3ASBA 5I92A 8AATA 3N4XA 3N5MA 3LV2A 1KL2A 2BWPA 2X8UA 3JU7A 4WYEA 4XQ2A 4IXOA 1V2DA 1UU1A 2EZ2A 3FRKA 5IWQA 2G7JA 2XH1A 4ADBA 3B8XA 1N31A 3WGBA 3KGXA 1AHEA 3MKJA 4W1WA 1ASDA 5EAVA 3ELPA 2Z20A 4A72A 2VMRA 1BJWA 4IXZA 3WLXA 2C7TA 1ASCA 2FN6A 4IYOB 1ZODA 1RV4A 2BI9A 4U1TA 4WB0B 1J04A 4R8DA 1ELUA 1YJYA 2VMPA 2JG2A 2QB2A 3E77A 2ZSMA 1X0MA 1AMRA 4ITGA 5LH9A 3WCOA 1SF2A 5M4DA 5FT4A 4JF0A 2WK8A 1YJSA 3E2ZA 3KKIA 2WB6A 2YRIA 3BCBA 3FVXA 2W7JA 2CSTA 3JWBA 4JE5D 2W8JA 4Y0IA 3RCHA 1CQ6A 1JF9A 2DGKA 3TFUA 2OKJA 4H51A 1ASNA 1Z3ZA 2HOZA 1WYTB 5G4IA 1I43A 3AOWA 5K8BA 2NMPA 4KAMA 5M49A 1AAWA 2AY1A 3WY7A 2VIBA 4ADEA 3PIUA 1BT4A 2OATA 3AEJA 4P3MA 1N8PA 4RKDA 1H0CA 1D7SA 3D6KA 4N0BA 4AH3A 3I16A 4WYFA 1CQ7A 1EG5A 3B46A 3AATA 3FVUA 3ZRPA 4R5ZA 5D5SA 9AATA 1W23A 2R0TA 2BIEA 4GE4A 1DGEA 1MLYA 4WYCA 4Y0DA 3FFRA 1AMAA 4ADDA 3DXWA 3FZ6A 2YKUA 1V2EA 2PB0A 2HUIA 4PVFA 1AY4A 4UQVA 1VEFA 4K2IA 1ZC9A 3FQ8A 3EUCA 5EIGB 4N0WA 4F5KA 3B1EA 1G7WA 5E3KA 2BKWA 1TOKA 1X2AA 3AELA 1KKPA 3NDNA 2AEUA 2QMAA 1D7RA 1U08A 3QN6A 3L44A 3QPGA 2AY6A 2BI2A 3CQ5A 1IUGA 1AMQA 3AEOA 2KFPA 2X5FA 1AKBA 1MAQA 1OXPA 4KXKA 2ZY2A 4WD2A 1XI9A 1ASBA 3PA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VP4 A;  3CQ4 A;  2CY8 A;  1LW4 A;  4AZK A;  2Z1Y A;  2CIN A;  4GEB A;  4IYO A;  4UHM A;  2W7D A;  3R4T A;  2W8W A;  1GEY A;  4MGR A;  1YNU A;  1OXO A;  2GB3 A;  4WB0 A;  4OYT A;  2YCT A;  2W7F A;  3RQ1 A;  2JJF A;  1MLZ A;  1C7N A;  2ZSL A;  2VLF A;  3P6K A;  3N75 A;  2D65 A;  4LNM A;  1S07 A;  1C4K A;  2EGY A;  4ISY A;  4WBT A;  5DB5 A;  2VMX A;  4AO9 A;  1M0O A;  4ZM4 A;  4ZDL A;  3UWC A;  2Q7W A;  3L8A A;  3Q8N A;  1MDZ A;  3DC1 A;  1EJI A;  3DR4 A;  5BJ3 A;  1LKC A;  1WYT A;  3BWN C;  2CJD A;  2VGW A;  4GRX A;  2EO5 A;  5G2Q A;  1G4V A;  1LK9 A;  2FNI A;  5J8Q A;  1ORD A;  3HBX A;  1QIT A;  3II0 A;  1P3W A;  4R2N A;  4IW7 A;  5FT6 A;  4A0H A;  2Z9X A;  1GC2 A;  2ZY5 A;  1O61 A;  2CJH A;  1ARG A;  4MQP A;  3JTX A;  4WYG A;  2GMU A;  3DRD A;  4WXF A;  1S08 A;  4AOA A;  1JG8 A;  4IX8 A;  2WK9 A;  4TV7 A;  2FYF A;  3QGU A;  4BMK A;  4GE9 A;  1GD9 A;  2DGM A;  3BB8 A;  3QHX A;  4CVQ A;  1E5E A;  2BHX A;  2HZP A;  3GZD C;  1UKJ A;  4EB5 A;  3AV7 A;  1BQD A;  2D63 A;  2GQN A;  4ZWM A;  3K40 A;  2PO3 A;  3ZRR A;  4EMY A;  3BCA A;  3AEJ C;  4XAU A;  4XK1 A;  4Q31 A;  1XEY A;  5EIG A;  1AJS B;  3ASA A;  3NYU A;  1AHG A;  1DJ9 A;  1KMK A;  1SZS A;  3MC6 C;  4M2M A;  3EI8 A;  2YKY A;  2XBN A;  2YCN A;  4L0O A;  1CS1 A;  1M7Y A;  3NNK A;  5M4B A;  5LHA A;  3FSL A;  1DJU A;  5JAY A;  1V72 A;  3A8U X;  1YIY A;  2CB1 A;  3WGC A;  3H14 A;  3TFT A;  2JJG A;  2D61 A;  4EFF A;  3AOV A;  2D7Y A;  4LC3 A;  2AY3 A;  1UU2 A;  4DQ6 A;  3B1D A;  1D2F A;  3GSB A;  2AEV A;  3VK3 A;  4F5G A;  1S09 A;  3BWN A;  4XJP A;  5G2P A;  1Y4I A;  2W8V A;  1IX6 A;  4P7Y A;  3FDD A;  3GZC A;  4GSA A;  2VYC A;  1AKC A;  4MSO A;  4XJO A;  1RVY A;  1TOG A;  2HP1 A;  2VIA A;  4W8I A;  1AAM A;  1TPL A;  3NYS A;  4NOG A;  1TAS A;  3NUI A;  2TPL A;  3JWA A;  4WXG A;  1I41 A;  4FL0 A;  1CJ0 A;  4PFF A;  4F4E A;  4IY7 A;  3ZZJ A;  1AY8 A;  3HMU A;  1GC4 A;  4JEW A;  4RAE A;  1M0P A;  4RM1 A;  2OGE A;  3GZD A;  4UHO A;  2E7J A;  2YHK A;  2GMS A;  3LG0 A;  3RUY A;  4OTL A;  1GEW A;  3TQX A;  1KMJ A;  2YOB A;  3A2B A;  4OCA A;  1JS6 A;  3PDB B;  4F5F A;  7AAT A;  3NX3 A;  4B98 A;  3EZ1 A;  1B5O A;  1GEX A;  2VGT A;  3W1J A;  2X3L A;  4W1X A;  1DKA A;  1KL1 A;  4A6U A;  1ART A;  2VMY A;  1VJO A;  4RIT A;  2HP2 A;  3MC6 A;  1PMO A;  1SZU A;  1X28 A;  2D64 A;  2R5E A;  2VMU A;  4RJY A;  5DJ9 A;  4ZSY A;  3AEP A;  4A0G A;  3FQA A;  2OKK A;  1WST A;  4A6R A;  4TMR A;  1B9H A;  1M4N A;  2ZUK A;  3ECD A;  4J5U A;  1D7U A;  5D95 A;  4BA4 A;  2VGZ A;  3EIA A;  3VK4 A;  2D5Y A;  1FG7 A;  4OC9 A;  2CAN A;  3FVS A;  1AJS A;  2VI9 A;  2BIA A;  3LVL B;  3ZZK A;  3AEM C;  4JEZ A;  5HXX A;  2W7H A;  4U2H A;  4XEW A;  4O6Z A;  1BW0 A;  2PB2 A;  4B9B A;  4OMA A;  3WZF A;  4Q6R A;  2V1P A;  1TAR A;  3HQT A;  2BI1 A;  1BQA A;  5BJ4 A;  2CTZ A;  3ISL A;  3EI9 A;  1MGV A;  2HOX A;  1IX7 A;  4WLJ A;  1GCK A;  1DJE A;  3DYD A;  3KE3 A;  4ZWV A;  1AX4 A;  4KYO A;  2Z9W A;  2CFB A;  2WKA A;  4EB7 A;  1T3I A;  4LNL A;  3JZL A;  3EI6 A;  4MKK A;  2ZY4 A;  1WYV B;  2VMW A;  1QJ3 A;  3GET A;  3HT4 A;  4F5H A;  3F6T A;  3I5T A;  1M6S A;  4I8A A;  1ARI A;  2R5C B;  4ZDO A;  1KKJ A;  2CJG A;  4RKC A;  4UOY A;  4A0R A;  1C7O A;  1LW5 A;  5EFS A;  3E9K A;  3MEB A;  4A00 A;  2ORD A;  1CL2 A;  3PDX A;  3IF2 A;  3TAT A;  1IAY A;  4LW4 A;  3B1C A;  3FFH A;  5G0A A;  1SFF A;  2E7U A;  2VMQ A;  3W1H A;  3FZ8 A;  3K7Y A;  4WXB A;  3W1I A;  2X5D A;  4PIW A;  3EI7 A;  1OHV A;  1X29 A;  2Z67 A;  2HUF A;  3PDB A;  4MQQ A;  3MAF B;  2AY8 A;  4Q76 A;  4RIZ A;  3VP6 A;  2EPJ A;  1TOI A;  1AHX A;  2BWN A;  1S06 A;  1AIC A;  1ASM A;  1IBJ A;  3AEM A;  3NUB A;  1FG3 A;  4K2B A;  1J32 A;  4M2K A;  2BYL A;  4Q75 A;  4XJL A;  1W7L A;  1BKG A;  2VMO A;  2YKX A;  3USF A;  3UAK A;  4F5L A;  2C44 A;  2GSA A;  2D7Z A;  3RBL A;  2W7L A;  5TF5 A;  1S0A A;  2DKJ A;  4E3Q A;  1QIS A;  3IHJ A;  2VGU A;  3E2Y A;  2QA3 A;  4J8L A;  2FQ6 A;  2Z61 A;  4CBS A;  2YRR A;  4FFC A;  5EUD A;  4ZDP A;  3DXV A;  3G0T A;  3ACZ A;  3NRA A;  3WKR A;  1PMM A;  2V0Y A;  1W7M A;  2VGV A;  3R9A A;  5FT8 A;  3FQ7 A;  5HHY A;  4BHD A;  3BV0 A;  3NYT A;  4ITX A;  1I29 A;  3CQ6 A;  3GR9 A;  3K28 A;  4M2J A;  2ZJG A;  3ELE A;  4QGR A;  1E5F A;  1AY5 A;  3QBO A;  4MQR A;  2D66 A;  1WYV A;  1WYU B;  4AZJ A;  1ECX A;  1W7N A;  1RV3 A;  2AY7 A;  2W7M A;  4F5J A;  1ARS A;  2W8T A;  4BA5 A;  2QLR A;  1GDE A;  5M46 A;  1SZK A;  1Z7D A;  1ASG A;  4CXQ A;  2R5C A;  4HVK A;  3WCN A;  1ASF A;  2OGA A;  5DX5 A;  1H1C A;  3FD0 A;  2AY5 A;  3UE8 A;  1JS3 A;  3WX9 A;  2W7K A;  3LVJ A;  2DOU A;  1BJ4 A;  1G4X A;  5EUE A;  2DKB A;  3VK2 A;  1QGN A;  1UU0 A;  2W7I A;  2FNU A;  3BWO A;  4ADC A;  3OP7 A;  4GDY A;  2Z9U A;  4F5I A;  1C7G A;  4EU1 A;  3WKS A;  4E1O A;  2QB3 A;  1DFO A;  2O1B A;  1OAT A;  3PAA A;  2VMN A;  1QZ9 A;  2BYJ A;  1ASA A;  1C9C A;  3AEN B;  3BCX A;  4RJ0 A;  3DOD A;  4ZAS A;  3MAF A;  2RFV A;  5E5I A;  4UHN A;  1SPA A;  2ZC0 A;  4ZM3 A;  2F8J A;  1DGD A;  1AKA A;  4OBV A;  5G4J A;  2AY9 A;  1O62 A;  4A6T A;  1SVV A;  2VMT A;  3DU4 A;  4RLG A;  4A0F A;  5DJ1 A;  1OHW A;  3PD6 B;  3EZS A;  1PG8 A;  3EIB A;  1AJR A;  1M0Q A;  3BC8 A;  4PFN A;  1BJO B;  2FM1 A;  4CXR A;  3A9Y A;  3T32 A;  2R2N A;  5EQC A;  5FT5 A;  3P1T A;  2HUU A;  3G8M A;  1GBN A;  3VOM A;  3NU8 A;  1MDX A;  1TAT A;  1TOE A;  1WKH A;  2CH2 A;  2QBT A;  2AAT A;  1AIA A;  3I4J A;  2VMZ A;  2C0R A;  3FCR A;  1TOJ A;  1YAA A;  4JE5 A;  3RI6 A;  2W7E A;  1AMS A;  3PJ0 A;  1V2F A;  3KGW A;  2Z9V A;  1ELQ A;  1OHY A;  1RVU A;  1BJN A;  2JGT A;  5F9S A;  1ARH A;  2CH1 A;  2BI5 A;  1YIZ A;  1ZOB A;  3MAD A;  1IAX A;  4JEV A;  3FDB A;  1YOO A;  2O7C A;  3BN1 A;  3LWS A;  3E6G A;  3OKS A;  2OQX A;  1WYU A;  1CQ8 A;  1YJZ A;  4OT8 A;  1B8G A;  2BWO A;  3COG A;  3G7Q A;  2ZY3 A;  2E7I A;  4R5F A;  2W8U A;  5EUN A;  1D7V A;  1MDO A;  2C81 A;  2AY2 A;  5F8V A;  1QIR A;  2EH6 A;  4W5K A;  3MBB A;  3GJU A;  4ZLV A;  4HF8 A;  3CBF A;  4F5M A;  1GC3 A;  2VLH A;  3NTJ A;  4BQ0 A;  5HDM A;  1IX8 A;  3FTB A;  3H7F A;  3F9T A;  3HLM A;  4DBC A;  3GWP A;  2Z1Z A;  3AEN A;  2YCP A;  2HOR A;  4WYD A;  3EI5 A;  5AX8 A;  2EZ1 A;  2G6W A;  1M0N A;  2DR1 A;  2DGL A;  1IVR A;  3F0H A;  3M5U A;  2VMV A;  3LVK A;  3FZ7 A;  3BS8 A;  3FKD A;  3LY1 A;  4Y0H A;  3VAX A;  4JEY A;  5E4Z A;  1CZE A;  3DR7 A;  4MKJ A;  4ZSW A;  2WK7 A;  3LVM A;  2ZYJ A;  1EQB A;  1O4S A;  4E3R A;  2HOY A;  3QI6 A;  3PD6 A;  1LC8 A;  1B9I A;  1QJ5 A;  3HL2 A;  1M32 A;  3E2Z B;  4W1V A;  2AY4 A;  2VGS A;  1WKG A;  1DTY A;  1N2T A;  4GE7 A;  4ZAH A;  3HVY A;  3A9X A;  1IJI A;  1BJO A;  4TN4 A;  3RCH B;  1LS3 A;  3MAU A;  1CZC A;  1LC5 A;  3A9Z A;  2JIS A;  1C0N A;  3TCM A;  2JJE A;  4OBU A;  3HDO A;  3CAI A;  4LW2 A;  3E2F A;  1AHF A;  1AHY A;  1B5P A;  5EAA A;  5C6U A;  3DZZ A;  4AO4 A;  2VMS A;  1B4X A;  3JW9 A;  4CBR A;  4JF1 A;  3PPL A;  4MY5 A;  4ATP A;  1I48 A;  1FC4 A;  4JEX A;  1ASL A;  4WLH A;  4DGT A;  3QM2 A;  4K2M A;  3NU7 A;  1AIB A;  2W7G A;  1MAP A;  3ATH A;  4IXS A;  4XJM A;  3ZRQ A;  4E77 A;  3PGY A;  1W3U A;  4W91 A;  4WYA A;  2O0R A;  1PFF A;  2E54 A;  2BI3 A;  3GBX A;  2BIG A;  2JJH A;  1BS0 A;  3RBF A;  1ASE A;  5G09 A;  1CL1 A;  1LC7 A;  3N0L A;  2ZP7 A;  4LNJ A;  4WP0 A;  4ATQ A;  1GC0 A;  2YKV A;  1G7X A;  1O69 A;  2VI8 A;  3ASB A;  5I92 A;  8AAT A;  3N5M A;  3LV2 A;  1KL2 A;  2BWP A;  2X8U A;  3JU7 A;  4WYE A;  4XQ2 A;  4IXO A;  1V2D A;  1UU1 A;  2EZ2 A;  3FRK A;  5IWQ A;  2XH1 A;  4ADB A;  3B8X A;  1N31 A;  3WGB A;  3KGX A;  1AHE A;  3MKJ A;  4W1W A;  1ASD A;  5EAV A;  3ELP A;  2Z20 A;  4A72 A;  2VMR A;  1BJW A;  4IXZ A;  3WLX A;  2C7T A;  1ASC A;  2FN6 A;  4IYO B;  1ZOD A;  1RV4 A;  2BI9 A;  4U1T A;  4WB0 B;  1J04 A;  4R8D A;  1ELU A;  1YJY A;  2VMP A;  2JG2 A;  2QB2 A;  3E77 A;  2ZSM A;  1X0M A;  1AMR A;  4ITG A;  5LH9 A;  3WCO A;  1SF2 A;  5M4D A;  5FT4 A;  4JF0 A;  2WK8 A;  1YJS A;  3E2Z A;  3KKI A;  2YRI A;  3BCB A;  3FVX A;  2W7J A;  2CST A;  3JWB A;  4JE5 D;  2W8J A;  4Y0I A;  3RCH A;  1CQ6 A;  1JF9 A;  2DGK A;  3TFU A;  2OKJ A;  4H51 A;  1ASN A;  1Z3Z A;  2HOZ A;  1WYT B;  5G4I A;  1I43 A;  3AOW A;  5K8B A;  2NMP A;  4KAM A;  5M49 A;  1AAW A;  2AY1 A;  3WY7 A;  2VIB A;  4ADE A;  3PIU A;  1BT4 A;  2OAT A;  3AEJ A;  4P3M A;  1N8P A;  4RKD A;  1H0C A;  1D7S A;  3D6K A;  4N0B A;  4AH3 A;  3I16 A;  4WYF A;  1CQ7 A;  1EG5 A;  3B46 A;  3AAT A;  3FVU A;  3ZRP A;  4R5Z A;  5D5S A;  9AAT A;  1W23 A;  2R0T A;  2BIE A;  4GE4 A;  1DGE A;  1MLY A;  4WYC A;  4Y0D A;  3FFR A;  1AMA A;  4ADD A;  3DXW A;  3FZ6 A;  2YKU A;  1V2E A;  2PB0 A;  2HUI A;  4PVF A;  1AY4 A;  4UQV A;  1VEF A;  4K2I A;  1ZC9 A;  3FQ8 A;  3EUC A;  5EIG B;  4N0W A;  4F5K A;  3B1E A;  1G7W A;  5E3K A;  2BKW A;  1TOK A;  1X2A A;  3AEL A;  1KKP A;  3NDN A;  2AEU A;  2QMA A;  1D7R A;  1U08 A;  3QN6 A;  3L44 A;  3QPG A;  2AY6 A;  2BI2 A;  3CQ5 A;  1IUG A;  1AMQ A;  3AEO A;  2X5F A;  1AKB A;  1MAQ A;  1OXP A;  4KXK A;  2ZY2 A;  4WD2 A;  1XI9 A;  1ASB A;  3PA9 A; 
#chains in the Genus database with same CATH topology
 1VP4 A;  3CQ4 A;  2CY8 A;  1LW4 A;  4AZK A;  2Z1Y A;  2CIN A;  4GEB A;  4IYO A;  4UHM A;  2W7D A;  3R4T A;  2W8W A;  1GEY A;  4MGR A;  1YNU A;  1OXO A;  2GB3 A;  4WB0 A;  4OYT A;  2YCT A;  2W7F A;  3RQ1 A;  2JJF A;  1MLZ A;  1C7N A;  2ZSL A;  2VLF A;  3P6K A;  3N75 A;  2D65 A;  4LNM A;  1S07 A;  1C4K A;  2EGY A;  4ISY A;  4WBT A;  5DB5 A;  2VMX A;  4AO9 A;  1M0O A;  4ZM4 A;  4ZDL A;  3UWC A;  2Q7W A;  3L8A A;  3Q8N A;  1MDZ A;  3DC1 A;  1EJI A;  3DR4 A;  5BJ3 A;  1LKC A;  1WYT A;  3BWN C;  2CJD A;  2VGW A;  4GRX A;  2EO5 A;  3N4R A;  5G2Q A;  1G4V A;  1LK9 A;  2FNI A;  5J8Q A;  1ORD A;  3HBX A;  1QIT A;  3II0 A;  1P3W A;  4R2N A;  4IW7 A;  5FT6 A;  4A0H A;  2Z9X A;  1GC2 A;  2ZY5 A;  1O61 A;  2CJH A;  1ARG A;  4MQP A;  3JTX A;  4WYG A;  2GMU A;  3DRD A;  4WXF A;  1S08 A;  4AOA A;  1JG8 A;  4IX8 A;  2WK9 A;  4TV7 A;  2FYF A;  3QGU A;  4BMK A;  4GE9 A;  1GD9 A;  2DGM A;  3BB8 A;  3QHX A;  4CVQ A;  1E5E A;  2BHX A;  2HZP A;  3GZD C;  1UKJ A;  4EB5 A;  3AV7 A;  1BQD A;  2D63 A;  2GQN A;  4ZWM A;  3K40 A;  2PO3 A;  3ZRR A;  4EMY A;  3BCA A;  3AEJ C;  4XAU A;  4XK1 A;  4Q31 A;  1XEY A;  5EIG A;  1AJS B;  3ASA A;  3NYU A;  1AHG A;  1DJ9 A;  1KMK A;  1SZS A;  3MC6 C;  4M2M A;  3EI8 A;  2YKY A;  2XBN A;  2YCN A;  4L0O A;  1CS1 A;  1M7Y A;  3NNK A;  5M4B A;  5LHA A;  2EYQ A;  3FSL A;  1DJU A;  5JAY A;  1V72 A;  3A8U X;  1YIY A;  2CB1 A;  3WGC A;  3H14 A;  3TFT A;  2JJG A;  2D61 A;  4EFF A;  3AOV A;  2D7Y A;  4LC3 A;  2AY3 A;  1UU2 A;  4DQ6 A;  3B1D A;  1D2F A;  3GSB A;  2AEV A;  3VK3 A;  4F5G A;  1S09 A;  3BWN A;  4XJP A;  5G2P A;  1Y4I A;  2W8V A;  1IX6 A;  4P7Y A;  3FDD A;  3GZC A;  4GSA A;  2VYC A;  1AKC A;  4MSO A;  4XJO A;  1RVY A;  1TOG A;  2HP1 A;  2VIA A;  4W8I A;  1AAM A;  1TPL A;  3NYS A;  4NOG A;  1TAS A;  3NUI A;  2TPL A;  3JWA A;  4WXG A;  1I41 A;  4FL0 A;  1CJ0 A;  4PFF A;  4F4E A;  4IY7 A;  3ZZJ A;  1AY8 A;  3HMU A;  1GC4 A;  4JEW A;  4RAE A;  1M0P A;  4RM1 A;  2OGE A;  3GZD A;  4UHO A;  2E7J A;  2YHK A;  2GMS A;  3LG0 A;  3RUY A;  3N7N A;  4OTL A;  1GEW A;  3TQX A;  1KMJ A;  2YOB A;  3A2B A;  4OCA A;  1JS6 A;  3PDB B;  4F5F A;  7AAT A;  3NX3 A;  4B98 A;  3EZ1 A;  1B5O A;  1GEX A;  2VGT A;  4K05 A;  3W1J A;  2X3L A;  4W1X A;  1DKA A;  1KL1 A;  4A6U A;  1ART A;  2VMY A;  1VJO A;  4RIT A;  2HP2 A;  3MC6 A;  1PMO A;  1SZU A;  1X28 A;  2D64 A;  2R5E A;  2VMU A;  4RJY A;  5DJ9 A;  4ZSY A;  3AEP A;  4A0G A;  3FQA A;  2OKK A;  1WST A;  4A6R A;  4TMR A;  1B9H A;  1M4N A;  2ZUK A;  3ECD A;  4J5U A;  1D7U A;  5D95 A;  4BA4 A;  2VGZ A;  3EIA A;  3VK4 A;  2D5Y A;  1FG7 A;  4OC9 A;  2CAN A;  3FVS A;  1AJS A;  2VI9 A;  2BIA A;  3LVL B;  3ZZK A;  3AEM C;  4JEZ A;  5HXX A;  2W7H A;  4U2H A;  4XEW A;  4O6Z A;  1BW0 A;  2PB2 A;  4B9B A;  4OMA A;  3WZF A;  4Q6R A;  2V1P A;  1TAR A;  3HQT A;  2BI1 A;  1BQA A;  5BJ4 A;  2CTZ A;  3ISL A;  3EI9 A;  1MGV A;  2HOX A;  1IX7 A;  4WLJ A;  1GCK A;  1DJE A;  3DYD A;  3KE3 A;  4ZWV A;  1AX4 A;  4KYO A;  2Z9W A;  2CFB A;  2WKA A;  4EB7 A;  1T3I A;  4LNL A;  3JZL A;  3EI6 A;  4MKK A;  2FKI A;  2ZY4 A;  1WYV B;  2VMW A;  1QJ3 A;  3GET A;  3HT4 A;  4F5H A;  3F6T A;  3I5T A;  1M6S A;  4I8A A;  1ARI A;  2R5C B;  4ZDO A;  1KKJ A;  2CJG A;  4RKC A;  4UOY A;  4A0R A;  1C7O A;  1LW5 A;  5EFS A;  3E9K A;  3MEB A;  4A00 A;  2ORD A;  1CL2 A;  3PDX A;  3IF2 A;  3TAT A;  1IAY A;  4LW4 A;  3B1C A;  3FFH A;  5G0A A;  1SFF A;  2E7U A;  2VMQ A;  3W1H A;  3FZ8 A;  3K7Y A;  4WXB A;  3W1I A;  2X5D A;  4PIW A;  3EI7 A;  1OHV A;  1X29 A;  2Z67 A;  2HUF A;  3PDB A;  4MQQ A;  3MAF B;  2AY8 A;  4Q76 A;  4RIZ A;  3VP6 A;  2EPJ A;  1TOI A;  1AHX A;  2BWN A;  1S06 A;  1AIC A;  1ASM A;  2A1V A;  1IBJ A;  3AEM A;  3NUB A;  1FG3 A;  4K2B A;  1J32 A;  4M2K A;  2BYL A;  4Q75 A;  4XJL A;  1W7L A;  1BKG A;  2VMO A;  1KAF A;  2YKX A;  3USF A;  3UAK A;  4F5L A;  2C44 A;  2GSA A;  2D7Z A;  3RBL A;  2W7L A;  5TF5 A;  1S0A A;  2DKJ A;  4E3Q A;  1QIS A;  3IHJ A;  2VGU A;  3E2Y A;  2QA3 A;  4J8L A;  2FQ6 A;  2Z61 A;  4CBS A;  2YRR A;  4FFC A;  5EUD A;  4ZDP A;  3DXV A;  3G0T A;  3ACZ A;  3NRA A;  3WKR A;  1PMM A;  2V0Y A;  1W7M A;  2VGV A;  3R9A A;  5FT8 A;  3FQ7 A;  5HHY A;  4BHD A;  3BV0 A;  3NYT A;  4ITX A;  1I29 A;  3CQ6 A;  3GR9 A;  3K28 A;  4M2J A;  2ZJG A;  3ELE A;  4QGR A;  1E5F A;  1AY5 A;  3QBO A;  4MQR A;  2D66 A;  1WYV A;  3H9X A;  1WYU B;  4AZJ A;  1ECX A;  1W7N A;  1RV3 A;  2AY7 A;  2W7M A;  4F5J A;  1ARS A;  2W8T A;  4BA5 A;  2QLR A;  1GDE A;  5M46 A;  1SZK A;  1Z7D A;  1ASG A;  4CXQ A;  2R5C A;  4HVK A;  3WCN A;  3N4S A;  1ASF A;  2OGA A;  5DX5 A;  1H1C A;  3FD0 A;  2AY5 A;  3UE8 A;  1JS3 A;  3WX9 A;  2W7K A;  3LVJ A;  2DOU A;  1BJ4 A;  1G4X A;  5EUE A;  2DKB A;  3VK2 A;  1QGN A;  1UU0 A;  2W7I A;  2FNU A;  3BWO A;  4ADC A;  3OP7 A;  4GDY A;  2Z9U A;  4F5I A;  1C7G A;  4EU1 A;  3WKS A;  4E1O A;  2QB3 A;  1DFO A;  2O1B A;  1OAT A;  3PAA A;  2VMN A;  1QZ9 A;  2BYJ A;  1ASA A;  1C9C A;  3AEN B;  3BCX A;  4RJ0 A;  3DOD A;  4ZAS A;  3MAF A;  2RFV A;  5E5I A;  4UHN A;  1SPA A;  2ZC0 A;  4ZM3 A;  2F8J A;  1DGD A;  1AKA A;  4OBV A;  5G4J A;  2AY9 A;  1O62 A;  4A6T A;  1SVV A;  2VMT A;  3DU4 A;  4RLG A;  4A0F A;  5DJ1 A;  1OHW A;  3PD6 B;  3EZS A;  1PG8 A;  3EIB A;  1AJR A;  1M0Q A;  3BC8 A;  4PFN A;  1BJO B;  2FM1 A;  4CXR A;  3A9Y A;  3T32 A;  2R2N A;  5EQC A;  5FT5 A;  3P1T A;  2HUU A;  3G8M A;  1GBN A;  3VOM A;  3NU8 A;  1MDX A;  1TAT A;  1TOE A;  1WKH A;  2CH2 A;  2QBT A;  2AAT A;  1AIA A;  3I4J A;  2VMZ A;  2C0R A;  3FCR A;  1TOJ A;  1YAA A;  4JE5 A;  3RI6 A;  2W7E A;  1AMS A;  3PJ0 A;  1V2F A;  3KGW A;  2Z9V A;  1ELQ A;  1OHY A;  1RVU A;  1BJN A;  2JGT A;  5F9S A;  1ARH A;  2CH1 A;  2BI5 A;  1YIZ A;  1ZOB A;  3MAD A;  1IAX A;  4JEV A;  3FDB A;  1YOO A;  2O7C A;  3BN1 A;  3LWS A;  3E6G A;  3OKS A;  2OQX A;  1WYU A;  1CQ8 A;  1YJZ A;  4OT8 A;  1B8G A;  2BWO A;  3COG A;  3G7Q A;  2ZY3 A;  2E7I A;  4R5F A;  2W8U A;  5EUN A;  1D7V A;  1MDO A;  2C81 A;  2AY2 A;  5F8V A;  1QIR A;  2EH6 A;  4W5K A;  3MBB A;  3GJU A;  4ZLV A;  4HF8 A;  3CBF A;  5KTB A;  4F5M A;  1GC3 A;  2VLH A;  3NTJ A;  4BQ0 A;  5HDM A;  1IX8 A;  3FTB A;  3H7F A;  3F9T A;  3HLM A;  4DBC A;  3GWP A;  2Z1Z A;  3AEN A;  2YCP A;  2HOR A;  4WYD A;  3EI5 A;  5AX8 A;  2EZ1 A;  2G6W A;  1M0N A;  2DR1 A;  2DGL A;  1IVR A;  3F0H A;  3M5U A;  2VMV A;  3LVK A;  3FZ7 A;  3BS8 A;  3FKD A;  3LY1 A;  4Y0H A;  3VAX A;  4JEY A;  5E4Z A;  1CZE A;  3DR7 A;  4MKJ A;  4ZSW A;  2WK7 A;  3LVM A;  2ZYJ A;  1EQB A;  1O4S A;  4E3R A;  2HOY A;  3QI6 A;  3PD6 A;  1LC8 A;  1B9I A;  1QJ5 A;  3HL2 A;  1M32 A;  3E2Z B;  4W1V A;  2AY4 A;  2VGS A;  1WKG A;  1DTY A;  1N2T A;  4GE7 A;  4ZAH A;  3HVY A;  3A9X A;  1IJI A;  1BJO A;  4TN4 A;  3RCH B;  1LS3 A;  3MAU A;  1CZC A;  1LC5 A;  3A9Z A;  2JIS A;  1C0N A;  3TCM A;  2JJE A;  4OBU A;  3HDO A;  3CAI A;  4LW2 A;  4H63 Q;  3E2F A;  2QSR A;  1AHF A;  1AHY A;  1B5P A;  5EAA A;  5C6U A;  3DZZ A;  4AO4 A;  2VMS A;  1B4X A;  3JW9 A;  4CBR A;  4JF1 A;  3PPL A;  4MY5 A;  4ATP A;  1I48 A;  1FC4 A;  4JEX A;  1ASL A;  4WLH A;  4DGT A;  3QM2 A;  4K2M A;  3NU7 A;  1AIB A;  2W7G A;  1MAP A;  3ATH A;  4IXS A;  4XJM A;  3ZRQ A;  4E77 A;  3PGY A;  1W3U A;  4W91 A;  4WYA A;  2O0R A;  1PFF A;  2E54 A;  2BI3 A;  3GBX A;  2BIG A;  2JJH A;  1BS0 A;  3RBF A;  1ASE A;  5G09 A;  1CL1 A;  1LC7 A;  3N0L A;  2ZP7 A;  4LNJ A;  4WP0 A;  4ATQ A;  1GC0 A;  2YKV A;  1G7X A;  1O69 A;  2VI8 A;  3ASB A;  5I92 A;  8AAT A;  3N4X A;  3N5M A;  3LV2 A;  1KL2 A;  2BWP A;  2X8U A;  3JU7 A;  4WYE A;  4XQ2 A;  4IXO A;  1V2D A;  1UU1 A;  2EZ2 A;  3FRK A;  5IWQ A;  2G7J A;  2XH1 A;  4ADB A;  3B8X A;  1N31 A;  3WGB A;  3KGX A;  1AHE A;  3MKJ A;  4W1W A;  1ASD A;  5EAV A;  3ELP A;  2Z20 A;  4A72 A;  2VMR A;  1BJW A;  4IXZ A;  3WLX A;  2C7T A;  1ASC A;  2FN6 A;  4IYO B;  1ZOD A;  1RV4 A;  2BI9 A;  4U1T A;  4WB0 B;  1J04 A;  4R8D A;  1ELU A;  1YJY A;  2VMP A;  2JG2 A;  2QB2 A;  3E77 A;  2ZSM A;  1X0M A;  1AMR A;  4ITG A;  5LH9 A;  3WCO A;  1SF2 A;  5M4D A;  5FT4 A;  4JF0 A;  2WK8 A;  1YJS A;  3E2Z A;  3KKI A;  2WB6 A;  2YRI A;  3BCB A;  3FVX A;  2W7J A;  2CST A;  3JWB A;  4JE5 D;  2W8J A;  4Y0I A;  3RCH A;  1CQ6 A;  1JF9 A;  2DGK A;  3TFU A;  2OKJ A;  4H51 A;  1ASN A;  1Z3Z A;  2HOZ A;  1WYT B;  5G4I A;  1I43 A;  3AOW A;  5K8B A;  2NMP A;  4KAM A;  5M49 A;  1AAW A;  2AY1 A;  3WY7 A;  2VIB A;  4ADE A;  3PIU A;  1BT4 A;  2OAT A;  3AEJ A;  4P3M A;  1N8P A;  4RKD A;  1H0C A;  1D7S A;  3D6K A;  4N0B A;  4AH3 A;  3I16 A;  4WYF A;  1CQ7 A;  1EG5 A;  3B46 A;  3AAT A;  3FVU A;  3ZRP A;  4R5Z A;  5D5S A;  9AAT A;  1W23 A;  2R0T A;  2BIE A;  4GE4 A;  1DGE A;  1MLY A;  4WYC A;  4Y0D A;  3FFR A;  1AMA A;  4ADD A;  3DXW A;  3FZ6 A;  2YKU A;  1V2E A;  2PB0 A;  2HUI A;  4PVF A;  1AY4 A;  4UQV A;  1VEF A;  4K2I A;  1ZC9 A;  3FQ8 A;  3EUC A;  5EIG B;  4N0W A;  4F5K A;  3B1E A;  1G7W A;  5E3K A;  2BKW A;  1TOK A;  1X2A A;  3AEL A;  1KKP A;  3NDN A;  2AEU A;  2QMA A;  1D7R A;  1U08 A;  3QN6 A;  3L44 A;  3QPG A;  2AY6 A;  2BI2 A;  3CQ5 A;  1IUG A;  1AMQ A;  3AEO A;  2KFP A;  2X5F A;  1AKB A;  1MAQ A;  1OXP A;  4KXK A;  2ZY2 A;  4WD2 A;  1XI9 A;  1ASB A;  3PA9 A; 
#chains in the Genus database with same CATH homology
 1VP4 A;  3CQ4 A;  2CY8 A;  1LW4 A;  4AZK A;  2Z1Y A;  2CIN A;  4GEB A;  4IYO A;  4UHM A;  2W7D A;  3R4T A;  2W8W A;  1GEY A;  4MGR A;  1YNU A;  1OXO A;  2GB3 A;  4WB0 A;  4OYT A;  2YCT A;  2W7F A;  3RQ1 A;  2JJF A;  1MLZ A;  1C7N A;  2ZSL A;  2VLF A;  3P6K A;  3N75 A;  2D65 A;  4LNM A;  1S07 A;  1C4K A;  2EGY A;  4ISY A;  4WBT A;  5DB5 A;  2VMX A;  4AO9 A;  1M0O A;  4ZM4 A;  4ZDL A;  3UWC A;  2Q7W A;  3L8A A;  3Q8N A;  1MDZ A;  3DC1 A;  1EJI A;  3DR4 A;  5BJ3 A;  1LKC A;  1WYT A;  3BWN C;  2CJD A;  2VGW A;  4GRX A;  2EO5 A;  3N4R A;  5G2Q A;  1G4V A;  1LK9 A;  2FNI A;  5J8Q A;  1ORD A;  3HBX A;  1QIT A;  3II0 A;  1P3W A;  4R2N A;  4IW7 A;  5FT6 A;  4A0H A;  2Z9X A;  1GC2 A;  2ZY5 A;  1O61 A;  2CJH A;  1ARG A;  4MQP A;  3JTX A;  4WYG A;  2GMU A;  3DRD A;  4WXF A;  1S08 A;  4AOA A;  1JG8 A;  4IX8 A;  2WK9 A;  4TV7 A;  2FYF A;  3QGU A;  4BMK A;  4GE9 A;  1GD9 A;  2DGM A;  3BB8 A;  3QHX A;  4CVQ A;  1E5E A;  2BHX A;  2HZP A;  3GZD C;  1UKJ A;  4EB5 A;  3AV7 A;  1BQD A;  2D63 A;  2GQN A;  4ZWM A;  3K40 A;  2PO3 A;  3ZRR A;  4EMY A;  3BCA A;  3AEJ C;  4XAU A;  4XK1 A;  4Q31 A;  1XEY A;  5EIG A;  1AJS B;  3ASA A;  3NYU A;  1AHG A;  1DJ9 A;  1KMK A;  1SZS A;  3MC6 C;  4M2M A;  3EI8 A;  2YKY A;  2XBN A;  2YCN A;  4L0O A;  1CS1 A;  1M7Y A;  3NNK A;  5M4B A;  5LHA A;  2EYQ A;  3FSL A;  1DJU A;  5JAY A;  1V72 A;  3A8U X;  1YIY A;  2CB1 A;  3WGC A;  3H14 A;  3TFT A;  2JJG A;  2D61 A;  4EFF A;  3AOV A;  2D7Y A;  4LC3 A;  2AY3 A;  1UU2 A;  4DQ6 A;  3B1D A;  1D2F A;  3GSB A;  2AEV A;  3VK3 A;  4F5G A;  1S09 A;  3BWN A;  4XJP A;  5G2P A;  1Y4I A;  2W8V A;  1IX6 A;  4P7Y A;  3FDD A;  3GZC A;  4GSA A;  2VYC A;  1AKC A;  4MSO A;  4XJO A;  1RVY A;  1TOG A;  2HP1 A;  2VIA A;  4W8I A;  1AAM A;  1TPL A;  3NYS A;  4NOG A;  1TAS A;  3NUI A;  2TPL A;  3JWA A;  4WXG A;  1I41 A;  4FL0 A;  1CJ0 A;  4PFF A;  4F4E A;  4IY7 A;  3ZZJ A;  1AY8 A;  3HMU A;  1GC4 A;  4JEW A;  4RAE A;  1M0P A;  4RM1 A;  2OGE A;  3GZD A;  4UHO A;  2E7J A;  2YHK A;  2GMS A;  3LG0 A;  3RUY A;  3N7N A;  4OTL A;  1GEW A;  3TQX A;  1KMJ A;  2YOB A;  3A2B A;  4OCA A;  1JS6 A;  3PDB B;  4F5F A;  7AAT A;  3NX3 A;  4B98 A;  3EZ1 A;  1B5O A;  1GEX A;  2VGT A;  4K05 A;  3W1J A;  2X3L A;  4W1X A;  1DKA A;  1KL1 A;  4A6U A;  1ART A;  2VMY A;  1VJO A;  4RIT A;  2HP2 A;  3MC6 A;  1PMO A;  1SZU A;  1X28 A;  2D64 A;  2R5E A;  2VMU A;  4RJY A;  5DJ9 A;  4ZSY A;  3AEP A;  4A0G A;  3FQA A;  2OKK A;  1WST A;  4A6R A;  4TMR A;  1B9H A;  1M4N A;  2ZUK A;  3ECD A;  4J5U A;  1D7U A;  5D95 A;  4BA4 A;  2VGZ A;  3EIA A;  3VK4 A;  2D5Y A;  1FG7 A;  4OC9 A;  2CAN A;  3FVS A;  1AJS A;  2VI9 A;  2BIA A;  3LVL B;  3ZZK A;  3AEM C;  4JEZ A;  5HXX A;  2W7H A;  4U2H A;  4XEW A;  4O6Z A;  1BW0 A;  2PB2 A;  4B9B A;  4OMA A;  3WZF A;  4Q6R A;  2V1P A;  1TAR A;  3HQT A;  2BI1 A;  1BQA A;  5BJ4 A;  2CTZ A;  3ISL A;  3EI9 A;  1MGV A;  2HOX A;  1IX7 A;  4WLJ A;  1GCK A;  1DJE A;  3DYD A;  3KE3 A;  4ZWV A;  1AX4 A;  4KYO A;  2Z9W A;  2CFB A;  2WKA A;  4EB7 A;  1T3I A;  4LNL A;  3JZL A;  3EI6 A;  4MKK A;  2FKI A;  2ZY4 A;  1WYV B;  2VMW A;  1QJ3 A;  3GET A;  3HT4 A;  4F5H A;  3F6T A;  3I5T A;  1M6S A;  4I8A A;  1ARI A;  2R5C B;  4ZDO A;  1KKJ A;  2CJG A;  4RKC A;  4UOY A;  4A0R A;  1C7O A;  1LW5 A;  5EFS A;  3E9K A;  3MEB A;  4A00 A;  2ORD A;  1CL2 A;  3PDX A;  3IF2 A;  3TAT A;  1IAY A;  4LW4 A;  3B1C A;  3FFH A;  5G0A A;  1SFF A;  2E7U A;  2VMQ A;  3W1H A;  3FZ8 A;  3K7Y A;  4WXB A;  3W1I A;  2X5D A;  4PIW A;  3EI7 A;  1OHV A;  1X29 A;  2Z67 A;  2HUF A;  3PDB A;  4MQQ A;  3MAF B;  2AY8 A;  4Q76 A;  4RIZ A;  3VP6 A;  2EPJ A;  1TOI A;  1AHX A;  2BWN A;  1S06 A;  1AIC A;  1ASM A;  2A1V A;  1IBJ A;  3AEM A;  3NUB A;  1FG3 A;  4K2B A;  1J32 A;  4M2K A;  2BYL A;  4Q75 A;  4XJL A;  1W7L A;  1BKG A;  2VMO A;  2YKX A;  3USF A;  3UAK A;  4F5L A;  2C44 A;  2GSA A;  2D7Z A;  3RBL A;  2W7L A;  5TF5 A;  1S0A A;  2DKJ A;  4E3Q A;  1QIS A;  3IHJ A;  2VGU A;  3E2Y A;  2QA3 A;  4J8L A;  2FQ6 A;  2Z61 A;  4CBS A;  2YRR A;  4FFC A;  5EUD A;  4ZDP A;  3DXV A;  3G0T A;  3ACZ A;  3NRA A;  3WKR A;  1PMM A;  2V0Y A;  1W7M A;  2VGV A;  3R9A A;  5FT8 A;  3FQ7 A;  5HHY A;  4BHD A;  3BV0 A;  3NYT A;  4ITX A;  1I29 A;  3CQ6 A;  3GR9 A;  3K28 A;  4M2J A;  2ZJG A;  3ELE A;  4QGR A;  1E5F A;  1AY5 A;  3QBO A;  4MQR A;  2D66 A;  1WYV A;  3H9X A;  1WYU B;  4AZJ A;  1ECX A;  1W7N A;  1RV3 A;  2AY7 A;  2W7M A;  4F5J A;  1ARS A;  2W8T A;  4BA5 A;  2QLR A;  1GDE A;  5M46 A;  1SZK A;  1Z7D A;  1ASG A;  4CXQ A;  2R5C A;  4HVK A;  3WCN A;  3N4S A;  1ASF A;  2OGA A;  5DX5 A;  1H1C A;  3FD0 A;  2AY5 A;  3UE8 A;  1JS3 A;  3WX9 A;  2W7K A;  3LVJ A;  2DOU A;  1BJ4 A;  1G4X A;  5EUE A;  2DKB A;  3VK2 A;  1QGN A;  1UU0 A;  2W7I A;  2FNU A;  3BWO A;  4ADC A;  3OP7 A;  4GDY A;  2Z9U A;  4F5I A;  1C7G A;  4EU1 A;  3WKS A;  4E1O A;  2QB3 A;  1DFO A;  2O1B A;  1OAT A;  3PAA A;  2VMN A;  1QZ9 A;  2BYJ A;  1ASA A;  1C9C A;  3AEN B;  3BCX A;  4RJ0 A;  3DOD A;  4ZAS A;  3MAF A;  2RFV A;  5E5I A;  4UHN A;  1SPA A;  2ZC0 A;  4ZM3 A;  2F8J A;  1DGD A;  1AKA A;  4OBV A;  5G4J A;  2AY9 A;  1O62 A;  4A6T A;  1SVV A;  2VMT A;  3DU4 A;  4RLG A;  4A0F A;  5DJ1 A;  1OHW A;  3PD6 B;  3EZS A;  1PG8 A;  3EIB A;  1AJR A;  1M0Q A;  3BC8 A;  4PFN A;  1BJO B;  2FM1 A;  4CXR A;  3A9Y A;  3T32 A;  2R2N A;  5EQC A;  5FT5 A;  3P1T A;  2HUU A;  3G8M A;  1GBN A;  3VOM A;  3NU8 A;  1MDX A;  1TAT A;  1TOE A;  1WKH A;  2CH2 A;  2QBT A;  2AAT A;  1AIA A;  3I4J A;  2VMZ A;  2C0R A;  3FCR A;  1TOJ A;  1YAA A;  4JE5 A;  3RI6 A;  2W7E A;  1AMS A;  3PJ0 A;  1V2F A;  3KGW A;  2Z9V A;  1ELQ A;  1OHY A;  1RVU A;  1BJN A;  2JGT A;  5F9S A;  1ARH A;  2CH1 A;  2BI5 A;  1YIZ A;  1ZOB A;  3MAD A;  1IAX A;  4JEV A;  3FDB A;  1YOO A;  2O7C A;  3BN1 A;  3LWS A;  3E6G A;  3OKS A;  2OQX A;  1WYU A;  1CQ8 A;  1YJZ A;  4OT8 A;  1B8G A;  2BWO A;  3COG A;  3G7Q A;  2ZY3 A;  2E7I A;  4R5F A;  2W8U A;  5EUN A;  1D7V A;  1MDO A;  2C81 A;  2AY2 A;  5F8V A;  1QIR A;  2EH6 A;  4W5K A;  3MBB A;  3GJU A;  4ZLV A;  4HF8 A;  3CBF A;  5KTB A;  4F5M A;  1GC3 A;  2VLH A;  3NTJ A;  4BQ0 A;  5HDM A;  1IX8 A;  3FTB A;  3H7F A;  3F9T A;  3HLM A;  4DBC A;  3GWP A;  2Z1Z A;  3AEN A;  2YCP A;  2HOR A;  4WYD A;  3EI5 A;  5AX8 A;  2EZ1 A;  2G6W A;  1M0N A;  2DR1 A;  2DGL A;  1IVR A;  3F0H A;  3M5U A;  2VMV A;  3LVK A;  3FZ7 A;  3BS8 A;  3FKD A;  3LY1 A;  4Y0H A;  3VAX A;  4JEY A;  5E4Z A;  1CZE A;  3DR7 A;  4MKJ A;  4ZSW A;  2WK7 A;  3LVM A;  2ZYJ A;  1EQB A;  1O4S A;  4E3R A;  2HOY A;  3QI6 A;  3PD6 A;  1LC8 A;  1B9I A;  1QJ5 A;  3HL2 A;  1M32 A;  3E2Z B;  4W1V A;  2AY4 A;  2VGS A;  1WKG A;  1DTY A;  1N2T A;  4GE7 A;  4ZAH A;  3HVY A;  3A9X A;  1IJI A;  1BJO A;  4TN4 A;  3RCH B;  1LS3 A;  3MAU A;  1CZC A;  1LC5 A;  3A9Z A;  2JIS A;  1C0N A;  3TCM A;  2JJE A;  4OBU A;  3HDO A;  3CAI A;  4LW2 A;  4H63 Q;  3E2F A;  2QSR A;  1AHF A;  1AHY A;  1B5P A;  5EAA A;  5C6U A;  3DZZ A;  4AO4 A;  2VMS A;  1B4X A;  3JW9 A;  4CBR A;  4JF1 A;  3PPL A;  4MY5 A;  4ATP A;  1I48 A;  1FC4 A;  4JEX A;  1ASL A;  4WLH A;  4DGT A;  3QM2 A;  4K2M A;  3NU7 A;  1AIB A;  2W7G A;  1MAP A;  3ATH A;  4IXS A;  4XJM A;  3ZRQ A;  4E77 A;  3PGY A;  1W3U A;  4W91 A;  4WYA A;  2O0R A;  1PFF A;  2E54 A;  2BI3 A;  3GBX A;  2BIG A;  2JJH A;  1BS0 A;  3RBF A;  1ASE A;  5G09 A;  1CL1 A;  1LC7 A;  3N0L A;  2ZP7 A;  4LNJ A;  4WP0 A;  4ATQ A;  1GC0 A;  2YKV A;  1G7X A;  1O69 A;  2VI8 A;  3ASB A;  5I92 A;  8AAT A;  3N4X A;  3N5M A;  3LV2 A;  1KL2 A;  2BWP A;  2X8U A;  3JU7 A;  4WYE A;  4XQ2 A;  4IXO A;  1V2D A;  1UU1 A;  2EZ2 A;  3FRK A;  5IWQ A;  2G7J A;  2XH1 A;  4ADB A;  3B8X A;  1N31 A;  3WGB A;  3KGX A;  1AHE A;  3MKJ A;  4W1W A;  1ASD A;  5EAV A;  3ELP A;  2Z20 A;  4A72 A;  2VMR A;  1BJW A;  4IXZ A;  3WLX A;  2C7T A;  1ASC A;  2FN6 A;  4IYO B;  1ZOD A;  1RV4 A;  2BI9 A;  4U1T A;  4WB0 B;  1J04 A;  4R8D A;  1ELU A;  1YJY A;  2VMP A;  2JG2 A;  2QB2 A;  3E77 A;  2ZSM A;  1X0M A;  1AMR A;  4ITG A;  5LH9 A;  3WCO A;  1SF2 A;  5M4D A;  5FT4 A;  4JF0 A;  2WK8 A;  1YJS A;  3E2Z A;  3KKI A;  2WB6 A;  2YRI A;  3BCB A;  3FVX A;  2W7J A;  2CST A;  3JWB A;  4JE5 D;  2W8J A;  4Y0I A;  3RCH A;  1CQ6 A;  1JF9 A;  2DGK A;  3TFU A;  2OKJ A;  4H51 A;  1ASN A;  1Z3Z A;  2HOZ A;  1WYT B;  5G4I A;  1I43 A;  3AOW A;  5K8B A;  2NMP A;  4KAM A;  5M49 A;  1AAW A;  2AY1 A;  3WY7 A;  2VIB A;  4ADE A;  3PIU A;  1BT4 A;  2OAT A;  3AEJ A;  4P3M A;  1N8P A;  4RKD A;  1H0C A;  1D7S A;  3D6K A;  4N0B A;  4AH3 A;  3I16 A;  4WYF A;  1CQ7 A;  1EG5 A;  3B46 A;  3AAT A;  3FVU A;  3ZRP A;  4R5Z A;  5D5S A;  9AAT A;  1W23 A;  2R0T A;  2BIE A;  4GE4 A;  1DGE A;  1MLY A;  4WYC A;  4Y0D A;  3FFR A;  1AMA A;  4ADD A;  3DXW A;  3FZ6 A;  2YKU A;  1V2E A;  2PB0 A;  2HUI A;  4PVF A;  1AY4 A;  4UQV A;  1VEF A;  4K2I A;  1ZC9 A;  3FQ8 A;  3EUC A;  5EIG B;  4N0W A;  4F5K A;  3B1E A;  1G7W A;  5E3K A;  2BKW A;  1TOK A;  1X2A A;  3AEL A;  1KKP A;  3NDN A;  2AEU A;  2QMA A;  1D7R A;  1U08 A;  3QN6 A;  3L44 A;  3QPG A;  2AY6 A;  2BI2 A;  3CQ5 A;  1IUG A;  1AMQ A;  3AEO A;  2KFP A;  2X5F A;  1AKB A;  1MAQ A;  1OXP A;  4KXK A;  2ZY2 A;  4WD2 A;  1XI9 A;  1ASB A;  3PA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...