4N0WA

X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
416
structure length
416
Chain Sequence
SMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of a serine hydroxymethyltransferase from Burkholderia cenocepacia with covalently attached pyridoxal phosphate
rcsb
source organism Burkholderia cenocepacia
molecule tags Transferase
molecule keywords Serine hydroxymethyltransferase
total genus 162
structure length 416
sequence length 416
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0wA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4n0wA02
4A00A 3WCOA 4M2JA 1YJYA 1KMKA 3FZ7A 1KKPA 3FCRA 3E77A 4MKJA 3FD0A 1ELUA 1SF2A 3DODA 1BJWA 3RUYA 4A0RA 4PFFA 4DBCA 4F5KA 3MAFB 2FN6A 2YOBA 5E5IA 4J8LA 1ASDA 4R5FA 2W7GA 1O69A 2VLHA 2OGEA 2BI9A 5DJ1A 5M46A 5M4BA 1ARSA 1IUGA 3LV2A 4ZAHA 1GC4A 2CY8A 2YCTA 2R5CA 3II0A 3NUIA 3VK2A 1MAQA 3KE3A 4WYEA 4RM1A 3EI9A 1WYVB 2BWPA 2JGTA 3JZLA 5G2QA 2CJHA 4W1WA 4W91A 2E7UA 3RQ1A 2ZY3A 1B4XA 4ISYA 3W1HA 1XI9A 1VP4A 1KL2A 3KKIA 5HHYA 1DFOA 1M0PA 2GQNA 2F8JA 3NDNA 3NYTA 5EFSA 2CSTA 1AKBA 1DGDA 2AY3A 3BCBA 2VI9A 4Q75A 4A6UA 3HLMA 1C7NA 1TOJA 2YKXA 1TOIA 1WKHA 1BJOA 1G7XA 2CINA 2D66A 3WGCA 1V2DA 5G2PA 3NX3A 3KGXA 3TCMA 3NYSA 1GD9A 2C0RA 4LW2A 5I92A 1FG7A 3P1TA 1N8PA 1GBNA 1ARIA 4JEZA 3TATA 3EI5A 1Z3ZA 1ZODA 2Z20A 3OP7A 5G4JA 3R9AA 3NNKA 5J8QA 3E2ZB 4EU1A 2O1BA 2YKUA 3MC6C 1V2FA 1X2AA 3MKJA 1ASMA 2Z9UA 4RLGA 3BV0A 4GEBA 3ZRRA 2DGKA 4HVKA 1S07A 1M0QA 1O62A 2OKKA 4GDYA 4JF0A 1ARHA 3AELA 3GETA 3EI7A 1JF9A 1Z7DA 3PAAA 1V72A 3L8AA 1W7MA 1M7YA 1V2EA 3TQXA 1AKCA 3AENA 5EIGA 3VOMA 1W7LA 1DJ9A 1E5EA 4A0HA 5F9SA 1TOKA 5E4ZA 2YCPA 4ZSYA 3QPGA 3A9YA 3EIAA 2D7YA 3GBXA 3LG0A 3DRDA 1EJIA 2WKAA 1CZEA 1AHEA 4ZWMA 4ADBA 1M0OA 1IAXA 2C44A 4A0GA 2TPLA 4JE5D 2AY6A 4BA4A 1M0NA 2O7CA 1SVVA 4Q31A 1Y4IA 3HMUA 4Y0DA 3E6GA 1QJ3A 2QB3A 1FG3A 1GEXA 2HOZA 3CQ4A 1OHVA 3AV7A 2BIEA 2HZPA 3QN6A 1ARGA 3BC8A 4NOGA 3EZSA 3PJ0A 1GC3A 2VMUA 3B1EA 4F5GA 4ADEA 1KKJA 1I41A 4J5UA 3D6KA 3MBBA 2CFBA 4GRXA 1KL1A 2Z61A 1RVUA 4KAMA 2JJGA 4BMKA 3ZZJA 4A72A 4AZKA 4F5FA 2D5YA 1ASFA 2QA3A 2ZSMA 3GR9A 4ADDA 4F5JA 5HDMA 1GEYA 9AATA 1G4VA 1JG8A 3FFRA 4MSOA 4Y0HA 1CQ8A 5G0AA 3ECDA 2EZ2A 4AO4A 1B8GA 1GDEA 3USFA 4XAUA 1G4XA 3ZRPA 2R5EA 3AEJA 2EZ1A 3LVLB 2AY7A 1DTYA 4PIWA 2D7ZA 4F4EA 1AHGA 1SZSA 3AEPA 3HVYA 4W5KA 2R0TA 2OKJA 2DR1A 4WB0A 2VGUA 1BJNA 2OQXA 4WLJA 4ZDLA 2YRIA 4UQVA 4WXGA 1J04A 2VMNA 1X29A 3GSBA 4CVQA 1QZ9A 3WZFA 4ADCA 4BHDA 1AJSA 1CQ7A 4ZSWA 3JTXA 4E77A 1YOOA 2V1PA 3ATHA 3VK4A 1BW0A 1CZCA 4WXFA 1FC4A 1W23A 1TOGA 2DOUA 2NMPA 4E3QA 8AATA 3PA9A 4AO9A 2DGMA 2X5DA 1I29A 3DR4A 3VK3A 1M32A 4TV7A 2Z9XA 1WYVA 1VEFA 3B1CA 3CBFA 1ASBA 1TASA 1BQDA 4UHOA 4A6RA 4R8DA 1AIBA 4BA5A 1OHWA 3MEBA 3W1IA 4F5LA 4DQ6A 4U1TA 2GMUA 1QJ5A 4AZJA 3GZCA 4KXKA 1DGEA 4GSAA 2W7DA 1BJ4A 3GJUA 1LK9A 1AICA 3E2ZA 2VMXA 3FSLA 1IX7A 2GSAA 1AMQA 2HORA 3GZDC 1YAAA 1WYUB 1MDXA 3DYDA 3NRAA 4OMAA 1J32A 4K2BA 4UHMA 2AATA 4XJPA 4ZM4A 2JJHA 2VLFA 2W8TA 2VYCA 4P7YA 2FNIA 4MQPA 1I48A 2W7EA 3GWPA 5JAYA 3JU7A 1GEWA 1ASNA 2VGWA 3AOWA 2EO5A 2EPJA 2BYJA 3F0HA 3LVJA 3NTJA 3ACZA 1ELQA 4W8IA 2W7MA 1AJRA 3HDOA 1IX6A 3HQTA 2AY9A 4EB7A 1UU0A 4OBUA 5HXXA 5EAAA 2VGTA 1TATA 2YRRA 3G7QA 3FDBA 4TMRA 5BJ4A 4UOYA 1LC8A 3CQ5A 3JWAA 2C7TA 1ASGA 3FDDA 1PMMA 5LH9A 1QIRA 4GE9A 2CTZA 4L0OA 3BWOA 2VMSA 1WYTB 3BB8A 3PDBA 3N0LA 3Q8NA 4O6ZA 4WYGA 1PMOA 4UHNA 3WKSA 4B9BA 1AMAA 3PDBB 2BWOA 1LW4A 2ZC0A 3G0TA 3RBFA 3T32A 1S08A 3NU8A 7AATA 3MAFA 4IYOA 4R5ZA 5FT4A 1GC2A 1GCKA 3N5MA 2WK8A 3I5TA 2VGVA 3FZ6A 1CQ6A 1TPLA 4Q76A 4F5MA 2R5CB 1MDZA 2CJGA 3H14A 3RI6A 3L44A 2FNUA 2C81A 1AMRA 2YHKA 3B8XA 2VMYA 4P3MA 4N0BA 4XJOA 4WP0A 3JWBA 2ORDA 2OATA 1AJSB 5FT6A 2ZY2A 4ZLVA 3RCHA 4IY7A 3RBLA 1TOEA 3A9ZA 1S09A 2W7FA 4I8AA 2QB2A 4CBSA 5M49A 1PFFA 2JJFA 3I4JA 1N2TA 1T3IA 2EH6A 3HBXA 3LVKA 1LC5A 4OYTA 2CJDA 3JW9A 1S0AA 2JG2A 4ITGA 3UWCA 2XH1A 2W8UA 4M2MA 3NU7A 2O0RA 1N31A 2BKWA 5G09A 3FKDA 4IXOA 5E3KA 1ASCA 2D63A 4MQQA 4ITXA 4OCAA 1ASEA 4WB0B 5C6UA 4RKCA 3WLXA 2YKYA 2Z67A 3AEMA 3LWSA 4WBTA 1AAMA 1QITA 1YJZA 1O4SA 1U08A 3H7FA 1BQAA 3BN1A 1ECXA 3CAIA 3FQAA 3PGYA 4PVFA 3ZZKA 4LNLA 4RIZA 5FT5A 4ZASA 3DZZA 3VAXA 2XBNA 4BQ0A 1MDOA 4KYOA 4EB5A 2VMTA 1B5OA 4E1OA 1WYUA 4XEWA 1C9CA 3E9KA 1G7WA 1B9IA 1AX4A 1BJOB 2FQ6A 1H1CA 5DJ9A 2BI2A 3NUBA 1M4NA 4RKDA 3LY1A 4N0WA 1WKGA 3WKRA 4ATPA 3K28A 3BS8A 1BKGA 2E7JA 5AX8A 4MKKA 1AY8A 4QGRA 4B98A 3HL2A 2ZY5A 2D64A 1TARA 4U2HA 4WYAA 3DR7A 4Q6RA 4FFCA 2HOXA 3AOVA 1ARTA 1UKJA 3NYUA 2OGAA 1IVRA 2AY4A 1GC0A 3BWNA 1AHXA 3WGBA 1ASAA 2VMVA 2QLRA 4OC9A 4A0FA 1AHYA 1RV4A 3FVXA 4WYDA 1ZC9A 4MY5A 2PB2A 4CXQA 1D7RA 1LC7A 3COGA 1OXOA 3MC6A 3QHXA 4K2IA 2PO3A 2WK7A 1AY5A 5K8BA 1BT4A 1SPAA 3EI8A 4WYCA 3AENB 2Z9VA 2AY1A 5TF5A 3F6TA 3W1JA 5EQCA 1LKCA 2DKBA 1D7SA 3PD6A 4LNMA 5EIGB 5EUEA 2YCNA 2CH2A 3PIUA 4XK1A 2Z1ZA 3UAKA 5M4DA 2HUUA 2VMQA 3VP6A 1XEYA 3A9XA 1UU2A 5EUDA 1WYTA 1BS0A 3MADA 1AIAA 1IAYA 2HP1A 2QMAA 1W3UA 3AATA 5F8VA 4ZM3A 4F5IA 3FTBA 3R4TA 2DGLA 1IX8A 2AY2A 1C7OA 2ZY4A 3RCHB 3K40A 1MGVA 3ZRQA 2GMSA 1AHFA 1RV3A 2ZYJA 2BI1A 1W7NA 3FVSA 3FZ8A 4ZDPA 4XJMA 5G4IA 4RAEA 3ELPA 4JE5A 2JJEA 1YNUA 2VIBA 1P3WA 2VMWA 3QM2A 4CXRA 1DJUA 1M6SA 3FVUA 2BWNA 3QI6A 3N75A 3GZDA 3PPLA 4LNJA 2ZSLA 4EMYA 2RFVA 3E2YA 3P6KA 1WSTA 2AEVA 3UE8A 1CL1A 4PFNA 2WK9A 1SZKA 4F5HA 2Q7WA 1E5FA 2VMPA 4IXSA 2VI8A 2ZJGA 3QBOA 4IW7A 4WYFA 2VIAA 4H51A 4AH3A 3B46A 4GE4A 3BCXA 3WCNA 5IWQA 1ORDA 2JISA 3ASAA 2VMOA 2X3LA 1LS3A 1EG5A 4WD2A 5FT8A 4ZDOA 2BI5A 2Z9WA 2BIAA 2X5FA 4XQ2A 2W7LA 1AKAA 3EIBA 1LW5A 4EFFA 3OKSA 2D61A 4MGRA 3KGWA 2BIGA 5BJ3A 2D65A 3LVMA 1VJOA 4A6TA 4M2KA 1QGNA 3IHJA 2HOYA 2FYFA 1JS6A 3HT4A 3IF2A 3B1DA 4MQRA 4JF1A 2VGSA 4K2MA 4FL0A 4OBVA 1OHYA 4Y0IA 3EI6A 3TFUA 2HUIA 4R2NA 2R2NA 2EGYA 4XJLA 1OXPA 1KMJA 3FQ7A 4GE7A 1D7VA 1ZOBA 3CQ6A 4RITA 2G6WA 5EUNA 1QISA 2E7IA 1D7UA 1H0CA 4RJYA 4CBRA 4RJ0A 3EUCA 3A2BA 1X0MA 1SFFA 3AEOA 4WLHA 3AEJC 3QGUA 4LC3A 2BI3A 1YIYA 3MAUA 4W1XA 5DB5A 3K7YA 2W7IA 4ZWVA 1DKAA 4JEVA 3DC1A 2AY8A 3E2FA 1O61A 2W8WA 2X8UA 2Z1YA 1OATA 1B9HA 1MLZA 5D95A 3DXVA 4JEWA 4AOAA 5DX5A 1DJEA 1CJ0A 3FFHA 3F9TA 4IXZA 3PD6B 4E3RA 2CANA 3ASBA 2W8JA 1EQBA 5EAVA 3WX9A 4OT8A 4ATQA 2E54A 1D2FA 1SZUA 2FM1A 2HUFA 3FRKA 4OTLA 1I43A 3WY7A 3TFTA 4DGTA 2ZP7A 2AY5A 4TN4A 4JEYA 2W8VA 1C4KA 1C7GA 4WXBA 1MAPA 3AEMC 1AY4A 1ASLA 2VMRA 1PG8A 1C0NA 5D5SA 3A8UX 3PDXA 1MLYA 3DXWA 2HP2A 1RVYA 2PB0A 2VMZA 4HF8A 1AMSA 2CH1A 4IYOB 3BCAA 4LW4A 2AEUA 2BYLA 1S06A 2W7KA 4IX8A 2ZUKA 3ISLA 1YIZA 1UU1A 1X28A 1CL2A 1AAWA 3G8MA 2V0YA 2QBTA 2W7JA 4W1VA 2GB3A 1JS3A 2BHXA 3BWNC 3DU4A 2DKJA 1IJIA 1YJSA 3FQ8A 3I16A 2VGZA 3M5UA 1CS1A 2W7HA 3ELEA 1IBJA 3EZ1A 4JEXA 1B5PA 5LHAA 2YKVA 2CB1A
chains in the Genus database with same CATH superfamily
4A00A 3WCOA 4M2JA 1YJYA 1KMKA 3FZ7A 1KKPA 3FCRA 3E77A 4MKJA 3FD0A 1ELUA 1SF2A 3DODA 1BJWA 3RUYA 4A0RA 4PFFA 4DBCA 4F5KA 3MAFB 2FN6A 2YOBA 5E5IA 4J8LA 1ASDA 4R5FA 2W7GA 1O69A 2VLHA 2OGEA 2BI9A 5DJ1A 5M46A 5M4BA 1ARSA 1IUGA 3LV2A 4ZAHA 1GC4A 2CY8A 2YCTA 2R5CA 3II0A 3NUIA 3VK2A 1MAQA 3KE3A 4WYEA 4RM1A 3EI9A 1WYVB 2BWPA 2JGTA 3JZLA 5G2QA 2CJHA 4W1WA 4W91A 2E7UA 3RQ1A 2ZY3A 1B4XA 4ISYA 3W1HA 1XI9A 1VP4A 1KL2A 3KKIA 5HHYA 1DFOA 1M0PA 2GQNA 2F8JA 3NDNA 3NYTA 5EFSA 2CSTA 1AKBA 1DGDA 2AY3A 3BCBA 2VI9A 4Q75A 4A6UA 3HLMA 1C7NA 1TOJA 2YKXA 1TOIA 1WKHA 1BJOA 1G7XA 2CINA 2D66A 3WGCA 1V2DA 5G2PA 3NX3A 3KGXA 3TCMA 3NYSA 1GD9A 2C0RA 4LW2A 5I92A 1FG7A 3P1TA 1N8PA 1GBNA 1ARIA 4JEZA 3TATA 3EI5A 1Z3ZA 1ZODA 2Z20A 3OP7A 5G4JA 3R9AA 3NNKA 5J8QA 3E2ZB 4EU1A 2O1BA 2YKUA 3MC6C 1V2FA 1X2AA 3MKJA 1ASMA 2Z9UA 4RLGA 3BV0A 4GEBA 3ZRRA 2DGKA 4HVKA 1S07A 1M0QA 1O62A 2OKKA 4GDYA 4JF0A 1ARHA 3AELA 3GETA 3EI7A 1JF9A 1Z7DA 3PAAA 1V72A 3L8AA 1W7MA 1M7YA 1V2EA 3TQXA 1AKCA 3AENA 5EIGA 3VOMA 1W7LA 1DJ9A 1E5EA 4A0HA 5F9SA 1TOKA 5E4ZA 2YCPA 2A1VA 4ZSYA 3QPGA 3A9YA 3EIAA 2D7YA 3GBXA 3LG0A 3DRDA 1EJIA 2WKAA 1CZEA 1AHEA 4ZWMA 4ADBA 1M0OA 1IAXA 2C44A 4A0GA 2TPLA 4JE5D 2AY6A 4BA4A 1M0NA 2O7CA 1SVVA 4Q31A 1Y4IA 3HMUA 4Y0DA 3E6GA 1QJ3A 2QB3A 1FG3A 1GEXA 2HOZA 3CQ4A 1OHVA 3AV7A 2BIEA 2HZPA 3QN6A 1ARGA 2WB6A 3BC8A 4NOGA 3EZSA 3PJ0A 1GC3A 2VMUA 3B1EA 4F5GA 4ADEA 1KKJA 1I41A 4J5UA 3D6KA 3MBBA 2CFBA 4GRXA 1KL1A 2Z61A 1RVUA 4KAMA 2JJGA 4BMKA 3ZZJA 4A72A 4AZKA 4F5FA 2D5YA 1ASFA 2QA3A 2ZSMA 3GR9A 4ADDA 4F5JA 5HDMA 1GEYA 9AATA 1G4VA 1JG8A 3FFRA 4MSOA 4Y0HA 1CQ8A 5G0AA 3ECDA 2EZ2A 4AO4A 1B8GA 1GDEA 3USFA 4XAUA 1G4XA 3ZRPA 3N7NA 2R5EA 3AEJA 2EZ1A 3LVLB 2AY7A 1DTYA 4PIWA 2D7ZA 4F4EA 1AHGA 1SZSA 3AEPA 3HVYA 4W5KA 2R0TA 2OKJA 2DR1A 4WB0A 2VGUA 1BJNA 2OQXA 4WLJA 4ZDLA 2YRIA 4UQVA 4WXGA 1J04A 2VMNA 1X29A 3GSBA 4CVQA 1QZ9A 3WZFA 4ADCA 4BHDA 1AJSA 1CQ7A 4ZSWA 4K05A 1KAFA 3JTXA 4E77A 1YOOA 2V1PA 3ATHA 3VK4A 1BW0A 1CZCA 4WXFA 1FC4A 1W23A 1TOGA 2DOUA 2NMPA 4E3QA 8AATA 3PA9A 4AO9A 2DGMA 2X5DA 1I29A 3DR4A 3VK3A 1M32A 4TV7A 2Z9XA 1WYVA 1VEFA 3B1CA 3CBFA 1ASBA 1TASA 1BQDA 4UHOA 4A6RA 4R8DA 1AIBA 4BA5A 1OHWA 3MEBA 3W1IA 4F5LA 4DQ6A 4U1TA 2GMUA 1QJ5A 2G7JA 4AZJA 3GZCA 4KXKA 1DGEA 4GSAA 2W7DA 1BJ4A 3GJUA 1LK9A 1AICA 3E2ZA 2VMXA 3FSLA 1IX7A 2GSAA 1AMQA 2HORA 3GZDC 1YAAA 1WYUB 1MDXA 3DYDA 3NRAA 4OMAA 1J32A 4K2BA 4UHMA 2AATA 4XJPA 4ZM4A 2JJHA 2VLFA 2W8TA 2VYCA 4P7YA 2FNIA 4MQPA 1I48A 2W7EA 3GWPA 5JAYA 3JU7A 1GEWA 1ASNA 2VGWA 3AOWA 2EO5A 2EPJA 2BYJA 3F0HA 3LVJA 3NTJA 3ACZA 1ELQA 4W8IA 2W7MA 1AJRA 3HDOA 1IX6A 3HQTA 2AY9A 4EB7A 1UU0A 4OBUA 5HXXA 5EAAA 2VGTA 1TATA 2YRRA 3G7QA 3FDBA 2EYQA 4TMRA 5BJ4A 4UOYA 1LC8A 3CQ5A 3JWAA 2C7TA 1ASGA 3FDDA 1PMMA 5LH9A 1QIRA 4GE9A 2CTZA 4L0OA 3BWOA 2VMSA 1WYTB 3BB8A 3PDBA 3N0LA 3Q8NA 4O6ZA 4WYGA 1PMOA 4UHNA 3WKSA 4B9BA 1AMAA 3PDBB 2BWOA 1LW4A 2ZC0A 3G0TA 3RBFA 3T32A 1S08A 3NU8A 7AATA 3MAFA 4IYOA 4R5ZA 5FT4A 1GC2A 1GCKA 3N5MA 2WK8A 3I5TA 2VGVA 3FZ6A 1CQ6A 1TPLA 4Q76A 4F5MA 2R5CB 1MDZA 2CJGA 3H14A 3RI6A 3L44A 2FNUA 2C81A 1AMRA 2YHKA 3B8XA 2VMYA 4P3MA 4N0BA 4XJOA 4WP0A 3JWBA 2ORDA 2OATA 1AJSB 5FT6A 2ZY2A 4ZLVA 3RCHA 4IY7A 3RBLA 1TOEA 3A9ZA 1S09A 2W7FA 4I8AA 2QB2A 4CBSA 5M49A 1PFFA 2JJFA 3I4JA 1N2TA 1T3IA 2EH6A 3HBXA 3LVKA 1LC5A 4OYTA 2CJDA 3JW9A 1S0AA 2JG2A 4ITGA 3UWCA 2XH1A 2W8UA 4M2MA 3NU7A 2O0RA 1N31A 2BKWA 5G09A 3FKDA 4IXOA 5E3KA 1ASCA 2D63A 4MQQA 4ITXA 4OCAA 1ASEA 4WB0B 5C6UA 4RKCA 3WLXA 2YKYA 2Z67A 3AEMA 3LWSA 4WBTA 1AAMA 1QITA 1YJZA 1O4SA 1U08A 3H7FA 1BQAA 3BN1A 3N4RA 1ECXA 3CAIA 3FQAA 3PGYA 4PVFA 3ZZKA 4LNLA 4RIZA 5FT5A 4ZASA 3DZZA 3VAXA 2XBNA 4BQ0A 1MDOA 4KYOA 4EB5A 2VMTA 1B5OA 4E1OA 1WYUA 4XEWA 1C9CA 3E9KA 1G7WA 1B9IA 1AX4A 1BJOB 2FQ6A 1H1CA 5DJ9A 2BI2A 3NUBA 1M4NA 4RKDA 3LY1A 4N0WA 1WKGA 3WKRA 4ATPA 3K28A 3BS8A 1BKGA 2E7JA 5AX8A 4MKKA 1AY8A 4QGRA 4B98A 3HL2A 2ZY5A 2D64A 1TARA 4U2HA 4WYAA 3DR7A 4Q6RA 4FFCA 2HOXA 3AOVA 1ARTA 1UKJA 3NYUA 2OGAA 1IVRA 2AY4A 1GC0A 3BWNA 1AHXA 3WGBA 1ASAA 2VMVA 3N4XA 2QLRA 4OC9A 4A0FA 1AHYA 1RV4A 3FVXA 4WYDA 1ZC9A 4MY5A 2PB2A 4CXQA 1D7RA 1LC7A 3COGA 1OXOA 3MC6A 3QHXA 4K2IA 2PO3A 2WK7A 1AY5A 5K8BA 1BT4A 1SPAA 3EI8A 4WYCA 3AENB 2Z9VA 2AY1A 5TF5A 3F6TA 3W1JA 5EQCA 1LKCA 2DKBA 1D7SA 3PD6A 4LNMA 5EIGB 5EUEA 2YCNA 2CH2A 3PIUA 4XK1A 2Z1ZA 3UAKA 5M4DA 2HUUA 2VMQA 3VP6A 1XEYA 3A9XA 1UU2A 5EUDA 1WYTA 1BS0A 3MADA 1AIAA 1IAYA 2HP1A 2QMAA 1W3UA 3AATA 5F8VA 4ZM3A 4F5IA 3FTBA 3R4TA 2DGLA 1IX8A 2AY2A 1C7OA 2ZY4A 3RCHB 3K40A 1MGVA 3ZRQA 2GMSA 1AHFA 1RV3A 2ZYJA 2BI1A 1W7NA 3FVSA 3FZ8A 4ZDPA 4XJMA 5G4IA 4RAEA 3ELPA 4JE5A 2JJEA 1YNUA 2VIBA 1P3WA 2VMWA 3QM2A 4CXRA 1DJUA 1M6SA 3FVUA 2BWNA 3QI6A 3N75A 3GZDA 3PPLA 4LNJA 2ZSLA 4EMYA 2RFVA 3E2YA 3P6KA 1WSTA 2AEVA 3UE8A 1CL1A 4PFNA 2WK9A 1SZKA 4F5HA 4H63Q 5KTBA 2Q7WA 1E5FA 2VMPA 4IXSA 2VI8A 2ZJGA 3QBOA 4IW7A 4WYFA 2VIAA 4H51A 4AH3A 3B46A 4GE4A 3BCXA 3WCNA 5IWQA 1ORDA 2JISA 3ASAA 2VMOA 2X3LA 1LS3A 1EG5A 4WD2A 5FT8A 4ZDOA 2BI5A 2Z9WA 2BIAA 2X5FA 4XQ2A 2W7LA 1AKAA 3EIBA 1LW5A 4EFFA 3OKSA 2D61A 4MGRA 3KGWA 2BIGA 5BJ3A 2D65A 3LVMA 1VJOA 4A6TA 4M2KA 1QGNA 3IHJA 2HOYA 2FYFA 1JS6A 3HT4A 3IF2A 3B1DA 4MQRA 4JF1A 2VGSA 4K2MA 4FL0A 4OBVA 1OHYA 4Y0IA 3EI6A 3TFUA 2HUIA 4R2NA 2R2NA 2EGYA 4XJLA 1OXPA 1KMJA 3FQ7A 4GE7A 1D7VA 1ZOBA 3CQ6A 4RITA 2G6WA 5EUNA 1QISA 2E7IA 1D7UA 1H0CA 4RJYA 4CBRA 4RJ0A 3EUCA 3A2BA 1X0MA 1SFFA 3AEOA 4WLHA 3AEJC 3QGUA 4LC3A 2FKIA 2BI3A 1YIYA 3MAUA 4W1XA 5DB5A 3K7YA 2W7IA 4ZWVA 1DKAA 4JEVA 3DC1A 2AY8A 3E2FA 1O61A 2W8WA 2X8UA 2Z1YA 1OATA 1B9HA 1MLZA 5D95A 3DXVA 4JEWA 3H9XA 4AOAA 5DX5A 1DJEA 1CJ0A 3FFHA 3F9TA 4IXZA 3PD6B 4E3RA 2CANA 3ASBA 2W8JA 1EQBA 5EAVA 3WX9A 4OT8A 4ATQA 2E54A 1D2FA 1SZUA 2FM1A 2HUFA 3FRKA 4OTLA 1I43A 3WY7A 3TFTA 4DGTA 2ZP7A 2AY5A 4TN4A 4JEYA 2W8VA 1C4KA 1C7GA 4WXBA 1MAPA 3AEMC 1AY4A 1ASLA 2VMRA 1PG8A 1C0NA 5D5SA 2QSRA 3A8UX 3PDXA 1MLYA 3DXWA 2HP2A 1RVYA 2PB0A 3N4SA 2VMZA 4HF8A 1AMSA 2CH1A 4IYOB 3BCAA 4LW4A 2AEUA 2BYLA 1S06A 2W7KA 4IX8A 2ZUKA 3ISLA 1YIZA 1UU1A 1X28A 1CL2A 1AAWA 3G8MA 2KFPA 2V0YA 2QBTA 2W7JA 4W1VA 2GB3A 1JS3A 2BHXA 3BWNC 3DU4A 2DKJA 1IJIA 1YJSA 3FQ8A 3I16A 2VGZA 3M5UA 1CS1A 2W7HA 3ELEA 1IBJA 3EZ1A 4JEXA 1B5PA 5LHAA 2YKVA 2CB1A
chains in the Genus database with same CATH topology
4A00A 3WCOA 4M2JA 1YJYA 1KMKA 3FZ7A 1KKPA 3FCRA 3E77A 4MKJA 3FD0A 1ELUA 1SF2A 3DODA 1BJWA 3RUYA 4A0RA 4PFFA 4DBCA 4F5KA 3MAFB 2FN6A 2YOBA 5E5IA 4J8LA 1ASDA 4R5FA 2W7GA 1O69A 2VLHA 2OGEA 2BI9A 5DJ1A 5M46A 5M4BA 1ARSA 1IUGA 3LV2A 4ZAHA 1GC4A 2CY8A 2YCTA 2R5CA 3II0A 3NUIA 3VK2A 1MAQA 3KE3A 4WYEA 4RM1A 3EI9A 1WYVB 2BWPA 2JGTA 3JZLA 5G2QA 2CJHA 4W1WA 4W91A 2E7UA 3RQ1A 2ZY3A 1B4XA 4ISYA 3W1HA 1XI9A 1VP4A 1KL2A 3KKIA 5HHYA 1DFOA 1M0PA 2GQNA 2F8JA 3NDNA 3NYTA 5EFSA 2CSTA 1AKBA 1DGDA 2AY3A 3BCBA 2VI9A 4Q75A 4A6UA 3HLMA 1C7NA 1TOJA 2YKXA 1TOIA 1WKHA 1BJOA 1G7XA 2CINA 2D66A 3WGCA 1V2DA 5G2PA 3NX3A 3KGXA 3TCMA 3NYSA 1GD9A 2C0RA 4LW2A 5I92A 1FG7A 3P1TA 1N8PA 1GBNA 1ARIA 4JEZA 3TATA 3EI5A 1Z3ZA 1ZODA 2Z20A 3OP7A 5G4JA 3R9AA 3NNKA 5J8QA 3E2ZB 4EU1A 2O1BA 2YKUA 3MC6C 1V2FA 1X2AA 3MKJA 1ASMA 2Z9UA 4RLGA 3BV0A 4GEBA 3ZRRA 2DGKA 4HVKA 1S07A 1M0QA 1O62A 2OKKA 4GDYA 4JF0A 1ARHA 3AELA 3GETA 3EI7A 1JF9A 1Z7DA 3PAAA 1V72A 3L8AA 1W7MA 1M7YA 1V2EA 3TQXA 1AKCA 3AENA 5EIGA 3VOMA 1W7LA 1DJ9A 1E5EA 4A0HA 5F9SA 1TOKA 5E4ZA 2YCPA 2A1VA 4ZSYA 3QPGA 3A9YA 3EIAA 2D7YA 3GBXA 3LG0A 3DRDA 1EJIA 2WKAA 1CZEA 1AHEA 4ZWMA 4ADBA 1M0OA 1IAXA 2C44A 4A0GA 2TPLA 4JE5D 2AY6A 4BA4A 1M0NA 2O7CA 1SVVA 4Q31A 1Y4IA 3HMUA 4Y0DA 3E6GA 1QJ3A 2QB3A 1FG3A 1GEXA 2HOZA 3CQ4A 1OHVA 3AV7A 2BIEA 2HZPA 3QN6A 1ARGA 2WB6A 3BC8A 4NOGA 3EZSA 3PJ0A 1GC3A 2VMUA 3B1EA 4F5GA 4ADEA 1KKJA 1I41A 4J5UA 3D6KA 3MBBA 2CFBA 4GRXA 1KL1A 2Z61A 1RVUA 4KAMA 2JJGA 4BMKA 3ZZJA 4A72A 4AZKA 4F5FA 2D5YA 1ASFA 2QA3A 2ZSMA 3GR9A 4ADDA 4F5JA 5HDMA 1GEYA 9AATA 1G4VA 1JG8A 3FFRA 4MSOA 4Y0HA 1CQ8A 5G0AA 3ECDA 2EZ2A 4AO4A 1B8GA 1GDEA 3USFA 4XAUA 1G4XA 3ZRPA 3N7NA 2R5EA 3AEJA 2EZ1A 3LVLB 2AY7A 1DTYA 4PIWA 2D7ZA 4F4EA 1AHGA 1SZSA 3AEPA 3HVYA 4W5KA 2R0TA 2OKJA 2DR1A 4WB0A 2VGUA 1BJNA 2OQXA 4WLJA 4ZDLA 2YRIA 4UQVA 4WXGA 1J04A 2VMNA 1X29A 3GSBA 4CVQA 1QZ9A 3WZFA 4ADCA 4BHDA 1AJSA 1CQ7A 4ZSWA 4K05A 3JTXA 4E77A 1YOOA 2V1PA 3ATHA 3VK4A 1BW0A 1CZCA 4WXFA 1FC4A 1W23A 1TOGA 2DOUA 2NMPA 4E3QA 8AATA 3PA9A 4AO9A 2DGMA 2X5DA 1I29A 3DR4A 3VK3A 1M32A 4TV7A 2Z9XA 1WYVA 1VEFA 3B1CA 3CBFA 1ASBA 1TASA 1BQDA 4UHOA 4A6RA 4R8DA 1AIBA 4BA5A 1OHWA 3MEBA 3W1IA 4F5LA 4DQ6A 4U1TA 2GMUA 1QJ5A 2G7JA 4AZJA 3GZCA 4KXKA 1DGEA 4GSAA 2W7DA 1BJ4A 3GJUA 1LK9A 1AICA 3E2ZA 2VMXA 3FSLA 1IX7A 2GSAA 1AMQA 2HORA 3GZDC 1YAAA 1WYUB 1MDXA 3DYDA 3NRAA 4OMAA 1J32A 4K2BA 4UHMA 2AATA 4XJPA 4ZM4A 2JJHA 2VLFA 2W8TA 2VYCA 4P7YA 2FNIA 4MQPA 1I48A 2W7EA 3GWPA 5JAYA 3JU7A 1GEWA 1ASNA 2VGWA 3AOWA 2EO5A 2EPJA 2BYJA 3F0HA 3LVJA 3NTJA 3ACZA 1ELQA 4W8IA 2W7MA 1AJRA 3HDOA 1IX6A 3HQTA 2AY9A 4EB7A 1UU0A 4OBUA 5HXXA 5EAAA 2VGTA 1TATA 2YRRA 3G7QA 3FDBA 2EYQA 4TMRA 5BJ4A 4UOYA 1LC8A 3CQ5A 3JWAA 2C7TA 1ASGA 3FDDA 1PMMA 5LH9A 1QIRA 4GE9A 2CTZA 4L0OA 3BWOA 2VMSA 1WYTB 3BB8A 3PDBA 3N0LA 3Q8NA 4O6ZA 4WYGA 1PMOA 4UHNA 3WKSA 4B9BA 1AMAA 3PDBB 2BWOA 1LW4A 2ZC0A 3G0TA 3RBFA 3T32A 1S08A 3NU8A 7AATA 3MAFA 4IYOA 4R5ZA 5FT4A 1GC2A 1GCKA 3N5MA 2WK8A 3I5TA 2VGVA 3FZ6A 1CQ6A 1TPLA 4Q76A 4F5MA 2R5CB 1MDZA 2CJGA 3H14A 3RI6A 3L44A 2FNUA 2C81A 1AMRA 2YHKA 3B8XA 2VMYA 4P3MA 4N0BA 4XJOA 4WP0A 3JWBA 2ORDA 2OATA 1AJSB 5FT6A 2ZY2A 4ZLVA 3RCHA 4IY7A 3RBLA 1TOEA 3A9ZA 1S09A 2W7FA 4I8AA 2QB2A 4CBSA 5M49A 1PFFA 2JJFA 3I4JA 1N2TA 1T3IA 2EH6A 3HBXA 3LVKA 1LC5A 4OYTA 2CJDA 3JW9A 1S0AA 2JG2A 4ITGA 3UWCA 2XH1A 2W8UA 4M2MA 3NU7A 2O0RA 1N31A 2BKWA 5G09A 3FKDA 4IXOA 5E3KA 1ASCA 2D63A 4MQQA 4ITXA 4OCAA 1ASEA 4WB0B 5C6UA 4RKCA 3WLXA 2YKYA 2Z67A 3AEMA 3LWSA 4WBTA 1AAMA 1QITA 1YJZA 1O4SA 1U08A 3H7FA 1BQAA 3BN1A 3N4RA 1ECXA 3CAIA 3FQAA 3PGYA 4PVFA 3ZZKA 4LNLA 4RIZA 5FT5A 4ZASA 3DZZA 3VAXA 2XBNA 4BQ0A 1MDOA 4KYOA 4EB5A 2VMTA 1B5OA 4E1OA 1WYUA 4XEWA 1C9CA 3E9KA 1G7WA 1B9IA 1AX4A 1BJOB 2FQ6A 1H1CA 5DJ9A 2BI2A 3NUBA 1M4NA 4RKDA 3LY1A 4N0WA 1WKGA 3WKRA 4ATPA 3K28A 3BS8A 1BKGA 2E7JA 5AX8A 4MKKA 1AY8A 4QGRA 4B98A 3HL2A 2ZY5A 2D64A 1TARA 4U2HA 4WYAA 3DR7A 4Q6RA 4FFCA 2HOXA 3AOVA 1ARTA 1UKJA 3NYUA 2OGAA 1IVRA 2AY4A 1GC0A 3BWNA 1AHXA 3WGBA 1ASAA 2VMVA 3N4XA 2QLRA 4OC9A 4A0FA 1AHYA 1RV4A 3FVXA 4WYDA 1ZC9A 4MY5A 2PB2A 4CXQA 1D7RA 1LC7A 3COGA 1OXOA 3MC6A 3QHXA 4K2IA 2PO3A 2WK7A 1AY5A 5K8BA 1BT4A 1SPAA 3EI8A 4WYCA 3AENB 2Z9VA 2AY1A 5TF5A 3F6TA 3W1JA 5EQCA 1LKCA 2DKBA 1D7SA 3PD6A 4LNMA 5EIGB 5EUEA 2YCNA 2CH2A 3PIUA 4XK1A 2Z1ZA 3UAKA 5M4DA 2HUUA 2VMQA 3VP6A 1XEYA 3A9XA 1UU2A 5EUDA 1WYTA 1BS0A 3MADA 1AIAA 1IAYA 2HP1A 2QMAA 1W3UA 3AATA 5F8VA 4ZM3A 4F5IA 3FTBA 3R4TA 2DGLA 1IX8A 2AY2A 1C7OA 2ZY4A 3RCHB 3K40A 1MGVA 3ZRQA 2GMSA 1AHFA 1RV3A 2ZYJA 2BI1A 1W7NA 3FVSA 3FZ8A 4ZDPA 4XJMA 5G4IA 4RAEA 3ELPA 4JE5A 2JJEA 1YNUA 2VIBA 1P3WA 2VMWA 3QM2A 4CXRA 1DJUA 1M6SA 3FVUA 2BWNA 3QI6A 3N75A 3GZDA 3PPLA 4LNJA 2ZSLA 4EMYA 2RFVA 3E2YA 3P6KA 1WSTA 2AEVA 3UE8A 1CL1A 4PFNA 2WK9A 1SZKA 4F5HA 4H63Q 5KTBA 2Q7WA 1E5FA 2VMPA 4IXSA 2VI8A 2ZJGA 3QBOA 4IW7A 4WYFA 2VIAA 4H51A 4AH3A 3B46A 4GE4A 3BCXA 3WCNA 5IWQA 1ORDA 2JISA 3ASAA 2VMOA 2X3LA 1LS3A 1EG5A 4WD2A 5FT8A 4ZDOA 2BI5A 2Z9WA 2BIAA 2X5FA 4XQ2A 2W7LA 1AKAA 3EIBA 1LW5A 4EFFA 3OKSA 2D61A 4MGRA 3KGWA 2BIGA 5BJ3A 2D65A 3LVMA 1VJOA 4A6TA 4M2KA 1QGNA 3IHJA 2HOYA 2FYFA 1JS6A 3HT4A 3IF2A 3B1DA 4MQRA 4JF1A 2VGSA 4K2MA 4FL0A 4OBVA 1OHYA 4Y0IA 3EI6A 3TFUA 2HUIA 4R2NA 2R2NA 2EGYA 4XJLA 1OXPA 1KMJA 3FQ7A 4GE7A 1D7VA 1ZOBA 3CQ6A 4RITA 2G6WA 5EUNA 1QISA 2E7IA 1D7UA 1H0CA 4RJYA 4CBRA 4RJ0A 3EUCA 3A2BA 1X0MA 1SFFA 3AEOA 4WLHA 3AEJC 3QGUA 4LC3A 2FKIA 2BI3A 1YIYA 3MAUA 4W1XA 5DB5A 3K7YA 2W7IA 4ZWVA 1DKAA 4JEVA 3DC1A 2AY8A 3E2FA 1O61A 2W8WA 2X8UA 2Z1YA 1OATA 1B9HA 1MLZA 5D95A 3DXVA 4JEWA 3H9XA 4AOAA 5DX5A 1DJEA 1CJ0A 3FFHA 3F9TA 4IXZA 3PD6B 4E3RA 2CANA 3ASBA 2W8JA 1EQBA 5EAVA 3WX9A 4OT8A 4ATQA 2E54A 1D2FA 1SZUA 2FM1A 2HUFA 3FRKA 4OTLA 1I43A 3WY7A 3TFTA 4DGTA 2ZP7A 2AY5A 4TN4A 4JEYA 2W8VA 1C4KA 1C7GA 4WXBA 1MAPA 3AEMC 1AY4A 1ASLA 2VMRA 1PG8A 1C0NA 5D5SA 2QSRA 3A8UX 3PDXA 1MLYA 3DXWA 2HP2A 1RVYA 2PB0A 3N4SA 2VMZA 4HF8A 1AMSA 2CH1A 4IYOB 3BCAA 4LW4A 2AEUA 2BYLA 1S06A 2W7KA 4IX8A 2ZUKA 3ISLA 1YIZA 1UU1A 1X28A 1CL2A 1AAWA 3G8MA 2KFPA 2V0YA 2QBTA 2W7JA 4W1VA 2GB3A 1JS3A 2BHXA 3BWNC 3DU4A 2DKJA 1IJIA 1YJSA 3FQ8A 3I16A 2VGZA 3M5UA 1CS1A 2W7HA 3ELEA 1IBJA 3EZ1A 4JEXA 1B5PA 5LHAA 2YKVA 2CB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A00 A;  3WCO A;  4M2J A;  1YJY A;  1KMK A;  3FZ7 A;  1KKP A;  3FCR A;  3E77 A;  4MKJ A;  3FD0 A;  1ELU A;  1SF2 A;  3DOD A;  1BJW A;  3RUY A;  4A0R A;  4PFF A;  4DBC A;  4F5K A;  3MAF B;  2FN6 A;  2YOB A;  5E5I A;  4J8L A;  1ASD A;  4R5F A;  2W7G A;  1O69 A;  2VLH A;  2OGE A;  2BI9 A;  5DJ1 A;  5M46 A;  5M4B A;  1ARS A;  1IUG A;  3LV2 A;  4ZAH A;  1GC4 A;  2CY8 A;  2YCT A;  2R5C A;  3II0 A;  3NUI A;  3VK2 A;  1MAQ A;  3KE3 A;  4WYE A;  4RM1 A;  3EI9 A;  1WYV B;  2BWP A;  2JGT A;  3JZL A;  5G2Q A;  2CJH A;  4W1W A;  4W91 A;  2E7U A;  3RQ1 A;  2ZY3 A;  1B4X A;  4ISY A;  3W1H A;  1XI9 A;  1VP4 A;  1KL2 A;  3KKI A;  5HHY A;  1DFO A;  1M0P A;  2GQN A;  2F8J A;  3NDN A;  3NYT A;  5EFS A;  2CST A;  1AKB A;  1DGD A;  2AY3 A;  3BCB A;  2VI9 A;  4Q75 A;  4A6U A;  3HLM A;  1C7N A;  1TOJ A;  2YKX A;  1TOI A;  1WKH A;  1BJO A;  1G7X A;  2CIN A;  2D66 A;  3WGC A;  1V2D A;  5G2P A;  3NX3 A;  3KGX A;  3TCM A;  3NYS A;  1GD9 A;  2C0R A;  4LW2 A;  5I92 A;  1FG7 A;  3P1T A;  1N8P A;  1GBN A;  1ARI A;  4JEZ A;  3TAT A;  3EI5 A;  1Z3Z A;  1ZOD A;  2Z20 A;  3OP7 A;  5G4J A;  3R9A A;  3NNK A;  5J8Q A;  3E2Z B;  4EU1 A;  2O1B A;  2YKU A;  3MC6 C;  1V2F A;  1X2A A;  3MKJ A;  1ASM A;  2Z9U A;  4RLG A;  3BV0 A;  4GEB A;  3ZRR A;  2DGK A;  4HVK A;  1S07 A;  1M0Q A;  1O62 A;  2OKK A;  4GDY A;  4JF0 A;  1ARH A;  3AEL A;  3GET A;  3EI7 A;  1JF9 A;  1Z7D A;  3PAA A;  1V72 A;  3L8A A;  1W7M A;  1M7Y A;  1V2E A;  3TQX A;  1AKC A;  3AEN A;  5EIG A;  3VOM A;  1W7L A;  1DJ9 A;  1E5E A;  4A0H A;  5F9S A;  1TOK A;  5E4Z A;  2YCP A;  4ZSY A;  3QPG A;  3A9Y A;  3EIA A;  2D7Y A;  3GBX A;  3LG0 A;  3DRD A;  1EJI A;  2WKA A;  1CZE A;  1AHE A;  4ZWM A;  4ADB A;  1M0O A;  1IAX A;  2C44 A;  4A0G A;  2TPL A;  4JE5 D;  2AY6 A;  4BA4 A;  1M0N A;  2O7C A;  1SVV A;  4Q31 A;  1Y4I A;  3HMU A;  4Y0D A;  3E6G A;  1QJ3 A;  2QB3 A;  1FG3 A;  1GEX A;  2HOZ A;  3CQ4 A;  1OHV A;  3AV7 A;  2BIE A;  2HZP A;  3QN6 A;  1ARG A;  3BC8 A;  4NOG A;  3EZS A;  3PJ0 A;  1GC3 A;  2VMU A;  3B1E A;  4F5G A;  4ADE A;  1KKJ A;  1I41 A;  4J5U A;  3D6K A;  3MBB A;  2CFB A;  4GRX A;  1KL1 A;  2Z61 A;  1RVU A;  4KAM A;  2JJG A;  4BMK A;  3ZZJ A;  4A72 A;  4AZK A;  4F5F A;  2D5Y A;  1ASF A;  2QA3 A;  2ZSM A;  3GR9 A;  4ADD A;  4F5J A;  5HDM A;  1GEY A;  9AAT A;  1G4V A;  1JG8 A;  3FFR A;  4MSO A;  4Y0H A;  1CQ8 A;  5G0A A;  3ECD A;  2EZ2 A;  4AO4 A;  1B8G A;  1GDE A;  3USF A;  4XAU A;  1G4X A;  3ZRP A;  2R5E A;  3AEJ A;  2EZ1 A;  3LVL B;  2AY7 A;  1DTY A;  4PIW A;  2D7Z A;  4F4E A;  1AHG A;  1SZS A;  3AEP A;  3HVY A;  4W5K A;  2R0T A;  2OKJ A;  2DR1 A;  4WB0 A;  2VGU A;  1BJN A;  2OQX A;  4WLJ A;  4ZDL A;  2YRI A;  4UQV A;  4WXG A;  1J04 A;  2VMN A;  1X29 A;  3GSB A;  4CVQ A;  1QZ9 A;  3WZF A;  4ADC A;  4BHD A;  1AJS A;  1CQ7 A;  4ZSW A;  3JTX A;  4E77 A;  1YOO A;  2V1P A;  3ATH A;  3VK4 A;  1BW0 A;  1CZC A;  4WXF A;  1FC4 A;  1W23 A;  1TOG A;  2DOU A;  2NMP A;  4E3Q A;  8AAT A;  3PA9 A;  4AO9 A;  2DGM A;  2X5D A;  1I29 A;  3DR4 A;  3VK3 A;  1M32 A;  4TV7 A;  2Z9X A;  1WYV A;  1VEF A;  3B1C A;  3CBF A;  1ASB A;  1TAS A;  1BQD A;  4UHO A;  4A6R A;  4R8D A;  1AIB A;  4BA5 A;  1OHW A;  3MEB A;  3W1I A;  4F5L A;  4DQ6 A;  4U1T A;  2GMU A;  1QJ5 A;  4AZJ A;  3GZC A;  4KXK A;  1DGE A;  4GSA A;  2W7D A;  1BJ4 A;  3GJU A;  1LK9 A;  1AIC A;  3E2Z A;  2VMX A;  3FSL A;  1IX7 A;  2GSA A;  1AMQ A;  2HOR A;  3GZD C;  1YAA A;  1WYU B;  1MDX A;  3DYD A;  3NRA A;  4OMA A;  1J32 A;  4K2B A;  4UHM A;  2AAT A;  4XJP A;  4ZM4 A;  2JJH A;  2VLF A;  2W8T A;  2VYC A;  4P7Y A;  2FNI A;  4MQP A;  1I48 A;  2W7E A;  3GWP A;  5JAY A;  3JU7 A;  1GEW A;  1ASN A;  2VGW A;  3AOW A;  2EO5 A;  2EPJ A;  2BYJ A;  3F0H A;  3LVJ A;  3NTJ A;  3ACZ A;  1ELQ A;  4W8I A;  2W7M A;  1AJR A;  3HDO A;  1IX6 A;  3HQT A;  2AY9 A;  4EB7 A;  1UU0 A;  4OBU A;  5HXX A;  5EAA A;  2VGT A;  1TAT A;  2YRR A;  3G7Q A;  3FDB A;  4TMR A;  5BJ4 A;  4UOY A;  1LC8 A;  3CQ5 A;  3JWA A;  2C7T A;  1ASG A;  3FDD A;  1PMM A;  5LH9 A;  1QIR A;  4GE9 A;  2CTZ A;  4L0O A;  3BWO A;  2VMS A;  1WYT B;  3BB8 A;  3PDB A;  3N0L A;  3Q8N A;  4O6Z A;  4WYG A;  1PMO A;  4UHN A;  3WKS A;  4B9B A;  1AMA A;  3PDB B;  2BWO A;  1LW4 A;  2ZC0 A;  3G0T A;  3RBF A;  3T32 A;  1S08 A;  3NU8 A;  7AAT A;  3MAF A;  4IYO A;  4R5Z A;  5FT4 A;  1GC2 A;  1GCK A;  3N5M A;  2WK8 A;  3I5T A;  2VGV A;  3FZ6 A;  1CQ6 A;  1TPL A;  4Q76 A;  4F5M A;  2R5C B;  1MDZ A;  2CJG A;  3H14 A;  3RI6 A;  3L44 A;  2FNU A;  2C81 A;  1AMR A;  2YHK A;  3B8X A;  2VMY A;  4P3M A;  4N0B A;  4XJO A;  4WP0 A;  3JWB A;  2ORD A;  2OAT A;  1AJS B;  5FT6 A;  2ZY2 A;  4ZLV A;  3RCH A;  4IY7 A;  3RBL A;  1TOE A;  3A9Z A;  1S09 A;  2W7F A;  4I8A A;  2QB2 A;  4CBS A;  5M49 A;  1PFF A;  2JJF A;  3I4J A;  1N2T A;  1T3I A;  2EH6 A;  3HBX A;  3LVK A;  1LC5 A;  4OYT A;  2CJD A;  3JW9 A;  1S0A A;  2JG2 A;  4ITG A;  3UWC A;  2XH1 A;  2W8U A;  4M2M A;  3NU7 A;  2O0R A;  1N31 A;  2BKW A;  5G09 A;  3FKD A;  4IXO A;  5E3K A;  1ASC A;  2D63 A;  4MQQ A;  4ITX A;  4OCA A;  1ASE A;  4WB0 B;  5C6U A;  4RKC A;  3WLX A;  2YKY A;  2Z67 A;  3AEM A;  3LWS A;  4WBT A;  1AAM A;  1QIT A;  1YJZ A;  1O4S A;  1U08 A;  3H7F A;  1BQA A;  3BN1 A;  1ECX A;  3CAI A;  3FQA A;  3PGY A;  4PVF A;  3ZZK A;  4LNL A;  4RIZ A;  5FT5 A;  4ZAS A;  3DZZ A;  3VAX A;  2XBN A;  4BQ0 A;  1MDO A;  4KYO A;  4EB5 A;  2VMT A;  1B5O A;  4E1O A;  1WYU A;  4XEW A;  1C9C A;  3E9K A;  1G7W A;  1B9I A;  1AX4 A;  1BJO B;  2FQ6 A;  1H1C A;  5DJ9 A;  2BI2 A;  3NUB A;  1M4N A;  4RKD A;  3LY1 A;  4N0W A;  1WKG A;  3WKR A;  4ATP A;  3K28 A;  3BS8 A;  1BKG A;  2E7J A;  5AX8 A;  4MKK A;  1AY8 A;  4QGR A;  4B98 A;  3HL2 A;  2ZY5 A;  2D64 A;  1TAR A;  4U2H A;  4WYA A;  3DR7 A;  4Q6R A;  4FFC A;  2HOX A;  3AOV A;  1ART A;  1UKJ A;  3NYU A;  2OGA A;  1IVR A;  2AY4 A;  1GC0 A;  3BWN A;  1AHX A;  3WGB A;  1ASA A;  2VMV A;  2QLR A;  4OC9 A;  4A0F A;  1AHY A;  1RV4 A;  3FVX A;  4WYD A;  1ZC9 A;  4MY5 A;  2PB2 A;  4CXQ A;  1D7R A;  1LC7 A;  3COG A;  1OXO A;  3MC6 A;  3QHX A;  4K2I A;  2PO3 A;  2WK7 A;  1AY5 A;  5K8B A;  1BT4 A;  1SPA A;  3EI8 A;  4WYC A;  3AEN B;  2Z9V A;  2AY1 A;  5TF5 A;  3F6T A;  3W1J A;  5EQC A;  1LKC A;  2DKB A;  1D7S A;  3PD6 A;  4LNM A;  5EIG B;  5EUE A;  2YCN A;  2CH2 A;  3PIU A;  4XK1 A;  2Z1Z A;  3UAK A;  5M4D A;  2HUU A;  2VMQ A;  3VP6 A;  1XEY A;  3A9X A;  1UU2 A;  5EUD A;  1WYT A;  1BS0 A;  3MAD A;  1AIA A;  1IAY A;  2HP1 A;  2QMA A;  1W3U A;  3AAT A;  5F8V A;  4ZM3 A;  4F5I A;  3FTB A;  3R4T A;  2DGL A;  1IX8 A;  2AY2 A;  1C7O A;  2ZY4 A;  3RCH B;  3K40 A;  1MGV A;  3ZRQ A;  2GMS A;  1AHF A;  1RV3 A;  2ZYJ A;  2BI1 A;  1W7N A;  3FVS A;  3FZ8 A;  4ZDP A;  4XJM A;  5G4I A;  4RAE A;  3ELP A;  4JE5 A;  2JJE A;  1YNU A;  2VIB A;  1P3W A;  2VMW A;  3QM2 A;  4CXR A;  1DJU A;  1M6S A;  3FVU A;  2BWN A;  3QI6 A;  3N75 A;  3GZD A;  3PPL A;  4LNJ A;  2ZSL A;  4EMY A;  2RFV A;  3E2Y A;  3P6K A;  1WST A;  2AEV A;  3UE8 A;  1CL1 A;  4PFN A;  2WK9 A;  1SZK A;  4F5H A;  2Q7W A;  1E5F A;  2VMP A;  4IXS A;  2VI8 A;  2ZJG A;  3QBO A;  4IW7 A;  4WYF A;  2VIA A;  4H51 A;  4AH3 A;  3B46 A;  4GE4 A;  3BCX A;  3WCN A;  5IWQ A;  1ORD A;  2JIS A;  3ASA A;  2VMO A;  2X3L A;  1LS3 A;  1EG5 A;  4WD2 A;  5FT8 A;  4ZDO A;  2BI5 A;  2Z9W A;  2BIA A;  2X5F A;  4XQ2 A;  2W7L A;  1AKA A;  3EIB A;  1LW5 A;  4EFF A;  3OKS A;  2D61 A;  4MGR A;  3KGW A;  2BIG A;  5BJ3 A;  2D65 A;  3LVM A;  1VJO A;  4A6T A;  4M2K A;  1QGN A;  3IHJ A;  2HOY A;  2FYF A;  1JS6 A;  3HT4 A;  3IF2 A;  3B1D A;  4MQR A;  4JF1 A;  2VGS A;  4K2M A;  4FL0 A;  4OBV A;  1OHY A;  4Y0I A;  3EI6 A;  3TFU A;  2HUI A;  4R2N A;  2R2N A;  2EGY A;  4XJL A;  1OXP A;  1KMJ A;  3FQ7 A;  4GE7 A;  1D7V A;  1ZOB A;  3CQ6 A;  4RIT A;  2G6W A;  5EUN A;  1QIS A;  2E7I A;  1D7U A;  1H0C A;  4RJY A;  4CBR A;  4RJ0 A;  3EUC A;  3A2B A;  1X0M A;  1SFF A;  3AEO A;  4WLH A;  3AEJ C;  3QGU A;  4LC3 A;  2BI3 A;  1YIY A;  3MAU A;  4W1X A;  5DB5 A;  3K7Y A;  2W7I A;  4ZWV A;  1DKA A;  4JEV A;  3DC1 A;  2AY8 A;  3E2F A;  1O61 A;  2W8W A;  2X8U A;  2Z1Y A;  1OAT A;  1B9H A;  1MLZ A;  5D95 A;  3DXV A;  4JEW A;  4AOA A;  5DX5 A;  1DJE A;  1CJ0 A;  3FFH A;  3F9T A;  4IXZ A;  3PD6 B;  4E3R A;  2CAN A;  3ASB A;  2W8J A;  1EQB A;  5EAV A;  3WX9 A;  4OT8 A;  4ATQ A;  2E54 A;  1D2F A;  1SZU A;  2FM1 A;  2HUF A;  3FRK A;  4OTL A;  1I43 A;  3WY7 A;  3TFT A;  4DGT A;  2ZP7 A;  2AY5 A;  4TN4 A;  4JEY A;  2W8V A;  1C4K A;  1C7G A;  4WXB A;  1MAP A;  3AEM C;  1AY4 A;  1ASL A;  2VMR A;  1PG8 A;  1C0N A;  5D5S A;  3A8U X;  3PDX A;  1MLY A;  3DXW A;  2HP2 A;  1RVY A;  2PB0 A;  2VMZ A;  4HF8 A;  1AMS A;  2CH1 A;  4IYO B;  3BCA A;  4LW4 A;  2AEU A;  2BYL A;  1S06 A;  2W7K A;  4IX8 A;  2ZUK A;  3ISL A;  1YIZ A;  1UU1 A;  1X28 A;  1CL2 A;  1AAW A;  3G8M A;  2V0Y A;  2QBT A;  2W7J A;  4W1V A;  2GB3 A;  1JS3 A;  2BHX A;  3BWN C;  3DU4 A;  2DKJ A;  1IJI A;  1YJS A;  3FQ8 A;  3I16 A;  2VGZ A;  3M5U A;  1CS1 A;  2W7H A;  3ELE A;  1IBJ A;  3EZ1 A;  4JEX A;  1B5P A;  5LHA A;  2YKV A;  2CB1 A; 
#chains in the Genus database with same CATH topology
 4A00 A;  3WCO A;  4M2J A;  1YJY A;  1KMK A;  3FZ7 A;  1KKP A;  3FCR A;  3E77 A;  4MKJ A;  3FD0 A;  1ELU A;  1SF2 A;  3DOD A;  1BJW A;  3RUY A;  4A0R A;  4PFF A;  4DBC A;  4F5K A;  3MAF B;  2FN6 A;  2YOB A;  5E5I A;  4J8L A;  1ASD A;  4R5F A;  2W7G A;  1O69 A;  2VLH A;  2OGE A;  2BI9 A;  5DJ1 A;  5M46 A;  5M4B A;  1ARS A;  1IUG A;  3LV2 A;  4ZAH A;  1GC4 A;  2CY8 A;  2YCT A;  2R5C A;  3II0 A;  3NUI A;  3VK2 A;  1MAQ A;  3KE3 A;  4WYE A;  4RM1 A;  3EI9 A;  1WYV B;  2BWP A;  2JGT A;  3JZL A;  5G2Q A;  2CJH A;  4W1W A;  4W91 A;  2E7U A;  3RQ1 A;  2ZY3 A;  1B4X A;  4ISY A;  3W1H A;  1XI9 A;  1VP4 A;  1KL2 A;  3KKI A;  5HHY A;  1DFO A;  1M0P A;  2GQN A;  2F8J A;  3NDN A;  3NYT A;  5EFS A;  2CST A;  1AKB A;  1DGD A;  2AY3 A;  3BCB A;  2VI9 A;  4Q75 A;  4A6U A;  3HLM A;  1C7N A;  1TOJ A;  2YKX A;  1TOI A;  1WKH A;  1BJO A;  1G7X A;  2CIN A;  2D66 A;  3WGC A;  1V2D A;  5G2P A;  3NX3 A;  3KGX A;  3TCM A;  3NYS A;  1GD9 A;  2C0R A;  4LW2 A;  5I92 A;  1FG7 A;  3P1T A;  1N8P A;  1GBN A;  1ARI A;  4JEZ A;  3TAT A;  3EI5 A;  1Z3Z A;  1ZOD A;  2Z20 A;  3OP7 A;  5G4J A;  3R9A A;  3NNK A;  5J8Q A;  3E2Z B;  4EU1 A;  2O1B A;  2YKU A;  3MC6 C;  1V2F A;  1X2A A;  3MKJ A;  1ASM A;  2Z9U A;  4RLG A;  3BV0 A;  4GEB A;  3ZRR A;  2DGK A;  4HVK A;  1S07 A;  1M0Q A;  1O62 A;  2OKK A;  4GDY A;  4JF0 A;  1ARH A;  3AEL A;  3GET A;  3EI7 A;  1JF9 A;  1Z7D A;  3PAA A;  1V72 A;  3L8A A;  1W7M A;  1M7Y A;  1V2E A;  3TQX A;  1AKC A;  3AEN A;  5EIG A;  3VOM A;  1W7L A;  1DJ9 A;  1E5E A;  4A0H A;  5F9S A;  1TOK A;  5E4Z A;  2YCP A;  2A1V A;  4ZSY A;  3QPG A;  3A9Y A;  3EIA A;  2D7Y A;  3GBX A;  3LG0 A;  3DRD A;  1EJI A;  2WKA A;  1CZE A;  1AHE A;  4ZWM A;  4ADB A;  1M0O A;  1IAX A;  2C44 A;  4A0G A;  2TPL A;  4JE5 D;  2AY6 A;  4BA4 A;  1M0N A;  2O7C A;  1SVV A;  4Q31 A;  1Y4I A;  3HMU A;  4Y0D A;  3E6G A;  1QJ3 A;  2QB3 A;  1FG3 A;  1GEX A;  2HOZ A;  3CQ4 A;  1OHV A;  3AV7 A;  2BIE A;  2HZP A;  3QN6 A;  1ARG A;  2WB6 A;  3BC8 A;  4NOG A;  3EZS A;  3PJ0 A;  1GC3 A;  2VMU A;  3B1E A;  4F5G A;  4ADE A;  1KKJ A;  1I41 A;  4J5U A;  3D6K A;  3MBB A;  2CFB A;  4GRX A;  1KL1 A;  2Z61 A;  1RVU A;  4KAM A;  2JJG A;  4BMK A;  3ZZJ A;  4A72 A;  4AZK A;  4F5F A;  2D5Y A;  1ASF A;  2QA3 A;  2ZSM A;  3GR9 A;  4ADD A;  4F5J A;  5HDM A;  1GEY A;  9AAT A;  1G4V A;  1JG8 A;  3FFR A;  4MSO A;  4Y0H A;  1CQ8 A;  5G0A A;  3ECD A;  2EZ2 A;  4AO4 A;  1B8G A;  1GDE A;  3USF A;  4XAU A;  1G4X A;  3ZRP A;  3N7N A;  2R5E A;  3AEJ A;  2EZ1 A;  3LVL B;  2AY7 A;  1DTY A;  4PIW A;  2D7Z A;  4F4E A;  1AHG A;  1SZS A;  3AEP A;  3HVY A;  4W5K A;  2R0T A;  2OKJ A;  2DR1 A;  4WB0 A;  2VGU A;  1BJN A;  2OQX A;  4WLJ A;  4ZDL A;  2YRI A;  4UQV A;  4WXG A;  1J04 A;  2VMN A;  1X29 A;  3GSB A;  4CVQ A;  1QZ9 A;  3WZF A;  4ADC A;  4BHD A;  1AJS A;  1CQ7 A;  4ZSW A;  4K05 A;  1KAF A;  3JTX A;  4E77 A;  1YOO A;  2V1P A;  3ATH A;  3VK4 A;  1BW0 A;  1CZC A;  4WXF A;  1FC4 A;  1W23 A;  1TOG A;  2DOU A;  2NMP A;  4E3Q A;  8AAT A;  3PA9 A;  4AO9 A;  2DGM A;  2X5D A;  1I29 A;  3DR4 A;  3VK3 A;  1M32 A;  4TV7 A;  2Z9X A;  1WYV A;  1VEF A;  3B1C A;  3CBF A;  1ASB A;  1TAS A;  1BQD A;  4UHO A;  4A6R A;  4R8D A;  1AIB A;  4BA5 A;  1OHW A;  3MEB A;  3W1I A;  4F5L A;  4DQ6 A;  4U1T A;  2GMU A;  1QJ5 A;  2G7J A;  4AZJ A;  3GZC A;  4KXK A;  1DGE A;  4GSA A;  2W7D A;  1BJ4 A;  3GJU A;  1LK9 A;  1AIC A;  3E2Z A;  2VMX A;  3FSL A;  1IX7 A;  2GSA A;  1AMQ A;  2HOR A;  3GZD C;  1YAA A;  1WYU B;  1MDX A;  3DYD A;  3NRA A;  4OMA A;  1J32 A;  4K2B A;  4UHM A;  2AAT A;  4XJP A;  4ZM4 A;  2JJH A;  2VLF A;  2W8T A;  2VYC A;  4P7Y A;  2FNI A;  4MQP A;  1I48 A;  2W7E A;  3GWP A;  5JAY A;  3JU7 A;  1GEW A;  1ASN A;  2VGW A;  3AOW A;  2EO5 A;  2EPJ A;  2BYJ A;  3F0H A;  3LVJ A;  3NTJ A;  3ACZ A;  1ELQ A;  4W8I A;  2W7M A;  1AJR A;  3HDO A;  1IX6 A;  3HQT A;  2AY9 A;  4EB7 A;  1UU0 A;  4OBU A;  5HXX A;  5EAA A;  2VGT A;  1TAT A;  2YRR A;  3G7Q A;  3FDB A;  2EYQ A;  4TMR A;  5BJ4 A;  4UOY A;  1LC8 A;  3CQ5 A;  3JWA A;  2C7T A;  1ASG A;  3FDD A;  1PMM A;  5LH9 A;  1QIR A;  4GE9 A;  2CTZ A;  4L0O A;  3BWO A;  2VMS A;  1WYT B;  3BB8 A;  3PDB A;  3N0L A;  3Q8N A;  4O6Z A;  4WYG A;  1PMO A;  4UHN A;  3WKS A;  4B9B A;  1AMA A;  3PDB B;  2BWO A;  1LW4 A;  2ZC0 A;  3G0T A;  3RBF A;  3T32 A;  1S08 A;  3NU8 A;  7AAT A;  3MAF A;  4IYO A;  4R5Z A;  5FT4 A;  1GC2 A;  1GCK A;  3N5M A;  2WK8 A;  3I5T A;  2VGV A;  3FZ6 A;  1CQ6 A;  1TPL A;  4Q76 A;  4F5M A;  2R5C B;  1MDZ A;  2CJG A;  3H14 A;  3RI6 A;  3L44 A;  2FNU A;  2C81 A;  1AMR A;  2YHK A;  3B8X A;  2VMY A;  4P3M A;  4N0B A;  4XJO A;  4WP0 A;  3JWB A;  2ORD A;  2OAT A;  1AJS B;  5FT6 A;  2ZY2 A;  4ZLV A;  3RCH A;  4IY7 A;  3RBL A;  1TOE A;  3A9Z A;  1S09 A;  2W7F A;  4I8A A;  2QB2 A;  4CBS A;  5M49 A;  1PFF A;  2JJF A;  3I4J A;  1N2T A;  1T3I A;  2EH6 A;  3HBX A;  3LVK A;  1LC5 A;  4OYT A;  2CJD A;  3JW9 A;  1S0A A;  2JG2 A;  4ITG A;  3UWC A;  2XH1 A;  2W8U A;  4M2M A;  3NU7 A;  2O0R A;  1N31 A;  2BKW A;  5G09 A;  3FKD A;  4IXO A;  5E3K A;  1ASC A;  2D63 A;  4MQQ A;  4ITX A;  4OCA A;  1ASE A;  4WB0 B;  5C6U A;  4RKC A;  3WLX A;  2YKY A;  2Z67 A;  3AEM A;  3LWS A;  4WBT A;  1AAM A;  1QIT A;  1YJZ A;  1O4S A;  1U08 A;  3H7F A;  1BQA A;  3BN1 A;  3N4R A;  1ECX A;  3CAI A;  3FQA A;  3PGY A;  4PVF A;  3ZZK A;  4LNL A;  4RIZ A;  5FT5 A;  4ZAS A;  3DZZ A;  3VAX A;  2XBN A;  4BQ0 A;  1MDO A;  4KYO A;  4EB5 A;  2VMT A;  1B5O A;  4E1O A;  1WYU A;  4XEW A;  1C9C A;  3E9K A;  1G7W A;  1B9I A;  1AX4 A;  1BJO B;  2FQ6 A;  1H1C A;  5DJ9 A;  2BI2 A;  3NUB A;  1M4N A;  4RKD A;  3LY1 A;  4N0W A;  1WKG A;  3WKR A;  4ATP A;  3K28 A;  3BS8 A;  1BKG A;  2E7J A;  5AX8 A;  4MKK A;  1AY8 A;  4QGR A;  4B98 A;  3HL2 A;  2ZY5 A;  2D64 A;  1TAR A;  4U2H A;  4WYA A;  3DR7 A;  4Q6R A;  4FFC A;  2HOX A;  3AOV A;  1ART A;  1UKJ A;  3NYU A;  2OGA A;  1IVR A;  2AY4 A;  1GC0 A;  3BWN A;  1AHX A;  3WGB A;  1ASA A;  2VMV A;  3N4X A;  2QLR A;  4OC9 A;  4A0F A;  1AHY A;  1RV4 A;  3FVX A;  4WYD A;  1ZC9 A;  4MY5 A;  2PB2 A;  4CXQ A;  1D7R A;  1LC7 A;  3COG A;  1OXO A;  3MC6 A;  3QHX A;  4K2I A;  2PO3 A;  2WK7 A;  1AY5 A;  5K8B A;  1BT4 A;  1SPA A;  3EI8 A;  4WYC A;  3AEN B;  2Z9V A;  2AY1 A;  5TF5 A;  3F6T A;  3W1J A;  5EQC A;  1LKC A;  2DKB A;  1D7S A;  3PD6 A;  4LNM A;  5EIG B;  5EUE A;  2YCN A;  2CH2 A;  3PIU A;  4XK1 A;  2Z1Z A;  3UAK A;  5M4D A;  2HUU A;  2VMQ A;  3VP6 A;  1XEY A;  3A9X A;  1UU2 A;  5EUD A;  1WYT A;  1BS0 A;  3MAD A;  1AIA A;  1IAY A;  2HP1 A;  2QMA A;  1W3U A;  3AAT A;  5F8V A;  4ZM3 A;  4F5I A;  3FTB A;  3R4T A;  2DGL A;  1IX8 A;  2AY2 A;  1C7O A;  2ZY4 A;  3RCH B;  3K40 A;  1MGV A;  3ZRQ A;  2GMS A;  1AHF A;  1RV3 A;  2ZYJ A;  2BI1 A;  1W7N A;  3FVS A;  3FZ8 A;  4ZDP A;  4XJM A;  5G4I A;  4RAE A;  3ELP A;  4JE5 A;  2JJE A;  1YNU A;  2VIB A;  1P3W A;  2VMW A;  3QM2 A;  4CXR A;  1DJU A;  1M6S A;  3FVU A;  2BWN A;  3QI6 A;  3N75 A;  3GZD A;  3PPL A;  4LNJ A;  2ZSL A;  4EMY A;  2RFV A;  3E2Y A;  3P6K A;  1WST A;  2AEV A;  3UE8 A;  1CL1 A;  4PFN A;  2WK9 A;  1SZK A;  4F5H A;  4H63 Q;  5KTB A;  2Q7W A;  1E5F A;  2VMP A;  4IXS A;  2VI8 A;  2ZJG A;  3QBO A;  4IW7 A;  4WYF A;  2VIA A;  4H51 A;  4AH3 A;  3B46 A;  4GE4 A;  3BCX A;  3WCN A;  5IWQ A;  1ORD A;  2JIS A;  3ASA A;  2VMO A;  2X3L A;  1LS3 A;  1EG5 A;  4WD2 A;  5FT8 A;  4ZDO A;  2BI5 A;  2Z9W A;  2BIA A;  2X5F A;  4XQ2 A;  2W7L A;  1AKA A;  3EIB A;  1LW5 A;  4EFF A;  3OKS A;  2D61 A;  4MGR A;  3KGW A;  2BIG A;  5BJ3 A;  2D65 A;  3LVM A;  1VJO A;  4A6T A;  4M2K A;  1QGN A;  3IHJ A;  2HOY A;  2FYF A;  1JS6 A;  3HT4 A;  3IF2 A;  3B1D A;  4MQR A;  4JF1 A;  2VGS A;  4K2M A;  4FL0 A;  4OBV A;  1OHY A;  4Y0I A;  3EI6 A;  3TFU A;  2HUI A;  4R2N A;  2R2N A;  2EGY A;  4XJL A;  1OXP A;  1KMJ A;  3FQ7 A;  4GE7 A;  1D7V A;  1ZOB A;  3CQ6 A;  4RIT A;  2G6W A;  5EUN A;  1QIS A;  2E7I A;  1D7U A;  1H0C A;  4RJY A;  4CBR A;  4RJ0 A;  3EUC A;  3A2B A;  1X0M A;  1SFF A;  3AEO A;  4WLH A;  3AEJ C;  3QGU A;  4LC3 A;  2FKI A;  2BI3 A;  1YIY A;  3MAU A;  4W1X A;  5DB5 A;  3K7Y A;  2W7I A;  4ZWV A;  1DKA A;  4JEV A;  3DC1 A;  2AY8 A;  3E2F A;  1O61 A;  2W8W A;  2X8U A;  2Z1Y A;  1OAT A;  1B9H A;  1MLZ A;  5D95 A;  3DXV A;  4JEW A;  3H9X A;  4AOA A;  5DX5 A;  1DJE A;  1CJ0 A;  3FFH A;  3F9T A;  4IXZ A;  3PD6 B;  4E3R A;  2CAN A;  3ASB A;  2W8J A;  1EQB A;  5EAV A;  3WX9 A;  4OT8 A;  4ATQ A;  2E54 A;  1D2F A;  1SZU A;  2FM1 A;  2HUF A;  3FRK A;  4OTL A;  1I43 A;  3WY7 A;  3TFT A;  4DGT A;  2ZP7 A;  2AY5 A;  4TN4 A;  4JEY A;  2W8V A;  1C4K A;  1C7G A;  4WXB A;  1MAP A;  3AEM C;  1AY4 A;  1ASL A;  2VMR A;  1PG8 A;  1C0N A;  5D5S A;  2QSR A;  3A8U X;  3PDX A;  1MLY A;  3DXW A;  2HP2 A;  1RVY A;  2PB0 A;  3N4S A;  2VMZ A;  4HF8 A;  1AMS A;  2CH1 A;  4IYO B;  3BCA A;  4LW4 A;  2AEU A;  2BYL A;  1S06 A;  2W7K A;  4IX8 A;  2ZUK A;  3ISL A;  1YIZ A;  1UU1 A;  1X28 A;  1CL2 A;  1AAW A;  3G8M A;  2KFP A;  2V0Y A;  2QBT A;  2W7J A;  4W1V A;  2GB3 A;  1JS3 A;  2BHX A;  3BWN C;  3DU4 A;  2DKJ A;  1IJI A;  1YJS A;  3FQ8 A;  3I16 A;  2VGZ A;  3M5U A;  1CS1 A;  2W7H A;  3ELE A;  1IBJ A;  3EZ1 A;  4JEX A;  1B5P A;  5LHA A;  2YKV A;  2CB1 A; 
#chains in the Genus database with same CATH homology
 4A00 A;  3WCO A;  4M2J A;  1YJY A;  1KMK A;  3FZ7 A;  1KKP A;  3FCR A;  3E77 A;  4MKJ A;  3FD0 A;  1ELU A;  1SF2 A;  3DOD A;  1BJW A;  3RUY A;  4A0R A;  4PFF A;  4DBC A;  4F5K A;  3MAF B;  2FN6 A;  2YOB A;  5E5I A;  4J8L A;  1ASD A;  4R5F A;  2W7G A;  1O69 A;  2VLH A;  2OGE A;  2BI9 A;  5DJ1 A;  5M46 A;  5M4B A;  1ARS A;  1IUG A;  3LV2 A;  4ZAH A;  1GC4 A;  2CY8 A;  2YCT A;  2R5C A;  3II0 A;  3NUI A;  3VK2 A;  1MAQ A;  3KE3 A;  4WYE A;  4RM1 A;  3EI9 A;  1WYV B;  2BWP A;  2JGT A;  3JZL A;  5G2Q A;  2CJH A;  4W1W A;  4W91 A;  2E7U A;  3RQ1 A;  2ZY3 A;  1B4X A;  4ISY A;  3W1H A;  1XI9 A;  1VP4 A;  1KL2 A;  3KKI A;  5HHY A;  1DFO A;  1M0P A;  2GQN A;  2F8J A;  3NDN A;  3NYT A;  5EFS A;  2CST A;  1AKB A;  1DGD A;  2AY3 A;  3BCB A;  2VI9 A;  4Q75 A;  4A6U A;  3HLM A;  1C7N A;  1TOJ A;  2YKX A;  1TOI A;  1WKH A;  1BJO A;  1G7X A;  2CIN A;  2D66 A;  3WGC A;  1V2D A;  5G2P A;  3NX3 A;  3KGX A;  3TCM A;  3NYS A;  1GD9 A;  2C0R A;  4LW2 A;  5I92 A;  1FG7 A;  3P1T A;  1N8P A;  1GBN A;  1ARI A;  4JEZ A;  3TAT A;  3EI5 A;  1Z3Z A;  1ZOD A;  2Z20 A;  3OP7 A;  5G4J A;  3R9A A;  3NNK A;  5J8Q A;  3E2Z B;  4EU1 A;  2O1B A;  2YKU A;  3MC6 C;  1V2F A;  1X2A A;  3MKJ A;  1ASM A;  2Z9U A;  4RLG A;  3BV0 A;  4GEB A;  3ZRR A;  2DGK A;  4HVK A;  1S07 A;  1M0Q A;  1O62 A;  2OKK A;  4GDY A;  4JF0 A;  1ARH A;  3AEL A;  3GET A;  3EI7 A;  1JF9 A;  1Z7D A;  3PAA A;  1V72 A;  3L8A A;  1W7M A;  1M7Y A;  1V2E A;  3TQX A;  1AKC A;  3AEN A;  5EIG A;  3VOM A;  1W7L A;  1DJ9 A;  1E5E A;  4A0H A;  5F9S A;  1TOK A;  5E4Z A;  2YCP A;  2A1V A;  4ZSY A;  3QPG A;  3A9Y A;  3EIA A;  2D7Y A;  3GBX A;  3LG0 A;  3DRD A;  1EJI A;  2WKA A;  1CZE A;  1AHE A;  4ZWM A;  4ADB A;  1M0O A;  1IAX A;  2C44 A;  4A0G A;  2TPL A;  4JE5 D;  2AY6 A;  4BA4 A;  1M0N A;  2O7C A;  1SVV A;  4Q31 A;  1Y4I A;  3HMU A;  4Y0D A;  3E6G A;  1QJ3 A;  2QB3 A;  1FG3 A;  1GEX A;  2HOZ A;  3CQ4 A;  1OHV A;  3AV7 A;  2BIE A;  2HZP A;  3QN6 A;  1ARG A;  2WB6 A;  3BC8 A;  4NOG A;  3EZS A;  3PJ0 A;  1GC3 A;  2VMU A;  3B1E A;  4F5G A;  4ADE A;  1KKJ A;  1I41 A;  4J5U A;  3D6K A;  3MBB A;  2CFB A;  4GRX A;  1KL1 A;  2Z61 A;  1RVU A;  4KAM A;  2JJG A;  4BMK A;  3ZZJ A;  4A72 A;  4AZK A;  4F5F A;  2D5Y A;  1ASF A;  2QA3 A;  2ZSM A;  3GR9 A;  4ADD A;  4F5J A;  5HDM A;  1GEY A;  9AAT A;  1G4V A;  1JG8 A;  3FFR A;  4MSO A;  4Y0H A;  1CQ8 A;  5G0A A;  3ECD A;  2EZ2 A;  4AO4 A;  1B8G A;  1GDE A;  3USF A;  4XAU A;  1G4X A;  3ZRP A;  3N7N A;  2R5E A;  3AEJ A;  2EZ1 A;  3LVL B;  2AY7 A;  1DTY A;  4PIW A;  2D7Z A;  4F4E A;  1AHG A;  1SZS A;  3AEP A;  3HVY A;  4W5K A;  2R0T A;  2OKJ A;  2DR1 A;  4WB0 A;  2VGU A;  1BJN A;  2OQX A;  4WLJ A;  4ZDL A;  2YRI A;  4UQV A;  4WXG A;  1J04 A;  2VMN A;  1X29 A;  3GSB A;  4CVQ A;  1QZ9 A;  3WZF A;  4ADC A;  4BHD A;  1AJS A;  1CQ7 A;  4ZSW A;  4K05 A;  3JTX A;  4E77 A;  1YOO A;  2V1P A;  3ATH A;  3VK4 A;  1BW0 A;  1CZC A;  4WXF A;  1FC4 A;  1W23 A;  1TOG A;  2DOU A;  2NMP A;  4E3Q A;  8AAT A;  3PA9 A;  4AO9 A;  2DGM A;  2X5D A;  1I29 A;  3DR4 A;  3VK3 A;  1M32 A;  4TV7 A;  2Z9X A;  1WYV A;  1VEF A;  3B1C A;  3CBF A;  1ASB A;  1TAS A;  1BQD A;  4UHO A;  4A6R A;  4R8D A;  1AIB A;  4BA5 A;  1OHW A;  3MEB A;  3W1I A;  4F5L A;  4DQ6 A;  4U1T A;  2GMU A;  1QJ5 A;  2G7J A;  4AZJ A;  3GZC A;  4KXK A;  1DGE A;  4GSA A;  2W7D A;  1BJ4 A;  3GJU A;  1LK9 A;  1AIC A;  3E2Z A;  2VMX A;  3FSL A;  1IX7 A;  2GSA A;  1AMQ A;  2HOR A;  3GZD C;  1YAA A;  1WYU B;  1MDX A;  3DYD A;  3NRA A;  4OMA A;  1J32 A;  4K2B A;  4UHM A;  2AAT A;  4XJP A;  4ZM4 A;  2JJH A;  2VLF A;  2W8T A;  2VYC A;  4P7Y A;  2FNI A;  4MQP A;  1I48 A;  2W7E A;  3GWP A;  5JAY A;  3JU7 A;  1GEW A;  1ASN A;  2VGW A;  3AOW A;  2EO5 A;  2EPJ A;  2BYJ A;  3F0H A;  3LVJ A;  3NTJ A;  3ACZ A;  1ELQ A;  4W8I A;  2W7M A;  1AJR A;  3HDO A;  1IX6 A;  3HQT A;  2AY9 A;  4EB7 A;  1UU0 A;  4OBU A;  5HXX A;  5EAA A;  2VGT A;  1TAT A;  2YRR A;  3G7Q A;  3FDB A;  2EYQ A;  4TMR A;  5BJ4 A;  4UOY A;  1LC8 A;  3CQ5 A;  3JWA A;  2C7T A;  1ASG A;  3FDD A;  1PMM A;  5LH9 A;  1QIR A;  4GE9 A;  2CTZ A;  4L0O A;  3BWO A;  2VMS A;  1WYT B;  3BB8 A;  3PDB A;  3N0L A;  3Q8N A;  4O6Z A;  4WYG A;  1PMO A;  4UHN A;  3WKS A;  4B9B A;  1AMA A;  3PDB B;  2BWO A;  1LW4 A;  2ZC0 A;  3G0T A;  3RBF A;  3T32 A;  1S08 A;  3NU8 A;  7AAT A;  3MAF A;  4IYO A;  4R5Z A;  5FT4 A;  1GC2 A;  1GCK A;  3N5M A;  2WK8 A;  3I5T A;  2VGV A;  3FZ6 A;  1CQ6 A;  1TPL A;  4Q76 A;  4F5M A;  2R5C B;  1MDZ A;  2CJG A;  3H14 A;  3RI6 A;  3L44 A;  2FNU A;  2C81 A;  1AMR A;  2YHK A;  3B8X A;  2VMY A;  4P3M A;  4N0B A;  4XJO A;  4WP0 A;  3JWB A;  2ORD A;  2OAT A;  1AJS B;  5FT6 A;  2ZY2 A;  4ZLV A;  3RCH A;  4IY7 A;  3RBL A;  1TOE A;  3A9Z A;  1S09 A;  2W7F A;  4I8A A;  2QB2 A;  4CBS A;  5M49 A;  1PFF A;  2JJF A;  3I4J A;  1N2T A;  1T3I A;  2EH6 A;  3HBX A;  3LVK A;  1LC5 A;  4OYT A;  2CJD A;  3JW9 A;  1S0A A;  2JG2 A;  4ITG A;  3UWC A;  2XH1 A;  2W8U A;  4M2M A;  3NU7 A;  2O0R A;  1N31 A;  2BKW A;  5G09 A;  3FKD A;  4IXO A;  5E3K A;  1ASC A;  2D63 A;  4MQQ A;  4ITX A;  4OCA A;  1ASE A;  4WB0 B;  5C6U A;  4RKC A;  3WLX A;  2YKY A;  2Z67 A;  3AEM A;  3LWS A;  4WBT A;  1AAM A;  1QIT A;  1YJZ A;  1O4S A;  1U08 A;  3H7F A;  1BQA A;  3BN1 A;  3N4R A;  1ECX A;  3CAI A;  3FQA A;  3PGY A;  4PVF A;  3ZZK A;  4LNL A;  4RIZ A;  5FT5 A;  4ZAS A;  3DZZ A;  3VAX A;  2XBN A;  4BQ0 A;  1MDO A;  4KYO A;  4EB5 A;  2VMT A;  1B5O A;  4E1O A;  1WYU A;  4XEW A;  1C9C A;  3E9K A;  1G7W A;  1B9I A;  1AX4 A;  1BJO B;  2FQ6 A;  1H1C A;  5DJ9 A;  2BI2 A;  3NUB A;  1M4N A;  4RKD A;  3LY1 A;  4N0W A;  1WKG A;  3WKR A;  4ATP A;  3K28 A;  3BS8 A;  1BKG A;  2E7J A;  5AX8 A;  4MKK A;  1AY8 A;  4QGR A;  4B98 A;  3HL2 A;  2ZY5 A;  2D64 A;  1TAR A;  4U2H A;  4WYA A;  3DR7 A;  4Q6R A;  4FFC A;  2HOX A;  3AOV A;  1ART A;  1UKJ A;  3NYU A;  2OGA A;  1IVR A;  2AY4 A;  1GC0 A;  3BWN A;  1AHX A;  3WGB A;  1ASA A;  2VMV A;  3N4X A;  2QLR A;  4OC9 A;  4A0F A;  1AHY A;  1RV4 A;  3FVX A;  4WYD A;  1ZC9 A;  4MY5 A;  2PB2 A;  4CXQ A;  1D7R A;  1LC7 A;  3COG A;  1OXO A;  3MC6 A;  3QHX A;  4K2I A;  2PO3 A;  2WK7 A;  1AY5 A;  5K8B A;  1BT4 A;  1SPA A;  3EI8 A;  4WYC A;  3AEN B;  2Z9V A;  2AY1 A;  5TF5 A;  3F6T A;  3W1J A;  5EQC A;  1LKC A;  2DKB A;  1D7S A;  3PD6 A;  4LNM A;  5EIG B;  5EUE A;  2YCN A;  2CH2 A;  3PIU A;  4XK1 A;  2Z1Z A;  3UAK A;  5M4D A;  2HUU A;  2VMQ A;  3VP6 A;  1XEY A;  3A9X A;  1UU2 A;  5EUD A;  1WYT A;  1BS0 A;  3MAD A;  1AIA A;  1IAY A;  2HP1 A;  2QMA A;  1W3U A;  3AAT A;  5F8V A;  4ZM3 A;  4F5I A;  3FTB A;  3R4T A;  2DGL A;  1IX8 A;  2AY2 A;  1C7O A;  2ZY4 A;  3RCH B;  3K40 A;  1MGV A;  3ZRQ A;  2GMS A;  1AHF A;  1RV3 A;  2ZYJ A;  2BI1 A;  1W7N A;  3FVS A;  3FZ8 A;  4ZDP A;  4XJM A;  5G4I A;  4RAE A;  3ELP A;  4JE5 A;  2JJE A;  1YNU A;  2VIB A;  1P3W A;  2VMW A;  3QM2 A;  4CXR A;  1DJU A;  1M6S A;  3FVU A;  2BWN A;  3QI6 A;  3N75 A;  3GZD A;  3PPL A;  4LNJ A;  2ZSL A;  4EMY A;  2RFV A;  3E2Y A;  3P6K A;  1WST A;  2AEV A;  3UE8 A;  1CL1 A;  4PFN A;  2WK9 A;  1SZK A;  4F5H A;  4H63 Q;  5KTB A;  2Q7W A;  1E5F A;  2VMP A;  4IXS A;  2VI8 A;  2ZJG A;  3QBO A;  4IW7 A;  4WYF A;  2VIA A;  4H51 A;  4AH3 A;  3B46 A;  4GE4 A;  3BCX A;  3WCN A;  5IWQ A;  1ORD A;  2JIS A;  3ASA A;  2VMO A;  2X3L A;  1LS3 A;  1EG5 A;  4WD2 A;  5FT8 A;  4ZDO A;  2BI5 A;  2Z9W A;  2BIA A;  2X5F A;  4XQ2 A;  2W7L A;  1AKA A;  3EIB A;  1LW5 A;  4EFF A;  3OKS A;  2D61 A;  4MGR A;  3KGW A;  2BIG A;  5BJ3 A;  2D65 A;  3LVM A;  1VJO A;  4A6T A;  4M2K A;  1QGN A;  3IHJ A;  2HOY A;  2FYF A;  1JS6 A;  3HT4 A;  3IF2 A;  3B1D A;  4MQR A;  4JF1 A;  2VGS A;  4K2M A;  4FL0 A;  4OBV A;  1OHY A;  4Y0I A;  3EI6 A;  3TFU A;  2HUI A;  4R2N A;  2R2N A;  2EGY A;  4XJL A;  1OXP A;  1KMJ A;  3FQ7 A;  4GE7 A;  1D7V A;  1ZOB A;  3CQ6 A;  4RIT A;  2G6W A;  5EUN A;  1QIS A;  2E7I A;  1D7U A;  1H0C A;  4RJY A;  4CBR A;  4RJ0 A;  3EUC A;  3A2B A;  1X0M A;  1SFF A;  3AEO A;  4WLH A;  3AEJ C;  3QGU A;  4LC3 A;  2FKI A;  2BI3 A;  1YIY A;  3MAU A;  4W1X A;  5DB5 A;  3K7Y A;  2W7I A;  4ZWV A;  1DKA A;  4JEV A;  3DC1 A;  2AY8 A;  3E2F A;  1O61 A;  2W8W A;  2X8U A;  2Z1Y A;  1OAT A;  1B9H A;  1MLZ A;  5D95 A;  3DXV A;  4JEW A;  3H9X A;  4AOA A;  5DX5 A;  1DJE A;  1CJ0 A;  3FFH A;  3F9T A;  4IXZ A;  3PD6 B;  4E3R A;  2CAN A;  3ASB A;  2W8J A;  1EQB A;  5EAV A;  3WX9 A;  4OT8 A;  4ATQ A;  2E54 A;  1D2F A;  1SZU A;  2FM1 A;  2HUF A;  3FRK A;  4OTL A;  1I43 A;  3WY7 A;  3TFT A;  4DGT A;  2ZP7 A;  2AY5 A;  4TN4 A;  4JEY A;  2W8V A;  1C4K A;  1C7G A;  4WXB A;  1MAP A;  3AEM C;  1AY4 A;  1ASL A;  2VMR A;  1PG8 A;  1C0N A;  5D5S A;  2QSR A;  3A8U X;  3PDX A;  1MLY A;  3DXW A;  2HP2 A;  1RVY A;  2PB0 A;  3N4S A;  2VMZ A;  4HF8 A;  1AMS A;  2CH1 A;  4IYO B;  3BCA A;  4LW4 A;  2AEU A;  2BYL A;  1S06 A;  2W7K A;  4IX8 A;  2ZUK A;  3ISL A;  1YIZ A;  1UU1 A;  1X28 A;  1CL2 A;  1AAW A;  3G8M A;  2KFP A;  2V0Y A;  2QBT A;  2W7J A;  4W1V A;  2GB3 A;  1JS3 A;  2BHX A;  3BWN C;  3DU4 A;  2DKJ A;  1IJI A;  1YJS A;  3FQ8 A;  3I16 A;  2VGZ A;  3M5U A;  1CS1 A;  2W7H A;  3ELE A;  1IBJ A;  3EZ1 A;  4JEX A;  1B5P A;  5LHA A;  2YKV A;  2CB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...