4N1IA

Crystal structure of the alpha-l-arabinofuranosidase umabf62a from ustilago maidys
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
312
Chain Sequence
b'SCALPTTYRWTSSAPLAQPKDGWVSLKDFTHVPYNGQHLVYASYHDSTKYGSMAFSPFKHWADMATATQTGMTQAAVAPTVFYFTPKKLWFLVSQWGSAPFTYRTSTDPTKVNGWSAPQPLFTGKVADSGTGPIDQTVIADDRKVYLFFVADNGKVYRTSMAIGDFPANFGTASEVILSDTQAKLFEAVQVYTVAGQNQYLMIVEAQGTNGRYFRSFTANSLDGEWKVQAGSESAPFAGKANSGASWTNDVSHGDLIRSNPDQTMTIDPCRLQLLYQGRDKNKVPSSYDLAPYRPGLLTLYGLGLEQKLISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-L-arabinofuranosidase UmAbf62A
publication title First Structural Insights into alpha-L-Arabinofuranosidases from the Two GH62 Glycoside Hydrolase Subfamilies.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Hydrolase
total genus 76
structure length 312
sequence length 312
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 4n1iA00
3AKFA 2OXBA 3PIGA 3UGGA 2X8SA 3WPZA 5GLLA 5AYEA 2VDTA 3NQHA 3P2NA 1ST8A 1Y9MA 5JOWA 5GLPA 3LIGA 2QQVA 3BYLA 4O8OA 5FIXA 2X8FA 2AEZA 3R4ZA 4N4BA 5GLRA 3VT1A 3AKGA 3VT2A 3ZXLA 2X8TA 5C0PA 3WPVA 2B4WA 4EQVA 5FK8A 5FKCA 3WASA 4KCBA 3LIHA 2QQWA 5FMCA 5GLOA 4AK7A 3C7OA 5FMDA 3VSSA 2EXKA 3C7EA 4FFIA 5GLNA 3SC7X 2EXJA 3BYNA 4N2RA 1PT2A 4U6DA 5GLQA 3WPYA 3K1UA 5JOZA 3LDRA 1W2TA 4U6BA 4PVIA 2AEYA 2EXIA 3WAUA 3VSFA 4N1IA 3OM5A 3R4YA 3R67A 3D61A 3BYJA 4MLGA 5FK7A 3C7GA 5FKBA 3D5ZA 3C7HA 4UDGA 4AK6A 3VT0A 2YFRA 3WATA 1GYDB 3AKIA 1UV4A 5A7VA 5JOXA 3LFIA 2QQUA 4KC7A 1YI7A 3OM2A 3UGHA 1W18A 3ZXKA 1OYGA 3QC2A 4KCAA 4ONZA 3OM6A 5GLMA 2ADDA 3UGFA 4UDKA 4KC8A 3WN2A 3VSRA 3WN1A 3D60A 2YFTA 2ADEA 4N2ZA 4NOVA 4O8NA 3LV4A 4D47A 3WMZA 4AK5A 3KSTA 3KF5A 3BYKA 3QZ4A 3C7FA 5AYCA 3WPUA 5A8CA 5AYDA 5JOYA 3CU9A 4FFFA 4FFHA 4UDIA 5AY9A 3VSZA 3WMYA 5A8DA 2YFSA 2XQRA 1WL7A 1Y4WA 3OM7A 3QEFA 4UDKE 4KMIA 1YIFA 4PVAA 3ZXJA 1Y7BA 5A7VB 3KF3A 3LF7A 2AC1A 5GLKA 3AKHA 3PIJA 4COTA 5B6TA 1UYPA 4O8PA 5FMBA 3OM4A 3U75A 1GYHA 3TAWA 1GYEB 1Y9GA 3LEMA 1VKDA 3D5YA 4QQSA 1YRZA 5ANNA 3RWKX 3QEDA 3U14A 3C2UA 3WN0A 3LDKA 4FFGA 5FLWA 5B6SA 3QEEA 4UDJA 2EXHA
chains in the Genus database with same CATH superfamily
3AKFA 2OXBA 3PIGA 3UGGA 2X8SA 3WPZA 5GLLA 5AYEA 2VDTA 3NQHA 3P2NA 1ST8A 1Y9MA 5JOWA 5GLPA 3LIGA 2QQVA 3BYLA 4O8OA 5FIXA 2X8FA 2AEZA 3R4ZA 4N4BA 5GLRA 3VT1A 3AKGA 3VT2A 3ZXLA 2X8TA 5C0PA 3WPVA 2B4WA 4EQVA 5FK8A 5FKCA 3WASA 4KCBA 3LIHA 2QQWA 5FMCA 5GLOA 4AK7A 3C7OA 5FMDA 3VSSA 2EXKA 3C7EA 4FFIA 5GLNA 3SC7X 2EXJA 3BYNA 4N2RA 1PT2A 4U6DA 5GLQA 3WPYA 3K1UA 5JOZA 3LDRA 1W2TA 4U6BA 4PVIA 2AEYA 2EXIA 3WAUA 3VSFA 4N1IA 3OM5A 3R4YA 3R67A 3D61A 3BYJA 4MLGA 5FK7A 3C7GA 5FKBA 3D5ZA 3C7HA 4UDGA 4AK6A 3VT0A 2YFRA 3WATA 1GYDB 1TL2A 1UV4A 3AKIA 5A7VA 5JOXA 3LFIA 5C2MA 2QQUA 4KC7A 1YI7A 3OM2A 3UGHA 1W18A 3ZXKA 1OYGA 3QC2A 4KCAA 4ONZA 3OM6A 5GLMA 2ADDA 3UGFA 4UDKA 4KC8A 3WN2A 3VSRA 3WN1A 3D60A 2YFTA 2ADEA 4N2ZA 4NOVA 4O8NA 3LV4A 4D47A 3WMZA 4AK5A 3KSTA 3KF5A 3BYKA 3QZ4A 3C7FA 5AYCA 3WPUA 5A8CA 5AYDA 5JOYA 3CU9A 4FFFA 4FFHA 4UDIA 5AY9A 3VSZA 3WMYA 5A8DA 2YFSA 2XQRA 1WL7A 1Y4WA 3OM7A 3QEFA 4UDKE 4KMIA 1YIFA 4PVAA 3ZXJA 1Y7BA 5A7VB 3KF3A 3LF7A 2AC1A 5GLKA 3AKHA 3PIJA 4COTA 5B6TA 1UYPA 4O8PA 5FMBA 3OM4A 3U75A 1GYHA 3TAWA 1GYEB 1Y9GA 3LEMA 1VKDA 3D5YA 4QQSA 1YRZA 5ANNA 3RWKX 3QEDA 3U14A 3C2UA 3WN0A 3LDKA 4FFGA 5FLWA 5B6SA 3QEEA 4UDJA 2EXHA
chains in the Genus database with same CATH topology
3AKFA 2OXBA 3PIGA 3UGGA 2X8SA 3WPZA 5GLLA 5AYEA 2VDTA 3NQHA 3P2NA 1ST8A 1Y9MA 5JOWA 5GLPA 3LIGA 2QQVA 3BYLA 4O8OA 5FIXA 2X8FA 2AEZA 3R4ZA 4N4BA 5GLRA 3VT1A 3AKGA 3VT2A 3ZXLA 2X8TA 5C0PA 3WPVA 2B4WA 4EQVA 5FK8A 5FKCA 3WASA 4KCBA 3LIHA 2QQWA 5FMCA 5GLOA 4AK7A 3C7OA 5FMDA 3VSSA 2EXKA 3C7EA 4FFIA 5GLNA 3SC7X 2EXJA 3BYNA 4N2RA 1PT2A 4U6DA 5GLQA 3WPYA 3K1UA 5JOZA 3LDRA 1W2TA 4U6BA 4PVIA 2AEYA 2EXIA 3WAUA 3VSFA 4N1IA 3OM5A 3R4YA 3R67A 3D61A 3BYJA 4MLGA 5FK7A 3C7GA 5FKBA 3D5ZA 3C7HA 4UDGA 4AK6A 3VT0A 2YFRA 3WATA 1GYDB 3AKIA 1UV4A 5A7VA 5JOXA 3LFIA 2QQUA 4KC7A 1YI7A 3OM2A 3UGHA 1W18A 3ZXKA 1OYGA 3QC2A 4KCAA 4ONZA 3OM6A 5GLMA 2ADDA 3UGFA 4UDKA 4KC8A 3WN2A 3VSRA 3WN1A 3D60A 2YFTA 2ADEA 4N2ZA 4NOVA 4O8NA 3LV4A 4D47A 3WMZA 4AK5A 3KSTA 3KF5A 3BYKA 3QZ4A 3C7FA 5AYCA 3WPUA 5A8CA 5AYDA 5JOYA 3CU9A 4FFFA 4FFHA 4UDIA 5AY9A 3VSZA 3WMYA 5A8DA 2YFSA 2XQRA 1WL7A 1Y4WA 3OM7A 3QEFA 4UDKE 4KMIA 1YIFA 4PVAA 3ZXJA 1Y7BA 5A7VB 3KF3A 3LF7A 2AC1A 5GLKA 3AKHA 3PIJA 4COTA 5B6TA 1UYPA 4O8PA 5FMBA 3OM4A 3U75A 1GYHA 3TAWA 1GYEB 1Y9GA 3LEMA 1VKDA 3D5YA 4QQSA 1YRZA 5ANNA 3RWKX 3QEDA 3U14A 3C2UA 3WN0A 3LDKA 4FFGA 5FLWA 5B6SA 3QEEA 4UDJA 2EXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKF A;  2OXB A;  3PIG A;  3UGG A;  2X8S A;  3WPZ A;  5GLL A;  5AYE A;  2VDT A;  3NQH A;  3P2N A;  1ST8 A;  1Y9M A;  5JOW A;  5GLP A;  3LIG A;  2QQV A;  3BYL A;  4O8O A;  5FIX A;  2X8F A;  2AEZ A;  3R4Z A;  4N4B A;  5GLR A;  3VT1 A;  3AKG A;  3VT2 A;  3ZXL A;  2X8T A;  5C0P A;  3WPV A;  2B4W A;  4EQV A;  5FK8 A;  5FKC A;  3WAS A;  4KCB A;  3LIH A;  2QQW A;  5FMC A;  5GLO A;  4AK7 A;  3C7O A;  5FMD A;  3VSS A;  2EXK A;  3C7E A;  4FFI A;  5GLN A;  3SC7 X;  2EXJ A;  3BYN A;  4N2R A;  1PT2 A;  4U6D A;  5GLQ A;  3WPY A;  3K1U A;  5JOZ A;  3LDR A;  1W2T A;  4U6B A;  4PVI A;  2AEY A;  2EXI A;  3WAU A;  3VSF A;  4N1I A;  3OM5 A;  3R4Y A;  3R67 A;  3D61 A;  3BYJ A;  4MLG A;  5FK7 A;  3C7G A;  5FKB A;  3D5Z A;  3C7H A;  4UDG A;  4AK6 A;  3VT0 A;  2YFR A;  3WAT A;  1GYD B;  3AKI A;  1UV4 A;  5A7V A;  5JOX A;  3LFI A;  2QQU A;  4KC7 A;  1YI7 A;  3OM2 A;  3UGH A;  1W18 A;  3ZXK A;  1OYG A;  3QC2 A;  4KCA A;  4ONZ A;  3OM6 A;  5GLM A;  2ADD A;  3UGF A;  4UDK A;  4KC8 A;  3WN2 A;  3VSR A;  3WN1 A;  3D60 A;  2YFT A;  2ADE A;  4N2Z A;  4NOV A;  4O8N A;  3LV4 A;  4D47 A;  3WMZ A;  4AK5 A;  3KST A;  3KF5 A;  3BYK A;  3QZ4 A;  3C7F A;  5AYC A;  3WPU A;  5A8C A;  5AYD A;  5JOY A;  3CU9 A;  4FFF A;  4FFH A;  4UDI A;  5AY9 A;  3VSZ A;  3WMY A;  5A8D A;  2YFS A;  2XQR A;  1WL7 A;  1Y4W A;  3OM7 A;  3QEF A;  4UDK E;  4KMI A;  1YIF A;  4PVA A;  3ZXJ A;  1Y7B A;  5A7V B;  3KF3 A;  3LF7 A;  2AC1 A;  5GLK A;  3AKH A;  3PIJ A;  4COT A;  5B6T A;  1UYP A;  4O8P A;  5FMB A;  3OM4 A;  3U75 A;  1GYH A;  3TAW A;  1GYE B;  1Y9G A;  3LEM A;  1VKD A;  3D5Y A;  4QQS A;  1YRZ A;  5ANN A;  3RWK X;  3QED A;  3U14 A;  3C2U A;  3WN0 A;  3LDK A;  4FFG A;  5FLW A;  5B6S A;  3QEE A;  4UDJ A;  2EXH A; 
#chains in the Genus database with same CATH topology
 3AKF A;  2OXB A;  3PIG A;  3UGG A;  2X8S A;  3WPZ A;  5GLL A;  5AYE A;  2VDT A;  3NQH A;  3P2N A;  1ST8 A;  1Y9M A;  5JOW A;  5GLP A;  3LIG A;  2QQV A;  3BYL A;  4O8O A;  5FIX A;  2X8F A;  2AEZ A;  3R4Z A;  4N4B A;  5GLR A;  3VT1 A;  3AKG A;  3VT2 A;  3ZXL A;  2X8T A;  5C0P A;  3WPV A;  2B4W A;  4EQV A;  5FK8 A;  5FKC A;  3WAS A;  4KCB A;  3LIH A;  2QQW A;  5FMC A;  5GLO A;  4AK7 A;  3C7O A;  5FMD A;  3VSS A;  2EXK A;  3C7E A;  4FFI A;  5GLN A;  3SC7 X;  2EXJ A;  3BYN A;  4N2R A;  1PT2 A;  4U6D A;  5GLQ A;  3WPY A;  3K1U A;  5JOZ A;  3LDR A;  1W2T A;  4U6B A;  4PVI A;  2AEY A;  2EXI A;  3WAU A;  3VSF A;  4N1I A;  3OM5 A;  3R4Y A;  3R67 A;  3D61 A;  3BYJ A;  4MLG A;  5FK7 A;  3C7G A;  5FKB A;  3D5Z A;  3C7H A;  4UDG A;  4AK6 A;  3VT0 A;  2YFR A;  3WAT A;  1GYD B;  1TL2 A;  1UV4 A;  3AKI A;  5A7V A;  5JOX A;  3LFI A;  5C2M A;  2QQU A;  4KC7 A;  1YI7 A;  3OM2 A;  3UGH A;  1W18 A;  3ZXK A;  1OYG A;  3QC2 A;  4KCA A;  4ONZ A;  3OM6 A;  5GLM A;  2ADD A;  3UGF A;  4UDK A;  4KC8 A;  3WN2 A;  3VSR A;  3WN1 A;  3D60 A;  2YFT A;  2ADE A;  4N2Z A;  4NOV A;  4O8N A;  3LV4 A;  4D47 A;  3WMZ A;  4AK5 A;  3KST A;  3KF5 A;  3BYK A;  3QZ4 A;  3C7F A;  5AYC A;  3WPU A;  5A8C A;  5AYD A;  5JOY A;  3CU9 A;  4FFF A;  4FFH A;  4UDI A;  5AY9 A;  3VSZ A;  3WMY A;  5A8D A;  2YFS A;  2XQR A;  1WL7 A;  1Y4W A;  3OM7 A;  3QEF A;  4UDK E;  4KMI A;  1YIF A;  4PVA A;  3ZXJ A;  1Y7B A;  5A7V B;  3KF3 A;  3LF7 A;  2AC1 A;  5GLK A;  3AKH A;  3PIJ A;  4COT A;  5B6T A;  1UYP A;  4O8P A;  5FMB A;  3OM4 A;  3U75 A;  1GYH A;  3TAW A;  1GYE B;  1Y9G A;  3LEM A;  1VKD A;  3D5Y A;  4QQS A;  1YRZ A;  5ANN A;  3RWK X;  3QED A;  3U14 A;  3C2U A;  3WN0 A;  3LDK A;  4FFG A;  5FLW A;  5B6S A;  3QEE A;  4UDJ A;  2EXH A; 
#chains in the Genus database with same CATH homology
 3AKF A;  2OXB A;  3PIG A;  3UGG A;  2X8S A;  3WPZ A;  5GLL A;  5AYE A;  2VDT A;  3NQH A;  3P2N A;  1ST8 A;  1Y9M A;  5JOW A;  5GLP A;  3LIG A;  2QQV A;  3BYL A;  4O8O A;  5FIX A;  2X8F A;  2AEZ A;  3R4Z A;  4N4B A;  5GLR A;  3VT1 A;  3AKG A;  3VT2 A;  3ZXL A;  2X8T A;  5C0P A;  3WPV A;  2B4W A;  4EQV A;  5FK8 A;  5FKC A;  3WAS A;  4KCB A;  3LIH A;  2QQW A;  5FMC A;  5GLO A;  4AK7 A;  3C7O A;  5FMD A;  3VSS A;  2EXK A;  3C7E A;  4FFI A;  5GLN A;  3SC7 X;  2EXJ A;  3BYN A;  4N2R A;  1PT2 A;  4U6D A;  5GLQ A;  3WPY A;  3K1U A;  5JOZ A;  3LDR A;  1W2T A;  4U6B A;  4PVI A;  2AEY A;  2EXI A;  3WAU A;  3VSF A;  4N1I A;  3OM5 A;  3R4Y A;  3R67 A;  3D61 A;  3BYJ A;  4MLG A;  5FK7 A;  3C7G A;  5FKB A;  3D5Z A;  3C7H A;  4UDG A;  4AK6 A;  3VT0 A;  2YFR A;  3WAT A;  1GYD B;  3AKI A;  1UV4 A;  5A7V A;  5JOX A;  3LFI A;  2QQU A;  4KC7 A;  1YI7 A;  3OM2 A;  3UGH A;  1W18 A;  3ZXK A;  1OYG A;  3QC2 A;  4KCA A;  4ONZ A;  3OM6 A;  5GLM A;  2ADD A;  3UGF A;  4UDK A;  4KC8 A;  3WN2 A;  3VSR A;  3WN1 A;  3D60 A;  2YFT A;  2ADE A;  4N2Z A;  4NOV A;  4O8N A;  3LV4 A;  4D47 A;  3WMZ A;  4AK5 A;  3KST A;  3KF5 A;  3BYK A;  3QZ4 A;  3C7F A;  5AYC A;  3WPU A;  5A8C A;  5AYD A;  5JOY A;  3CU9 A;  4FFF A;  4FFH A;  4UDI A;  5AY9 A;  3VSZ A;  3WMY A;  5A8D A;  2YFS A;  2XQR A;  1WL7 A;  1Y4W A;  3OM7 A;  3QEF A;  4UDK E;  4KMI A;  1YIF A;  4PVA A;  3ZXJ A;  1Y7B A;  5A7V B;  3KF3 A;  3LF7 A;  2AC1 A;  5GLK A;  3AKH A;  3PIJ A;  4COT A;  5B6T A;  1UYP A;  4O8P A;  5FMB A;  3OM4 A;  3U75 A;  1GYH A;  3TAW A;  1GYE B;  1Y9G A;  3LEM A;  1VKD A;  3D5Y A;  4QQS A;  1YRZ A;  5ANN A;  3RWK X;  3QED A;  3U14 A;  3C2U A;  3WN0 A;  3LDK A;  4FFG A;  5FLW A;  5B6S A;  3QEE A;  4UDJ A;  2EXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...