4N1JA

Crystal structures of nlrp14 pyrin domain reveal a conformational switch mechanism, regulating its molecular interactions
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
SSSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWNEVKKARREDLANLMKKYYPGEKAWSVSLKIFGKMNLKDLCERAKEEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the NLRP14 pyrin domain reveal a conformational switch mechanism regulating its molecular interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords NACHT, LRR and PYD domains-containing protein 14
total genus 27
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4n1jA00
2BBZA 2DBGA 2MN4A 3T6PA 3J6JA 4IZAB 3LQQA 1FADA 4O7QA 2P1HA 1A1WA 1D2ZA 4F42A 1A1ZA 2N7ZA 3CRDA 4N1KA 2N97A 4A2WA 2YQFA 4I16A 1ICHA 3QF2A 1E3YA 1UCPA 2MS8A 2NZ7A 4O9FA 4O6XA 2D96A 2NAQA 1CWWA 4F44A 2MPCA 2NSNA 2DBHA 2M5VA 4QOBA 2N80A 3YGSC 2N83A 4O9LA 3YGSP 2IB1A 2LWDA 4UZ0A 4NQKA 1WH4A 3KATA 2YVIA 4A2QA 1WXPA 4P4HA 4RHWA 3MOPK 2KM6A 2YGSA 1DGNA 4P4HI 4EWIA 4IZ7B 4DWNA 1E41A 4N1JA 4JUPA 3MOPG 1D2ZB 2N00A 2B1WA 2O71A 2L6AA 2LWEA 2MB9A 4M9ZA 3LQRA 1CY5A 2OF5H 4D8OA 1C15A 4LWDA 2L9MA 1DDFA 4ZBWA 2OF5A 2DBDA 2BBRA 2F1SA 2LS7A 1YGOA 3EZQB 2A5YB 4FH0A 3J63A 3CL3A 4N1LA 2HM2Q 2A9IA 2DO9A 2GF5A 1Z6TA 2G7RA 1N3KA 2MS7A 4M9XA 4M9SA 1PN5A 2YU0A 2KN6A 4E9MA 2VGQA 3EZQA 4JQWA 3MOPA 1WMGA 2N1FA 4IZ5E 1NGRA 4RHWE 2DBFA
chains in the Genus database with same CATH superfamily
2BBZA 2DBGA 2MN4A 2XV9A 3T6PA 3J6JA 4IZAB 3LQQA 1FADA 4O7QA 2P1HA 1A1WA 1D2ZA 4F42A 1A1ZA 2N7ZA 3CRDA 4N1KA 2N97A 4A2WA 2YQFA 4I16A 1ICHA 3QF2A 1E3YA 1UCPA 2MS8A 2NZ7A 4O9FA 4O6XA 2D96A 2NAQA 1CWWA 4F44A 2MPCA 2NSNA 2DBHA 2M5VA 4QOBA 2N80A 3YGSC 2N83A 4O9LA 3YGSP 2IB1A 2LWDA 4UZ0A 4NQKA 1WH4A 3KATA 2YVIA 4A2QA 1WXPA 4P4HA 4RHWA 3MOPK 2KM6A 2YGSA 1DGNA 4P4HI 4EWIA 4IZ7B 4DWNA 1E41A 4N1JA 4JUPA 3MOPG 1D2ZB 2N00A 2B1WA 2O71A 2L6AA 2LWEA 2MB9A 4M9ZA 3LQRA 1CY5A 2OF5H 4D8OA 1C15A 4LWDA 2L9MA 1DDFA 4ZBWA 2OF5A 2DBDA 2BBRA 2F1SA 2LS7A 1YGOA 3EZQB 2A5YB 4FH0A 3J63A 3CL3A 2MJMA 4N1LA 2HM2Q 2A9IA 2DO9A 2GF5A 1Z6TA 2G7RA 1N3KA 2MS7A 4M9XA 4M9SA 1PN5A 2YU0A 2KN6A 4E9MA 2VGQA 3EZQA 4JQWA 3MOPA 1WMGA 2N1FA 4IZ5E 1NGRA 4RHWE 2DBFA
chains in the Genus database with same CATH topology
2BBZA 2DBGA 2MN4A 2XV9A 3T6PA 3J6JA 4IZAB 3LQQA 1FADA 4O7QA 2P1HA 1A1WA 1D2ZA 4F42A 1A1ZA 2N7ZA 3CRDA 4N1KA 2N97A 4A2WA 2YQFA 4I16A 1ICHA 3QF2A 1E3YA 1UCPA 2MS8A 2NZ7A 4O9FA 4O6XA 2D96A 2NAQA 1CWWA 4F44A 2MPCA 2NSNA 2DBHA 2M5VA 4QOBA 2N80A 3YGSC 2N83A 4O9LA 3YGSP 2IB1A 2LWDA 4UZ0A 4NQKA 1WH4A 3KATA 2YVIA 4A2QA 1WXPA 4P4HA 4RHWA 3MOPK 2KM6A 2YGSA 1DGNA 4P4HI 4EWIA 4IZ7B 4DWNA 1E41A 4N1JA 4JUPA 3MOPG 1D2ZB 2N00A 2B1WA 2O71A 2L6AA 2LWEA 2MB9A 4M9ZA 3LQRA 1CY5A 2OF5H 4D8OA 1C15A 4LWDA 2L9MA 1DDFA 4ZBWA 2OF5A 2DBDA 2BBRA 2F1SA 2LS7A 1YGOA 3EZQB 2A5YB 4FH0A 3J63A 3CL3A 2MJMA 4N1LA 2HM2Q 2A9IA 2DO9A 2GF5A 1Z6TA 2G7RA 1N3KA 2MS7A 4M9XA 4M9SA 1PN5A 2YU0A 2KN6A 4E9MA 2VGQA 3EZQA 4JQWA 3MOPA 1WMGA 2N1FA 4IZ5E 1NGRA 4RHWE 2DBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBZ A;  2DBG A;  2MN4 A;  3T6P A;  3J6J A;  4IZA B;  3LQQ A;  1FAD A;  4O7Q A;  2P1H A;  1A1W A;  1D2Z A;  4F42 A;  1A1Z A;  2N7Z A;  3CRD A;  4N1K A;  2N97 A;  4A2W A;  2YQF A;  4I16 A;  1ICH A;  3QF2 A;  1E3Y A;  1UCP A;  2MS8 A;  2NZ7 A;  4O9F A;  4O6X A;  2D96 A;  2NAQ A;  1CWW A;  4F44 A;  2MPC A;  2NSN A;  2DBH A;  2M5V A;  4QOB A;  2N80 A;  3YGS C;  2N83 A;  4O9L A;  3YGS P;  2IB1 A;  2LWD A;  4UZ0 A;  4NQK A;  1WH4 A;  3KAT A;  2YVI A;  4A2Q A;  1WXP A;  4P4H A;  4RHW A;  3MOP K;  2KM6 A;  2YGS A;  1DGN A;  4P4H I;  4EWI A;  4IZ7 B;  4DWN A;  1E41 A;  4N1J A;  4JUP A;  3MOP G;  1D2Z B;  2N00 A;  2B1W A;  2O71 A;  2L6A A;  2LWE A;  2MB9 A;  4M9Z A;  3LQR A;  1CY5 A;  2OF5 H;  4D8O A;  1C15 A;  4LWD A;  2L9M A;  1DDF A;  4ZBW A;  2OF5 A;  2DBD A;  2BBR A;  2F1S A;  2LS7 A;  1YGO A;  3EZQ B;  2A5Y B;  4FH0 A;  3J63 A;  3CL3 A;  4N1L A;  2HM2 Q;  2A9I A;  2DO9 A;  2GF5 A;  1Z6T A;  2G7R A;  1N3K A;  2MS7 A;  4M9X A;  4M9S A;  1PN5 A;  2YU0 A;  2KN6 A;  4E9M A;  2VGQ A;  3EZQ A;  4JQW A;  3MOP A;  1WMG A;  2N1F A;  4IZ5 E;  1NGR A;  4RHW E;  2DBF A; 
#chains in the Genus database with same CATH topology
 2BBZ A;  2DBG A;  2MN4 A;  2XV9 A;  3T6P A;  3J6J A;  4IZA B;  3LQQ A;  1FAD A;  4O7Q A;  2P1H A;  1A1W A;  1D2Z A;  4F42 A;  1A1Z A;  2N7Z A;  3CRD A;  4N1K A;  2N97 A;  4A2W A;  2YQF A;  4I16 A;  1ICH A;  3QF2 A;  1E3Y A;  1UCP A;  2MS8 A;  2NZ7 A;  4O9F A;  4O6X A;  2D96 A;  2NAQ A;  1CWW A;  4F44 A;  2MPC A;  2NSN A;  2DBH A;  2M5V A;  4QOB A;  2N80 A;  3YGS C;  2N83 A;  4O9L A;  3YGS P;  2IB1 A;  2LWD A;  4UZ0 A;  4NQK A;  1WH4 A;  3KAT A;  2YVI A;  4A2Q A;  1WXP A;  4P4H A;  4RHW A;  3MOP K;  2KM6 A;  2YGS A;  1DGN A;  4P4H I;  4EWI A;  4IZ7 B;  4DWN A;  1E41 A;  4N1J A;  4JUP A;  3MOP G;  1D2Z B;  2N00 A;  2B1W A;  2O71 A;  2L6A A;  2LWE A;  2MB9 A;  4M9Z A;  3LQR A;  1CY5 A;  2OF5 H;  4D8O A;  1C15 A;  4LWD A;  2L9M A;  1DDF A;  4ZBW A;  2OF5 A;  2DBD A;  2BBR A;  2F1S A;  2LS7 A;  1YGO A;  3EZQ B;  2A5Y B;  4FH0 A;  3J63 A;  3CL3 A;  2MJM A;  4N1L A;  2HM2 Q;  2A9I A;  2DO9 A;  2GF5 A;  1Z6T A;  2G7R A;  1N3K A;  2MS7 A;  4M9X A;  4M9S A;  1PN5 A;  2YU0 A;  2KN6 A;  4E9M A;  2VGQ A;  3EZQ A;  4JQW A;  3MOP A;  1WMG A;  2N1F A;  4IZ5 E;  1NGR A;  4RHW E;  2DBF A; 
#chains in the Genus database with same CATH homology
 2BBZ A;  2DBG A;  2MN4 A;  2XV9 A;  3T6P A;  3J6J A;  4IZA B;  3LQQ A;  1FAD A;  4O7Q A;  2P1H A;  1A1W A;  1D2Z A;  4F42 A;  1A1Z A;  2N7Z A;  3CRD A;  4N1K A;  2N97 A;  4A2W A;  2YQF A;  4I16 A;  1ICH A;  3QF2 A;  1E3Y A;  1UCP A;  2MS8 A;  2NZ7 A;  4O9F A;  4O6X A;  2D96 A;  2NAQ A;  1CWW A;  4F44 A;  2MPC A;  2NSN A;  2DBH A;  2M5V A;  4QOB A;  2N80 A;  3YGS C;  2N83 A;  4O9L A;  3YGS P;  2IB1 A;  2LWD A;  4UZ0 A;  4NQK A;  1WH4 A;  3KAT A;  2YVI A;  4A2Q A;  1WXP A;  4P4H A;  4RHW A;  3MOP K;  2KM6 A;  2YGS A;  1DGN A;  4P4H I;  4EWI A;  4IZ7 B;  4DWN A;  1E41 A;  4N1J A;  4JUP A;  3MOP G;  1D2Z B;  2N00 A;  2B1W A;  2O71 A;  2L6A A;  2LWE A;  2MB9 A;  4M9Z A;  3LQR A;  1CY5 A;  2OF5 H;  4D8O A;  1C15 A;  4LWD A;  2L9M A;  1DDF A;  4ZBW A;  2OF5 A;  2DBD A;  2BBR A;  2F1S A;  2LS7 A;  1YGO A;  3EZQ B;  2A5Y B;  4FH0 A;  3J63 A;  3CL3 A;  2MJM A;  4N1L A;  2HM2 Q;  2A9I A;  2DO9 A;  2GF5 A;  1Z6T A;  2G7R A;  1N3K A;  2MS7 A;  4M9X A;  4M9S A;  1PN5 A;  2YU0 A;  2KN6 A;  4E9M A;  2VGQ A;  3EZQ A;  4JQW A;  3MOP A;  1WMG A;  2N1F A;  4IZ5 E;  1NGR A;  4RHW E;  2DBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...