4N1KA

Crystal structures of nlrp14 pyrin domain reveal a conformational switch mechanism, regulating its molecular interactions
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
SSSFFPDFGLLLYLEELNKEELNTFKLFLKETMEPEHGLTPWNEVKKARREDLANLMKKYYPGEKAWSVSLKIFGKMNLKVLCERAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the NLRP14 pyrin domain reveal a conformational switch mechanism regulating its molecular interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords NACHT, LRR and PYD domains-containing protein 14
total genus 30
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02758 PYRIN PAAD/DAPIN/Pyrin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4n1kA00
4D8OA 4N1KA 4M9SA 4NQKA 3J6JA 2LWDA 4A2WA 4QOBA 4IZ7B 1CY5A 3T6PA 2BBRA 4RHWE 1FADA 2DBDA 1Z6TA 4IZ5E 1ICHA 1NGRA 4F42A 3LQRA 4M9XA 4I16A 2A9IA 3EZQA 2N97A 1PN5A 4M9ZA 3J63A 1YGOA 1WH4A 2YVIA 2MPCA 4N1JA 4E9MA 2MN4A 1WMGA 3YGSC 3QF2A 3MOPG 2KN6A 4F44A 1C15A 2B1WA 2O71A 3MOPK 2L6AA 2NSNA 4EWIA 2G7RA 4DWNA 1A1WA 2GF5A 2IB1A 2YGSA 2DBFA 2N00A 1DGNA 2N1FA 3LQQA 2P1HA 2L9MA 3YGSP 2DO9A 2YQFA 4A2QA 1A1ZA 4JQWA 1CWWA 2YU0A 2LS7A 2MS8A 4O7QA 2LWEA 1D2ZA 1WXPA 2N83A 1D2ZB 1DDFA 2N7ZA 2OF5H 4N1LA 4P4HI 2OF5A 2NAQA 2HM2Q 2M5VA 4JUPA 4O9FA 2BBZA 2MB9A 2N80A 2A5YB 2KM6A 1E3YA 1N3KA 4P4HA 4IZAB 2NZ7A 4LWDA 2VGQA 2DBGA 4O6XA 2MS7A 2F1SA 1E41A 2DBHA 3MOPA 4UZ0A 3KATA 3CRDA 3CL3A 2D96A 4FH0A 4O9LA 1UCPA 4ZBWA 3EZQB 4RHWA
chains in the Genus database with same CATH superfamily
4D8OA 4N1KA 4M9SA 4NQKA 3J6JA 2LWDA 4A2WA 4QOBA 4IZ7B 1CY5A 3T6PA 2BBRA 4RHWE 1FADA 2XV9A 2DBDA 1Z6TA 4IZ5E 1ICHA 1NGRA 4F42A 3LQRA 4M9XA 4I16A 2A9IA 3EZQA 2N97A 1PN5A 2MJMA 4M9ZA 3J63A 1YGOA 1WH4A 2YVIA 2MPCA 4N1JA 4E9MA 2MN4A 1WMGA 3YGSC 3QF2A 3MOPG 2KN6A 4F44A 1C15A 2B1WA 2O71A 3MOPK 2L6AA 2NSNA 4EWIA 2G7RA 4DWNA 1A1WA 2GF5A 2IB1A 2YGSA 2DBFA 2N00A 1DGNA 2N1FA 3LQQA 2P1HA 2L9MA 3YGSP 2DO9A 2YQFA 4A2QA 1A1ZA 4JQWA 1CWWA 2YU0A 2LS7A 2MS8A 4O7QA 2LWEA 1D2ZA 1WXPA 2N83A 1D2ZB 1DDFA 2N7ZA 2OF5H 4N1LA 4P4HI 2OF5A 2NAQA 2HM2Q 2M5VA 4JUPA 4O9FA 2BBZA 2MB9A 2N80A 2A5YB 2KM6A 1E3YA 1N3KA 4P4HA 4IZAB 2NZ7A 4LWDA 2VGQA 2DBGA 4O6XA 2MS7A 2F1SA 1E41A 2DBHA 3MOPA 4UZ0A 3KATA 3CRDA 3CL3A 2D96A 4FH0A 4O9LA 1UCPA 4ZBWA 3EZQB 4RHWA
chains in the Genus database with same CATH topology
4D8OA 4N1KA 4M9SA 4NQKA 3J6JA 2LWDA 4A2WA 4QOBA 4IZ7B 1CY5A 3T6PA 2BBRA 4RHWE 1FADA 2XV9A 2DBDA 1Z6TA 4IZ5E 1ICHA 1NGRA 4F42A 3LQRA 4M9XA 4I16A 2A9IA 3EZQA 2N97A 1PN5A 2MJMA 4M9ZA 3J63A 1YGOA 1WH4A 2YVIA 2MPCA 4N1JA 4E9MA 2MN4A 1WMGA 3YGSC 3QF2A 3MOPG 2KN6A 4F44A 1C15A 2B1WA 2O71A 3MOPK 2L6AA 2NSNA 4EWIA 2G7RA 4DWNA 1A1WA 2GF5A 2IB1A 2YGSA 2DBFA 2N00A 1DGNA 2N1FA 3LQQA 2P1HA 2L9MA 3YGSP 2DO9A 2YQFA 4A2QA 1A1ZA 4JQWA 1CWWA 2YU0A 2LS7A 2MS8A 4O7QA 2LWEA 1D2ZA 1WXPA 2N83A 1D2ZB 1DDFA 2N7ZA 2OF5H 4N1LA 4P4HI 2OF5A 2NAQA 2HM2Q 2M5VA 4JUPA 4O9FA 2BBZA 2MB9A 2N80A 2A5YB 2KM6A 1E3YA 1N3KA 4P4HA 4IZAB 2NZ7A 4LWDA 2VGQA 2DBGA 4O6XA 2MS7A 2F1SA 1E41A 2DBHA 3MOPA 4UZ0A 3KATA 3CRDA 3CL3A 2D96A 4FH0A 4O9LA 1UCPA 4ZBWA 3EZQB 4RHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8O A;  4N1K A;  4M9S A;  4NQK A;  3J6J A;  2LWD A;  4A2W A;  4QOB A;  4IZ7 B;  1CY5 A;  3T6P A;  2BBR A;  4RHW E;  1FAD A;  2DBD A;  1Z6T A;  4IZ5 E;  1ICH A;  1NGR A;  4F42 A;  3LQR A;  4M9X A;  4I16 A;  2A9I A;  3EZQ A;  2N97 A;  1PN5 A;  4M9Z A;  3J63 A;  1YGO A;  1WH4 A;  2YVI A;  2MPC A;  4N1J A;  4E9M A;  2MN4 A;  1WMG A;  3YGS C;  3QF2 A;  3MOP G;  2KN6 A;  4F44 A;  1C15 A;  2B1W A;  2O71 A;  3MOP K;  2L6A A;  2NSN A;  4EWI A;  2G7R A;  4DWN A;  1A1W A;  2GF5 A;  2IB1 A;  2YGS A;  2DBF A;  2N00 A;  1DGN A;  2N1F A;  3LQQ A;  2P1H A;  2L9M A;  3YGS P;  2DO9 A;  2YQF A;  4A2Q A;  1A1Z A;  4JQW A;  1CWW A;  2YU0 A;  2LS7 A;  2MS8 A;  4O7Q A;  2LWE A;  1D2Z A;  1WXP A;  2N83 A;  1D2Z B;  1DDF A;  2N7Z A;  2OF5 H;  4N1L A;  4P4H I;  2OF5 A;  2NAQ A;  2HM2 Q;  2M5V A;  4JUP A;  4O9F A;  2BBZ A;  2MB9 A;  2N80 A;  2A5Y B;  2KM6 A;  1E3Y A;  1N3K A;  4P4H A;  4IZA B;  2NZ7 A;  4LWD A;  2VGQ A;  2DBG A;  4O6X A;  2MS7 A;  2F1S A;  1E41 A;  2DBH A;  3MOP A;  4UZ0 A;  3KAT A;  3CRD A;  3CL3 A;  2D96 A;  4FH0 A;  4O9L A;  1UCP A;  4ZBW A;  3EZQ B;  4RHW A; 
#chains in the Genus database with same CATH topology
 4D8O A;  4N1K A;  4M9S A;  4NQK A;  3J6J A;  2LWD A;  4A2W A;  4QOB A;  4IZ7 B;  1CY5 A;  3T6P A;  2BBR A;  4RHW E;  1FAD A;  2XV9 A;  2DBD A;  1Z6T A;  4IZ5 E;  1ICH A;  1NGR A;  4F42 A;  3LQR A;  4M9X A;  4I16 A;  2A9I A;  3EZQ A;  2N97 A;  1PN5 A;  2MJM A;  4M9Z A;  3J63 A;  1YGO A;  1WH4 A;  2YVI A;  2MPC A;  4N1J A;  4E9M A;  2MN4 A;  1WMG A;  3YGS C;  3QF2 A;  3MOP G;  2KN6 A;  4F44 A;  1C15 A;  2B1W A;  2O71 A;  3MOP K;  2L6A A;  2NSN A;  4EWI A;  2G7R A;  4DWN A;  1A1W A;  2GF5 A;  2IB1 A;  2YGS A;  2DBF A;  2N00 A;  1DGN A;  2N1F A;  3LQQ A;  2P1H A;  2L9M A;  3YGS P;  2DO9 A;  2YQF A;  4A2Q A;  1A1Z A;  4JQW A;  1CWW A;  2YU0 A;  2LS7 A;  2MS8 A;  4O7Q A;  2LWE A;  1D2Z A;  1WXP A;  2N83 A;  1D2Z B;  1DDF A;  2N7Z A;  2OF5 H;  4N1L A;  4P4H I;  2OF5 A;  2NAQ A;  2HM2 Q;  2M5V A;  4JUP A;  4O9F A;  2BBZ A;  2MB9 A;  2N80 A;  2A5Y B;  2KM6 A;  1E3Y A;  1N3K A;  4P4H A;  4IZA B;  2NZ7 A;  4LWD A;  2VGQ A;  2DBG A;  4O6X A;  2MS7 A;  2F1S A;  1E41 A;  2DBH A;  3MOP A;  4UZ0 A;  3KAT A;  3CRD A;  3CL3 A;  2D96 A;  4FH0 A;  4O9L A;  1UCP A;  4ZBW A;  3EZQ B;  4RHW A; 
#chains in the Genus database with same CATH homology
 4D8O A;  4N1K A;  4M9S A;  4NQK A;  3J6J A;  2LWD A;  4A2W A;  4QOB A;  4IZ7 B;  1CY5 A;  3T6P A;  2BBR A;  4RHW E;  1FAD A;  2XV9 A;  2DBD A;  1Z6T A;  4IZ5 E;  1ICH A;  1NGR A;  4F42 A;  3LQR A;  4M9X A;  4I16 A;  2A9I A;  3EZQ A;  2N97 A;  1PN5 A;  2MJM A;  4M9Z A;  3J63 A;  1YGO A;  1WH4 A;  2YVI A;  2MPC A;  4N1J A;  4E9M A;  2MN4 A;  1WMG A;  3YGS C;  3QF2 A;  3MOP G;  2KN6 A;  4F44 A;  1C15 A;  2B1W A;  2O71 A;  3MOP K;  2L6A A;  2NSN A;  4EWI A;  2G7R A;  4DWN A;  1A1W A;  2GF5 A;  2IB1 A;  2YGS A;  2DBF A;  2N00 A;  1DGN A;  2N1F A;  3LQQ A;  2P1H A;  2L9M A;  3YGS P;  2DO9 A;  2YQF A;  4A2Q A;  1A1Z A;  4JQW A;  1CWW A;  2YU0 A;  2LS7 A;  2MS8 A;  4O7Q A;  2LWE A;  1D2Z A;  1WXP A;  2N83 A;  1D2Z B;  1DDF A;  2N7Z A;  2OF5 H;  4N1L A;  4P4H I;  2OF5 A;  2NAQ A;  2HM2 Q;  2M5V A;  4JUP A;  4O9F A;  2BBZ A;  2MB9 A;  2N80 A;  2A5Y B;  2KM6 A;  1E3Y A;  1N3K A;  4P4H A;  4IZA B;  2NZ7 A;  4LWD A;  2VGQ A;  2DBG A;  4O6X A;  2MS7 A;  2F1S A;  1E41 A;  2DBH A;  3MOP A;  4UZ0 A;  3KAT A;  3CRD A;  3CL3 A;  2D96 A;  4FH0 A;  4O9L A;  1UCP A;  4ZBW A;  3EZQ B;  4RHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...