4N21A

Crystal structure of the gp2 core domain from the california academy of science virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
123
structure length
123
Chain Sequence
ENLYFQGNMKQIEDKIEEILSKIYHIENEIARIKKLIGAIASKIIKTANYTTNALFLLNKEESEIRDHVVEHELALNYLLAHQGGLCNVVKGPMCSSDIDDFSKNVSDMIDKVHEEMKKFYHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of the Glycoprotein GP2 Core Domain from the CAS Virus, a Novel Arenavirus-Like Species.
pubmed doi rcsb
source organism Cas virus
molecule tags Viral protein
molecule keywords GP2 Ectodomain
total genus 50
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4n21A00
5CN0A 1F23A 1ENVA 2EZOA 1MG1A 3H01A 3M99B 1K33A 4FJCC 4N21A 1K34A 1SZTA 2M7WA 3B77A 3MHHC 3P30A 5KA6A 1MOFA 5CMUA 4E2LA 2EBOA 3CYOA 1QR9A 2P6JA 1Y4MA 4JPRA 1DF4A 2EZPA 3GWOA 1QR8A 4JGSA 3B8MA 5HFMA 2X7RB 1QCEA 4FIPC 5KA5A 5HFLA 4JF3A 1I5YA 1QBZA 4G2KA 1EBOA 2LP7A 1I5XA 1DLBA 3B8NA 4FK5C 3WFVA 1JPXA 1JQ0A 2OT5A 4N23A 1DF5A 5H9CA 1Y66A 3K9AA 3CP1A 3MHSC 2MK3A
chains in the Genus database with same CATH superfamily
1K92A 4X8AA 4N21A 3K79A 4I50B 1QLEC 2YXLA 2R9IA 2KG7A 1MOFA 2RMKB 4DV6O 1V55C 1YJ9V 1AJNA 1KB9F 1UJWB 4PA7A 2XOKG 2CDYA 4O2AB 4JF3A 4DR2O 3FD9A 4G2KA 4YHHB 4BR6A 1DLBA 5FLXN 3ABMC 1OCCC 2XTAA 3B2EE 1S5LZ 2A7WA 2Y69C 4CH3A 1K4DC 2K9PA 4QE9A 5KX5A 3LSQA 4YIOA 1JFFB 5JVDA 5J2TA 1SQQH 4UCSA 4WFFA 2IU3A 3JSLA 2B1IA 1AR5A 1IVSA 5IYZA 4A5UB 3DC6A 5LGUA 3TK1A 3P32A 1G4YB 1BSMA 4K0KB 5JQGA 5IE9A 1BHBA 4DR4B 2CUGA 2QM4A 4NXNO 3DC5A 1Y74B 4TOIA 4J9YB 4B3TO 4PDMA 5JH7B 3ZHUA 4JI6O 4O4HB 4QPKA 3BA8A 1NT2B 5KHKA 2ZM6O 4EB6B 1AVMA 2UXCB 4H33A 5KA6A 1H2SB 5CBFA 2BCCH 4DO2A 3LSSA 3E89A 2CH7B 1I7FA 2Q0OC 4EB6A 1PD3A 5H6QA 2NR5A 5IJ9A 3CP1A 2WA3A 3HKCA 1I94O 5B3SB 3AK3A 3FB7C 4H0LB 4X1IB 4JYYA 3TGUH 4E2LA 1NTKH 4U3JA 3WB0A 2UUCB 1EZVH 3CCLV 4TUYA 2EILC 2QKCA 1BT8A 4WBNA 3FB5C 3ASNB 4J11A 4GX5A 3E2EA 2AZ0A 1PPJH 4DXWA 1Z5WA 1JVMA 2D3OW 3QG5A 4FVMA 1HNZO 2QR4A 1BL8A 4OX9O 1OCOB 1JR9A 4WBNB 3D3IA 1K7DA 2WPDG 3KZIZ 4ZI7B 5GONA 4PI2A 3JYCA 1K5SA 4LWSB 2CTWA 3CS5A 2LGWA 1SA0A 1P7GA 1DGSA 1VQNV 1JX9A 3HB3B 4J41A 1GN2A 2JDIG 3T2MA 4JI0B 2W0FC 4RAIA 5LP6C 3OM3B 4IYIA 4ZI7A 2E5LB 3TCUA 5A9GA 3LDDA 2QJ1A 5LP6B 4DV5B 4EEQA 1MZFA 4I4TB 1ENVA 3ZEDA 4FJCC 2DWEC 1KQSU 1AI4A 4D6TH 3W7XA 5CA0A 1SQPH 4LF6B 3BRCA 1SZXA 3FFQA 2ZT9B 4YY3B 1PM9A 1LUWA 2HR3A 1DF5A 1OZ0A 2HKOA 2VRZA 5H2FZ 1YXBA 3OEHG 4LFBO 3K03A 1SRYA 2RQ6A 3RYIB 2Q8VA 2JGDB 2JVDA 3T4DA 4I9QA 2QKSA 2DWDC 4NYKA 3GVMA 4JTCB 2AGAA 3RYCA 1I0HA 1NKDA 3ZN0A 4O2BB 3M7MX 5LL6Y 4JAUA 1S76D 1BZKA 1K73W 1W0KG 5IDJA 4N23A 4I7ZB 3CC4V 2YIAA 3SDLA 4DRXB 3EFFK 3M8AA 2QTSA 2YI8A 4EKWA 3RYCB 1G8MA 3OMIB 3JAKB 3IFXA 4UCUA 1IDSA 3CCJV 3CMEV 4LFCB 3SYAA 1JQ0A 3ABTA 4ZIBA 4O4LA 3J81N 3FB6C 4IHJA 3S3XA 3UM7A 1Q86W 4XDKA 3CCVV 5J2TB 1N32B 4PDVA 2RNBA 3F5WC 4X65B 3QO8A 5KX5B 1WJZA 3SYPA 2X7RB 2BOBC 1HR0B 2IH1C 2PYLA 5B1OA 4FK5C 4YHHO 2UU9O 2VWKA 2JRIA 4LH6A 1EFRG 1M1KW 2NN4A 4LF8O 4DV5O 1R73A 4NXMB 2P4KA 1N0NA 1Y6XA 3ZBHA 1FFXB 4K8XA 2PY5A 2L35A 1LNQA 4UV8A 5L3BA 2DW4A 4NXNB 1PL4A 2MW2B 1YTFD 5BXZA 2XAFA 2BTOA 3CWBH 2NLJC 3CC7V 1NH2D 4C7UA 3K59A 2DJVA 4JTAB 2F4VB 3CCMV 3FKSG 4CS3A 1BGYH 4MSWC 4UB6Z 5H6RA 4H13B 4K35A 3CRQA 4XDJA 1J5EO 1D2DA 2LQTA 3OFNG 3L71H 1TAEA 3H1JH 3ZMZA 2AHZA 3K5OA 4DW1A 3CYOA 1KECA 2PZSA 3HKBA 3DGEA 2G38A 3T1HO 2FB5A 4CH5A 4TV8A 2JGDA 1NU1H 1JJOA 4X1IA 1EBOA 4MVRA 3IGAC 4RUEA 2DYSB 3F5TA 2YSUB 1NVPD 1D5NA 2IJKA 4JI1O 1JA8A 2QGNA 2H3OA 4ZOLB 2Z5UA 2IW5A 2EZOA 2LGQA 5J9PC 1FJGO 1N4CA 4DR6B 4DR3B 3JCZA 4MTGA 5FPRA 3OTFA 5GTHZ 2UUCO 3K58A 2H94A 4NR1A 1S77D 1ZWIC 2QWPB 2EINB 3OTOO 3W7UA 1N32O 4ASUG 2A0LA 1H2NA 4B3SO 2MK3A 4B3MO 1NTMH 4JI7O 2JEXA 3T1CA 4JI2O 1H38A 5LXTA 1YZBA 3G80A 2XAGA 2QSAA 2R70A 4NXMO 4B3RB 2ZR2A 3DXRA 3O65A 3ASOB 1SESA 3ETEA 3VQXA 1TA8A 4DR7O 3QO5A 1XDCA 1EZJA 4FFKA 4JI1B 1HNWO 4O2AA 1W59A 4MVOA 1XNQO 1IURA 3H01A 3CRCA 2Y0IA 4OGQB 3G4SV 3VBBA 5LP6A 2VWJA 3C3TA 3CRMA 1BE3H 3K0DA 1VQ9V 5KHGA 5B66Z 2WLHA 2QEXV 1QNMA 4JYAO 1ZAUA 2GUZA 5CA0B 1GN3A 1VQPV 2E74B 1L8DA 1VF6C 3W7TA 1Y66A 2ITCC 4HYOA 1PNLA 3JALA 3I55V 4QE7A 3SYCA 1H2LA 2F66C 4FM2A 1OCRB 4MTXA 2DYRC 4Q6GA 1BS3A 1ROPA 1SC5B 3R65A 2RCVA 1B6QA 4J7KA 1SS3A 5FNVA 3OUSA 1XMQB 3JAWA 4F4LA 3CC2V 5FPOA 2UXDO 2WSSG 1Z5VA 3ETDA 3CPWU 2PYJA 3K3WA 2E75B 4TV9B 4GUNA 2DN9A 5K1XA 1FXHA 4CH6A 4DV4O 5FNVB 5LA6A 1LR1A 2WWWA 3UCSC 5EBWC 1MSDA 3JD4A 1QLNA 3UO3A 4BIOA 2OCCC 1XQ8A 4DR5B 2FL4A 3E8HA 3RGBA 3JD3A 1YEWA 2P22C 4I0XB 1US6A 2N05A 2EIMC 5LOVB 3SPGA 4TV8B 3L74H 5D5PA 3OW2U 4B3SB 5EIBC 1LUVA 5KAFZ 3B40A 1RM1B 1WN7A 2UXDB 5L3GA 5L3DA 3OR7C 5BMVA 3H1KH 4UXNA 4GX1A 4DR1O 4JAVA 3WB1A 1NR1A 4NVPA 1JFFA 4RWUA 3JCUZ 5KA5A 3IC7A 3OE7G 1VEWA 1J95A 3EXAA 1GRJA 3D36C 1MMMA 4UV9A 3BY6A 3SYQA 4JASA 3DXRB 3AG7A 3O9OA 2A9HA 2Y48A 2HJDA 4LF8B 1COWG 5IYDO 1R1BA 4JTDB 4HZ3A 2WLJA 1GK9A 4BIZA 2ODMA 2JJ1G 5BR8O 1QHTA 2JS5A 2LO1A 5B1BB 3C90A 1QVGU 4R50A 2UUAB 4PA4A 4ICGA 2A06H 4ZHQA 1VQOV 1FAFA 1NTZH 1NVPB 5IWAO 4LF9O 2F4VO 4Q20A 2VQEO 2EIJB 3HKEA 3QF7A 2XAHA 3GWKC 1R6TA 3ABKB 1F51A 3OTOB 4KP4A 4TSFG 2Q7GA 3K08A 2YI9A 2XAJA 4HNAB 2YIDA 4ZOLA 4IT5A 2P06A 5ITZB 1FD9A 4X1YB 1NBMG 2QTOA 3BHPA 3N2GA 4PA3A 1CEZA 3OEEG 1FXVA 2AZ2A 3ZMTA 1J5EB 3ZMUA 5IT9N 1IX9A 4TV9A 5LMNB 4R7CA 4LNUA 2HLDG 4Z1VA 3CCEV 1ZSPA 4GCZA 2DYRB 3KCXA 1HNWB 2VQFB 2RN9A 2NNUA 1Q6UA 3A0HZ 2PGGA 1P7BA 4YY3O 1ZL8B 4I0XA 1WB8A 4MTOA 2P5OA 5LXTB 4CC5A 4DR6O 3IJ4A 2ZM6B 2XAQA 2YXYA 3QTCA 3E86A 4UCTA 2EJ7A 2R72A 1NS1A 1Q6HA 3JASB 2CTRA 3SPJA 2XT9A 2CTPA 4DUYO 3ZRXA 4DYLA 4LFAO 3SR2C 5LYJA 1SA0B 3VOUA 1N8RW 2OCCB 1GAXA 2DQ0A 5L3FA 3ZHRA 3OMAB 1WAZA 2UXNA 2YEVB 1WA8A 4GX2A 5LGNA 1I08A 3E83A 4IGGA 4DV7B 1M4UA 3RYHB 2CGNA 4LP8A 3J80N 2GTAA 2AW9A 3ZX6A 1IZ3A 3G6EV 3E35A 3JAMN 1VQ6V 1MG1A 2UUAO 3SPHA 3ABMB 3KG2A 3RVZA 4H37A 3CE2A 4Z1MG 2Q69A 4W4KA 2FYUH 4JZGA 3OGIB 1E1QG 1K97A 1FXKC 4I9WA 4MS2A 3WB2A 4O4HA 5C8YA 3W7WA 4X65O 2UUBB 3OGCC 3OAAG 3PN1A 5GTIZ 1RSOA 1YITV 1R6KA 3SGIA 3RW0A 3ZRSA 3ETQA 4P2ZA 3N27A 1KMIZ 4P9OA 4AQYB 3IC9A 1YVWA 4BAYA 4IL6Z 2DMXA 3OMNB 4QIWF 5H9CA 1WB7A 1KKDA 2WLMA 4DUZO 2W6JG 1N33B 2O57A 5EK0A 1OJHA 3HPLC 1IBMO 4DRXA 4QPJA 2XHBA 1JJ2U 1KP3A 4TT3G 1XI1A 2ZD9A 1PKXA 4JI8B 3Q4HB 1R3IC 1QQCA 4UVBA 3B8NA 1Y67A 1KUQA 3HKDB 3SPCA 2GBOA 2UUBO 4KHPO 2EULA 1FS0G 1GTOA 1BQZA 4J7ZA 3VQVA 2ZIMA 4PJ0Z 1N0JA 5CA3A 4DV3B 1W0JG 1G1XB 3WU2Z 1YI2V 1V54B 4NKGB 3LNMB 3A8TA 2Z3YA 2X6BA 2DQ3A 1QU7A 2ZXWB 1QCEA 3STLC 4LCUC 1I5YA 4L87A 1L0LH 4DV1B 3DTUB 1CPYA 4YJ3B 4LFBB 3U10A 2IU0A 4J80A 4DUZB 3RT3C 1DK1A 3RN4A 1R6NA 1K34A 4F6EA 4HBNA 4DV2O 4HAMA 2HVKC 1AILA 3ABUA 1DF4A 3VQYA 1TUBA 4CS2A 3ZHQA 3JD0A 3ZMSA 1Q7YW 3JSNA 4E4EA 3G6BA 1Q43A 1OCOC 4JI7B 1NJIW 3ABLB 3AG4C 1OV9A 2GV9A 1YSCA 1SZTA 3B77A 3E8GA 3P30A 1IBKB 2EX3A 2HVJC 1KKCA 5HFMA 1E1RG 3I56V 3AG4B 4X66O 4AQYO 4LF5O 1WP8A 3UKMA 2HFEC 4I5SA 3GB7C 2GUZB 3RYIA 5EC2C 3K04A 4TWKA 3M99B 2QA4V 4IIJB 4X88A 4YJ2B 1HR0O 1OCCB 5E79Z 1PV0A 1Q6IA 3ZS8C 4BW9A 4WFEA 5B1AC 5TISZ 1RPOA 2P90A 5JCOA 4FLZA 1K3EA 4JI8O 4TQDA 2W0XA 4PA9A 1XREA 1V55B 3UQ8A 1H8HG 1KU9A 4LFAB 4LNUB 5CN0A 5B1AB 1SERA 3SJAC 4OX9B 3AG1C 2LW1A 1FXKB 2EBOA 4LH7A 2ADPA 3EVKA 1HP8A 2Q7EA 4X89A 3RFRA 2K1EA 2LP7A 4DV1O 3WG7B 2Z0AA 3AG1B 1N34B 4IHJB 5JCOC 5C93A 1Q81W 2YIBA 4J9ZB 1GKFA 3K5LA 2ZNJA 2QWOB 3AG2B 3G71V 4LC1A 1HNXB 3CB2A 2QWQB 2Y0PA 1RP3B 3WG7C 3CCUV 1VQ5V 5DM6V 4NB5A 1K9MW 3U11A 3UO2A 4DV0O 2X6CA 1HWYA 3AG2C 4O4JB 5LHHA 1OHHG 4JYBA 2YICA 3K0GA 2BTQB 4X20A 1H2GA 1AR1B 1VQKV 4WF9V 2JIZG 4GX0A 5LBQA 1Y76A 3TXQA 1R3LC 1ZTEA 4DV7O 1VF5B 2DOSA 4O4JA 1SQXH 4DK1A 4LF4O 1V54C 4LWSA 4GT1A 1XNRO 1WNSA 1VP7A 2ITDC 5CA1B 5EIBD 3BPZA 3CD6V 1VQ4V 4BW5A 3E22B 3FAVB 3UT5A 5LHIA 4R8CA 5B3SC 3ZRWA 1O9HA 4DR2B 5EYPA 3LDCA 1XHZA 1PNKA 2ADQB 3AG3B 2RJZA 3A0RA 3APQA 2PUSA 1U97A 3LSUA 4B08A 1VQLV 2OCHA 4JAAA 3D3QA 1QR9A 4X9QA 3VQWA 1R3KC 3CRAA 1CP9A 2FKXA 4JYCA 5H5NA 2P4VA 3AG3C 3L73H 4FZ1A 4DR7B 3PJSK 1I5XA 2YXHA 3AK1A 3MDSA 2OT5A 5GW7A 4GKJO 1Q8IA 3JD1A 4TQFA 1H8EG 1NI8A 4UVAA 4U3JB 1JCHA 2ZINA 2CGOA 1QVFU 1PP9H 4OXSA 1IBMB 2OWOA 4X1YA 2WLKA 3BFRA 2BSKA 2JS3A 4FLTA 1Q3EA 2EIKB 3I5DA 3BABA 2ZR3A 4FLUA 1QLEB 2LW7A 5LHGA 2R9AA 2VS0A 4O2BA 2IM9A 3ZHTA 3MHSC 1EM1A 1XL4A 2F95B 2DYSC 3K57A 4KUMA 2LJ2A 3NR7A 3B8MA 1TUBB 1MNGA 1GMGA 2LFSA 3FX7A 4CZZA 3SYOA 4L8JA 4U7OA 1BQ0A 1DTOA 1D5AA 2EINC 3FYEB 1K33A 1E79G 2Q73A 5KAIZ 3SPIA 4RQFA 2HHHO 1YJNV 2W6IG 4F6RA 1U96A 3B4SA 4X20B 2ATKC 1ZUQA 5K1PA 1HDJA 4OPAA 1KYOF 3H9VA 1K4CC 1UPGA 2N04A 4CH4A 3MHHC 4LF5B 3ZN1A 4JI4B 4JPRA 1GM9A 3P3PA 3JAWB 4ZKIA 5IYBO 5HFLA 3HKEB 1IBKO 2V4DA 4GKJB 4UFZA 2JJ2G 4NTXA 4AILC 4X64O 5JQGB 4FLXA 2JEUA 4PA6A 4MVQA 4DR3O 3STZC 2WLIB 1AROP 2AHYA 1FFTB 2B5UA 4PI0A 2F43G 5JWPA 4DR5O 3K9SA 3CMAV 1XMOO 1JPXA 3LDEA 4PDLA 3U0ZA 2OTJV 5LOVA 4KXRA 4B3MB 5KHIA 4FM0A 1TGOA 2R9RB 1YF2A 2FMLA 3ML0A 2EILB 2OIEA 2F23A 3TXSA 4K8ZA 4K0KO 4B3RO 4CC6A 4WFAV 1B04A 2X6AA 3HKBB 2Q0AA 3JATB 2CH7A 2L6LA 2Y4TA 3Q4HA 3E8FA 3CSXA 2WLNA 2KSDA 1OCZC 3HKDA 3JASA 1SKVA 5IYCO 1X59A 2Q4PA 3QVNA 4FLVA 4PHZA 1CXZB 2H8PC 3CX5F 4JYAB 4FIPC 1G6UA 5DN6G 4W4LA 2HHHB 3RWRD 2UXXA 3ZMVA 3APOA 3K9AA 3ETGA 4EFBA 1VMGA 1KBHA 1XEQA 5J2UB 1T5EA 4JI6B 3ZHSA 3QNEA 2ZE6A 4YJ3A 2C2AA 1AR4A 4KHPB 2EIKC 2XNDG 3B09A 2OIGA 3K5NA 4Z2WA 2ARHA 1AI6A 2UXBB 5DEDA 2YIBD 4X62B 1MABG 5CA1A 1VQMV 2GDSA 2CK3G 1XILA 4R6ZA 3FAVA 3UT5B 1XOUA 1MZEA 3AEIA 4DV4B 5CBHA 5EYPB 1GH6A 1M93A 4MVZA 1GM7A 1RSOB 1SETA 4PV1B 4G28B 3E8BA 4ZBMA 3LNNA 5B5EZ 4UCVA 2M6YA 2ZCEA 1SQFA 3CHXA 1Q82W 1AI5A 3NXSA 3N2KA 3ASOC 2N74A 5IJ0B 2F1MA 1FKAO 1GN4A 3N2GB 3ICXA 1VF6A 4YJ2A 4UVCA 2BSKB 3T4ZA 1RPRA 3N2KB 4P9PA 3CXCU 1IXBA 2Q6AA 4GKKO 4XBFA 2VQFO 1ZX3A 3BEHA 4PELA 1IBLB 4O4IA 3RVYA 3ZJZA 3S3WA 3LUTB 3BCCH 1Y4MA 1SF9A 4B7KA 1QR8A 1OCRC 2BOCC 1BHAA 1FXKA 2Y4UA 5IJ9B 2KQXA 1S5HC 4KL1A 4LF6O 2IJHA 1XL6A 2RDCA 2HG5C 4YXWG 3OT7A 4J42A 4U3FH 1YIJV 3HR0A 4JI2B 5CMUA 2Q7HA 3OD4A 2A79B 4WCEV 1WA8B 1N34O 4MVMA 4F6RB 1VQ7V 2ZIOA 1MSWD 3TJTA 1GM8A 2YS8A 1QBZA 4LR3A 3DSQA 5F2VO 2Q68A 2YUAA 2VQEB 3G67A 1NH2B 4UB8Z 5CBGA 3L70H 3L72H 1S5JA 5BMVB 1HW7A 4LF9B 1F7YA 3T1YB 5KMGB 3MAQA 4GLXA 1FJGB 1SQVH 3L9DA 5GONB 2WAMA 4DV0B 4UCOA 2BTQA 1YHQV 3BAAA 4XDLA 2QWNB 3ZHVA 3R66A 2BE3A 2E3CA 1OCZB 5C8YB 1HNXO 1B3QA 1F4MA 3THOA 4GZRB 3X2QB 3H1LH 4MW8A 1K5QA 2XUMA 5KUMA 4PD4F 4BWAA 4LBEC 1THZA 5JH7A 2PI5A 4IIJA 5IY5B 3GWOA 4LF7B 1MA1A 1TVKB 3JD2A 1X4TA 2ZDIC 1AJQA 3P3NA 1V9PA 4B7EA 2WLIA 3F7YC 1JMKC 3F7VC 4KFMA 1AI7A 3ZIAG 1W2BU 2CAZC 2ILMA 3K5MA 4FZ0A 4D7TA 4MT8A 1AJPA 4WFBV 4LFCO 3CCRV 1N33O 1K8AW 4K3AA 4PDRA 2HP8A 3SJBC 4EFEA 2IJJA 4JGSA 1IXMA 1KC8W 3HKCB 2WA4A 1YDXA 1FYJA 5B1BC 4I55B 1R3JC 1M56C 2XASA 3JATA 1XHXA 3AK2A 5B1NA 2P6JA 3TETA 2B9ZA 4J7JA 5EC1C 1KD1W 4X66B 4QGPA 4X62O 4JI3O 4P30A 2EIJC 5DECA 1M56B 5A2QN 4I55A 2ZKOA 5AG2A 3ABKC 1L0NH 2ZDIA 3OUFA 1VARA 5EZYB 2DE0X 5E1AC 5KUKA 3CJHB 1ZL8A 1PNMA 3JARA 3L75H 5J2UA 3RYFB 4MW3A 4O4LB 3BA9A 4MVSA 4I50A 2KB1A 2KG7B 3KCYA 4FMTA 5BY1A 2CTQA 4UCRA 5JJEB 4RO2A 1ZLZA 4X1KB 2GTSA 2JGUA 2IBZH 3CJHA 1M90W 2YDEA 5BZBA 1M9NA 2ZE5A 2QE7G 1KP2A 4WFHA 4OPHA 2HJFC 1Q90D 4NTYA 5KMGA 1A32A 1H2MA 4GKKB 1GO3F 4X1KA 1XUQA 3ZRWB 5IJ0A 2HEPA 4WFGA 5IYZB 1WP7A 1B06A 2ZNIA 1AP6A 1S3JA 2AXTZ 3ABLC 5JVDB 1BMFG 1S0VA 1VIBA 4RUFA 4HNAA 2Q5ZA 3A0BZ 5EBLC 4DV3O 2OYQA 2PF4E 5ITZA 2EJRA 4FM1A 2ZQMA 4AI8A 2UXCO 4JI5B 3IAYA 1Y74A 1M57C 3H1IH 3W7SA 3ZCCA 2EIMB 3X2QC 1YCIA 5FL7G 3FB8C 1M57B 2E76B 4YIPA 4DV2B 4IYHA 1WPXA 5KLVH 1S72V 4GYCB 5IY5C 5JJNB 1XNQB 1RM1C 3J7AU 5KHHA 3JAKA 2M7WA 1EN4A 2Y69B 5IWAB 3CRRA 2GHYA 4U7NA 5LA6B 2UU9B 1RFYA 4RQEA 5L3CA 2B1GA 2ZE7A 4X64B 3K06A 1NR7A 5CB4B 1XBLA 4B3TB 2FTKA 1P4RA 3WFVA 4CS4A 2X0LA 3OR6C 3SJQC 4G27B 1L1FA 5LYJB 4DUYB 1EN6A 2QM7A 4ABMA 3CCQV 2P7TC 2ETNA 1HNZB 2YEVA 2ZE8A 5LGTA 1XMOB 1N36O 3RYHA 1O9GA 3SJCC 5CB4A 2EZPA 1Y76B 4TUYB 3RBZA 2QKAA 4FFBB 3CXHF 2YC0A 5EZYA 5JJJB 3T1YO 1FPOA 4FPPA 4MTFA 1XMQO 2WLLB 1UFIA 3JARB 5KHJA 5LMUO 4JV5B 3RYFA 4CBCA 1ORQC 1NZ6A 2LFRA 5EBMC 4DV6B 4D7SA 3A2FA 1FFXA 2E5LO 2P67A 2PI4A 1NQTA 4FFBA 2QWRB 3E22A 2GSMB 1P49A 4JI0O 4DK0A 3H1HH 2QDOA 2WLLA 1P84F 3FYIB 2ZXWC 4QJFB 5L3EA 3CCSV 1Q5OA 1TVKA 1BCCH 1EN5A 4MVUA 1N36B 2UXBO 3D36A 3CEIA 1AB3A 4H44B 1GN6A 3QO7A 2JK5C 5BR8B 1M5IA 1Z2GA 4JI5O 4QNHB 2V7QG 2Q9LA 4I4TA 3ZRVA 4LF7O 3JALB 1H2KA 4ZHQB 3D8CA 5D5QA 3T1HB 4DR4O 5LMUB 4JV5O 3ASNC 1F23A 4FLYA 3EHBB 1VQ8V 2OTLV 1PL0A 2QM8A 2KKWA 1YJWV 3BVOA 1YTFB 4JZ2A 1URFA 2V1DA 2A3QA 4AHCA 2PTMA 1TUEB 4DR1B 4UUJC 1AP5A 2D2CB 4NTWA 2CE4A 2IJIA 4JI4O 2Q67A 4DW0A 3MD0A 4BIUA 1F4NA 1JOYA 1WPBA 3KKYA 1WLEA 2IH3C 3C3SA 1VF7A 4O4IB 4LF4B 4J10A 5LMNO 1I94B 2F93B 1SQBH 1IBLO 4JI3B 1SQGA 4FLWA 1XNRB
chains in the Genus database with same CATH topology
3K04A 1K92A 4TWKA 3H01A 3M99B 4X8AA 4N21A 3K79A 3RVYA 2QA4V 4X88A 1QLEC 1OCCB 2R9IA 3VBBA 3ZJZA 3G4SV 1MOFA 1V55C 1YJ9V 1AJNA 3LUTB 1Y4MA 4WFEA 1UJWB 1QR8A 1OCRC 3K0DA 4PA7A 5B1AC 2XOKG 1VQ9V 2BOCC 1BHAA 1RPOA 2P90A 2WLHA 1FXKA 2QEXV 1K3EA 4JF3A 4G2KA 1DLBA 1S5HC 1VQPV 3ABMC 1OCCC 4PA9A 3W7TA 2Y69C 2IJHA 1V55B 1Y66A 1XL6A 2ITCC 1PNLA 4HYOA 1H8HG 4QE7A 3I55V 3SYCA 1K4DC 2HG5C 5CN0A 4YXWG 5B1AB 1OCRB 4QE9A 1SERA 3LSQA 4MTXA 2DYRC 1YIJV 1ROPA 3AG1C 3R65A 1FXKB 5CMUA 1B6QA 2EBOA 4WFFA 2IU3A 2A79B 4WCEV 3OUSA 2B1IA 4MVMA 1VQ7V 1MSWD 4F4LA 5LGUA 3TK1A 3P32A 4X89A 3CC2V 1G4YB 1GM8A 2K1EA 1QBZA 2WSSG 2LP7A 2Q68A 3ETDA 3WG7B 3CPWU 3AG1B 3K3WA 1NH2B 5CBGA 5C93A 1Q81W 1FXHA 4J9ZB 1GKFA 1BHBA 3AG2B 3G71V 4LC1A 2WWWA 2WAMA 5EBWC 3WG7C 3JD4A 3CCUV 1VQ5V 5DM6V 1QLNA 1YHQV 2OCCC 4XDLA 4J9YB 1K9MW 4PDMA 3E8HA 3JD3A 1OCZB 2X6CA 4QPKA 1F4MA 1HWYA 3AG2C 5LHHA 2EIMC 3SPGA 3X2QB 1OHHG 4JYBA 3K0GA 4MW8A 4H33A 1K5QA 5KUMA 3OW2U 5KA6A 4LBEC 1H2GA 1AR1B 1THZA 2PI5A 1VQKV 4WF9V 5IY5B 3GWOA 2JIZG 1RM1B 4GX0A 5LBQA 5CBFA 3JD2A 2ZDIC 1AJQA 1R3LC 5L3GA 4DO2A 3LSSA 2WLIA 3E89A 3F7YC 5L3DA 3F7VC 3OR7C 4KFMA 1AI7A 3ZIAG 1W2BU 1PD3A 5H6QA 1V54C 3CP1A 5B3SB 4GT1A 4UXNA 4GX1A 4MT8A 3FB7C 1AJPA 4WFBV 2ITDC 3CCRV 4JAVA 1K8AW 1NR1A 4E2LA 4PDRA 2IJJA 3CD6V 1VQ4V 3CCLV 4JGSA 4BW5A 2EILC 5LHIA 5KA5A 3IC7A 1IXMA 3FB5C 4R8CA 5B3SC 1KC8W 3ASNB 3ZRWA 3OE7G 1J95A 3LDCA 1PNKA 4UV9A 3BY6A 4GX5A 3E2EA 3SYQA 3AG3B 4JASA 5B1BC 3A0RA 4DXWA 2A9HA 2Y48A 1R3JC 1JVMA 2D3OW 1M56C 1COWG 2XASA 5IYDO 1VQLV 4JTDB 1BL8A 4HZ3A 1OCOB 1GK9A 2WLJA 5B1NA 4BIZA 1QR9A 2P6JA 2JJ1G 3TETA 3D3IA 5EC1C 1R3KC 1K7DA 1KD1W 1CP9A 2WPDG 4JYCA 3AG3C 5B1BB 1QVGU 4R50A 3PJSK 3JYCA 4PA4A 1K5SA 1I5XA 4P30A 2EIJC 1M56B 2OT5A 5GW7A 1VQOV 1VQNV 1JX9A 3ABKC 3JD1A 2ZDIA 3HB3B 3OUFA 1H8EG 2JDIG 3T2MA 1NVPB 2W0FC 4RAIA 4UVAA 1JCHA 4Q20A 1QVFU 3OM3B 5E1AC 5KUKA 4OXSA 2EIJB 3TCUA 1PNMA 2WLKA 2XAHA 3ABKB 4MW3A 1F51A 4KP4A 2EIKB 4MVSA 4TSFG 3LDDA 2KB1A 2ZR3A 1QLEB 3K08A 4FMTA 5LHGA 2XAJA 3MHSC 4RO2A 1ENVA 1XL4A 4FJCC 2DWEC 1KQSU 1AI4A 2DYSC 1NBMG 2QTOA 1M90W 3W7XA 5BZBA 1M9NA 4PA3A 4KUMA 1CEZA 3OEEG 1FXVA 2QE7G 1KP2A 4WFHA 3ZMTA 3ZMUA 3B8MA 2HJFC 1GMGA 4R7CA 2LFSA 2HLDG 4CZZA 3SYOA 2HR3A 3CCEV 4U7OA 4GCZA 2DYRB 1DF5A 1OZ0A 1GO3F 2HKOA 2NNUA 3OEHG 1DTOA 3ZRWB 3K03A 1SRYA 2EINC 4WFGA 1P7BA 3FYEB 1K33A 3T4DA 1E79G 1S3JA 3ABLC 4MTOA 2QKSA 2DWDC 3SPIA 4RQFA 1YJNV 2W6IG 1BMFG 1S0VA 4JTCB 4RUFA 1NKDA 2XAQA 3ZN0A 3E86A 4JAUA 1S76D 5EBLC 1K73W 2ATKC 1W0KG 5IDJA 4N23A 2EJRA 2ZQMA 3SPJA 3CC4V 3ZRXA 1K4CC 3VOUA 3EFFK 1N8RW 2OCCB 1M57C 3MHHC 2DQ0A 3ZN1A 5L3FA 4EKWA 3OMAB 1G8MA 3W7SA 4JPRA 1GM9A 3OMIB 2UXNA 2YEVB 4ZKIA 3ZCCA 4GX2A 5LGNA 3IFXA 2EIMB 3E83A 5IYBO 3X2QC 5HFLA 4LP8A 5FL7G 3CMEV 3CCJV 3FB8C 3SYAA 1JQ0A 1M57B 2JJ2G 3ABTA 3G6EV 1WPXA 3E35A 1S72V 3FB6C 1VQ6V 2JEUA 5IY5C 1MG1A 4PA6A 1RM1C 4MVQA 3UM7A 3SPHA 2M7WA 3ABMB 1Q86W 3KG2A 2WLIB 2Y69B 4H37A 1AROP 2AHYA 2GHYA 4U7NA 4XDKA 3RVZA 3STZC 4Z1MG 3CCVV 4PDVA 1FFTB 4RQEA 5L3CA 3F5WC 2Q69A 2B1GA 3QO8A 2B5UA 3K06A 2F43G 2X7RB 3SYPA 2BOBC 1NR7A 2IH1C 1E1QG 1K97A 2FTKA 1FXKC 4I9WA 4MS2A 5B1OA 3CMAV 4FK5C 1P4RA 3WFVA 1JPXA 2X0LA 3OR6C 3LDEA 4G27B 3SJQC 4PDLA 1L1FA 3W7WA 2OTJV 1EFRG 3OGCC 1M1KW 2R9RB 3OAAG 2QM7A 3ML0A 3CCQV 2EILB 2P7TC 2YEVA 5LGTA 1YITV 1R6KA 1R73A 2EZPA 4WFAV 3RW0A 3ZRSA 4P2ZA 3RBZA 2X6AA 4P9OA 4BAYA 3OMNB 4FPPA 4MTFA 4QIWF 5H9CA 2WLLB 1LNQA 1KKDA 4UV8A 3E8FA 5L3BA 2DW4A 2WLMA 2WLNA 1OCZC 4CBCA 1ORQC 1YTFD 2LFRA 2W6JG 5EBMC 5IYCO 5EK0A 2XAFA 3HPLC 2P67A 2PI4A 1NQTA 4QPJA 1JJ2U 1KP3A 2H8PC 4TT3G 2NLJC 2GSMB 3CC7V 1NH2D 2ZD9A 1PKXA 4FIPC 4JTAB 3CCMV 1R3IC 4UVBA 3FKSG 3B8NA 2WLLA 5DN6G 3FYIB 4MSWC 2UXXA 5H6RA 3SPCA 3ZMVA 1FS0G 2ZXWC 3K9AA 4QJFB 1GTOA 5L3EA 3CCSV 4XDJA 3ETGA 3QNEA 3OFNG 4MVUA 3D36A 5CA3A 2C2AA 1W0JG 3QO7A 2AHZA 2EIKC 1V54B 2XNDG 3ZMZA 1YI2V 2JK5C 3CYOA 1KECA 3DGEA 3LNMB 2Z3YA 2X6BA 4QNHB 2V7QG 2DQ3A 2ZXWB 3ZRVA 1QCEA 1AI6A 3STLC 4LCUC 1I5YA 4L87A 1EBOA 1MABG 3IGAC 4MVRA 4RUEA 1VQMV 3DTUB 1CPYA 2CK3G 2DYSB 4R6ZA 2YSUB 1NVPD 2IU0A 2IJKA 2Z5UA 3ASNC 1F23A 2IW5A 3EHBB 2EZOA 1VQ8V 2OTLV 3AEIA 1PL0A 1R6NA 5CBHA 5J9PC 1K34A 2QM8A 1YJWV 3JCZA 4MTGA 4MVZA 1YTFB 1GM7A 4HAMA 2HVKC 3ABUA 1DF4A 2V1DA 1SETA 4G28B 2H94A 3E8BA 1S77D 1TUEB 4ZBMA 1ZWIC 3JD0A 3ZMSA 1Q7YW 4UUJC 2EINB 1OCOC 3W7UA 1Q82W 4ASUG 2A0LA 1AI5A 1NJIW 3ABLB 3NXSA 2IJIA 3AG4C 3ASOC 2Q67A 2MK3A 3MD0A 1YSCA 4BIUA 2JEXA 1SZTA 3T1CA 3B77A 1F4NA 3E8GA 3P30A 1H38A 1JOYA 2XAGA 1WLEA 2IH3C 2HVJC 4UVCA 5HFMA 1E1RG 2ZR2A 3I56V 3AG4B 3ASOB 3T4ZA 1RPRA 1SESA 3ETEA 4P9PA 3QO5A 3CXCU 3UKMA 1EZJA 2HFEC 2Q6AA 4XBFA 4I5SA 3GB7C 3BEHA 5EC2C 4PELA 4MVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CN0 A;  1F23 A;  1ENV A;  2EZO A;  1MG1 A;  3H01 A;  3M99 B;  1K33 A;  4FJC C;  4N21 A;  1K34 A;  1SZT A;  2M7W A;  3B77 A;  3MHH C;  3P30 A;  5KA6 A;  1MOF A;  5CMU A;  4E2L A;  2EBO A;  3CYO A;  1QR9 A;  2P6J A;  1Y4M A;  4JPR A;  1DF4 A;  2EZP A;  3GWO A;  1QR8 A;  4JGS A;  3B8M A;  5HFM A;  2X7R B;  1QCE A;  4FIP C;  5KA5 A;  5HFL A;  4JF3 A;  1I5Y A;  1QBZ A;  4G2K A;  1EBO A;  2LP7 A;  1I5X A;  1DLB A;  3B8N A;  4FK5 C;  3WFV A;  1JPX A;  1JQ0 A;  2OT5 A;  4N23 A;  1DF5 A;  5H9C A;  1Y66 A;  3K9A A;  3CP1 A;  3MHS C;  2MK3 A; 
#chains in the Genus database with same CATH topology
 1K92 A;  4X8A A;  4N21 A;  3K79 A;  4I50 B;  1QLE C;  2YXL A;  2R9I A;  2KG7 A;  1MOF A;  2RMK B;  4DV6 O;  1V55 C;  1YJ9 V;  1AJN A;  1KB9 F;  1UJW B;  4PA7 A;  2XOK G;  2CDY A;  4O2A B;  4JF3 A;  4DR2 O;  3FD9 A;  4G2K A;  4YHH B;  4BR6 A;  1DLB A;  5FLX N;  3ABM C;  1OCC C;  2XTA A;  3B2E E;  1S5L Z;  2A7W A;  2Y69 C;  4CH3 A;  1K4D C;  2K9P A;  4QE9 A;  5KX5 A;  3LSQ A;  4YIO A;  1JFF B;  5JVD A;  5J2T A;  1SQQ H;  4UCS A;  4WFF A;  2IU3 A;  3JSL A;  2B1I A;  1AR5 A;  1IVS A;  5IYZ A;  4A5U B;  3DC6 A;  5LGU A;  3TK1 A;  3P32 A;  1G4Y B;  1BSM A;  4K0K B;  5JQG A;  5IE9 A;  1BHB A;  4DR4 B;  2CUG A;  2QM4 A;  4NXN O;  3DC5 A;  1Y74 B;  4TOI A;  4J9Y B;  4B3T O;  4PDM A;  5JH7 B;  3ZHU A;  4JI6 O;  4O4H B;  4QPK A;  3BA8 A;  1NT2 B;  5KHK A;  2ZM6 O;  4EB6 B;  1AVM A;  2UXC B;  4H33 A;  5KA6 A;  1H2S B;  5CBF A;  2BCC H;  4DO2 A;  3LSS A;  3E89 A;  2CH7 B;  1I7F A;  2Q0O C;  4EB6 A;  1PD3 A;  5H6Q A;  2NR5 A;  5IJ9 A;  3CP1 A;  2WA3 A;  3HKC A;  1I94 O;  5B3S B;  3AK3 A;  3FB7 C;  4H0L B;  4X1I B;  4JYY A;  3TGU H;  4E2L A;  1NTK H;  4U3J A;  3WB0 A;  2UUC B;  1EZV H;  3CCL V;  4TUY A;  2EIL C;  2QKC A;  1BT8 A;  4WBN A;  3FB5 C;  3ASN B;  4J11 A;  4GX5 A;  3E2E A;  2AZ0 A;  1PPJ H;  4DXW A;  1Z5W A;  1JVM A;  2D3O W;  3QG5 A;  4FVM A;  1HNZ O;  2QR4 A;  1BL8 A;  4OX9 O;  1OCO B;  1JR9 A;  4WBN B;  3D3I A;  1K7D A;  2WPD G;  3KZI Z;  4ZI7 B;  5GON A;  4PI2 A;  3JYC A;  1K5S A;  4LWS B;  2CTW A;  3CS5 A;  2LGW A;  1SA0 A;  1P7G A;  1DGS A;  1VQN V;  1JX9 A;  3HB3 B;  4J41 A;  1GN2 A;  2JDI G;  3T2M A;  4JI0 B;  2W0F C;  4RAI A;  5LP6 C;  3OM3 B;  4IYI A;  4ZI7 A;  2E5L B;  3TCU A;  5A9G A;  3LDD A;  2QJ1 A;  5LP6 B;  4DV5 B;  4EEQ A;  1MZF A;  4I4T B;  1ENV A;  3ZED A;  4FJC C;  2DWE C;  1KQS U;  1AI4 A;  4D6T H;  3W7X A;  5CA0 A;  1SQP H;  4LF6 B;  3BRC A;  1SZX A;  3FFQ A;  2ZT9 B;  4YY3 B;  1PM9 A;  1LUW A;  2HR3 A;  1DF5 A;  1OZ0 A;  2HKO A;  2VRZ A;  5H2F Z;  1YXB A;  3OEH G;  4LFB O;  3K03 A;  1SRY A;  2RQ6 A;  3RYI B;  2Q8V A;  2JGD B;  2JVD A;  3T4D A;  4I9Q A;  2QKS A;  2DWD C;  4NYK A;  3GVM A;  4JTC B;  2AGA A;  3RYC A;  1I0H A;  1NKD A;  3ZN0 A;  4O2B B;  3M7M X;  5LL6 Y;  4JAU A;  1S76 D;  1BZK A;  1K73 W;  1W0K G;  5IDJ A;  4N23 A;  4I7Z B;  3CC4 V;  2YIA A;  3SDL A;  4DRX B;  3EFF K;  3M8A A;  2QTS A;  2YI8 A;  4EKW A;  3RYC B;  1G8M A;  3OMI B;  3JAK B;  3IFX A;  4UCU A;  1IDS A;  3CCJ V;  3CME V;  4LFC B;  3SYA A;  1JQ0 A;  3ABT A;  4ZIB A;  4O4L A;  3J81 N;  3FB6 C;  4IHJ A;  3S3X A;  3UM7 A;  1Q86 W;  4XDK A;  3CCV V;  5J2T B;  1N32 B;  4PDV A;  2RNB A;  3F5W C;  4X65 B;  3QO8 A;  5KX5 B;  1WJZ A;  3SYP A;  2X7R B;  2BOB C;  1HR0 B;  2IH1 C;  2PYL A;  5B1O A;  4FK5 C;  4YHH O;  2UU9 O;  2VWK A;  2JRI A;  4LH6 A;  1EFR G;  1M1K W;  2NN4 A;  4LF8 O;  4DV5 O;  1R73 A;  4NXM B;  2P4K A;  1N0N A;  1Y6X A;  3ZBH A;  1FFX B;  4K8X A;  2PY5 A;  2L35 A;  1LNQ A;  4UV8 A;  5L3B A;  2DW4 A;  4NXN B;  1PL4 A;  2MW2 B;  1YTF D;  5BXZ A;  2XAF A;  2BTO A;  3CWB H;  2NLJ C;  3CC7 V;  1NH2 D;  4C7U A;  3K59 A;  2DJV A;  4JTA B;  2F4V B;  3CCM V;  3FKS G;  4CS3 A;  1BGY H;  4MSW C;  4UB6 Z;  5H6R A;  4H13 B;  4K35 A;  3CRQ A;  4XDJ A;  1J5E O;  1D2D A;  2LQT A;  3OFN G;  3L71 H;  1TAE A;  3H1J H;  3ZMZ A;  2AHZ A;  3K5O A;  4DW1 A;  3CYO A;  1KEC A;  2PZS A;  3HKB A;  3DGE A;  2G38 A;  3T1H O;  2FB5 A;  4CH5 A;  4TV8 A;  2JGD A;  1NU1 H;  1JJO A;  4X1I A;  1EBO A;  4MVR A;  3IGA C;  4RUE A;  2DYS B;  3F5T A;  2YSU B;  1NVP D;  1D5N A;  2IJK A;  4JI1 O;  1JA8 A;  2QGN A;  2H3O A;  4ZOL B;  2Z5U A;  2IW5 A;  2EZO A;  2LGQ A;  5J9P C;  1FJG O;  1N4C A;  4DR6 B;  4DR3 B;  3JCZ A;  4MTG A;  5FPR A;  3OTF A;  5GTH Z;  2UUC O;  3K58 A;  2H94 A;  4NR1 A;  1S77 D;  1ZWI C;  2QWP B;  2EIN B;  3OTO O;  3W7U A;  1N32 O;  4ASU G;  2A0L A;  1H2N A;  4B3S O;  2MK3 A;  4B3M O;  1NTM H;  4JI7 O;  2JEX A;  3T1C A;  4JI2 O;  1H38 A;  5LXT A;  1YZB A;  3G80 A;  2XAG A;  2QSA A;  2R70 A;  4NXM O;  4B3R B;  2ZR2 A;  3DXR A;  3O65 A;  3ASO B;  1SES A;  3ETE A;  3VQX A;  1TA8 A;  4DR7 O;  3QO5 A;  1XDC A;  1EZJ A;  4FFK A;  4JI1 B;  1HNW O;  4O2A A;  1W59 A;  4MVO A;  1XNQ O;  1IUR A;  3H01 A;  3CRC A;  2Y0I A;  4OGQ B;  3G4S V;  3VBB A;  5LP6 A;  2VWJ A;  3C3T A;  3CRM A;  1BE3 H;  3K0D A;  1VQ9 V;  5KHG A;  5B66 Z;  2WLH A;  2QEX V;  1QNM A;  4JYA O;  1ZAU A;  2GUZ A;  5CA0 B;  1GN3 A;  1VQP V;  2E74 B;  1L8D A;  1VF6 C;  3W7T A;  1Y66 A;  2ITC C;  4HYO A;  1PNL A;  3JAL A;  3I55 V;  4QE7 A;  3SYC A;  1H2L A;  2F66 C;  4FM2 A;  1OCR B;  4MTX A;  2DYR C;  4Q6G A;  1BS3 A;  1ROP A;  1SC5 B;  3R65 A;  2RCV A;  1B6Q A;  4J7K A;  1SS3 A;  5FNV A;  3OUS A;  1XMQ B;  3JAW A;  4F4L A;  3CC2 V;  5FPO A;  2UXD O;  2WSS G;  1Z5V A;  3ETD A;  3CPW U;  2PYJ A;  3K3W A;  2E75 B;  4TV9 B;  4GUN A;  2DN9 A;  5K1X A;  1FXH A;  4CH6 A;  4DV4 O;  5FNV B;  5LA6 A;  1LR1 A;  2WWW A;  3UCS C;  5EBW C;  1MSD A;  3JD4 A;  1QLN A;  3UO3 A;  4BIO A;  2OCC C;  1XQ8 A;  4DR5 B;  2FL4 A;  3E8H A;  3RGB A;  3JD3 A;  1YEW A;  2P22 C;  4I0X B;  1US6 A;  2N05 A;  2EIM C;  5LOV B;  3SPG A;  4TV8 B;  3L74 H;  5D5P A;  3OW2 U;  4B3S B;  5EIB C;  1LUV A;  5KAF Z;  3B40 A;  1RM1 B;  1WN7 A;  2UXD B;  5L3G A;  5L3D A;  3OR7 C;  5BMV A;  3H1K H;  4UXN A;  4GX1 A;  4DR1 O;  4JAV A;  3WB1 A;  1NR1 A;  4NVP A;  1JFF A;  4RWU A;  3JCU Z;  5KA5 A;  3IC7 A;  3OE7 G;  1VEW A;  1J95 A;  3EXA A;  1GRJ A;  3D36 C;  1MMM A;  4UV9 A;  3BY6 A;  3SYQ A;  4JAS A;  3DXR B;  3AG7 A;  3O9O A;  2A9H A;  2Y48 A;  2HJD A;  4LF8 B;  1COW G;  5IYD O;  1R1B A;  4JTD B;  4HZ3 A;  2WLJ A;  1GK9 A;  4BIZ A;  2ODM A;  2JJ1 G;  5BR8 O;  1QHT A;  2JS5 A;  2LO1 A;  5B1B B;  3C90 A;  1QVG U;  4R50 A;  2UUA B;  4PA4 A;  4ICG A;  2A06 H;  4ZHQ A;  1VQO V;  1FAF A;  1NTZ H;  1NVP B;  5IWA O;  4LF9 O;  2F4V O;  4Q20 A;  2VQE O;  2EIJ B;  3HKE A;  3QF7 A;  2XAH A;  3GWK C;  1R6T A;  3ABK B;  1F51 A;  3OTO B;  4KP4 A;  4TSF G;  2Q7G A;  3K08 A;  2YI9 A;  2XAJ A;  4HNA B;  2YID A;  4ZOL A;  4IT5 A;  2P06 A;  5ITZ B;  1FD9 A;  4X1Y B;  1NBM G;  2QTO A;  3BHP A;  3N2G A;  4PA3 A;  1CEZ A;  3OEE G;  1FXV A;  2AZ2 A;  3ZMT A;  1J5E B;  3ZMU A;  5IT9 N;  1IX9 A;  4TV9 A;  5LMN B;  4R7C A;  4LNU A;  2HLD G;  4Z1V A;  3CCE V;  1ZSP A;  4GCZ A;  2DYR B;  3KCX A;  1HNW B;  2VQF B;  2RN9 A;  2NNU A;  1Q6U A;  3A0H Z;  2PGG A;  1P7B A;  4YY3 O;  1ZL8 B;  4I0X A;  1WB8 A;  4MTO A;  2P5O A;  5LXT B;  4CC5 A;  4DR6 O;  3IJ4 A;  2ZM6 B;  2XAQ A;  2YXY A;  3QTC A;  3E86 A;  4UCT A;  2EJ7 A;  2R72 A;  1NS1 A;  1Q6H A;  3JAS B;  2CTR A;  3SPJ A;  2XT9 A;  2CTP A;  4DUY O;  3ZRX A;  4DYL A;  4LFA O;  3SR2 C;  5LYJ A;  1SA0 B;  3VOU A;  1N8R W;  2OCC B;  1GAX A;  2DQ0 A;  5L3F A;  3ZHR A;  3OMA B;  1WAZ A;  2UXN A;  2YEV B;  1WA8 A;  4GX2 A;  5LGN A;  1I08 A;  3E83 A;  4IGG A;  4DV7 B;  1M4U A;  3RYH B;  2CGN A;  4LP8 A;  3J80 N;  2GTA A;  2AW9 A;  3ZX6 A;  1IZ3 A;  3G6E V;  3E35 A;  3JAM N;  1VQ6 V;  1MG1 A;  2UUA O;  3SPH A;  3ABM B;  3KG2 A;  3RVZ A;  4H37 A;  3CE2 A;  4Z1M G;  2Q69 A;  4W4K A;  2FYU H;  4JZG A;  3OGI B;  1E1Q G;  1K97 A;  1FXK C;  4I9W A;  4MS2 A;  3WB2 A;  4O4H A;  5C8Y A;  3W7W A;  4X65 O;  2UUB B;  3OGC C;  3OAA G;  3PN1 A;  5GTI Z;  1RSO A;  1YIT V;  1R6K A;  3SGI A;  3RW0 A;  3ZRS A;  3ETQ A;  4P2Z A;  3N27 A;  1KMI Z;  4P9O A;  4AQY B;  3IC9 A;  1YVW A;  4BAY A;  4IL6 Z;  2DMX A;  3OMN B;  4QIW F;  5H9C A;  1WB7 A;  1KKD A;  2WLM A;  4DUZ O;  2W6J G;  1N33 B;  2O57 A;  5EK0 A;  1OJH A;  3HPL C;  1IBM O;  4DRX A;  4QPJ A;  2XHB A;  1JJ2 U;  1KP3 A;  4TT3 G;  1XI1 A;  2ZD9 A;  1PKX A;  4JI8 B;  3Q4H B;  1R3I C;  1QQC A;  4UVB A;  3B8N A;  1Y67 A;  1KUQ A;  3HKD B;  3SPC A;  2GBO A;  2UUB O;  4KHP O;  2EUL A;  1FS0 G;  1GTO A;  1BQZ A;  4J7Z A;  3VQV A;  2ZIM A;  4PJ0 Z;  1N0J A;  5CA3 A;  4DV3 B;  1W0J G;  1G1X B;  3WU2 Z;  1YI2 V;  1V54 B;  4NKG B;  3LNM B;  3A8T A;  2Z3Y A;  2X6B A;  2DQ3 A;  1QU7 A;  2ZXW B;  1QCE A;  3STL C;  4LCU C;  1I5Y A;  4L87 A;  1L0L H;  4DV1 B;  3DTU B;  1CPY A;  4YJ3 B;  4LFB B;  3U10 A;  2IU0 A;  4J80 A;  4DUZ B;  3RT3 C;  1DK1 A;  3RN4 A;  1R6N A;  1K34 A;  4F6E A;  4HBN A;  4DV2 O;  4HAM A;  2HVK C;  1AIL A;  3ABU A;  1DF4 A;  3VQY A;  1TUB A;  4CS2 A;  3ZHQ A;  3JD0 A;  3ZMS A;  1Q7Y W;  3JSN A;  4E4E A;  3G6B A;  1Q43 A;  1OCO C;  4JI7 B;  1NJI W;  3ABL B;  3AG4 C;  1OV9 A;  2GV9 A;  1YSC A;  1SZT A;  3B77 A;  3E8G A;  3P30 A;  1IBK B;  2EX3 A;  2HVJ C;  1KKC A;  5HFM A;  1E1R G;  3I56 V;  3AG4 B;  4X66 O;  4AQY O;  4LF5 O;  1WP8 A;  3UKM A;  2HFE C;  4I5S A;  3GB7 C;  2GUZ B;  3RYI A;  5EC2 C;  3K04 A;  4TWK A;  3M99 B;  2QA4 V;  4IIJ B;  4X88 A;  4YJ2 B;  1HR0 O;  1OCC B;  5E79 Z;  1PV0 A;  1Q6I A;  3ZS8 C;  4BW9 A;  4WFE A;  5B1A C;  5TIS Z;  1RPO A;  2P90 A;  5JCO A;  4FLZ A;  1K3E A;  4JI8 O;  4TQD A;  2W0X A;  4PA9 A;  1XRE A;  1V55 B;  3UQ8 A;  1H8H G;  1KU9 A;  4LFA B;  4LNU B;  5CN0 A;  5B1A B;  1SER A;  3SJA C;  4OX9 B;  3AG1 C;  2LW1 A;  1FXK B;  2EBO A;  4LH7 A;  2ADP A;  3EVK A;  1HP8 A;  2Q7E A;  4X89 A;  3RFR A;  2K1E A;  2LP7 A;  4DV1 O;  3WG7 B;  2Z0A A;  3AG1 B;  1N34 B;  4IHJ B;  5JCO C;  5C93 A;  1Q81 W;  2YIB A;  4J9Z B;  1GKF A;  3K5L A;  2ZNJ A;  2QWO B;  3AG2 B;  3G71 V;  4LC1 A;  1HNX B;  3CB2 A;  2QWQ B;  2Y0P A;  1RP3 B;  3WG7 C;  3CCU V;  1VQ5 V;  5DM6 V;  4NB5 A;  1K9M W;  3U11 A;  3UO2 A;  4DV0 O;  2X6C A;  1HWY A;  3AG2 C;  4O4J B;  5LHH A;  1OHH G;  4JYB A;  2YIC A;  3K0G A;  2BTQ B;  4X20 A;  1H2G A;  1AR1 B;  1VQK V;  4WF9 V;  2JIZ G;  4GX0 A;  5LBQ A;  1Y76 A;  3TXQ A;  1R3L C;  1ZTE A;  4DV7 O;  1VF5 B;  2DOS A;  4O4J A;  1SQX H;  4DK1 A;  4LF4 O;  1V54 C;  4LWS A;  4GT1 A;  1XNR O;  1WNS A;  1VP7 A;  2ITD C;  5CA1 B;  5EIB D;  3BPZ A;  3CD6 V;  1VQ4 V;  4BW5 A;  3E22 B;  3FAV B;  3UT5 A;  5LHI A;  4R8C A;  5B3S C;  3ZRW A;  1O9H A;  4DR2 B;  5EYP A;  3LDC A;  1XHZ A;  1PNK A;  2ADQ B;  3AG3 B;  2RJZ A;  3A0R A;  3APQ A;  2PUS A;  1U97 A;  3LSU A;  4B08 A;  1VQL V;  2OCH A;  4JAA A;  3D3Q A;  1QR9 A;  4X9Q A;  3VQW A;  1R3K C;  3CRA A;  1CP9 A;  2FKX A;  4JYC A;  5H5N A;  2P4V A;  3AG3 C;  3L73 H;  4FZ1 A;  4DR7 B;  3PJS K;  1I5X A;  2YXH A;  3AK1 A;  3MDS A;  2OT5 A;  5GW7 A;  4GKJ O;  1Q8I A;  3JD1 A;  4TQF A;  1H8E G;  1NI8 A;  4UVA A;  4U3J B;  1JCH A;  2ZIN A;  2CGO A;  1QVF U;  1PP9 H;  4OXS A;  1IBM B;  2OWO A;  4X1Y A;  2WLK A;  3BFR A;  2BSK A;  2JS3 A;  4FLT A;  1Q3E A;  2EIK B;  3I5D A;  3BAB A;  2ZR3 A;  4FLU A;  1QLE B;  2LW7 A;  5LHG A;  2R9A A;  2VS0 A;  4O2B A;  2IM9 A;  3ZHT A;  3MHS C;  1EM1 A;  1XL4 A;  2F95 B;  2DYS C;  3K57 A;  4KUM A;  2LJ2 A;  3NR7 A;  3B8M A;  1TUB B;  1MNG A;  1GMG A;  2LFS A;  3FX7 A;  4CZZ A;  3SYO A;  4L8J A;  4U7O A;  1BQ0 A;  1DTO A;  1D5A A;  2EIN C;  3FYE B;  1K33 A;  1E79 G;  2Q73 A;  5KAI Z;  3SPI A;  4RQF A;  2HHH O;  1YJN V;  2W6I G;  4F6R A;  1U96 A;  3B4S A;  4X20 B;  2ATK C;  1ZUQ A;  5K1P A;  1HDJ A;  4OPA A;  1KYO F;  3H9V A;  1K4C C;  1UPG A;  2N04 A;  4CH4 A;  3MHH C;  4LF5 B;  3ZN1 A;  4JI4 B;  4JPR A;  1GM9 A;  3P3P A;  3JAW B;  4ZKI A;  5IYB O;  5HFL A;  3HKE B;  1IBK O;  2V4D A;  4GKJ B;  4UFZ A;  2JJ2 G;  4NTX A;  4AIL C;  4X64 O;  5JQG B;  4FLX A;  2JEU A;  4PA6 A;  4MVQ A;  4DR3 O;  3STZ C;  2WLI B;  1ARO P;  2AHY A;  1FFT B;  2B5U A;  4PI0 A;  2F43 G;  5JWP A;  4DR5 O;  3K9S A;  3CMA V;  1XMO O;  1JPX A;  3LDE A;  4PDL A;  3U0Z A;  2OTJ V;  5LOV A;  4KXR A;  4B3M B;  5KHI A;  4FM0 A;  1TGO A;  2R9R B;  1YF2 A;  2FML A;  3ML0 A;  2EIL B;  2OIE A;  2F23 A;  3TXS A;  4K8Z A;  4K0K O;  4B3R O;  4CC6 A;  4WFA V;  1B04 A;  2X6A A;  3HKB B;  2Q0A A;  3JAT B;  2CH7 A;  2L6L A;  2Y4T A;  3Q4H A;  3E8F A;  3CSX A;  2WLN A;  2KSD A;  1OCZ C;  3HKD A;  3JAS A;  1SKV A;  5IYC O;  1X59 A;  2Q4P A;  3QVN A;  4FLV A;  4PHZ A;  1CXZ B;  2H8P C;  3CX5 F;  4JYA B;  4FIP C;  1G6U A;  5DN6 G;  4W4L A;  2HHH B;  3RWR D;  2UXX A;  3ZMV A;  3APO A;  3K9A A;  3ETG A;  4EFB A;  1VMG A;  1KBH A;  1XEQ A;  5J2U B;  1T5E A;  4JI6 B;  3ZHS A;  3QNE A;  2ZE6 A;  4YJ3 A;  2C2A A;  1AR4 A;  4KHP B;  2EIK C;  2XND G;  3B09 A;  2OIG A;  3K5N A;  4Z2W A;  2ARH A;  1AI6 A;  2UXB B;  5DED A;  2YIB D;  4X62 B;  1MAB G;  5CA1 A;  1VQM V;  2GDS A;  2CK3 G;  1XIL A;  4R6Z A;  3FAV A;  3UT5 B;  1XOU A;  1MZE A;  3AEI A;  4DV4 B;  5CBH A;  5EYP B;  1GH6 A;  1M93 A;  4MVZ A;  1GM7 A;  1RSO B;  1SET A;  4PV1 B;  4G28 B;  3E8B A;  4ZBM A;  3LNN A;  5B5E Z;  4UCV A;  2M6Y A;  2ZCE A;  1SQF A;  3CHX A;  1Q82 W;  1AI5 A;  3NXS A;  3N2K A;  3ASO C;  2N74 A;  5IJ0 B;  2F1M A;  1FKA O;  1GN4 A;  3N2G B;  3ICX A;  1VF6 A;  4YJ2 A;  4UVC A;  2BSK B;  3T4Z A;  1RPR A;  3N2K B;  4P9P A;  3CXC U;  1IXB A;  2Q6A A;  4GKK O;  4XBF A;  2VQF O;  1ZX3 A;  3BEH A;  4PEL A;  1IBL B;  4O4I A;  3RVY A;  3ZJZ A;  3S3W A;  3LUT B;  3BCC H;  1Y4M A;  1SF9 A;  4B7K A;  1QR8 A;  1OCR C;  2BOC C;  1BHA A;  1FXK A;  2Y4U A;  5IJ9 B;  2KQX A;  1S5H C;  4KL1 A;  4LF6 O;  2IJH A;  1XL6 A;  2RDC A;  2HG5 C;  4YXW G;  3OT7 A;  4J42 A;  4U3F H;  1YIJ V;  3HR0 A;  4JI2 B;  5CMU A;  2Q7H A;  3OD4 A;  2A79 B;  4WCE V;  1WA8 B;  1N34 O;  4MVM A;  4F6R B;  1VQ7 V;  2ZIO A;  1MSW D;  3TJT A;  1GM8 A;  2YS8 A;  1QBZ A;  4LR3 A;  3DSQ A;  5F2V O;  2Q68 A;  2YUA A;  2VQE B;  3G67 A;  1NH2 B;  4UB8 Z;  5CBG A;  3L70 H;  3L72 H;  1S5J A;  5BMV B;  1HW7 A;  4LF9 B;  1F7Y A;  3T1Y B;  5KMG B;  3MAQ A;  4GLX A;  1FJG B;  1SQV H;  3L9D A;  5GON B;  2WAM A;  4DV0 B;  4UCO A;  2BTQ A;  1YHQ V;  3BAA A;  4XDL A;  2QWN B;  3ZHV A;  3R66 A;  2BE3 A;  2E3C A;  1OCZ B;  5C8Y B;  1HNX O;  1B3Q A;  1F4M A;  3THO A;  4GZR B;  3X2Q B;  3H1L H;  4MW8 A;  1K5Q A;  2XUM A;  5KUM A;  4PD4 F;  4BWA A;  4LBE C;  1THZ A;  5JH7 A;  2PI5 A;  4IIJ A;  5IY5 B;  3GWO A;  4LF7 B;  1MA1 A;  1TVK B;  3JD2 A;  1X4T A;  2ZDI C;  1AJQ A;  3P3N A;  1V9P A;  4B7E A;  2WLI A;  3F7Y C;  1JMK C;  3F7V C;  4KFM A;  1AI7 A;  3ZIA G;  1W2B U;  2CAZ C;  2ILM A;  3K5M A;  4FZ0 A;  4D7T A;  4MT8 A;  1AJP A;  4WFB V;  4LFC O;  3CCR V;  1N33 O;  1K8A W;  4K3A A;  4PDR A;  2HP8 A;  3SJB C;  4EFE A;  2IJJ A;  4JGS A;  1IXM A;  1KC8 W;  3HKC B;  2WA4 A;  1YDX A;  1FYJ A;  5B1B C;  4I55 B;  1R3J C;  1M56 C;  2XAS A;  3JAT A;  1XHX A;  3AK2 A;  5B1N A;  2P6J A;  3TET A;  2B9Z A;  4J7J A;  5EC1 C;  1KD1 W;  4X66 B;  4QGP A;  4X62 O;  4JI3 O;  4P30 A;  2EIJ C;  5DEC A;  1M56 B;  5A2Q N;  4I55 A;  2ZKO A;  5AG2 A;  3ABK C;  1L0N H;  2ZDI A;  3OUF A;  1VAR A;  5EZY B;  2DE0 X;  5E1A C;  5KUK A;  3CJH B;  1ZL8 A;  1PNM A;  3JAR A;  3L75 H;  5J2U A;  3RYF B;  4MW3 A;  4O4L B;  3BA9 A;  4MVS A;  4I50 A;  2KB1 A;  2KG7 B;  3KCY A;  4FMT A;  5BY1 A;  2CTQ A;  4UCR A;  5JJE B;  4RO2 A;  1ZLZ A;  4X1K B;  2GTS A;  2JGU A;  2IBZ H;  3CJH A;  1M90 W;  2YDE A;  5BZB A;  1M9N A;  2ZE5 A;  2QE7 G;  1KP2 A;  4WFH A;  4OPH A;  2HJF C;  1Q90 D;  4NTY A;  5KMG A;  1A32 A;  1H2M A;  4GKK B;  1GO3 F;  4X1K A;  1XUQ A;  3ZRW B;  5IJ0 A;  2HEP A;  4WFG A;  5IYZ B;  1WP7 A;  1B06 A;  2ZNI A;  1AP6 A;  1S3J A;  2AXT Z;  3ABL C;  5JVD B;  1BMF G;  1S0V A;  1VIB A;  4RUF A;  4HNA A;  2Q5Z A;  3A0B Z;  5EBL C;  4DV3 O;  2OYQ A;  2PF4 E;  5ITZ A;  2EJR A;  4FM1 A;  2ZQM A;  4AI8 A;  2UXC O;  4JI5 B;  3IAY A;  1Y74 A;  1M57 C;  3H1I H;  3W7S A;  3ZCC A;  2EIM B;  3X2Q C;  1YCI A;  5FL7 G;  3FB8 C;  1M57 B;  2E76 B;  4YIP A;  4DV2 B;  4IYH A;  1WPX A;  5KLV H;  1S72 V;  4GYC B;  5IY5 C;  5JJN B;  1XNQ B;  1RM1 C;  3J7A U;  5KHH A;  3JAK A;  2M7W A;  1EN4 A;  2Y69 B;  5IWA B;  3CRR A;  2GHY A;  4U7N A;  5LA6 B;  2UU9 B;  1RFY A;  4RQE A;  5L3C A;  2B1G A;  2ZE7 A;  4X64 B;  3K06 A;  1NR7 A;  5CB4 B;  1XBL A;  4B3T B;  2FTK A;  1P4R A;  3WFV A;  4CS4 A;  2X0L A;  3OR6 C;  3SJQ C;  4G27 B;  1L1F A;  5LYJ B;  4DUY B;  1EN6 A;  2QM7 A;  4ABM A;  3CCQ V;  2P7T C;  2ETN A;  1HNZ B;  2YEV A;  2ZE8 A;  5LGT A;  1XMO B;  1N36 O;  3RYH A;  1O9G A;  3SJC C;  5CB4 A;  2EZP A;  1Y76 B;  4TUY B;  3RBZ A;  2QKA A;  4FFB B;  3CXH F;  2YC0 A;  5EZY A;  5JJJ B;  3T1Y O;  1FPO A;  4FPP A;  4MTF A;  1XMQ O;  2WLL B;  1UFI A;  3JAR B;  5KHJ A;  5LMU O;  4JV5 B;  3RYF A;  4CBC A;  1ORQ C;  1NZ6 A;  2LFR A;  5EBM C;  4DV6 B;  4D7S A;  3A2F A;  1FFX A;  2E5L O;  2P67 A;  2PI4 A;  1NQT A;  4FFB A;  2QWR B;  3E22 A;  2GSM B;  1P49 A;  4JI0 O;  4DK0 A;  3H1H H;  2QDO A;  2WLL A;  1P84 F;  3FYI B;  2ZXW C;  4QJF B;  5L3E A;  3CCS V;  1Q5O A;  1TVK A;  1BCC H;  1EN5 A;  4MVU A;  1N36 B;  2UXB O;  3D36 A;  3CEI A;  1AB3 A;  4H44 B;  1GN6 A;  3QO7 A;  2JK5 C;  5BR8 B;  1M5I A;  1Z2G A;  4JI5 O;  4QNH B;  2V7Q G;  2Q9L A;  4I4T A;  3ZRV A;  4LF7 O;  3JAL B;  1H2K A;  4ZHQ B;  3D8C A;  5D5Q A;  3T1H B;  4DR4 O;  5LMU B;  4JV5 O;  3ASN C;  1F23 A;  4FLY A;  3EHB B;  1VQ8 V;  2OTL V;  1PL0 A;  2QM8 A;  2KKW A;  1YJW V;  3BVO A;  1YTF B;  4JZ2 A;  1URF A;  2V1D A;  2A3Q A;  4AHC A;  2PTM A;  1TUE B;  4DR1 B;  4UUJ C;  1AP5 A;  2D2C B;  4NTW A;  2CE4 A;  2IJI A;  4JI4 O;  2Q67 A;  4DW0 A;  3MD0 A;  4BIU A;  1F4N A;  1JOY A;  1WPB A;  3KKY A;  1WLE A;  2IH3 C;  3C3S A;  1VF7 A;  4O4I B;  4LF4 B;  4J10 A;  5LMN O;  1I94 B;  2F93 B;  1SQB H;  1IBL O;  4JI3 B;  1SQG A;  4FLW A;  1XNR B; 
#chains in the Genus database with same CATH homology
 3K04 A;  1K92 A;  4TWK A;  3H01 A;  3M99 B;  4X8A A;  4N21 A;  3K79 A;  3RVY A;  2QA4 V;  4X88 A;  1QLE C;  1OCC B;  2R9I A;  3VBB A;  3ZJZ A;  3G4S V;  1MOF A;  1V55 C;  1YJ9 V;  1AJN A;  3LUT B;  1Y4M A;  4WFE A;  1UJW B;  1QR8 A;  1OCR C;  3K0D A;  4PA7 A;  5B1A C;  2XOK G;  1VQ9 V;  2BOC C;  1BHA A;  1RPO A;  2P90 A;  2WLH A;  1FXK A;  2QEX V;  1K3E A;  4JF3 A;  4G2K A;  1DLB A;  1S5H C;  1VQP V;  3ABM C;  1OCC C;  4PA9 A;  3W7T A;  2Y69 C;  2IJH A;  1V55 B;  1Y66 A;  1XL6 A;  2ITC C;  1PNL A;  4HYO A;  1H8H G;  4QE7 A;  3I55 V;  3SYC A;  1K4D C;  2HG5 C;  5CN0 A;  4YXW G;  5B1A B;  1OCR B;  4QE9 A;  1SER A;  3LSQ A;  4MTX A;  2DYR C;  1YIJ V;  1ROP A;  3AG1 C;  3R65 A;  1FXK B;  5CMU A;  1B6Q A;  2EBO A;  4WFF A;  2IU3 A;  2A79 B;  4WCE V;  3OUS A;  2B1I A;  4MVM A;  1VQ7 V;  1MSW D;  4F4L A;  5LGU A;  3TK1 A;  3P32 A;  4X89 A;  3CC2 V;  1G4Y B;  1GM8 A;  2K1E A;  1QBZ A;  2WSS G;  2LP7 A;  2Q68 A;  3ETD A;  3WG7 B;  3CPW U;  3AG1 B;  3K3W A;  1NH2 B;  5CBG A;  5C93 A;  1Q81 W;  1FXH A;  4J9Z B;  1GKF A;  1BHB A;  3AG2 B;  3G71 V;  4LC1 A;  2WWW A;  2WAM A;  5EBW C;  3WG7 C;  3JD4 A;  3CCU V;  1VQ5 V;  5DM6 V;  1QLN A;  1YHQ V;  2OCC C;  4XDL A;  4J9Y B;  1K9M W;  4PDM A;  3E8H A;  3JD3 A;  1OCZ B;  2X6C A;  4QPK A;  1F4M A;  1HWY A;  3AG2 C;  5LHH A;  2EIM C;  3SPG A;  3X2Q B;  1OHH G;  4JYB A;  3K0G A;  4MW8 A;  4H33 A;  1K5Q A;  5KUM A;  3OW2 U;  5KA6 A;  4LBE C;  1H2G A;  1AR1 B;  1THZ A;  2PI5 A;  1VQK V;  4WF9 V;  5IY5 B;  3GWO A;  2JIZ G;  1RM1 B;  4GX0 A;  5LBQ A;  5CBF A;  3JD2 A;  2ZDI C;  1AJQ A;  1R3L C;  5L3G A;  4DO2 A;  3LSS A;  2WLI A;  3E89 A;  3F7Y C;  5L3D A;  3F7V C;  3OR7 C;  4KFM A;  1AI7 A;  3ZIA G;  1W2B U;  1PD3 A;  5H6Q A;  1V54 C;  3CP1 A;  5B3S B;  4GT1 A;  4UXN A;  4GX1 A;  4MT8 A;  3FB7 C;  1AJP A;  4WFB V;  2ITD C;  3CCR V;  4JAV A;  1K8A W;  1NR1 A;  4E2L A;  4PDR A;  2IJJ A;  3CD6 V;  1VQ4 V;  3CCL V;  4JGS A;  4BW5 A;  2EIL C;  5LHI A;  5KA5 A;  3IC7 A;  1IXM A;  3FB5 C;  4R8C A;  5B3S C;  1KC8 W;  3ASN B;  3ZRW A;  3OE7 G;  1J95 A;  3LDC A;  1PNK A;  4UV9 A;  3BY6 A;  4GX5 A;  3E2E A;  3SYQ A;  3AG3 B;  4JAS A;  5B1B C;  3A0R A;  4DXW A;  2A9H A;  2Y48 A;  1R3J C;  1JVM A;  2D3O W;  1M56 C;  1COW G;  2XAS A;  5IYD O;  1VQL V;  4JTD B;  1BL8 A;  4HZ3 A;  1OCO B;  1GK9 A;  2WLJ A;  5B1N A;  4BIZ A;  1QR9 A;  2P6J A;  2JJ1 G;  3TET A;  3D3I A;  5EC1 C;  1R3K C;  1K7D A;  1KD1 W;  1CP9 A;  2WPD G;  4JYC A;  3AG3 C;  5B1B B;  1QVG U;  4R50 A;  3PJS K;  3JYC A;  4PA4 A;  1K5S A;  1I5X A;  4P30 A;  2EIJ C;  1M56 B;  2OT5 A;  5GW7 A;  1VQO V;  1VQN V;  1JX9 A;  3ABK C;  3JD1 A;  2ZDI A;  3HB3 B;  3OUF A;  1H8E G;  2JDI G;  3T2M A;  1NVP B;  2W0F C;  4RAI A;  4UVA A;  1JCH A;  4Q20 A;  1QVF U;  3OM3 B;  5E1A C;  5KUK A;  4OXS A;  2EIJ B;  3TCU A;  1PNM A;  2WLK A;  2XAH A;  3ABK B;  4MW3 A;  1F51 A;  4KP4 A;  2EIK B;  4MVS A;  4TSF G;  3LDD A;  2KB1 A;  2ZR3 A;  1QLE B;  3K08 A;  4FMT A;  5LHG A;  2XAJ A;  3MHS C;  4RO2 A;  1ENV A;  1XL4 A;  4FJC C;  2DWE C;  1KQS U;  1AI4 A;  2DYS C;  1NBM G;  2QTO A;  1M90 W;  3W7X A;  5BZB A;  1M9N A;  4PA3 A;  4KUM A;  1CEZ A;  3OEE G;  1FXV A;  2QE7 G;  1KP2 A;  4WFH A;  3ZMT A;  3ZMU A;  3B8M A;  2HJF C;  1GMG A;  4R7C A;  2LFS A;  2HLD G;  4CZZ A;  3SYO A;  2HR3 A;  3CCE V;  4U7O A;  4GCZ A;  2DYR B;  1DF5 A;  1OZ0 A;  1GO3 F;  2HKO A;  2NNU A;  3OEH G;  1DTO A;  3ZRW B;  3K03 A;  1SRY A;  2EIN C;  4WFG A;  1P7B A;  3FYE B;  1K33 A;  3T4D A;  1E79 G;  1S3J A;  3ABL C;  4MTO A;  2QKS A;  2DWD C;  3SPI A;  4RQF A;  1YJN V;  2W6I G;  1BMF G;  1S0V A;  4JTC B;  4RUF A;  1NKD A;  2XAQ A;  3ZN0 A;  3E86 A;  4JAU A;  1S76 D;  5EBL C;  1K73 W;  2ATK C;  1W0K G;  5IDJ A;  4N23 A;  2EJR A;  2ZQM A;  3SPJ A;  3CC4 V;  3ZRX A;  1K4C C;  3VOU A;  3EFF K;  1N8R W;  2OCC B;  1M57 C;  3MHH C;  2DQ0 A;  3ZN1 A;  5L3F A;  4EKW A;  3OMA B;  1G8M A;  3W7S A;  4JPR A;  1GM9 A;  3OMI B;  2UXN A;  2YEV B;  4ZKI A;  3ZCC A;  4GX2 A;  5LGN A;  3IFX A;  2EIM B;  3E83 A;  5IYB O;  3X2Q C;  5HFL A;  4LP8 A;  5FL7 G;  3CME V;  3CCJ V;  3FB8 C;  3SYA A;  1JQ0 A;  1M57 B;  2JJ2 G;  3ABT A;  3G6E V;  1WPX A;  3E35 A;  1S72 V;  3FB6 C;  1VQ6 V;  2JEU A;  5IY5 C;  1MG1 A;  4PA6 A;  1RM1 C;  4MVQ A;  3UM7 A;  3SPH A;  2M7W A;  3ABM B;  1Q86 W;  3KG2 A;  2WLI B;  2Y69 B;  4H37 A;  1ARO P;  2AHY A;  2GHY A;  4U7N A;  4XDK A;  3RVZ A;  3STZ C;  4Z1M G;  3CCV V;  4PDV A;  1FFT B;  4RQE A;  5L3C A;  3F5W C;  2Q69 A;  2B1G A;  3QO8 A;  2B5U A;  3K06 A;  2F43 G;  2X7R B;  3SYP A;  2BOB C;  1NR7 A;  2IH1 C;  1E1Q G;  1K97 A;  2FTK A;  1FXK C;  4I9W A;  4MS2 A;  5B1O A;  3CMA V;  4FK5 C;  1P4R A;  3WFV A;  1JPX A;  2X0L A;  3OR6 C;  3LDE A;  4G27 B;  3SJQ C;  4PDL A;  1L1F A;  3W7W A;  2OTJ V;  1EFR G;  3OGC C;  1M1K W;  2R9R B;  3OAA G;  2QM7 A;  3ML0 A;  3CCQ V;  2EIL B;  2P7T C;  2YEV A;  5LGT A;  1YIT V;  1R6K A;  1R73 A;  2EZP A;  4WFA V;  3RW0 A;  3ZRS A;  4P2Z A;  3RBZ A;  2X6A A;  4P9O A;  4BAY A;  3OMN B;  4FPP A;  4MTF A;  4QIW F;  5H9C A;  2WLL B;  1LNQ A;  1KKD A;  4UV8 A;  3E8F A;  5L3B A;  2DW4 A;  2WLM A;  2WLN A;  1OCZ C;  4CBC A;  1ORQ C;  1YTF D;  2LFR A;  2W6J G;  5EBM C;  5IYC O;  5EK0 A;  2XAF A;  3HPL C;  2P67 A;  2PI4 A;  1NQT A;  4QPJ A;  1JJ2 U;  1KP3 A;  2H8P C;  4TT3 G;  2NLJ C;  2GSM B;  3CC7 V;  1NH2 D;  2ZD9 A;  1PKX A;  4FIP C;  4JTA B;  3CCM V;  1R3I C;  4UVB A;  3FKS G;  3B8N A;  2WLL A;  5DN6 G;  3FYI B;  4MSW C;  2UXX A;  5H6R A;  3SPC A;  3ZMV A;  1FS0 G;  2ZXW C;  3K9A A;  4QJF B;  1GTO A;  5L3E A;  3CCS V;  4XDJ A;  3ETG A;  3QNE A;  3OFN G;  4MVU A;  3D36 A;  5CA3 A;  2C2A A;  1W0J G;  3QO7 A;  2AHZ A;  2EIK C;  1V54 B;  2XND G;  3ZMZ A;  1YI2 V;  2JK5 C;  3CYO A;  1KEC A;  3DGE A;  3LNM B;  2Z3Y A;  2X6B A;  4QNH B;  2V7Q G;  2DQ3 A;  2ZXW B;  3ZRV A;  1QCE A;  1AI6 A;  3STL C;  4LCU C;  1I5Y A;  4L87 A;  1EBO A;  1MAB G;  3IGA C;  4MVR A;  4RUE A;  1VQM V;  3DTU B;  1CPY A;  2CK3 G;  2DYS B;  4R6Z A;  2YSU B;  1NVP D;  2IU0 A;  2IJK A;  2Z5U A;  3ASN C;  1F23 A;  2IW5 A;  3EHB B;  2EZO A;  1VQ8 V;  2OTL V;  3AEI A;  1PL0 A;  1R6N A;  5CBH A;  5J9P C;  1K34 A;  2QM8 A;  1YJW V;  3JCZ A;  4MTG A;  4MVZ A;  1YTF B;  1GM7 A;  4HAM A;  2HVK C;  3ABU A;  1DF4 A;  2V1D A;  1SET A;  4G28 B;  2H94 A;  3E8B A;  1S77 D;  1TUE B;  4ZBM A;  1ZWI C;  3JD0 A;  3ZMS A;  1Q7Y W;  4UUJ C;  2EIN B;  1OCO C;  3W7U A;  1Q82 W;  4ASU G;  2A0L A;  1AI5 A;  1NJI W;  3ABL B;  3NXS A;  2IJI A;  3AG4 C;  3ASO C;  2Q67 A;  2MK3 A;  3MD0 A;  1YSC A;  4BIU A;  2JEX A;  1SZT A;  3T1C A;  3B77 A;  1F4N A;  3E8G A;  3P30 A;  1H38 A;  1JOY A;  2XAG A;  1WLE A;  2IH3 C;  2HVJ C;  4UVC A;  5HFM A;  1E1R G;  2ZR2 A;  3I56 V;  3AG4 B;  3ASO B;  3T4Z A;  1RPR A;  1SES A;  3ETE A;  4P9P A;  3QO5 A;  3CXC U;  3UKM A;  1EZJ A;  2HFE C;  2Q6A A;  4XBF A;  4I5S A;  3GB7 C;  3BEH A;  5EC2 C;  4PEL A;  4MVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...