4N21A

Crystal structure of the gp2 core domain from the california academy of science virus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
123
structure length
123
Chain Sequence
ENLYFQGNMKQIEDKIEEILSKIYHIENEIARIKKLIGAIASKIIKTANYTTNALFLLNKEESEIRDHVVEHELALNYLLAHQGGLCNVVKGPMCSSDIDDFSKNVSDMIDKVHEEMKKFYHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GP2 Ectodomain
publication title Structural Characterization of the Glycoprotein GP2 Core Domain from the CAS Virus, a Novel Arenavirus-Like Species.
pubmed doi rcsb
source organism Cas virus
molecule tags Viral protein
total genus 50
structure length 123
sequence length 123
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4n21A00
2LP7A 3M99B 1QBZA 1QR8A 3CYOA 3B8NA 5H9CA 3CP1A 5CN0A 5HFMA 3B8MA 3MHSC 1ENVA 1Y4MA 2EZPA 1DF5A 1JPXA 1Y66A 2P6JA 5KA5A 3B77A 1I5XA 4FIPC 4N21A 1DF4A 3GWOA 4JF3A 1QR9A 1QCEA 4E2LA 1DLBA 3WFVA 5CMUA 5HFLA 1EBOA 3MHHC 1I5YA 2M7WA 1F23A 4FK5C 3H01A 2MK3A 4N23A 2EZOA 5KA6A 1K33A 2EBOA 4JGSA 1K34A 1SZTA 3K9AA 4JPRA 1JQ0A 1MG1A 4FJCC 2OT5A 1MOFA 4G2KA 3P30A 2X7RB
chains in the Genus database with same CATH superfamily
1PL4A 1N8RW 1SQXH 1Q8IA 1VMGA 4UCTA 3SJCC 3K5MA 1YITV 1J5EO 4DV5B 1GH6A 3JASB 1Z5VA 2PUSA 4FZ0A 1DF4A 1IBMO 1K97A 1WAZA 1A32A 4B7KA 4I4TB 2W0FC 4JYAO 2ZR2A 4U7OA 1H2KA 1G4YB 2OT5A 5CB4B 3CMEV 3E2EA 4MVQA 1YHQV 4DV0B 2QWNB 3B8NA 3WU2Z 1G6UA 2EINB 2ZE8A 4DW1A 4UCSA 2CTPA 1XMOB 2IH1C 2AHZA 5CA1B 4QGPA 3OGCC 3ZCCA 4X66O 2IH3C 2OCHA 3M99B 4IHJA 4CH3A 4TT3G 3JD4A 2PF4E 3F5TA 2UUBO 4DR4O 3CCVV 1YJ9V 1OCCB 3P3PA 2Q67A 1Q6HA 2W6JG 2KG7B 5IT9N 4PDRA 3EHBB 3GVMA 5AG2A 5KX5B 1B06A 2WLLA 4GX5A 1DGSA 3RVZA 5GTIZ 3CC4V 1Y67A 3CCLV 3AG2B 3RYFB 4LNUB 3OMIB 1IBKO 2WLNA 1N32B 5L3DA 4UB8Z 3ASNC 3ASOB 1WP8A 1M90W 2UU9O 4IIJA 3TXQA 4X88A 5J2UA 2HEPA 2EIJB 3M7MX 4KHPO 3MDSA 1SS3A 4GZRB 2YEVA 3ZHTA 4NXNO 1HNZO 5LL6Y 2VWJA 4F6RA 4B3TB 1DF5A 4DV6O 2Y0IA 1NTMH 3RVYA 4TSFG 2GV9A 1ZL8A 4YXWG 1FYJA 4X1IB 4JI6B 3PN1A 1YTFB 2JEXA 1NI8A 3CRMA 1XNQB 3FB5C 1R6TA 1R6KA 3X2QB 3OAAG 1UPGA 3I56V 4DR1B 2K1EA 4DUZO 2WLKA 4LF5O 4TOIA 2EZPA 4LFAO 5CA0A 4FFBA 1I5XA 1NU1H 1FFXA 4B3RO 2E74B 1WA8A 4H13B 1OCOB 2Q8VA 5BR8O 5F2VO 5LMUB 5ITZB 2XAJA 3ML0A 4X1YB 1H2NA 1P7BA 1YDXA 3K57A 3K9AA 5BXZA 4JYBA 4FLVA 2QM4A 4NVPA 2Z0AA 2WLLB 2WA3A 1WP7A 5LGUA 3JD2A 1N36B 4FM2A 4AHCA 4X65B 1G8MA 2JK5C 2LQTA 2UXBB 2WAMA 4JV5B 1QVFU 2P67A 1D5AA 4B7EA 5LMNB 4RAIA 2JEUA 3ZHRA 3JARB 4B3SO 4PA9A 3FX7A 1SRYA 4ZI7A 2CDYA 2Q69A 1VQ6V 4GT1A 4DR7B 5J2TA 3KZIZ 1E1RG 1VF6A 2QSAA 2WSSG 5LHIA 4O4IB 2GTSA 5IWAB 2Y48A 5JJNB 4RUEA 5CBHA 4YJ2A 1Y74A 1U96A 1ZSPA 3N2KB 4CS2A 1SQGA 4CS4A 1KB9F 3H1JH 4PA7A 4TUYB 1S77D 3UO2A 1EBOA 1NS1A 4GKJB 1AP5A 2ZXWB 1YJWV 2Q6AA 4JI0O 2JGDB 3E22A 1FJGB 1K73W 3EXAA 4AQYB 1SKVA 3Q4HB 2UUCO 4CS3A 1ZLZA 4R7CA 3ETGA 5LYJA 1MSDA 4CC6A 4FFBB 5JJEB 3DGEA 1FFXB 1QCEA 2W6IG 2IBZH 3JALB 1IZ3A 1L8DA 2N04A 3CCJV 2VQEB 3C3TA 4LF4B 5BMVA 5B1NA 1SETA 4JPRA 4TQFA 2XNDG 3UQ8A 3QG5A 1P7GA 5J9PC 4WF9V 2B5UA 4PA3A 4PELA 2BTQB 2P6JA 3S3WA 4I9QA 3C3SA 1YIJV 2W0XA 4JI1B 3BFRA 4JI4B 2UXDO 4K8XA 4X64O 2ODMA 2XUMA 1SQVH 1YXBA 3OT7A 3ABTA 2XAHA 4PI2A 2IU0A 3RGBA 1TVKB 3JAWB 2GSMB 1SC5B 1QLEC 1NH2B 2ITDC 4LFCB 4JYYA 2QWRB 4LBEC 4E2LA 4DR3O 1VQKV 1XMQB 2JS5A 3BA9A 4ZHQB 4DR5O 3CXCU 3BCCH 1W0KG 1S5JA 3SPGA 1PPJH 1TUBA 4WBNA 1HR0O 2X6AA 4JI2B 5JVDA 1V54C 3P3NA 3CP1A 1PV0A 3IJ4A 3JSNA 4JF3A 3VQWA 4TQDA 1BHBA 4XBFA 2YI8A 2PGGA 3OW2U 1BMFG 3N2GA 5LOVA 1HDJA 1K5QA 2OCCB 4BWAA 3K5LA 4F6EA 5LYJB 3SPJA 1KKDA 1N34O 3SPCA 1K9MW 3B4SA 4BW5A 1PM9A 3VQVA 1IXMA 1N33O 2D3OW 3IFXA 1H38A 3JD0A 2CE4A 3SYQA 4NXMB 5KHGA 1MABG 3CRQA 1QR8A 1Q81W 4I9WA 4YHHB 2DWEC 3JCUZ 5C8YB 1BCCH 1XOUA 1YI2V 4HZ3A 4J7KA 3UO3A 1COWG 2Y69C 2A06H 2FMLA 5IDJA 3VBBA 1LR1A 4JI3B 2ZE6A 2F1MA 2MW2B 1VQ8V 3ZN1A 1HNXB 2P5OA 3ICXA 2JRIA 1Z2GA 5IY5C 4X1KB 1AR1B 1Q90D 4H44B 3ETDA 4LF8O 2QTSA 2QGNA 2EILC 5IJ0B 2YS8A 5KMGB 3SYPA 1BE3H 4IGGA 3OR6C 2QR4A 2HG5C 2M6YA 1ZWIC 5B1AC 3CXHF 4UV8A 4U3JA 5JQGB 2Z5UA 1W2BU 5IYZB 1U97A 4G28B 3G6BA 4I50A 4D7SA 2BTOA 1K3EA 1NTZH 1FXKA 2GUZA 1JJOA 5EZYA 1S3JA 1R3IC 3O65A 1XILA 4QIWF 2ZD9A 4MVUA 1VQMV 2ZE5A 3M8AA 4ZBMA 1M93A 5KUMA 2L35A 3IAYA 1EN4A 2Q5ZA 3J81N 4O2AB 2FKXA 3AG3B 3G6EV 2FTKA 4RQEA 4O2BB 3E86A 1IBMB 1IBLB 3K03A 1H8EG 3R65A 1R1BA 3K58A 4K35A 4JYAB 2WA4A 1AR5A 4ZKIA 1O9GA 1Q6UA 1M57C 4JASA 4DR6O 1K92A 3H1LH 4PD4F 4UCRA 3BEHA 4F4LA 3HKCB 1EN5A 4EB6B 3K0DA 5LA6A 4DV1O 4HNAB 4DRXB 1OCZC 1IXBA 1QLEB 2HP8A 4P30A 5BZBA 5LGNA 4RQFA 5JWPA 1Q82W 5KHJA 2NNUA 3MHSC 3T1YO 2Q7EA 2HR3A 3ZIAG 4X66B 2AW9A 2ADQB 4GYCB 1EN6A 1IVSA 4FK5C 4FMTA 2UUBB 1AI6A 3WG7C 2IJJA 3ZRXA 2Y4UA 2IJIA 3RYHA 4LWSA 2YUAA 4IT5A 3GB7C 3CSXA 4X62O 1SQPH 2V7QG 3CC2V 2EJ7A 1V55C 2NLJC 1WPBA 2GUZB 3SYAA 5FPRA 1ZAUA 3K79A 1GN2A 4YY3B 1IBKB 1S76D 4PI0A 4X20A 1VF5B 1M56B 2Q4PA 2P06A 1FS0G 1KP3A 2DYRC 1KECA 5FLXN 1NKDA 4UFZA 2CH7B 2EIKC 1QHTA 2A7WA 1TGOA 5IYBO 4KHPB 2QKAA 4EKWA 5L3BA 5EBLC 4ABMA 1L1FA 1VQNV 3TXSA 4NXNB 1BT8A 1X59A 3FD9A 2LJ2A 3ZN0A 2CGNA 2Y69B 3P32A 4LF7B 4TV8A 2K9PA 1VQOV 2ILMA 4JI7O 3JATA 2JGUA 4H37A 1HP8A 1PD3A 1P4RA 3AG4C 4JI8O 5KUKA 3AK3A 1K8AW 4CBCA 2QWOB 4UCVA 2X6BA 2UXNA 2G38A 4CH6A 1JPXA 4O4LB 4ZIBA 3U0ZA 5IY5B 4QNHB 3BRCA 4BIUA 3WB1A 5L3EA 2EILB 4LF5B 3L71H 3H01A 2YDEA 3F5WC 4L87A 3CJHB 4LFAB 1X4TA 2DW4A 3S3XA 1V9PA 3JAKB 4B3RB 3T4ZA 4QJFB 3CCEV 2C2AA 1XQ8A 5B1AB 4GLXA 3B8MA 1BSMA 3U10A 3CEIA 4LC1A 3CWBH 3DTUB 2YIDA 2EIMC 2QA4V 3WFVA 2WLIA 1SF9A 3E83A 3FB6C 3W7TA 5JH7A 4QPKA 4X9QA 1IURA 1VF6C 5DEDA 3MAQA 1HNWO 5K1XA 4LFBO 1RFYA 3DXRA 3TCUA 1NJIW 1CEZA 5IE9A 1NTKH 3K0GA 2RQ6A 4B3SB 4MTGA 1Y76A 5B1BB 1H2LA 1K33A 3BAAA 1M57B 4IHJB 1LUVA 2OTLV 3ZHVA 1P49A 4PHZA 2HHHO 1Y66A 4LF6B 3K59A 4ASUG 3ZMZA 5KAFZ 4I0XA 2ZIOA 1TUEB 4JAUA 4MS2A 5KHHA 3H9VA 1RSOA 2ZM6B 1MA1A 3JATB 3CRRA 2MK3A 1I94O 1OCZB 3FKSG 3OFNG 4W4KA 3UT5A 3RYIA 5KHIA 2QKCA 2QTOA 3B09A 3SJBC 1VF7A 3JAMN 2KKWA 3ABMC 1FKAO 4RWUA 1MSWD 1XUQA 4J10A 3RN4A 2JJ1G 3JYCA 1N32O 2R70A 2UUCB 3LDEA 1AR4A 3TGUH 4LF9B 2EBOA 3WG7B 2AGAA 3HKEA 2R9RB 3CHXA 2P90A 1RPRA 1AJNA 1VARA 2WWWA 1SZXA 4P9PA 1RM1C 3ABKC 4D7TA 3IC9A 5IJ9A 1VQ9V 4IIJB 3RYCA 1R73A 3ZMVA 5J2UB 2IJHA 3OGIB 1R3KC 2E5LO 2H8PC 2EZOA 1W0JG 1YEWA 2CUGA 3OUFA 2YEVB 3NR7A 4IYIA 2Y0PA 4JI6O 1AROP 4F6RB 3B40A 1W59A 4JAAA 3ZS8C 5LXTA 4DV3O 2DOSA 3RBZA 1WLEA 2X0LA 3L72H 4H0LB 1ZL8B 3CCMV 4DR1O 2DYRB 1JFFA 4J9ZB 1N0JA 4JZ2A 4WFFA 3W7WA 4DV4O 4LH7A 2ZNJA 4GX2A 5KAIZ 4HBNA 5EYPA 3HKBA 4O4HA 3AG1C 3F7VC 1JJ2U 1LNQA 2NR5A 2WLHA 4DR5B 5LMUO 1YF2A 1LUWA 1BZKA 5CA0B 4ZOLA 4FLUA 1HR0B 1GN4A 5D5QA 1RPOA 1WA8B 1CXZB 1Z5WA 3MD0A 1ORQC 4J80A 3AG4B 1ZX3A 2DYSC 4JTAB 3JCZA 1N36O 1Q86W 2PYJA 3W7SA 4KFMA 1E1QG 2ITCC 4BIOA 1BHAA 1XNRO 1PNKA 3FB8C 1WNSA 5DM6V 2PTMA 1L0LH 2YXLA 3TK1A 5GONA 3K5OA 4DR7O 3L73H 3ASNB 3OTOO 1EFRG 4FLWA 3APQA 5HFMA 2H3OA 1N33B 4QPJA 4D6TH 4OX9O 2HKOA 1VQ4V 5KA5A 4ZI7B 4OPHA 5EC2C 2PYLA 5IWAO 2EIMB 4GUNA 1M4UA 5J2TB 4C7UA 2F93B 1AI7A 5EIBD 3ZRWA 4Z1MG 2ZDIA 3CX5F 2OTJV 4TWKA 5B66Z 1WPXA 3W7XA 5CBFA 1MZEA 4EEQA 1WJZA 4YJ2B 1XHZA 1GMGA 1Q5OA 1Y74B 3I5DA 1XREA 2F66C 3T1HB 2RCVA 1FXVA 2OIEA 4AQYO 1OZ0A 3QNEA 1D2DA 3FAVA 1I08A 2ZNIA 3RFRA 2BOCC 1HW7A 4K3AA 5LHGA 4FJCC 1GN6A 3E22B 3VQXA 4FM0A 5LP6A 2VQEO 1FXKC 4LF8B 3KCYA 2LW1A 2E3CA 4GKKO 1VEWA 3CCQV 2P4KA 1DTOA 5L3CA 2EX3A 3LNNA 1AI4A 3T2MA 2F4VO 2E76B 1OJHA 3T4DA 4FPPA 2ZIMA 5BMVB 4RO2A 3LUTB 3HPLC 4TV9A 2IU3A 4WFAV 2HFEC 5K1PA 5EBWC 5IYCO 4LH6A 3ABMB 3HKDA 5H9CA 1QVGU 1KMIZ 2HVKC 2XHBA 2EINC 3I55V 2XT9A 5CBGA 1R3JC 4LFCO 5H6QA 2NN4A 1B6QA 2X6CA 1XL6A 3H1HH 2LP7A 1OHHG 4FVMA 4K8ZA 3THOA 4OPAA 3CYOA 2DJVA 1RM1B 3ABKB 3QO8A 2QM8A 4DV2B 2UXCO 1AJPA 3ZHSA 3A8TA 2VRZA 2IM9A 2M7WA 3K08A 4UUJC 3K5NA 1SA0A 3BHPA 1NQTA 4DR6B 3RT3C 1TUBB 1VP7A 2X7RB 4WBNB 1OCRC 3NXSA 5JVDB 3ABLC 2AHYA 2BSKA 4DV1B 1XHXA 1K5SA 2QDOA 5L3FA 2VQFB 5IYDO 5E79Z 3FAVB 3ZJZA 1IX9A 3T1YB 3SDLA 3BY6A 3UM7A 4DR2O 1GO3F 3CE2A 3N2GB 5LOVB 2VS0A 1MOFA 1GN3A 3AG1B 4E4EA 2L6LA 2QE7G 2P4VA 3LNMB 3D36A 2WPDG 3JASA 1B3QA 2RN9A 4NXMO 2CTQA 4I4TA 3OD4A 4J42A 1KU9A 1D5NA 1I7FA 4DUYO 3O9OA 3BPZA 1Q3EA 5EK0A 4B3MO 2IJKA 1J5EB 4YHHO 1BQ0A 1F51A 4NKGB 1H2GA 1NVPB 3P30A 4NTYA 4X62B 2HJFC 2XOKG 3QTCA 3E8FA 1BS3A 2O57A 3OE7G 4JYCA 1YTFD 4MW3A 2ATKC 3ETQA 1H2MA 4CH5A 1DLBA 3SYOA 3SGIA 5CA1A 3AK2A 3K9SA 5GW7A 4NTWA 2OIGA 4UVBA 4G2KA 1K7DA 4JZGA 3ETEA 3JSLA 3STZC 3AEIA 4UV9A 2ZR3A 2P7TC 4KUMA 2RNBA 3N27A 5JCOA 2QEXV 2KQXA 2RMKB 5B1OA 4FLTA 1M5IA 2Q7GA 1N0NA 2KG7A 2JIZG 4DR4B 1V54B 3D3IA 1K4DC 4JI7B 3CPWU 4U3JB 3ZMSA 5A9GA 4DV7O 4JI8B 1KYOF 3WB2A 2E75B 4DW0A 2CGOA 4JI5O 2GBOA 3RYFA 4LNUA 4ICGA 4R8CA 4I50B 1BQZA 3EVKA 4CH4A 5H5NA 1FXKB 3DSQA 5EZYB 5FL7G 2UUAO 2AXTZ 1M1KW 2DN9A 1IBLO 3GWOA 1NT2B 3B2EE 4KP4A 3CS5A 2LW7A 1QLNA 1YJNV 2UU9B 3UCSC 3J7AU 2AZ2A 4YIPA 1NZ6A 2RJZA 4Q6GA 1K4CC 2WLMA 2JVDA 4GX1A 1PP9H 1YVWA 5TISZ 1HNZB 3LSQA 5JJJB 5FNVA 1HNWB 1MNGA 4X1IA 4LFBB 1QU7A 1F23A 2DE0X 2ZXWC 1XL4A 5LA6B 1BL8A 4DXWA 1Q7YW 3F7YC 4DV6B 5LHHA 3OMNB 1PKXA 2ZT9B 4R50A 1YSCA 5B3SC 1RP3B 4K0KO 4X89A 1SERA 1TA8A 2CAZC 2YC0A 5LGTA 3LSSA 3SPHA 2F43G 4DUZB 5ITZA 1GKFA 4X1YA 1US6A 4DV5O 2HHHB 1KKCA 3E8HA 1S5HC 1OCRB 3SJQC 3ABLB 5EBMC 1AVMA 1DK1A 3RYHB 5BR8B 4LWSB 1I94B 3EFFK 4J9YB 2ZQMA 1YZBA 5FPOA 3IC7A 1KBHA 2V4DA 3BABA 4DV0O 2ETNA 2PI4A 1AP6A 2ADPA 1B04A 3ZRSA 2QKSA 4YY3O 4CZZA 3ZHUA 1NH2D 3QF7A 1OV9A 1XMOO 3JARA 1T5EA 3ZMUA 3CC7V 5CN0A 3G71V 2XAGA 3ZHQA 1VQLV 4PDLA 1FAFA 3OEEG 4X20B 2OWOA 3MHHC 1AB3A 1H8HG 4L8JA 4JGSA 4WFBV 2Z3YA 4O4IA 2YSUB 1IDSA 2LFSA 2Q0AA 4HAMA 4LF7O 2E5LB 3OMAB 3N2KA 3B77A 4UXNA 4TUYA 3DC5A 5FNVB 4JTDB 3ABUA 4TV8B 1KUQA 2JGDA 4DV3B 5L3GA 2OCCC 3OR7C 2ZCEA 1KP2A 4KL1A 1JCHA 3Q4HA 4NB5A 3K3WA 4I7ZB 1PNLA 4MTOA 1JX9A 3H1IH 2YXYA 4DV4B 4XDJA 4JI0B 4BW9A 4LCUC 2KB1A 3JALA 4MTXA 2DQ3A 1GK9A 3K04A 2B1GA 4PV1B 3G80A 4BIZA 1S0VA 1FPOA 1ROPA 3W7UA 2BTQA 4J11A 2DQ0A 4NTXA 4DYLA 1F4MA 2HJDA 1QR9A 4PJ0Z 1JVMA 3AG7A 4LP8A 1EZVH 4EFEA 4UCOA 1NR7A 3A0RA 2WLIB 4BAYA 1FXHA 2R72A 4B3TO 5JH7B 3E8BA 5KA6A 1ZUQA 3T1CA 4QE7A 1V55B 3BA8A 1JQ0A 5DECA 1TVKA 3JAWA 4H33A 1G1XB 3GWKC 2DMXA 3JD1A 1XNRB 2UXDB 2ZDIC 2Q68A 4X64B 2JS3A 2N05A 3FFQA 3DXRB 2YIBD 1Y4MA 2A0LA 1EZJA 1GM9A 4PA6A 4NYKA 1XNQO 2ZKOA 4N21A 4P2ZA 2A79B 3TETA 3J80N 3QO7A 2GTAA 3VOUA 1AILA 3L9DA 3ZEDA 4ZHQA 3OUSA 3OTOB 1J95A 2B9ZA 1GM7A 1Y76B 2D2CB 4OX9B 4N23A 4FM1A 4J7JA 4LF6O 2YXHA 1R3LC 1E79G 1MG1A 2EIKB 1TAEA 1R6NA 2CTWA 4DR3B 2Y4TA 4B08A 4MVZA 2ZM6O 5LP6C 4Z2WA 4OGQB 1SESA 3K06A 4NR1A 3SR2C 4MW8A 1HWYA 2DWDC 2JDIG 4I0XB 1Q43A 1SQBH 4KXRA 3CRCA 1RSOB 4MVRA 1P84F 3E89A 1SQFA 3UKMA 4OXSA 3UT5B 3RYIB 5B3SB 4WCEV 4X65O 4JTCB 2UXBO 1Q6IA 4LF9O 2P22C 2R9AA 4JV5O 3CMAV 1EM1A 4FZ1A 1VQPV 5LMNO 4RUFA 1MMMA 1NVPD 2Q0OC 4XDKA 1XBLA 5C93A 3SYCA 4GKKB 3AG3C 2BOBC 1SZTA 3HKEB 2EJRA 1N34B 3FYEB 1MZFA 4IL6Z 1PNMA 1UJWB 3HR0A 2F4VB 3QVNA 2YI9A 3JD3A 3L75H 2XAFA 2N74A 2B1IA 1QQCA 5C8YA 5IJ9B 3KKYA 3RYCB 3ZBHA 5LBQA 2QWPB 4LR3A 4MVMA 3A0HZ 3KG2A 3AK1A 1KD1W 4I5SA 1F7YA 3HB3B 4UVCA 1H2SB 3U11A 2JJ2G 4GKJO 1NBMG 5EIBC 1O9HA 1GRJA 3OEHG 4J41A 5LXTB 3LSUA 2PY5A 1GTOA 5H2FZ 1PL0A 2YIBA 3SJAC 1FJGO 3G67A 2FL4A 5A2QN 2FB5A 4X1KA 4O4JA 2YIAA 1M9NA 1N4CA 4UVAA 1JFFB 5IJ0A 5KHKA 5KMGA 5CA3A 4DK0A 1XDCA 1JOYA 2UXCB 5EYPB 1SQQH 2WLJA 3HKBB 4O4HB 1WB8A 1JMKC 3IGAC 4IYHA 4LF4O 5EC1C 1GM8A 3D36C 5JQGA 1KQSU 3L70H 2PI5A 4Z1VA 4UCUA 4ZOLB 5IYZA 3CD6V 1JR9A 4BR6A 4YIOA 2EULA 2Q7HA 1BGYH 1VQ7V 3CCRV 3KCXA 4JAVA 4JI1O 1WN7A 2CK3G 5KLVH 4JI4O 3A0BZ 2XTAA 5GTHZ 4Q20A 1ENVA 4DR2B 3FYIB 3QO5A 4I55A 2LGQA 4WFGA 1M56C 4WFEA 4O2AA 2IW5A 1CP9A 4O2BA 1THZA 5GONB 1XMQO 3R66A 2A9HA 3A2FA 4DUYB 1F4NA 4B3MB 3VQYA 2VWKA 5H6RA 3WB0A 4PA4A 3HKCA 4JI2O 5JCOC 4EB6A 4DK1A 4YJ3A 1XEQA 1OCCC 4WFHA 2CTRA 4HNAA 4DRXA 3T1HO 3ZRWB 4U3FH 2RDCA 2F95B 4W4LA 4PDMA 3DC6A 1S5LZ 1AI5A 3D3QA 3TJTA 1YCIA 3FB7C 1VIBA 5BY1A 3CRAA 4FLXA 2F23A 3OTFA 2KSDA 3L74H 4O4JB 4FLZA 2AZ0A 2BE3A 2GDSA 2QM7A 4XDLA 3AG2C 4G27B 1GAXA 5LP6B 2OYQA 4PDVA 1FFTB 1WB7A 2HLDG 4DO2A 3H1KH 3ASOC 1QNMA 2H94A 1S72V 2Q9LA 4QE9A 2ZE7A 2LO1A 4MTFA 2EIJC 4U7NA 4UB6Z 3RWRD 5B5EZ 2FYUH 2Q73A 2V1DA 4MT8A 1K34A 3OM3B 1UFIA 4DV7B 4GCZA 4TV9B 2DYSB 4CC5A 5CB4A 1URFA 4P9OA 5E1AC 3G4SV 3HKDB 4R6ZA 2QJ1A 4JI5B 3E35A 2GHYA 3SPIA 2UXXA 4X8AA 2R9IA 3CB2A 4JI3O 1L0NH 4J7ZA 4I55B 4EFBA 5CMUA 1I5YA 2UUAB 1JA8A 2XASA 4DV2O 1HNXO 5B1BC 1VQ5V 2A3QA 2XAQA 2CH7A 3X2QC 1QBZA 2HVJC 4A5UB 3ZMTA 1I0HA 3ZX6A 3CCUV 4HYOA 1FD9A 1XI1A 2PZSA 2LGWA 4MSWC 4YJ3B 1AJQA 1OCOC 1SA0B 3D8CA 3C90A 2VQFO 2YICA 2BCCH 3LDCA 4MVSA 2ZINA 1CPYA 4GX0A 1ZTEA 3RW0A 2BSKB 2ARHA 4AILC 5D5PA 4AI8A 5KX5A 4O4LA 2LFRA 4FIPC 5DN6G 3STLC 3BVOA 3PJSK 4FFKA 1Y6XA 3APOA 5HFLA 4K0KB 4MVOA 2QWQB 3ZRVA 3CJHA 3LDDA 1KC8W 3E8GA 1NR1A 4FLYA 3JAKA 3CCSV
chains in the Genus database with same CATH topology
2DYSC 2LFSA 4JTAB 3JCZA 1N8RW 1Q86W 1YITV 4HAMA 4KFMA 3W7SA 3OMAB 1E1QG 1VQ8V 3ZN1A 2ITCC 1BHAA 3B77A 1DF4A 4UXNA 1K97A 5IY5C 4JTDB 2W0FC 1AR1B 1PNKA 3ABUA 3ETDA 3FB8C 2EILC 2ZR2A 4U7OA 5DM6V 3SYPA 5L3GA 1G4YB 2OT5A 3TK1A 3CMEV 2OCCC 3E2EA 3OR7C 1KP2A 4MVQA 1YHQV 3OR6C 1JCHA 3ASNB 3K3WA 1PNLA 4MTOA 1EFRG 3B8NA 2HG5C 1JX9A 5HFMA 1ZWIC 2EINB 4QPJA 5B1AC 4UV8A 4XDJA 2HKOA 1VQ4V 5KA5A 4LCUC 5EC2C 2Z5UA 2KB1A 2EIMB 1W2BU 2IH1C 2AHZA 4MTXA 4G28B 2DQ3A 1GK9A 3OGCC 3K04A 2B1GA 1AI7A 3ZCCA 2IH3C 3ZRWA 4Z1MG 1K3EA 2ZDIA 2OTJV 1FXKA 3M99B 4TWKA 1WPXA 4BIZA 1S0VA 3W7XA 5CBFA 1ROPA 1S3JA 1R3IC 1GMGA 3W7UA 4TT3G 4QIWF 2ZD9A 4MVUA 1VQMV 2DQ0A 1F4MA 3JD4A 1QR9A 4ZBMA 1FXVA 1JVMA 4LP8A 1OZ0A 3QNEA 5KUMA 3CCVV 1NR7A 3A0RA 2WLIB 4BAYA 1YJ9V 1OCCB 1FXHA 2BOCC 2Q67A 3AG3B 3E8BA 2FTKA 3T1CA 5KA6A 4QE7A 1V55B 2W6JG 4RQEA 3G6EV 3E86A 1JQ0A 4H33A 5LHGA 4FJCC 3K03A 1H8EG 3R65A 3JD1A 2ZDIC 2Q68A 4PDRA 1FXKC 4ZKIA 3EHBB 1Y4MA 2A0LA 1M57C 4JASA 1EZJA 1GM9A 2WLLA 4PA6A 3CCQV 1DTOA 4N21A 4GX5A 4P2ZA 5L3CA 2A79B 3RVZA 1K92A 3TETA 3CC4V 3QO7A 3BEHA 4F4LA 1AI4A 3T2MA 3VOUA 3OUSA 1J95A 3CCLV 1GM7A 3K0DA 3T4DA 3AG2B 4FPPA 4N23A 1R3LC 1E79G 4RO2A 3LUTB 3OMIB 3HPLC 1MG1A 2EIKB 1OCZC 2WLNA 1R6NA 1QLEB 2IU3A 4WFAV 2HFEC 4P30A 5BZBA 5LGNA 5EBWC 5L3DA 5IYCO 4RQFA 4MVZA 3ASNC 3ABMB 3ASOB 1Q82W 5H9CA 2NNUA 1QVGU 3MHSC 2HVKC 1M90W 2HR3A 2EINC 3ZIAG 1SESA 3K06A 4MW8A 3I55V 1HWYA 2DWDC 2JDIG 5CBGA 4X88A 2EIJB 1R3JC 4FK5C 4MVRA 4FMTA 3E89A 3UKMA 2YEVA 5H6QA 4OXSA 2X6CA 1B6QA 1AI6A 1XL6A 2LP7A 1OHHG 2IJJA 3WG7C 5B3SB 4WCEV 3ZRXA 2IJIA 3CYOA 4JTCB 1RM1B 3ABKB 3QO8A 2QM8A 1DF5A 3CMAV 1VQPV 1AJPA 3RVYA 4TSFG 3GB7C 4RUFA 4YXWG 1NVPD 4XDKA 1YTFB 2JEXA 2M7WA 2V7QG 3K08A 4UUJC 3CC2V 5C93A 3SYCA 3AG3C 1NQTA 1SZTA 2BOBC 3FB5C 1V55C 1R6KA 3X2QB 2EJRA 3OAAG 2NLJC 2X7RB 3FYEB 3SYAA 1PNMA 1UJWB 1OCRC 3NXSA 3I56V 2K1EA 3JD3A 3ABLC 2AHYA 2WLKA 2XAFA 3K79A 2EZPA 2B1IA 1I5XA 1K5SA 1S76D 5L3FA 5IYDO 5LBQA 3ZJZA 1OCOB 4MVMA 1M56B 1FS0G 1KP3A 3KG2A 2DYRC 2XAJA 3ML0A 3BY6A 1P7BA 4I5SA 1KECA 3UM7A 1GO3F 1NKDA 1KD1W 3K9AA 1MOFA 2EIKC 3AG1B 3HB3B 4UVCA 4JYBA 2QE7G 5IYBO 2JJ2G 3LNMB 4EKWA 5L3BA 5EBLC 1NBMG 3D36A 2WLLB 2WPDG 1L1FA 1VQNV 3OEHG 5LGUA 1GTOA 1PL0A 3JD2A 3ZN0A 1M9NA 4UVAA 1G8MA 2JK5C 2Y69B 3P32A 5EK0A 2IJKA 2WAMA 5CA3A 1VQOV 4H37A 1PD3A 1F51A 1QVFU 1JOYA 2P67A 1H2GA 3AG4C 1P4RA 1NVPB 3P30A 4RAIA 5KUKA 2WLJA 1K8AW 2JEUA 4CBCA 2HJFC 4PA9A 3IGAC 2XOKG 3E8FA 5EC1C 1GM8A 2X6BA 1SRYA 2UXNA 1JPXA 3OE7G 4JYCA 1YTFD 1KQSU 4MW3A 5IY5B 2PI5A 4QNHB 2Q69A 1VQ6V 2ATKC 4GT1A 4BIUA 3CD6V 5L3EA 1DLBA 2EILB 3SYOA 1E1RG 5GW7A 3H01A 3F5WC 4L87A 2DW4A 2WSSG 5LHIA 4UVBA 1VQ7V 4G2KA 1K7DA 4JAVA 3CCRV 3T4ZA 2Y48A 2CK3G 4QJFB 3CCEV 2C2AA 3ETEA 4RUEA 3STZC 3AEIA 5CBHA 4UV9A 2ZR3A 5B1AB 4Q20A 3B8MA 1ENVA 2P7TC 4KUMA 3FYIB 4PA7A 4LC1A 1S77D 3DTUB 2QEXV 2EIMC 5B1OA 2QA4V 3WFVA 2WLIA 3QO5A 1EBOA 3E83A 3FB6C 4WFGA 3W7TA 1M56C 2ZXWB 4WFEA 2IW5A 1YJWV 2Q6AA 4QPKA 1CP9A 1THZA 1K73W 2JIZG 2A9HA 1V54B 3D3IA 1K4DC 1F4NA 4R7CA 3ETGA 3TCUA 3CPWU 1NJIW 1CEZA 3ZMSA 3DGEA 5H6RA 1QCEA 2W6IG 3K0GA 4PA4A 3CCJV 4MTGA 1OCCC 5B1BB 4WFHA 1K33A 5B1NA 1SETA 4R8CA 4JPRA 3ZRWB 2XNDG 4PDMA 1FXKB 1AI5A 5J9PC 4WF9V 5FL7G 1M57B 2B5UA 4PA3A 3FB7C 2OTLV 4PELA 1M1KW 2P6JA 1Y66A 4ASUG 3ZMZA 3GWOA 1YIJV 4KP4A 1TUEB 4JAUA 4MS2A 1QLNA 3ABTA 2MK3A 2QM7A 2XAHA 4XDLA 1OCZB 3FKSG 3OFNG 2IU0A 3AG2C 1YJNV 4G27B 2QTOA 2GSMB 1QLEC 4PDVA 1FFTB 1K4CC 2WLMA 2HLDG 1NH2B 4DO2A 2ITDC 3ABMC 3ASOC 1MSWD 4GX1A 2H94A 1S72V 4LBEC 4QE9A 4E2LA 1VQKV 3LSQA 2JJ1G 3JYCA 4MTFA 3LDEA 2EIJC 1F23A 4U7NA 3CXCU 1W0KG 1XL4A 2V1DA 2ZXWC 4MT8A 2EBOA 1BL8A 1K34A 3OM3B 3SPGA 3WG7B 4DXWA 1Q7YW 3F7YC 5LHHA 4GCZA 3OMNB 2DYSB 2R9RB 1PKXA 2P90A 2X6AA 4P9OA 4R50A 5B3SC 1YSCA 5E1AC 3G4SV 1RPRA 1V54C 3CP1A 1AJNA 2WWWA 4R6ZA 4X89A 1SERA 3E35A 4P9PA 2GHYA 3ABKC 1RM1C 3SPIA 2UXXA 1VQ9V 4JF3A 4X8AA 1R73A 3ZMVA 2R9IA 2IJHA 5LGTA 3LSSA 3SPHA 5CMUA 1BHBA 4XBFA 1I5YA 2F43G 1R3KC 1GKFA 2XASA 2H8PC 2EZOA 1W0JG 3OW2U 1BMFG 5B1BC 3E8HA 2YEVB 3OUFA 2XAQA 1S5HC 1K5QA 2OCCB 1VQ5V 1OCRB 3SJQC 3X2QC 1QBZA 3ABLB 5EBMC 2HVJC 1AROP 3ZMTA 3EFFK 4J9YB 3SPJA 2ZQMA 3CCUV 4HYOA 3RBZA 1KKDA 3SPCA 1K9MW 1WLEA 2X0LA 3IC7A 3CCMV 2DYRB 4MSWC 4BW5A 2PI4A 1AJQA 1OCOC 1IXMA 3ZRSA 4J9ZB 4WFFA 2D3OW 2QKSA 3IFXA 3W7WA 1H38A 4CZZA 4GX2A 3JD0A 1NH2D 3SYQA 1MABG 3AG1C 3LDCA 4MVSA 3F7VC 1JJ2U 1LNQA 1CPYA 2WLHA 1QR8A 4GX0A 3ZMUA 3CC7V 1Q81W 5CN0A 4I9WA 3RW0A 3G71V 2XAGA 1VQLV 4PDLA 3OEEG 2DWEC 2LFRA 4FIPC 5DN6G 3STLC 3PJSK 1RPOA 3MD0A 1YI2V 5HFLA 4HZ3A 3MHHC 1ORQC 4MVOA 1H8HG 3ZRVA 1COWG 2Y69C 3LDDA 1KC8W 3E8GA 4JGSA 3AG4B 1NR1A 3VBBA 2Z3YA 5IDJA 4WFBV 3CCSV 2YSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP7 A;  3M99 B;  1QBZ A;  1QR8 A;  3CYO A;  3B8N A;  5H9C A;  3CP1 A;  5CN0 A;  5HFM A;  3B8M A;  3MHS C;  1ENV A;  1Y4M A;  2EZP A;  1DF5 A;  1JPX A;  1Y66 A;  2P6J A;  5KA5 A;  3B77 A;  1I5X A;  4FIP C;  4N21 A;  1DF4 A;  3GWO A;  4JF3 A;  1QR9 A;  1QCE A;  4E2L A;  1DLB A;  3WFV A;  5CMU A;  5HFL A;  1EBO A;  3MHH C;  1I5Y A;  2M7W A;  1F23 A;  4FK5 C;  3H01 A;  2MK3 A;  4N23 A;  2EZO A;  5KA6 A;  1K33 A;  2EBO A;  4JGS A;  1K34 A;  1SZT A;  3K9A A;  4JPR A;  1JQ0 A;  1MG1 A;  4FJC C;  2OT5 A;  1MOF A;  4G2K A;  3P30 A;  2X7R B; 
#chains in the Genus database with same CATH topology
 1PL4 A;  1N8R W;  1SQX H;  1Q8I A;  1VMG A;  4UCT A;  3SJC C;  3K5M A;  1YIT V;  1J5E O;  4DV5 B;  1GH6 A;  3JAS B;  1Z5V A;  2PUS A;  4FZ0 A;  1DF4 A;  1IBM O;  1K97 A;  1WAZ A;  1A32 A;  4B7K A;  4I4T B;  2W0F C;  4JYA O;  2ZR2 A;  4U7O A;  1H2K A;  1G4Y B;  2OT5 A;  5CB4 B;  3CME V;  3E2E A;  4MVQ A;  1YHQ V;  4DV0 B;  2QWN B;  3B8N A;  3WU2 Z;  1G6U A;  2EIN B;  2ZE8 A;  4DW1 A;  4UCS A;  2CTP A;  1XMO B;  2IH1 C;  2AHZ A;  5CA1 B;  4QGP A;  3OGC C;  3ZCC A;  4X66 O;  2IH3 C;  2OCH A;  3M99 B;  4IHJ A;  4CH3 A;  4TT3 G;  3JD4 A;  2PF4 E;  3F5T A;  2UUB O;  4DR4 O;  3CCV V;  1YJ9 V;  1OCC B;  3P3P A;  2Q67 A;  1Q6H A;  2W6J G;  2KG7 B;  5IT9 N;  4PDR A;  3EHB B;  3GVM A;  5AG2 A;  5KX5 B;  1B06 A;  2WLL A;  4GX5 A;  1DGS A;  3RVZ A;  5GTI Z;  3CC4 V;  1Y67 A;  3CCL V;  3AG2 B;  3RYF B;  4LNU B;  3OMI B;  1IBK O;  2WLN A;  1N32 B;  5L3D A;  4UB8 Z;  3ASN C;  3ASO B;  1WP8 A;  1M90 W;  2UU9 O;  4IIJ A;  3TXQ A;  4X88 A;  5J2U A;  2HEP A;  2EIJ B;  3M7M X;  4KHP O;  3MDS A;  1SS3 A;  4GZR B;  2YEV A;  3ZHT A;  4NXN O;  1HNZ O;  5LL6 Y;  2VWJ A;  4F6R A;  4B3T B;  1DF5 A;  4DV6 O;  2Y0I A;  1NTM H;  3RVY A;  4TSF G;  2GV9 A;  1ZL8 A;  4YXW G;  1FYJ A;  4X1I B;  4JI6 B;  3PN1 A;  1YTF B;  2JEX A;  1NI8 A;  3CRM A;  1XNQ B;  3FB5 C;  1R6T A;  1R6K A;  3X2Q B;  3OAA G;  1UPG A;  3I56 V;  4DR1 B;  2K1E A;  4DUZ O;  2WLK A;  4LF5 O;  4TOI A;  2EZP A;  4LFA O;  5CA0 A;  4FFB A;  1I5X A;  1NU1 H;  1FFX A;  4B3R O;  2E74 B;  1WA8 A;  4H13 B;  1OCO B;  2Q8V A;  5BR8 O;  5F2V O;  5LMU B;  5ITZ B;  2XAJ A;  3ML0 A;  4X1Y B;  1H2N A;  1P7B A;  1YDX A;  3K57 A;  3K9A A;  5BXZ A;  4JYB A;  4FLV A;  2QM4 A;  4NVP A;  2Z0A A;  2WLL B;  2WA3 A;  1WP7 A;  5LGU A;  3JD2 A;  1N36 B;  4FM2 A;  4AHC A;  4X65 B;  1G8M A;  2JK5 C;  2LQT A;  2UXB B;  2WAM A;  4JV5 B;  1QVF U;  2P67 A;  1D5A A;  4B7E A;  5LMN B;  4RAI A;  2JEU A;  3ZHR A;  3JAR B;  4B3S O;  4PA9 A;  3FX7 A;  1SRY A;  4ZI7 A;  2CDY A;  2Q69 A;  1VQ6 V;  4GT1 A;  4DR7 B;  5J2T A;  3KZI Z;  1E1R G;  1VF6 A;  2QSA A;  2WSS G;  5LHI A;  4O4I B;  2GTS A;  5IWA B;  2Y48 A;  5JJN B;  4RUE A;  5CBH A;  4YJ2 A;  1Y74 A;  1U96 A;  1ZSP A;  3N2K B;  4CS2 A;  1SQG A;  4CS4 A;  1KB9 F;  3H1J H;  4PA7 A;  4TUY B;  1S77 D;  3UO2 A;  1EBO A;  1NS1 A;  4GKJ B;  1AP5 A;  2ZXW B;  1YJW V;  2Q6A A;  4JI0 O;  2JGD B;  3E22 A;  1FJG B;  1K73 W;  3EXA A;  4AQY B;  1SKV A;  3Q4H B;  2UUC O;  4CS3 A;  1ZLZ A;  4R7C A;  3ETG A;  5LYJ A;  1MSD A;  4CC6 A;  4FFB B;  5JJE B;  3DGE A;  1FFX B;  1QCE A;  2W6I G;  2IBZ H;  3JAL B;  1IZ3 A;  1L8D A;  2N04 A;  3CCJ V;  2VQE B;  3C3T A;  4LF4 B;  5BMV A;  5B1N A;  1SET A;  4JPR A;  4TQF A;  2XND G;  3UQ8 A;  3QG5 A;  1P7G A;  5J9P C;  4WF9 V;  2B5U A;  4PA3 A;  4PEL A;  2BTQ B;  2P6J A;  3S3W A;  4I9Q A;  3C3S A;  1YIJ V;  2W0X A;  4JI1 B;  3BFR A;  4JI4 B;  2UXD O;  4K8X A;  4X64 O;  2ODM A;  2XUM A;  1SQV H;  1YXB A;  3OT7 A;  3ABT A;  2XAH A;  4PI2 A;  2IU0 A;  3RGB A;  1TVK B;  3JAW B;  2GSM B;  1SC5 B;  1QLE C;  1NH2 B;  2ITD C;  4LFC B;  4JYY A;  2QWR B;  4LBE C;  4E2L A;  4DR3 O;  1VQK V;  1XMQ B;  2JS5 A;  3BA9 A;  4ZHQ B;  4DR5 O;  3CXC U;  3BCC H;  1W0K G;  1S5J A;  3SPG A;  1PPJ H;  1TUB A;  4WBN A;  1HR0 O;  2X6A A;  4JI2 B;  5JVD A;  1V54 C;  3P3N A;  3CP1 A;  1PV0 A;  3IJ4 A;  3JSN A;  4JF3 A;  3VQW A;  4TQD A;  1BHB A;  4XBF A;  2YI8 A;  2PGG A;  3OW2 U;  1BMF G;  3N2G A;  5LOV A;  1HDJ A;  1K5Q A;  2OCC B;  4BWA A;  3K5L A;  4F6E A;  5LYJ B;  3SPJ A;  1KKD A;  1N34 O;  3SPC A;  1K9M W;  3B4S A;  4BW5 A;  1PM9 A;  3VQV A;  1IXM A;  1N33 O;  2D3O W;  3IFX A;  1H38 A;  3JD0 A;  2CE4 A;  3SYQ A;  4NXM B;  5KHG A;  1MAB G;  3CRQ A;  1QR8 A;  1Q81 W;  4I9W A;  4YHH B;  2DWE C;  3JCU Z;  5C8Y B;  1BCC H;  1XOU A;  1YI2 V;  4HZ3 A;  4J7K A;  3UO3 A;  1COW G;  2Y69 C;  2A06 H;  2FML A;  5IDJ A;  3VBB A;  1LR1 A;  4JI3 B;  2ZE6 A;  2F1M A;  2MW2 B;  1VQ8 V;  3ZN1 A;  1HNX B;  2P5O A;  3ICX A;  2JRI A;  1Z2G A;  5IY5 C;  4X1K B;  1AR1 B;  1Q90 D;  4H44 B;  3ETD A;  4LF8 O;  2QTS A;  2QGN A;  2EIL C;  5IJ0 B;  2YS8 A;  5KMG B;  3SYP A;  1BE3 H;  4IGG A;  3OR6 C;  2QR4 A;  2HG5 C;  2M6Y A;  1ZWI C;  5B1A C;  3CXH F;  4UV8 A;  4U3J A;  5JQG B;  2Z5U A;  1W2B U;  5IYZ B;  1U97 A;  4G28 B;  3G6B A;  4I50 A;  4D7S A;  2BTO A;  1K3E A;  1NTZ H;  1FXK A;  2GUZ A;  1JJO A;  5EZY A;  1S3J A;  1R3I C;  3O65 A;  1XIL A;  4QIW F;  2ZD9 A;  4MVU A;  1VQM V;  2ZE5 A;  3M8A A;  4ZBM A;  1M93 A;  5KUM A;  2L35 A;  3IAY A;  1EN4 A;  2Q5Z A;  3J81 N;  4O2A B;  2FKX A;  3AG3 B;  3G6E V;  2FTK A;  4RQE A;  4O2B B;  3E86 A;  1IBM B;  1IBL B;  3K03 A;  1H8E G;  3R65 A;  1R1B A;  3K58 A;  4K35 A;  4JYA B;  2WA4 A;  1AR5 A;  4ZKI A;  1O9G A;  1Q6U A;  1M57 C;  4JAS A;  4DR6 O;  1K92 A;  3H1L H;  4PD4 F;  4UCR A;  3BEH A;  4F4L A;  3HKC B;  1EN5 A;  4EB6 B;  3K0D A;  5LA6 A;  4DV1 O;  4HNA B;  4DRX B;  1OCZ C;  1IXB A;  1QLE B;  2HP8 A;  4P30 A;  5BZB A;  5LGN A;  4RQF A;  5JWP A;  1Q82 W;  5KHJ A;  2NNU A;  3MHS C;  3T1Y O;  2Q7E A;  2HR3 A;  3ZIA G;  4X66 B;  2AW9 A;  2ADQ B;  4GYC B;  1EN6 A;  1IVS A;  4FK5 C;  4FMT A;  2UUB B;  1AI6 A;  3WG7 C;  2IJJ A;  3ZRX A;  2Y4U A;  2IJI A;  3RYH A;  4LWS A;  2YUA A;  4IT5 A;  3GB7 C;  3CSX A;  4X62 O;  1SQP H;  2V7Q G;  3CC2 V;  2EJ7 A;  1V55 C;  2NLJ C;  1WPB A;  2GUZ B;  3SYA A;  5FPR A;  1ZAU A;  3K79 A;  1GN2 A;  4YY3 B;  1IBK B;  1S76 D;  4PI0 A;  4X20 A;  1VF5 B;  1M56 B;  2Q4P A;  2P06 A;  1FS0 G;  1KP3 A;  2DYR C;  1KEC A;  5FLX N;  1NKD A;  4UFZ A;  2CH7 B;  2EIK C;  1QHT A;  2A7W A;  1TGO A;  5IYB O;  4KHP B;  2QKA A;  4EKW A;  5L3B A;  5EBL C;  4ABM A;  1L1F A;  1VQN V;  3TXS A;  4NXN B;  1BT8 A;  1X59 A;  3FD9 A;  2LJ2 A;  3ZN0 A;  2CGN A;  2Y69 B;  3P32 A;  4LF7 B;  4TV8 A;  2K9P A;  1VQO V;  2ILM A;  4JI7 O;  3JAT A;  2JGU A;  4H37 A;  1HP8 A;  1PD3 A;  1P4R A;  3AG4 C;  4JI8 O;  5KUK A;  3AK3 A;  1K8A W;  4CBC A;  2QWO B;  4UCV A;  2X6B A;  2UXN A;  2G38 A;  4CH6 A;  1JPX A;  4O4L B;  4ZIB A;  3U0Z A;  5IY5 B;  4QNH B;  3BRC A;  4BIU A;  3WB1 A;  5L3E A;  2EIL B;  4LF5 B;  3L71 H;  3H01 A;  2YDE A;  3F5W C;  4L87 A;  3CJH B;  4LFA B;  1X4T A;  2DW4 A;  3S3X A;  1V9P A;  3JAK B;  4B3R B;  3T4Z A;  4QJF B;  3CCE V;  2C2A A;  1XQ8 A;  5B1A B;  4GLX A;  3B8M A;  1BSM A;  3U10 A;  3CEI A;  4LC1 A;  3CWB H;  3DTU B;  2YID A;  2EIM C;  2QA4 V;  3WFV A;  2WLI A;  1SF9 A;  3E83 A;  3FB6 C;  3W7T A;  5JH7 A;  4QPK A;  4X9Q A;  1IUR A;  1VF6 C;  5DED A;  3MAQ A;  1HNW O;  5K1X A;  4LFB O;  1RFY A;  3DXR A;  3TCU A;  1NJI W;  1CEZ A;  5IE9 A;  1NTK H;  3K0G A;  2RQ6 A;  4B3S B;  4MTG A;  1Y76 A;  5B1B B;  1H2L A;  1K33 A;  3BAA A;  1M57 B;  4IHJ B;  1LUV A;  2OTL V;  3ZHV A;  1P49 A;  4PHZ A;  2HHH O;  1Y66 A;  4LF6 B;  3K59 A;  4ASU G;  3ZMZ A;  5KAF Z;  4I0X A;  2ZIO A;  1TUE B;  4JAU A;  4MS2 A;  5KHH A;  3H9V A;  1RSO A;  2ZM6 B;  1MA1 A;  3JAT B;  3CRR A;  2MK3 A;  1I94 O;  1OCZ B;  3FKS G;  3OFN G;  4W4K A;  3UT5 A;  3RYI A;  5KHI A;  2QKC A;  2QTO A;  3B09 A;  3SJB C;  1VF7 A;  3JAM N;  2KKW A;  3ABM C;  1FKA O;  4RWU A;  1MSW D;  1XUQ A;  4J10 A;  3RN4 A;  2JJ1 G;  3JYC A;  1N32 O;  2R70 A;  2UUC B;  3LDE A;  1AR4 A;  3TGU H;  4LF9 B;  2EBO A;  3WG7 B;  2AGA A;  3HKE A;  2R9R B;  3CHX A;  2P90 A;  1RPR A;  1AJN A;  1VAR A;  2WWW A;  1SZX A;  4P9P A;  1RM1 C;  3ABK C;  4D7T A;  3IC9 A;  5IJ9 A;  1VQ9 V;  4IIJ B;  3RYC A;  1R73 A;  3ZMV A;  5J2U B;  2IJH A;  3OGI B;  1R3K C;  2E5L O;  2H8P C;  2EZO A;  1W0J G;  1YEW A;  2CUG A;  3OUF A;  2YEV B;  3NR7 A;  4IYI A;  2Y0P A;  4JI6 O;  1ARO P;  4F6R B;  3B40 A;  1W59 A;  4JAA A;  3ZS8 C;  5LXT A;  4DV3 O;  2DOS A;  3RBZ A;  1WLE A;  2X0L A;  3L72 H;  4H0L B;  1ZL8 B;  3CCM V;  4DR1 O;  2DYR B;  1JFF A;  4J9Z B;  1N0J A;  4JZ2 A;  4WFF A;  3W7W A;  4DV4 O;  4LH7 A;  2ZNJ A;  4GX2 A;  5KAI Z;  4HBN A;  5EYP A;  3HKB A;  4O4H A;  3AG1 C;  3F7V C;  1JJ2 U;  1LNQ A;  2NR5 A;  2WLH A;  4DR5 B;  5LMU O;  1YF2 A;  1LUW A;  1BZK A;  5CA0 B;  4ZOL A;  4FLU A;  1HR0 B;  1GN4 A;  5D5Q A;  1RPO A;  1WA8 B;  1CXZ B;  1Z5W A;  3MD0 A;  1ORQ C;  4J80 A;  3AG4 B;  1ZX3 A;  2DYS C;  4JTA B;  3JCZ A;  1N36 O;  1Q86 W;  2PYJ A;  3W7S A;  4KFM A;  1E1Q G;  2ITC C;  4BIO A;  1BHA A;  1XNR O;  1PNK A;  3FB8 C;  1WNS A;  5DM6 V;  2PTM A;  1L0L H;  2YXL A;  3TK1 A;  5GON A;  3K5O A;  4DR7 O;  3L73 H;  3ASN B;  3OTO O;  1EFR G;  4FLW A;  3APQ A;  5HFM A;  2H3O A;  1N33 B;  4QPJ A;  4D6T H;  4OX9 O;  2HKO A;  1VQ4 V;  5KA5 A;  4ZI7 B;  4OPH A;  5EC2 C;  2PYL A;  5IWA O;  2EIM B;  4GUN A;  1M4U A;  5J2T B;  4C7U A;  2F93 B;  1AI7 A;  5EIB D;  3ZRW A;  4Z1M G;  2ZDI A;  3CX5 F;  2OTJ V;  4TWK A;  5B66 Z;  1WPX A;  3W7X A;  5CBF A;  1MZE A;  4EEQ A;  1WJZ A;  4YJ2 B;  1XHZ A;  1GMG A;  1Q5O A;  1Y74 B;  3I5D A;  1XRE A;  2F66 C;  3T1H B;  2RCV A;  1FXV A;  2OIE A;  4AQY O;  1OZ0 A;  3QNE A;  1D2D A;  3FAV A;  1I08 A;  2ZNI A;  3RFR A;  2BOC C;  1HW7 A;  4K3A A;  5LHG A;  4FJC C;  1GN6 A;  3E22 B;  3VQX A;  4FM0 A;  5LP6 A;  2VQE O;  1FXK C;  4LF8 B;  3KCY A;  2LW1 A;  2E3C A;  4GKK O;  1VEW A;  3CCQ V;  2P4K A;  1DTO A;  5L3C A;  2EX3 A;  3LNN A;  1AI4 A;  3T2M A;  2F4V O;  2E76 B;  1OJH A;  3T4D A;  4FPP A;  2ZIM A;  5BMV B;  4RO2 A;  3LUT B;  3HPL C;  4TV9 A;  2IU3 A;  4WFA V;  2HFE C;  5K1P A;  5EBW C;  5IYC O;  4LH6 A;  3ABM B;  3HKD A;  5H9C A;  1QVG U;  1KMI Z;  2HVK C;  2XHB A;  2EIN C;  3I55 V;  2XT9 A;  5CBG A;  1R3J C;  4LFC O;  5H6Q A;  2NN4 A;  1B6Q A;  2X6C A;  1XL6 A;  3H1H H;  2LP7 A;  1OHH G;  4FVM A;  4K8Z A;  3THO A;  4OPA A;  3CYO A;  2DJV A;  1RM1 B;  3ABK B;  3QO8 A;  2QM8 A;  4DV2 B;  2UXC O;  1AJP A;  3ZHS A;  3A8T A;  2VRZ A;  2IM9 A;  2M7W A;  3K08 A;  4UUJ C;  3K5N A;  1SA0 A;  3BHP A;  1NQT A;  4DR6 B;  3RT3 C;  1TUB B;  1VP7 A;  2X7R B;  4WBN B;  1OCR C;  3NXS A;  5JVD B;  3ABL C;  2AHY A;  2BSK A;  4DV1 B;  1XHX A;  1K5S A;  2QDO A;  5L3F A;  2VQF B;  5IYD O;  5E79 Z;  3FAV B;  3ZJZ A;  1IX9 A;  3T1Y B;  3SDL A;  3BY6 A;  3UM7 A;  4DR2 O;  1GO3 F;  3CE2 A;  3N2G B;  5LOV B;  2VS0 A;  1MOF A;  1GN3 A;  3AG1 B;  4E4E A;  2L6L A;  2QE7 G;  2P4V A;  3LNM B;  3D36 A;  2WPD G;  3JAS A;  1B3Q A;  2RN9 A;  4NXM O;  2CTQ A;  4I4T A;  3OD4 A;  4J42 A;  1KU9 A;  1D5N A;  1I7F A;  4DUY O;  3O9O A;  3BPZ A;  1Q3E A;  5EK0 A;  4B3M O;  2IJK A;  1J5E B;  4YHH O;  1BQ0 A;  1F51 A;  4NKG B;  1H2G A;  1NVP B;  3P30 A;  4NTY A;  4X62 B;  2HJF C;  2XOK G;  3QTC A;  3E8F A;  1BS3 A;  2O57 A;  3OE7 G;  4JYC A;  1YTF D;  4MW3 A;  2ATK C;  3ETQ A;  1H2M A;  4CH5 A;  1DLB A;  3SYO A;  3SGI A;  5CA1 A;  3AK2 A;  3K9S A;  5GW7 A;  4NTW A;  2OIG A;  4UVB A;  4G2K A;  1K7D A;  4JZG A;  3ETE A;  3JSL A;  3STZ C;  3AEI A;  4UV9 A;  2ZR3 A;  2P7T C;  4KUM A;  2RNB A;  3N27 A;  5JCO A;  2QEX V;  2KQX A;  2RMK B;  5B1O A;  4FLT A;  1M5I A;  2Q7G A;  1N0N A;  2KG7 A;  2JIZ G;  4DR4 B;  1V54 B;  3D3I A;  1K4D C;  4JI7 B;  3CPW U;  4U3J B;  3ZMS A;  5A9G A;  4DV7 O;  4JI8 B;  1KYO F;  3WB2 A;  2E75 B;  4DW0 A;  2CGO A;  4JI5 O;  2GBO A;  3RYF A;  4LNU A;  4ICG A;  4R8C A;  4I50 B;  1BQZ A;  3EVK A;  4CH4 A;  5H5N A;  1FXK B;  3DSQ A;  5EZY B;  5FL7 G;  2UUA O;  2AXT Z;  1M1K W;  2DN9 A;  1IBL O;  3GWO A;  1NT2 B;  3B2E E;  4KP4 A;  3CS5 A;  2LW7 A;  1QLN A;  1YJN V;  2UU9 B;  3UCS C;  3J7A U;  2AZ2 A;  4YIP A;  1NZ6 A;  2RJZ A;  4Q6G A;  1K4C C;  2WLM A;  2JVD A;  4GX1 A;  1PP9 H;  1YVW A;  5TIS Z;  1HNZ B;  3LSQ A;  5JJJ B;  5FNV A;  1HNW B;  1MNG A;  4X1I A;  4LFB B;  1QU7 A;  1F23 A;  2DE0 X;  2ZXW C;  1XL4 A;  5LA6 B;  1BL8 A;  4DXW A;  1Q7Y W;  3F7Y C;  4DV6 B;  5LHH A;  3OMN B;  1PKX A;  2ZT9 B;  4R50 A;  1YSC A;  5B3S C;  1RP3 B;  4K0K O;  4X89 A;  1SER A;  1TA8 A;  2CAZ C;  2YC0 A;  5LGT A;  3LSS A;  3SPH A;  2F43 G;  4DUZ B;  5ITZ A;  1GKF A;  4X1Y A;  1US6 A;  4DV5 O;  2HHH B;  1KKC A;  3E8H A;  1S5H C;  1OCR B;  3SJQ C;  3ABL B;  5EBM C;  1AVM A;  1DK1 A;  3RYH B;  5BR8 B;  4LWS B;  1I94 B;  3EFF K;  4J9Y B;  2ZQM A;  1YZB A;  5FPO A;  3IC7 A;  1KBH A;  2V4D A;  3BAB A;  4DV0 O;  2ETN A;  2PI4 A;  1AP6 A;  2ADP A;  1B04 A;  3ZRS A;  2QKS A;  4YY3 O;  4CZZ A;  3ZHU A;  1NH2 D;  3QF7 A;  1OV9 A;  1XMO O;  3JAR A;  1T5E A;  3ZMU A;  3CC7 V;  5CN0 A;  3G71 V;  2XAG A;  3ZHQ A;  1VQL V;  4PDL A;  1FAF A;  3OEE G;  4X20 B;  2OWO A;  3MHH C;  1AB3 A;  1H8H G;  4L8J A;  4JGS A;  4WFB V;  2Z3Y A;  4O4I A;  2YSU B;  1IDS A;  2LFS A;  2Q0A A;  4HAM A;  4LF7 O;  2E5L B;  3OMA B;  3N2K A;  3B77 A;  4UXN A;  4TUY A;  3DC5 A;  5FNV B;  4JTD B;  3ABU A;  4TV8 B;  1KUQ A;  2JGD A;  4DV3 B;  5L3G A;  2OCC C;  3OR7 C;  2ZCE A;  1KP2 A;  4KL1 A;  1JCH A;  3Q4H A;  4NB5 A;  3K3W A;  4I7Z B;  1PNL A;  4MTO A;  1JX9 A;  3H1I H;  2YXY A;  4DV4 B;  4XDJ A;  4JI0 B;  4BW9 A;  4LCU C;  2KB1 A;  3JAL A;  4MTX A;  2DQ3 A;  1GK9 A;  3K04 A;  2B1G A;  4PV1 B;  3G80 A;  4BIZ A;  1S0V A;  1FPO A;  1ROP A;  3W7U A;  2BTQ A;  4J11 A;  2DQ0 A;  4NTX A;  4DYL A;  1F4M A;  2HJD A;  1QR9 A;  4PJ0 Z;  1JVM A;  3AG7 A;  4LP8 A;  1EZV H;  4EFE A;  4UCO A;  1NR7 A;  3A0R A;  2WLI B;  4BAY A;  1FXH A;  2R72 A;  4B3T O;  5JH7 B;  3E8B A;  5KA6 A;  1ZUQ A;  3T1C A;  4QE7 A;  1V55 B;  3BA8 A;  1JQ0 A;  5DEC A;  1TVK A;  3JAW A;  4H33 A;  1G1X B;  3GWK C;  2DMX A;  3JD1 A;  1XNR B;  2UXD B;  2ZDI C;  2Q68 A;  4X64 B;  2JS3 A;  2N05 A;  3FFQ A;  3DXR B;  2YIB D;  1Y4M A;  2A0L A;  1EZJ A;  1GM9 A;  4PA6 A;  4NYK A;  1XNQ O;  2ZKO A;  4N21 A;  4P2Z A;  2A79 B;  3TET A;  3J80 N;  3QO7 A;  2GTA A;  3VOU A;  1AIL A;  3L9D A;  3ZED A;  4ZHQ A;  3OUS A;  3OTO B;  1J95 A;  2B9Z A;  1GM7 A;  1Y76 B;  2D2C B;  4OX9 B;  4N23 A;  4FM1 A;  4J7J A;  4LF6 O;  2YXH A;  1R3L C;  1E79 G;  1MG1 A;  2EIK B;  1TAE A;  1R6N A;  2CTW A;  4DR3 B;  2Y4T A;  4B08 A;  4MVZ A;  2ZM6 O;  5LP6 C;  4Z2W A;  4OGQ B;  1SES A;  3K06 A;  4NR1 A;  3SR2 C;  4MW8 A;  1HWY A;  2DWD C;  2JDI G;  4I0X B;  1Q43 A;  1SQB H;  4KXR A;  3CRC A;  1RSO B;  4MVR A;  1P84 F;  3E89 A;  1SQF A;  3UKM A;  4OXS A;  3UT5 B;  3RYI B;  5B3S B;  4WCE V;  4X65 O;  4JTC B;  2UXB O;  1Q6I A;  4LF9 O;  2P22 C;  2R9A A;  4JV5 O;  3CMA V;  1EM1 A;  4FZ1 A;  1VQP V;  5LMN O;  4RUF A;  1MMM A;  1NVP D;  2Q0O C;  4XDK A;  1XBL A;  5C93 A;  3SYC A;  4GKK B;  3AG3 C;  2BOB C;  1SZT A;  3HKE B;  2EJR A;  1N34 B;  3FYE B;  1MZF A;  4IL6 Z;  1PNM A;  1UJW B;  3HR0 A;  2F4V B;  3QVN A;  2YI9 A;  3JD3 A;  3L75 H;  2XAF A;  2N74 A;  2B1I A;  1QQC A;  5C8Y A;  5IJ9 B;  3KKY A;  3RYC B;  3ZBH A;  5LBQ A;  2QWP B;  4LR3 A;  4MVM A;  3A0H Z;  3KG2 A;  3AK1 A;  1KD1 W;  4I5S A;  1F7Y A;  3HB3 B;  4UVC A;  1H2S B;  3U11 A;  2JJ2 G;  4GKJ O;  1NBM G;  5EIB C;  1O9H A;  1GRJ A;  3OEH G;  4J41 A;  5LXT B;  3LSU A;  2PY5 A;  1GTO A;  5H2F Z;  1PL0 A;  2YIB A;  3SJA C;  1FJG O;  3G67 A;  2FL4 A;  5A2Q N;  2FB5 A;  4X1K A;  4O4J A;  2YIA A;  1M9N A;  1N4C A;  4UVA A;  1JFF B;  5IJ0 A;  5KHK A;  5KMG A;  5CA3 A;  4DK0 A;  1XDC A;  1JOY A;  2UXC B;  5EYP B;  1SQQ H;  2WLJ A;  3HKB B;  4O4H B;  1WB8 A;  1JMK C;  3IGA C;  4IYH A;  4LF4 O;  5EC1 C;  1GM8 A;  3D36 C;  5JQG A;  1KQS U;  3L70 H;  2PI5 A;  4Z1V A;  4UCU A;  4ZOL B;  5IYZ A;  3CD6 V;  1JR9 A;  4BR6 A;  4YIO A;  2EUL A;  2Q7H A;  1BGY H;  1VQ7 V;  3CCR V;  3KCX A;  4JAV A;  4JI1 O;  1WN7 A;  2CK3 G;  5KLV H;  4JI4 O;  3A0B Z;  2XTA A;  5GTH Z;  4Q20 A;  1ENV A;  4DR2 B;  3FYI B;  3QO5 A;  4I55 A;  2LGQ A;  4WFG A;  1M56 C;  4WFE A;  4O2A A;  2IW5 A;  1CP9 A;  4O2B A;  1THZ A;  5GON B;  1XMQ O;  3R66 A;  2A9H A;  3A2F A;  4DUY B;  1F4N A;  4B3M B;  3VQY A;  2VWK A;  5H6R A;  3WB0 A;  4PA4 A;  3HKC A;  4JI2 O;  5JCO C;  4EB6 A;  4DK1 A;  4YJ3 A;  1XEQ A;  1OCC C;  4WFH A;  2CTR A;  4HNA A;  4DRX A;  3T1H O;  3ZRW B;  4U3F H;  2RDC A;  2F95 B;  4W4L A;  4PDM A;  3DC6 A;  1S5L Z;  1AI5 A;  3D3Q A;  3TJT A;  1YCI A;  3FB7 C;  1VIB A;  5BY1 A;  3CRA A;  4FLX A;  2F23 A;  3OTF A;  2KSD A;  3L74 H;  4O4J B;  4FLZ A;  2AZ0 A;  2BE3 A;  2GDS A;  2QM7 A;  4XDL A;  3AG2 C;  4G27 B;  1GAX A;  5LP6 B;  2OYQ A;  4PDV A;  1FFT B;  1WB7 A;  2HLD G;  4DO2 A;  3H1K H;  3ASO C;  1QNM A;  2H94 A;  1S72 V;  2Q9L A;  4QE9 A;  2ZE7 A;  2LO1 A;  4MTF A;  2EIJ C;  4U7N A;  4UB6 Z;  3RWR D;  5B5E Z;  2FYU H;  2Q73 A;  2V1D A;  4MT8 A;  1K34 A;  3OM3 B;  1UFI A;  4DV7 B;  4GCZ A;  4TV9 B;  2DYS B;  4CC5 A;  5CB4 A;  1URF A;  4P9O A;  5E1A C;  3G4S V;  3HKD B;  4R6Z A;  2QJ1 A;  4JI5 B;  3E35 A;  2GHY A;  3SPI A;  2UXX A;  4X8A A;  2R9I A;  3CB2 A;  4JI3 O;  1L0N H;  4J7Z A;  4I55 B;  4EFB A;  5CMU A;  1I5Y A;  2UUA B;  1JA8 A;  2XAS A;  4DV2 O;  1HNX O;  5B1B C;  1VQ5 V;  2A3Q A;  2XAQ A;  2CH7 A;  3X2Q C;  1QBZ A;  2HVJ C;  4A5U B;  3ZMT A;  1I0H A;  3ZX6 A;  3CCU V;  4HYO A;  1FD9 A;  1XI1 A;  2PZS A;  2LGW A;  4MSW C;  4YJ3 B;  1AJQ A;  1OCO C;  1SA0 B;  3D8C A;  3C90 A;  2VQF O;  2YIC A;  2BCC H;  3LDC A;  4MVS A;  2ZIN A;  1CPY A;  4GX0 A;  1ZTE A;  3RW0 A;  2BSK B;  2ARH A;  4AIL C;  5D5P A;  4AI8 A;  5KX5 A;  4O4L A;  2LFR A;  4FIP C;  5DN6 G;  3STL C;  3BVO A;  3PJS K;  4FFK A;  1Y6X A;  3APO A;  5HFL A;  4K0K B;  4MVO A;  2QWQ B;  3ZRV A;  3CJH A;  3LDD A;  1KC8 W;  3E8G A;  1NR1 A;  4FLY A;  3JAK A;  3CCS V; 
#chains in the Genus database with same CATH homology
 2DYS C;  2LFS A;  4JTA B;  3JCZ A;  1N8R W;  1Q86 W;  1YIT V;  4HAM A;  4KFM A;  3W7S A;  3OMA B;  1E1Q G;  1VQ8 V;  3ZN1 A;  2ITC C;  1BHA A;  3B77 A;  1DF4 A;  4UXN A;  1K97 A;  5IY5 C;  4JTD B;  2W0F C;  1AR1 B;  1PNK A;  3ABU A;  3ETD A;  3FB8 C;  2EIL C;  2ZR2 A;  4U7O A;  5DM6 V;  3SYP A;  5L3G A;  1G4Y B;  2OT5 A;  3TK1 A;  3CME V;  2OCC C;  3E2E A;  3OR7 C;  1KP2 A;  4MVQ A;  1YHQ V;  3OR6 C;  1JCH A;  3ASN B;  3K3W A;  1PNL A;  4MTO A;  1EFR G;  3B8N A;  2HG5 C;  1JX9 A;  5HFM A;  1ZWI C;  2EIN B;  4QPJ A;  5B1A C;  4UV8 A;  4XDJ A;  2HKO A;  1VQ4 V;  5KA5 A;  4LCU C;  5EC2 C;  2Z5U A;  2KB1 A;  2EIM B;  1W2B U;  2IH1 C;  2AHZ A;  4MTX A;  4G28 B;  2DQ3 A;  1GK9 A;  3OGC C;  3K04 A;  2B1G A;  1AI7 A;  3ZCC A;  2IH3 C;  3ZRW A;  4Z1M G;  1K3E A;  2ZDI A;  2OTJ V;  1FXK A;  3M99 B;  4TWK A;  1WPX A;  4BIZ A;  1S0V A;  3W7X A;  5CBF A;  1ROP A;  1S3J A;  1R3I C;  1GMG A;  3W7U A;  4TT3 G;  4QIW F;  2ZD9 A;  4MVU A;  1VQM V;  2DQ0 A;  1F4M A;  3JD4 A;  1QR9 A;  4ZBM A;  1FXV A;  1JVM A;  4LP8 A;  1OZ0 A;  3QNE A;  5KUM A;  3CCV V;  1NR7 A;  3A0R A;  2WLI B;  4BAY A;  1YJ9 V;  1OCC B;  1FXH A;  2BOC C;  2Q67 A;  3AG3 B;  3E8B A;  2FTK A;  3T1C A;  5KA6 A;  4QE7 A;  1V55 B;  2W6J G;  4RQE A;  3G6E V;  3E86 A;  1JQ0 A;  4H33 A;  5LHG A;  4FJC C;  3K03 A;  1H8E G;  3R65 A;  3JD1 A;  2ZDI C;  2Q68 A;  4PDR A;  1FXK C;  4ZKI A;  3EHB B;  1Y4M A;  2A0L A;  1M57 C;  4JAS A;  1EZJ A;  1GM9 A;  2WLL A;  4PA6 A;  3CCQ V;  1DTO A;  4N21 A;  4GX5 A;  4P2Z A;  5L3C A;  2A79 B;  3RVZ A;  1K92 A;  3TET A;  3CC4 V;  3QO7 A;  3BEH A;  4F4L A;  1AI4 A;  3T2M A;  3VOU A;  3OUS A;  1J95 A;  3CCL V;  1GM7 A;  3K0D A;  3T4D A;  3AG2 B;  4FPP A;  4N23 A;  1R3L C;  1E79 G;  4RO2 A;  3LUT B;  3OMI B;  3HPL C;  1MG1 A;  2EIK B;  1OCZ C;  2WLN A;  1R6N A;  1QLE B;  2IU3 A;  4WFA V;  2HFE C;  4P30 A;  5BZB A;  5LGN A;  5EBW C;  5L3D A;  5IYC O;  4RQF A;  4MVZ A;  3ASN C;  3ABM B;  3ASO B;  1Q82 W;  5H9C A;  2NNU A;  1QVG U;  3MHS C;  2HVK C;  1M90 W;  2HR3 A;  2EIN C;  3ZIA G;  1SES A;  3K06 A;  4MW8 A;  3I55 V;  1HWY A;  2DWD C;  2JDI G;  5CBG A;  4X88 A;  2EIJ B;  1R3J C;  4FK5 C;  4MVR A;  4FMT A;  3E89 A;  3UKM A;  2YEV A;  5H6Q A;  4OXS A;  2X6C A;  1B6Q A;  1AI6 A;  1XL6 A;  2LP7 A;  1OHH G;  2IJJ A;  3WG7 C;  5B3S B;  4WCE V;  3ZRX A;  2IJI A;  3CYO A;  4JTC B;  1RM1 B;  3ABK B;  3QO8 A;  2QM8 A;  1DF5 A;  3CMA V;  1VQP V;  1AJP A;  3RVY A;  4TSF G;  3GB7 C;  4RUF A;  4YXW G;  1NVP D;  4XDK A;  1YTF B;  2JEX A;  2M7W A;  2V7Q G;  3K08 A;  4UUJ C;  3CC2 V;  5C93 A;  3SYC A;  3AG3 C;  1NQT A;  1SZT A;  2BOB C;  3FB5 C;  1V55 C;  1R6K A;  3X2Q B;  2EJR A;  3OAA G;  2NLJ C;  2X7R B;  3FYE B;  3SYA A;  1PNM A;  1UJW B;  1OCR C;  3NXS A;  3I56 V;  2K1E A;  3JD3 A;  3ABL C;  2AHY A;  2WLK A;  2XAF A;  3K79 A;  2EZP A;  2B1I A;  1I5X A;  1K5S A;  1S76 D;  5L3F A;  5IYD O;  5LBQ A;  3ZJZ A;  1OCO B;  4MVM A;  1M56 B;  1FS0 G;  1KP3 A;  3KG2 A;  2DYR C;  2XAJ A;  3ML0 A;  3BY6 A;  1P7B A;  4I5S A;  1KEC A;  3UM7 A;  1GO3 F;  1NKD A;  1KD1 W;  3K9A A;  1MOF A;  2EIK C;  3AG1 B;  3HB3 B;  4UVC A;  4JYB A;  2QE7 G;  5IYB O;  2JJ2 G;  3LNM B;  4EKW A;  5L3B A;  5EBL C;  1NBM G;  3D36 A;  2WLL B;  2WPD G;  1L1F A;  1VQN V;  3OEH G;  5LGU A;  1GTO A;  1PL0 A;  3JD2 A;  3ZN0 A;  1M9N A;  4UVA A;  1G8M A;  2JK5 C;  2Y69 B;  3P32 A;  5EK0 A;  2IJK A;  2WAM A;  5CA3 A;  1VQO V;  4H37 A;  1PD3 A;  1F51 A;  1QVF U;  1JOY A;  2P67 A;  1H2G A;  3AG4 C;  1P4R A;  1NVP B;  3P30 A;  4RAI A;  5KUK A;  2WLJ A;  1K8A W;  2JEU A;  4CBC A;  2HJF C;  4PA9 A;  3IGA C;  2XOK G;  3E8F A;  5EC1 C;  1GM8 A;  2X6B A;  1SRY A;  2UXN A;  1JPX A;  3OE7 G;  4JYC A;  1YTF D;  1KQS U;  4MW3 A;  5IY5 B;  2PI5 A;  4QNH B;  2Q69 A;  1VQ6 V;  2ATK C;  4GT1 A;  4BIU A;  3CD6 V;  5L3E A;  1DLB A;  2EIL B;  3SYO A;  1E1R G;  5GW7 A;  3H01 A;  3F5W C;  4L87 A;  2DW4 A;  2WSS G;  5LHI A;  4UVB A;  1VQ7 V;  4G2K A;  1K7D A;  4JAV A;  3CCR V;  3T4Z A;  2Y48 A;  2CK3 G;  4QJF B;  3CCE V;  2C2A A;  3ETE A;  4RUE A;  3STZ C;  3AEI A;  5CBH A;  4UV9 A;  2ZR3 A;  5B1A B;  4Q20 A;  3B8M A;  1ENV A;  2P7T C;  4KUM A;  3FYI B;  4PA7 A;  4LC1 A;  1S77 D;  3DTU B;  2QEX V;  2EIM C;  5B1O A;  2QA4 V;  3WFV A;  2WLI A;  3QO5 A;  1EBO A;  3E83 A;  3FB6 C;  4WFG A;  3W7T A;  1M56 C;  2ZXW B;  4WFE A;  2IW5 A;  1YJW V;  2Q6A A;  4QPK A;  1CP9 A;  1THZ A;  1K73 W;  2JIZ G;  2A9H A;  1V54 B;  3D3I A;  1K4D C;  1F4N A;  4R7C A;  3ETG A;  3TCU A;  3CPW U;  1NJI W;  1CEZ A;  3ZMS A;  3DGE A;  5H6R A;  1QCE A;  2W6I G;  3K0G A;  4PA4 A;  3CCJ V;  4MTG A;  1OCC C;  5B1B B;  4WFH A;  1K33 A;  5B1N A;  1SET A;  4R8C A;  4JPR A;  3ZRW B;  2XND G;  4PDM A;  1FXK B;  1AI5 A;  5J9P C;  4WF9 V;  5FL7 G;  1M57 B;  2B5U A;  4PA3 A;  3FB7 C;  2OTL V;  4PEL A;  1M1K W;  2P6J A;  1Y66 A;  4ASU G;  3ZMZ A;  3GWO A;  1YIJ V;  4KP4 A;  1TUE B;  4JAU A;  4MS2 A;  1QLN A;  3ABT A;  2MK3 A;  2QM7 A;  2XAH A;  4XDL A;  1OCZ B;  3FKS G;  3OFN G;  2IU0 A;  3AG2 C;  1YJN V;  4G27 B;  2QTO A;  2GSM B;  1QLE C;  4PDV A;  1FFT B;  1K4C C;  2WLM A;  2HLD G;  1NH2 B;  4DO2 A;  2ITD C;  3ABM C;  3ASO C;  1MSW D;  4GX1 A;  2H94 A;  1S72 V;  4LBE C;  4QE9 A;  4E2L A;  1VQK V;  3LSQ A;  2JJ1 G;  3JYC A;  4MTF A;  3LDE A;  2EIJ C;  1F23 A;  4U7N A;  3CXC U;  1W0K G;  1XL4 A;  2V1D A;  2ZXW C;  4MT8 A;  2EBO A;  1BL8 A;  1K34 A;  3OM3 B;  3SPG A;  3WG7 B;  4DXW A;  1Q7Y W;  3F7Y C;  5LHH A;  4GCZ A;  3OMN B;  2DYS B;  2R9R B;  1PKX A;  2P90 A;  2X6A A;  4P9O A;  4R50 A;  5B3S C;  1YSC A;  5E1A C;  3G4S V;  1RPR A;  1V54 C;  3CP1 A;  1AJN A;  2WWW A;  4R6Z A;  4X89 A;  1SER A;  3E35 A;  4P9P A;  2GHY A;  3ABK C;  1RM1 C;  3SPI A;  2UXX A;  1VQ9 V;  4JF3 A;  4X8A A;  1R73 A;  3ZMV A;  2R9I A;  2IJH A;  5LGT A;  3LSS A;  3SPH A;  5CMU A;  1BHB A;  4XBF A;  1I5Y A;  2F43 G;  1R3K C;  1GKF A;  2XAS A;  2H8P C;  2EZO A;  1W0J G;  3OW2 U;  1BMF G;  5B1B C;  3E8H A;  2YEV B;  3OUF A;  2XAQ A;  1S5H C;  1K5Q A;  2OCC B;  1VQ5 V;  1OCR B;  3SJQ C;  3X2Q C;  1QBZ A;  3ABL B;  5EBM C;  2HVJ C;  1ARO P;  3ZMT A;  3EFF K;  4J9Y B;  3SPJ A;  2ZQM A;  3CCU V;  4HYO A;  3RBZ A;  1KKD A;  3SPC A;  1K9M W;  1WLE A;  2X0L A;  3IC7 A;  3CCM V;  2DYR B;  4MSW C;  4BW5 A;  2PI4 A;  1AJQ A;  1OCO C;  1IXM A;  3ZRS A;  4J9Z B;  4WFF A;  2D3O W;  2QKS A;  3IFX A;  3W7W A;  1H38 A;  4CZZ A;  4GX2 A;  3JD0 A;  1NH2 D;  3SYQ A;  1MAB G;  3AG1 C;  3LDC A;  4MVS A;  3F7V C;  1JJ2 U;  1LNQ A;  1CPY A;  2WLH A;  1QR8 A;  4GX0 A;  3ZMU A;  3CC7 V;  1Q81 W;  5CN0 A;  4I9W A;  3RW0 A;  3G71 V;  2XAG A;  1VQL V;  4PDL A;  3OEE G;  2DWE C;  2LFR A;  4FIP C;  5DN6 G;  3STL C;  3PJS K;  1RPO A;  3MD0 A;  1YI2 V;  5HFL A;  4HZ3 A;  3MHH C;  1ORQ C;  4MVO A;  1H8H G;  3ZRV A;  1COW G;  2Y69 C;  3LDD A;  1KC8 W;  3E8G A;  4JGS A;  3AG4 B;  1NR1 A;  3VBB A;  2Z3Y A;  5IDJ A;  4WFB V;  3CCS V;  2YSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...