4N2QA

Crystal structure of tha8 in complex with zm4 rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Splicing/rna
molecule keywords THA8 RNA binding protein
total genus 69
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n2qA00
2MHKA 3RO2A 5FT9A 2FBNA 4APOA 3QWWA 4WNDA 3VTXA 4CGVA 5LCWC 5FZRA 3GYZA 4HOUA 2JLBA 1NA0A 2VSNA 3GZ1A 5C1DA 3LYAA 4XI9A 4GCOA 3CK9A 3MKRA 1OUVA 4IN3B 4HOSA 2AVPA 2KATA 2VYIA 1YA0A 3ASHA 3ULQA 3OXFA 4G26A 1XNFA 3ZHEA 5KJMA 3Q15A 3CVNA 3CVQA 3CVPA 2V5FA 3N71A 4GA1A 4J0UA 4Y6WA 3OXLA 4J8DA 4J8EA 4N3CA 4UQZA 4G2VA 3ZN3A 5A6CA 2YQ8A 2LSUA 2VGXB 3CKCA 1NZNA 4N3BA 1HXIA 4CDRA 5LCWJ 1QZ2A 3FWVA 4H7XA 4N39A 1ZU2A 4W9RA 4A1SA 3ASDA 3MEKA 4XIFA 3LPZA 4I17A 3RJVA 4G24A 4YVOA 1WAO1 3TG5A 2PZIA 2UWJG 2VSYA 2VGXA 2XCBA 5FZQA 4F3VA 4CGWA 3Q4AB 3GZ2A 4RG6A 4BT9A 2GW1A 4KBQA 5EX0A 4ME2A 5A7DB 3Q49B 4NRHB 4U04A 5ARGA 5CCMA 3Q5MA 3WXXA 3FP3A 3QWPA 2WQHA 2OOEA 2FO7A 3RIBA 4AM9A 1ZBPA 2PQNA 2XEVA 3ZFWA 2E2EA 3IEGA 4UI9J 3UQ3A 2XGOA 3KD7A 5JJ7A 3UPVA 5M72A 5G04J 3RO3A 4UI9C 3MV2B 4N2SA 1IHGA 4I9EA 1HH8A 1IYGA 3AS8A 4HOQA 2VQ2A 1KT1A 5G05C 4GZ3A 1ELRA 3CK8A 4G25A 4I2ZA 1WM5A 1TJCA 4JHRA 4GZ6A 4AY5A 2IFUA 1Y8MA 3LY7A 2YHCA 3SF4A 2Y4TA 3QKYA 3NF1A 4UQXA 4ABNA 4I2WA 4YVQC 3VTYA 3ZPJA 3LY8A 1FCHA 3FFLA 2IF4A 4GCNA 3S7BA 3UUXA 3MA5A 2QFCA 2HR2A 4GPKA 4HORA 4U07A 2HYZA 4JA9A 2Q7FA 5D0QD 2KC7A 2R5SA 2C0LA 2ONDA 2P58C 4J8FA 2NC9A 2UY1A 4JA7A 4RG9A 4UQYA 3OXGA 4U0ZA 3QDNA 4B94A 4EQFA 3QWVA 1PC2A 3RU0A 2LNIA 4U0SA 1W3BA 2C2LA 1KT0A 3AS4A 3CV0A 3HYMB 4WNEA 5ARFA 3MV3B 5KJKA 3Q47B 2C0MA 3JYSA 3TG4A 1ELWA 3ZHEB 2VGYA 5KJLA 5CHEE 1HZ4A 3PDNA 3PE4A 4YNDA 3CEQA 5KJNA 2I6HA 1B89A 3RKVA 2LSVA 2XGMA 2Y4UA 5BW8C 4XI0A 5EKQD 4N2QA 2PQRA 4KXKB 4WUYA 3S7JA 2XGSA 1KLXA 5HI7A 2BUGA 1P5QA 3ASGA 4JL0A 5AYWD 2FF4A 4GYYA 3GW4A 5G04C 4I1AA 2KCLA 4O6FA 4WNGA 3TAXA 2FI7A 1QQEA 4G23A 4Y6CA 2XPIA 2KCKA 3K9IA 3LY9A 4GA2A 4I9CA 3CVLA 4NQ0A 4U0UA 2FEZA 2HO1A 4H7YA 2KCVA 5CCLA 4BWRA 3EDTB 5JJTA 2XCCA 4KYOB 3O48A 4LEUA 5EX3A 5G05J 3CKBA 3S7DA 2UY1B 2WPVA 4BTAA 3AS5A 3ASFA 3PE3A 3ESKA 3S7FA 4BTBA 3U3WA 4AY6A 3KS2A 1NA3A 3LKUA 4GA0A 3BEEA 4BT8A 3TGOA 3ZGQA 1E96B 4GZ5A 5BNWA 5DIZA 5FZSA 3URZA 3LCAA 4GYOA 5BT1A 3SZ7A 3QOUA 3KAEA 4WNFA 3R9AB 4GYWA 3U4TA 3E4BA 5FTPA 5D0OD 5FJYA 2L6JA 4N5CA 5DBKA 4AIFA 4G1TA 5HQ8A 4N3AA 2J9QA 5JJ6A 1A17A 4HOTA 4UI9K 2PL2A 2DBAA 3CK7A
chains in the Genus database with same CATH superfamily
3FY4A 4APFA 5AENA 2CHWA 3C5RA 1DNPA 2R2LA 5ENSD 4DLQA 3OTNA 5D66A 3SD5A 1HXIA 3PVLA 1LD8A 3E34A 5D2MC 1MQSA 1S0PA 4G24A 1NP7A 2F8XK 4TRQA 4BT9A 4J8SA 3Q49B 4NRHB 1N94A 3LJ3A 3PH0C 1U3DA 4LERA 3UPVA 4URKA 4I1MA 3MV2B 1X81A 1KT1A 3AG2E 3B13A 2P9LG 3LY7A 1DVPA 3FH5A 1N4RA 4YVQC 1O1TA 3JQ0A 3FTSA 3RU0A 1JCSA 4WNEA 3LDZA 4GTQA 2PM7A 3PZ2A 2VGEA 4CDNA 4PS7A 1DCQA 1HU3A 4JL0A 2ILRA 2FF4A 2HO1A 2WXKA 5JJTA 3VLFA 2KBXA 5FQ4A 2UY1B 1TN6A 3AS5A 1N54A 3LVRE 4E85A 5D0OD 4XE0A 1H19A 5EN5D 2IOLA 4N5QA 3PREA 2DBAA 4FHKA 1V54E 3QWWA 4A3VA 2V4LA 3G2TA 5FZRA 4F7AA 2JLBA 2VSNA 2QY7A 4K0RA 1X5BA 4Y6WA 1H6OA 1TYQG 3MKQB 3ZRHA 4UUCA 3RRMB 4HVBA 1UG3A 2XCBA 4Q96A 3PEVB 3HG0D 3IHYA 5HS0A 3UIPC 5EYPF 4CYMD 5KWDA 4UI9C 4U7EB 2OEWA 3BU8A 5AARA 1IQRA 4J6IA 4DLOA 4PS3A 1N0QA 4WWNA 2GGFA 3UX4A 3CHQA 4HORA 2R5SA 1JCQA 4JA7A 3Q9UC 2C0MA 1KPSB 3TG4A 1MZCA 2I6HA 4PH4B 2RFMA 5CRVA 2XGSA 4Z68A 5G04C 4HRNA 3PZDA 4E6HA 4YDEA 3TL5A 4KYOB 4DUIA 2XEEA 1JUQA 3C98A 4K5CA 1E8YA 5DIZA 5B1BE 5LP0A 3PZ4A 4BSXA 4GYWA 3AAAC 2L6JA 2B0OE 1S70B 2LAIA 2CHXA 3VTXA 4LSZE 3UKRG 1N95A 3FULA 3FTXA 3Q9NC 5CBNA 2AVPA 1YA0A 1MX4A 3EHQA 1UN9A 4EBAG 3W9FA 5BV1A 1SZAA 3ENEA 3FHEA 3MCXA 5LOZA 4N3BA 1TNOA 1MX6A 4M3OA 4AXHA 3FTWA 3TG5A 2VJ8A 3SGHA 1E7VA 4J8YA 4B8AA 3TWVA 2EINE 3MGBA 3SFXA 2NSZA 1HS6A 3UT4A 3FUIA 2ZGGA 4L2LA 1WM5A 4AY5A 5CEDB 3APDA 5KBAA 3UTMA 2CFZA 1E8ZA 4FU3A 2P9UG 4L2YA 1TJFA 3L13A 2VGYA 3CVUA 2LSVA 4O1PA 4YDWA 1BLXB 4AEZC 4O6FA 2KCLA 5B1AE 2OV8A 4F6RD 5KJKA 3FTUA 4BEPA 3C3RA 4AY6A 3KS2A 1HG5A 4GA0A 3TWWA 3BEEA 1SW6A 1BU9A 3ZGQA 4C48B 3G2VA 3DWLG 4KMOA 4C0EA 2X38A 3T5XA 5BPPA 4XKBA 1A17A 2Y69E 1K1AA 4ATGA 1UJKA 4CDMA 1V55E 3CVWA 2EIKE 2IQCA 3DPDA 2VYIA 3AU5A 1JCRA 1XNFA 5KJMA 4DI4A 1OXJA 4AVXA 4Q69A 3NBNB 2X6JA 4JHKA 2YQ8A 2R03A 2VGXB 3ISMC 3CHPA 3FU6A 3LPZA 4UWHA 4U63A 5EIDA 4F3VA 3QJZA 3QARA 4CZ2D 2WB2A 2NYJA 3HDXA 3WXXA 4NIKA 3G2UA 5CCMA 2A4ZA 5CERB 2XGOA 3ONKA 4N2SA 2A5UA 4HOQA 1AWCB 1TJCA 4JHRA 1S64A 3FUNA 3TXMA 3VLDA 3UUXA 4RVBA 4JA9A 2P9SG 4XEIG 3SQVA 4JW1A 1IKND 4EQFA 3ZYQA 3PE4A 1GW6A 2XZDG 5ENTD 4WNGA 2KCKA 1K8KG 4I9CA 2FEZA 5J08A 1Z3XA 3SNXA 4I6EA 5AQBA 1WG0A 4GZ5A 4UWLA 5T8IA 1H2UA 1O1SA 3E4BA 3F6QA 1U2VG 4LNUD 1JWFA 3QWVA 1FT1A 3QC1A 1DC2A 2X6FA 1Q2ZA 2IO3C 2RD0A 1K1BA 5AQ7A 3L6AA 3EHMA 5BUZA 3N71A 4C9BB 4RLYA 5AQ9A 2WMNA 2KZTB 2AXVA 1MX2A 3MEKA 3BG0B 3R7RA 2RG8A 3JUIA 1O1RA 5CEAA 3LXUX 3U9WA 3CHOA 2OOEA 3RIBA 3SFYA 4A55A 1NL4A 4PUCA 5JJ7A 4RQIA 5H7PA 1IHGA 5KCMA 3T8MA 1EF1C 3SY2A 2V5QC 3QB2A 2QZAA 4BETA 2V4HC 2DYRE 3VTYA 3QK0A 3LY8A 1FCHA 4BX9A 2ETBA 2QFCA 4CRWA 2J4DA 2C0LA 4U0ZA 1BI7B 4CT4A 1SQMA 2IJGX 2DIWA 3AS4A 2P9PG 3HXDA 4AV7A 1HFAA 3EHNA 4XI0A 4WUYA 2DZNA 3ML8A 5BXUA 2FI7A 3U66A 1DCEA 3JQ1A 3S7FA 3PE3A 3ESKA 4JZYA 3L9TA 2MOWA 5BNWA 5AJLA 5CMWA 3X2QE 5FJYA 3EHRA 3J5QB 2WXJA 4F1SA 3ABME 5KNGA 4KZCA 1N4QA 2M63A 2FULA 4LNBA 1UW4B 5IY5E 3TWUA 3NQPA 4ILHB 1OWLA 1KZOA 3QAQA 3UMVA 3CHSA 4JVSA 2ETCA 1HO8A 2CFUA 2GRPB 4HXIA 1WY6A 5G2NA 2Y0BG 2GRLA 1KZPA 4FA6A 5M72A 4KVMA 3SO8A 1SA5A 3T9KA 1MYOA 4ZHBA 3ZUVB 3UM2A 3PZ1A 3ZKJA 4A3TA 1LF8A 1NFIE 2XENA 3T8KA 1TNYA 1PC2A 2DYSE 1W3BA 1TN8A 3AJIA 5KJLA 5HKPA 4OAUC 3MX3A 2J09A 2AXZA 3GW4A 4K5AB 2XCCA 3FU3A 2GRNB 3U3WA 1E96B 3C3OA 4EZKA 3SZ7A 2J8SD 5HQ8A 2R02A 3BUAA 2LO6A 4A63B 2XEHA 4LUNU 2L0TB 3L08A 3CK9A 3TWSA 4DK5A 2X3MA 2ZU6B 3FTYA 4GTTA 2V5FA 2LXMA 3OAWA 1INZA 4N3CA 4G2VA 4TUUA 2VTBA 1NZNA 4G11A 1UJJA 4U95D 2GRQB 1EDUA 2PZIA 2UWJG 2YNQA 4RG6A 2WXRA 2DWZA 4ME2A 4U04A 3D9JA 4JD2G 3D9LA 2R05A 3ULYA 3FTZA 3CHMA 4I9EA 4JC8A 3ZXPA 3ABKE 1EPUA 1IYGA 2Y1LE 4GZ3A 1ELRA 3Q75A 3Q7AA 1MJ0A 1LD7A 1TNZA 3UT7A 2IY0C 1Z3YA 3NB2A 2P58C 2UY1A 3OXGA 3QDNA 3FUMA 4HQDA 3HIZA 4DI3A 3V30A 3ZHEB 3JYSA 4BSZB 2L0IA 3RKVA 5AJDA 1Z5SC 2LAHA 3L17A 4KXKB 4AJWA 2H6FA 4M7CA 4BY6A 3O4ZA 2KCVA 2J4BA 3PZ3A 4OAVB 2CHZA 2B6CA 3LKUA 4FP7A 2XHEA 4BX8A 5C2YA 4V3IA 5BT1A 4GYOA 3W9GA 3FDHA 4LRZA 5JJ6A 3V2OA 4GMJA 2EQXA 5ENPD 4APOA 4WNDA 3B7TA 4HRMB 1OUVA 4MS6A 4TV3A 3CLJA 4EECA 3CVQA 1N4SA 4GTPA 3UT8A 5JHAA 2KXPC 4K5BA 3EU9A 4W9RA 4CT0A 4XIFA 3DPYA 5FZQA 3Q4AB 5EYLA 3PRZA 2P9IG 2R17C 3R9MA 5G04J 1RW2A 5EILA 5G05C 2PNNA 3LS8A 1PAQA 4GZ6A 2IFUA 4PDXA 2KZTA 2YHCA 3NF1A 3Q73A 4GCNA 2OCCE 4CCAA 3UKUG 2ETAA 3HXEA 4ATZD 4DX5D 3APCA 5ITZF 4B94A 3B7UX 3ZVVA 4U0SA 3ZIMA 2NXPA 4I6GA 4YNDA 3I4GA 3CIAA 5HI7A 1KLXA 5FIOA 3C72A 3K9IA 2VTBB 4JEUA 3BQOA 1IXVA 4JEHA 1G3NB 1PY1A 3V79K 3URZA 3FUJA 4Q94A 2J07A 4UWKA 1OT8A 3U64A 3UM3A 4EPZA 3NOGD 2P9NG 2CG3A 4J7WA 4NURA 1L5JA 2BF0X 3LYAA 3ULQA 3APFA 3V2XA 3LVQE 3CVNA 1HX8A 4FLHA 3L82A 3B7RL 5LCWJ 4G8LA 3T5VA 2IEJA 4CGWA 3HXFA 2GW1A 5ARGA 1JWGA 2XEVA 3ZFWA 3UQ3A 3UIOC 2XS1A 5FQ7A 2QYJA 3JXJA 4FLBA 4GU5A 3CVVA 1SVXA 3FEYA 1OCZE 4IYPA 4ANVA 4J8FA 2EILE 2MRIA 1ZB1A 5CRUA 3HYMB 2WVIA 2XQ0A 1JPLA 3DEOA 1B89A 5AQAA 2PQRA 3CVXA 3P2BA 2EIJE 3HVEA 4HB5A 3Q78A 2J49A 5BV0A 4GTSA 3FUKA 3ML9A 3ASFA 4HNAD 1NI1A 3Q7FA 4BT8A 4XZ4A 4DX7D 3PUJA 3IBEA 4A1GA 4GTVA 2EIME 2WXHA 2FBNA 3ABLE 4TXPA 1H6KA 1TEZA 5C1DA 4IN3B 1QNFA 3OXFA 4OVUA 2DVWA 3ZN3A 3FTVA 1XGWA 3CSTA 3PNLB 3RJVA 1HG2A 3ASNE 4LNGA 3D9NA 1BD8A 4F1PA 3FUDA 2WQHA 2FO7A 4AM9A 3ZYKA 4UI9J 2L6BA 3EIQC 3AS8A 3ONLA 2VQ2A 3AG3E 4DX6D 5JHBA 3QKYA 1FVFA 3IXEA 2PM6A 3S7BA 4GPKA 3WG7E 2Q7FA 5D0QD 4GB9A 5AIJA 4JPSA 4C0MA 2DCPA 4I1AA 1TR4A 2DZOA 2F8YA 3LY9A 2GRMA 4LEUA 3R7QA 4N2QA 3DSTA 2LUHA 5E76A 1TN7A 3QNKA 2Y3AA 2ZIRA 3R9AB 1QBQA 4X8QA 2GRRB 4U96D 4BWRA 2MHKA 1NA0A 2HM8A 2MYOA 2WXGA 3GZ1A 5AN8A 1BI8B 4KZ0A 3ASHA 4NACA 3OXLA 1VDYA 4J8DA 4UQZA 3I4RB 4CDRA 3ZEFA 3FWVA 4ILGA 4P29A 3FUFA 3EIJA 2I9CA 3P1UA 4GAAA 4L7TA 3E37A 2P9KG 2V0PA 3UM1A 3BG1B 3NZSA 3E33A 3EJNA 2WXLA 4BESA 3CQCB 3RSEG 3MA5A 1MHQA 3RAUA 5LX8A 1N11A 2XPZA 2C2LA 3DXKG 2ZISA 3MYVA 3AU4A 5KJNA 2ZXWE 3CSFA 3IKOB 3SHFA 2WXPA 1QQEA 4I6JA 4NQ0A 3ASOE 4K03A 1IHBA 5CCLA 4H7YA 4TUMA 4BTAA 4ZFHA 1D8DA 2HE0A 3FU0A 4OYSA 3TGOA 3B7SA 4JHJA 2WXFA 3LCAA 3JXIA 4FHJA 4U8HA 3KAEA 4GPMA 3LJNA 4G23A 4Y6CA 3MJWA 3TJPA 4G8KA 2H6HA 2X6KA 4XI9A 4IULA 5ANLA 2AJAA 4YDYA 2KATA 4WAFA 3CVPA 3TWXA 3NZUA 1FT2A 5A6CA 5EDSA 1LTXA 2YINA 1QZ2A 3CHRA 3D9KA 4DX2A 2IO2C 3RRUA 2KM4A 2VGXA 4FJYA 4O1OA 5EX0A 5A7DB 4HS2A 3SBSA 4U8VD 2E2EA 2WMOA 4LCTA 5KNHD 1OWNA 4B8CB 4R7LA 2H6GA 3B95A 4GZCA 1Y8MA 1ELKA 4WWOA 3ZW3A 3SI5A 3FFLA 2QC9A 1N9AA 1H0AA 2BTDA 2XS8A 3MKQA 5B3SE 4GZDA 1OCOE 4I43A 5ENNA 2QYUA 3CV0A 1OY3D 3ZYLA 3Q47B 3EU5A 1OWOA 5CHEE 3D9OA 3FUEA 3JCKC 2XGMA 1A5EA 2L9BA 4ILIA 4ACLA 4IRUA 5T4YA 2J08A 1O5MA 2AWIA 4EZLA 3CVLA 5FINA 4FJZA 4L23A 3EDTB 5G05J 1SA4A 3UXGA 1OWPA 3S2AA 5JMND 4O60A 4DPRA 5FZSA 2OEVA 3C3QA 4MKTA 4WNFA 4AIFA 2J9QA 3KEAA 3CK7A 3RO2A 4CGVA 1FPPA 4RSYA 4XKCA 4KVOA 4TXQA 3HVEB 5CBOA 4GCOA 3MKRA 3FH7A 4G26A 3ZHEA 3Q15A 4GA1A 5JA4D 3DSSA 4ANWA 3E30A 4H7XA 4N39A 4A1SA 2BEDA 4DJAA 4YVOA 3PNTB 4OVVA 4UWFA 4XX5A 3NAWA 2I2OA 3D9HA 3IV0A 2RKKA 2I1KA 1HH8A 3HHMA 3CVYA 3CGHA 2Y4TA 4FADA 4FULA 3D3MA 3KSLA 2F0YA 4UQYA 4ANUA 4UWGA 1HF8A 4ABNA 4EBAA 1ELWA 3ZXSA 3PDNA 1TNBA 2Y4UA 3MZLB 5EKQD 2X6HA 5AYWD 4GMRA 3PUKA 5BXOA 3TAXA 2XPIA 1EYHA 5ENQD 2E0IA 3I3NA 3FH8A 1U3CA 2JEKA 5CECB 3U4TA 3UI2A 4UI9K 4HFGA 2XZTG 5ENRD 5LCWC 4KT6B 4FC8A 3CR3A 1K3ZD 3E32A 3JUEA 3CKCA 4ANXA 3ASDA 5AAOA 4I17A 4BFRA 2VSYA 2ZGDA 4I1OB 2GROB 2VSXE 3L22A 2IU1A 5E75A 3G2SA 3Q5MA 3QWPA 3B7BA 1Y6IA 3RO3A 1UN8A 5FQ8A 3DRAA 2WQ7A 2F37A 3CK8A 4G25A 1D8EA 4MLPA 3SBTB 2WQ6A 1FVHA 2H6IA 1H2VC 4HI9A 2OVBA 5ANRA 3EUVA 3D9PA 1E8WA 2OVFA 4GTMA 5FQ6A 1YMPA 3DSUA 3MV3B 3D9IA 1HZ4A 3CEQA 1QYMA 4B0ZA 1P5QA 3ASGA 4AOFA 1Z6TA 4GA2A 4EZJA 4B89A 1H6PA 4HLLA 3S7DA 2WPVA 1NA3A 2FO1E 4WWPA 3ZYMA 3Q79A 2WXNA 1S63A 3RK6A 4HOTA 2VSOE 2PL2A 3KEZA 3HXCA 5FT9A 5T3RA 3GYZA 5FWQA 1N0RA 2BKGA 3GZSA 3IHVA 3HXBA 4MBGA 4YDOA 2XRYA 4J8EA 4L1BA 4DRXE 2AW6A 3AG1E 3ESLA 2WXIA 1WAO1 4QQIA 3GZ2A 2I1JA 1ZBPA 1N52A 3KD7A 2BKKB 4LG6A 4I2ZA 3UM0A 2IONA 1BPOA 1IQUA 3ZPJA 3KSQA 4MRUA 4AP2A 2XPYA 2HR2A 2HYZA 3DSVA 4EHMA 4HLEA 4RG9A 2NC9A 2V8SE 2XRZA 5ARFA 3TWRA 1D9SA 3TXNA 2YHEA 1AP7A 5BW8C 2BUGA 2AXUA 4GYYA 4ACKA 3TWQA 2RFAA 3PEUB 4GTOA 1OWMA 4BERA 5A23A 3DSWA 5HRYA 3FEXA 3I5PA 1YYHA 3ULEG 4DX1A 2CG2A 2IOSA 3L54A 5G55A 3QOUA 4F53A 4GMLA 4N5CA 5DBKA 1N4PA 5J90A 4N3AA 3DXMG 3L16A 3ZU7B 3VLEA 2WXMA 4HOUA 1H2TC 4HOSA 3UINC 4J0UA 4TXRA 3TWTA 3DBSA 2LSUA 1OCCE 3V31A 5CMYA 4HRLA 1ZU2A 4U8YD 1E8XA 2P2CP 1SZ9A 4KBQA 3CQGB 4CEMA 2JABA 4HBDA 3FP3A 1E7UA 2R59A 2PQNA 4B93B 3IEGA 3AG4E 3HRAA 3FUHA 1YCSB 1RZ4A 1OCRE 3SF4A 3FU5A 4UQXA 3J5PA 4D10C 2X6IA 2LXLA 4I2WA 2IF4A 4U07A 2A5EA 3ZNGA 2KC7A 2ONDA 3LEWA 2WXOA 2LNIA 4PS8A 2WM9A 1KT0A 3SFZA 1HE8A 1TNUA 5EIBE 3S7JA 3RRNB 3PS6A 3G2WA 1UOHA 1E90A 1WDYA 4U0UA 5ENOD 4JB8P 3O48A 5EX3A 3CKBA 2WXQA 4BTBA 4QFVA 3NOCD 4L9PA 5LFAA 4GTRA 4HI8A 5FTPA 3D9MA 4G1TA 4JXTA 3DSXA 3DEPA
chains in the Genus database with same CATH topology
3FY4A 3U64A 4APFA 3RO2A 3QC1A 4EPZA 5AENA 4CGVA 2X6FA 2CHWA 2CG3A 2RD0A 4RSYA 4XKCA 4NURA 4KVOA 1L5JA 2BF0X 3HVEB 3LYAA 4GCOA 3MKRA 3L6AA 1DNPA 3ULQA 3EHMA 3FH7A 4G26A 3APFA 3ZHEA 3LVQE 3Q15A 3CVNA 5BUZA 1HX8A 3N71A 4GA1A 4C9BB 4DLQA 4FLHA 2WMNA 3B7RL 2KZTB 3OTNA 3SD5A 4ANWA 1HXIA 2AXVA 3PVLA 5LCWJ 4H7XA 4N39A 4A1SA 3MEKA 3BG0B 3R7RA 5C2YA 1MQSA 1S0PA 4G24A 2RG8A 1NP7A 3PNTB 4TRQA 3JUIA 4OVVA 4YVOA 4DJAA 4UWFA 3LXUX 4XX5A 4CGWA 4BT9A 2GW1A 2I2OA 3U9WA 4J8SA 3CHOA 3Q49B 4NRHB 5ARGA 3LJ3A 2OOEA 3IV0A 3RIBA 1JWGA 2XEVA 3PH0C 3ZFWA 4A55A 1U3DA 4LERA 4PUCA 3UQ3A 4URKA 5JJ7A 4I1MA 3UPVA 2I1KA 3MV2B 1IHGA 5KCMA 3T8MA 1EF1C 1HH8A 3HHMA 5FQ7A 3CVYA 1KT1A 3CGHA 3B13A 3QB2A 4FLBA 4GU5A 3LY7A 1DVPA 2Y4TA 3FH5A 3CVVA 3VTYA 4YVQC 4FADA 3QK0A 3LY8A 1FCHA 4FULA 4BX9A 3FEYA 2QFCA 4CRWA 2J4DA 3JQ0A 4IYPA 4ANVA 3D3MA 2C0LA 4J8FA 4UQYA 3FTSA 4ANUA 4UWGA 1HF8A 4U0ZA 4CT4A 3RU0A 2MRIA 1SQMA 2IJGX 2DIWA 3AS4A 4ABNA 4WNEA 3LDZA 3HYMB 2PM7A 4AV7A 1HFAA 2WVIA 2XQ0A 4EBAA 1ELWA 1JPLA 3ZXSA 3PDNA 4CDNA 3EHNA 4PS7A 1B89A 2Y4UA 3MZLB 4XI0A 5EKQD 2PQRA 4WUYA 3CVXA 1HU3A 2X6HA 3P2BA 3PUKA 2ILRA 4JL0A 2FF4A 5AYWD 3ML8A 3TAXA 2FI7A 3HVEA 3U66A 2XPIA 1EYHA 2J49A 5BV0A 3JQ1A 2HO1A 2WXKA 2E0IA 5JJTA 3VLFA 3I3NA 5FQ4A 2UY1B 3FUKA 3ML9A 3AS5A 3ASFA 3PE3A 3ESKA 3S7FA 4JZYA 2MOWA 3FH8A 1N54A 4BT8A 1U3CA 2JEKA 3LVRE 5BNWA 4XZ4A 5AJLA 3PUJA 3IBEA 4A1GA 5CMWA 4E85A 3U4TA 5D0OD 5FJYA 4XE0A 1H19A 2IOLA 4UI9K 3PREA 2DBAA 4FHKA 2WXHA 2WXJA 4HFGA 4F1SA 2FBNA 3QWWA 5LCWC 4A3VA 2V4LA 3G2TA 1H6KA 4KT6B 5FZRA 4F7AA 2JLBA 2VSNA 4FC8A 5C1DA 1TEZA 2QY7A 3CR3A 4IN3B 4K0RA 1QNFA 1X5BA 4KZCA 3OXFA 2M63A 2FULA 4Y6WA 1UW4B 3NQPA 4ILHB 4OVUA 3ZN3A 3FTVA 3MKQB 3ZRHA 1OWLA 1XGWA 3CKCA 3CSTA 3RRMB 4ANXA 4HVBA 3PNLB 3ASDA 3QAQA 1UG3A 3UMVA 4I17A 3CHSA 3RJVA 4BFRA 1HG2A 4JVSA 1HO8A 2VSYA 2XCBA 4Q96A 4I1OB 2CFUA 3D9NA 2VSXE 4HXIA 3L22A 3PEVB 2IU1A 1WY6A 5G2NA 3IHYA 5E75A 3G2SA 3Q5MA 3FUDA 3QWPA 2WQHA 2FO7A 2GRLA 4AM9A 3ZYKA 4UI9J 4FA6A 1Y6IA 3EIQC 5M72A 3RO3A 4UI9C 1UN8A 5FQ8A 4KVMA 3AS8A 3ONLA 2WQ7A 2VQ2A 1IQRA 4J6IA 3CK8A 4G25A 4DLOA 4MLPA 4PS3A 5JHBA 3QKYA 4WWNA 2GGFA 1FVFA 3SBTB 2WQ6A 1FVHA 2PM6A 3S7BA 3UX4A 3CHQA 4GPKA 4HORA 1H2VC 4A3TA 2OVBA 5ANRA 1LF8A 2Q7FA 5D0QD 2R5SA 3D9PA 4GB9A 1E8WA 4JA7A 5AIJA 2OVFA 1PC2A 5FQ6A 1W3BA 3MV3B 4JPSA 2C0MA 3TG4A 4C0MA 5KJLA 3D9IA 1HZ4A 3CEQA 2I6HA 4PH4B 3MX3A 2J09A 2XGSA 4B0ZA 2AXZA 1P5QA 3ASGA 2DCPA 3GW4A 5G04C 4I1AA 4AOFA 1Z6TA 3PZDA 4GA2A 3LY9A 4E6HA 4EZJA 2GRMA 3TL5A 4B89A 2XCCA 4KYOB 4LEUA 3FU3A 3R7QA 3S7DA 4N2QA 2WPVA 3U3WA 1NA3A 1JUQA 5E76A 3C98A 1E96B 3QNKA 2Y3AA 1E8YA 5DIZA 4EZKA 3SZ7A 4WWPA 3ZYMA 5LP0A 3R9AB 4BSXA 4GYWA 2WXNA 2L6JA 5HQ8A 3RK6A 4HOTA 2VSOE 2PL2A 4BWRA 2LAIA 2MHKA 3KEZA 5T3RA 2CHXA 2LO6A 5FT9A 3VTXA 3GYZA 4LUNU 5FWQA 1NA0A 2HM8A 3GZ1A 2WXGA 3FULA 2L0TB 3L08A 3FTXA 3CK9A 4KZ0A 3GZSA 4DK5A 2AVPA 3IHVA 3ASHA 1YA0A 2X3MA 2ZU6B 3FTYA 4NACA 1UN9A 4EBAG 2V5FA 5BV1A 3OXLA 1VDYA 1SZAA 2XRYA 3ENEA 3OAWA 4J8DA 4J8EA 4G2VA 3FHEA 4L1BA 4N3CA 4UQZA 3I4RB 3MCXA 4TUUA 5LOZA 2VTBA 1NZNA 2AW6A 4N3BA 4CDRA 4G11A 1UJJA 3ZEFA 3FWVA 4ILGA 3ESLA 2WXIA 4M3OA 4P29A 1EDUA 3FUFA 4AXHA 3FTWA 3EIJA 1WAO1 3TG5A 2PZIA 2UWJG 2I9CA 2VJ8A 3P1UA 2YNQA 4GAAA 3SGHA 3GZ2A 4L7TA 4RG6A 1E7VA 2WXRA 4ME2A 2V0PA 4B8AA 4U04A 3D9JA 2I1JA 1ZBPA 3BG1B 1N52A 3MGBA 3NZSA 3D9LA 3KD7A 2NSZA 3FTZA 1HS6A 3CHMA 4I9EA 3UT4A 3FUIA 3EJNA 4JC8A 1EPUA 1IYGA 2WXLA 4L2LA 4GZ3A 1ELRA 4I2ZA 1WM5A 4AY5A 2IONA 3APDA 3CQCB 1BPOA 1IQUA 3ZPJA 4MRUA 4AP2A 2XPYA 2CFZA 3MA5A 3UT7A 2HR2A 1E8ZA 2HYZA 4FU3A 1Z3YA 1MHQA 4HLEA 2P58C 4RG9A 2NC9A 2UY1A 5LX8A 3OXGA 2XPZA 4L2YA 2V8SE 3QDNA 3FUMA 2XRZA 3HIZA 5ARFA 2C2LA 4DI3A 1TJFA 3ZHEB 3JYSA 3L13A 2VGYA 3CVUA 3MYVA 3TXNA 3AU4A 2L0IA 2YHEA 5KJNA 3RKVA 5AJDA 2LSVA 3CSFA 5BW8C 3IKOB 2LAHA 3L17A 4KXKB 3SHFA 4AEZC 4AJWA 2BUGA 2WXPA 2AXUA 4GYYA 4ACKA 4O6FA 2KCLA 1QQEA 4I6JA 4K03A 3PEUB 4NQ0A 3O4ZA 2OV8A 4H7YA 4BY6A 2KCVA 5CCLA 2J4BA 5KJKA 3FTUA 1OWMA 4BTAA 4AY6A 5A23A 3KS2A 1HG5A 2CHZA 3LKUA 3FEXA 3FU0A 4FP7A 4GA0A 3BEEA 3I5PA 4OYSA 2XHEA 3B7SA 3TGOA 3ZGQA 4BX8A 4JHJA 2CG2A 2IOSA 2WXFA 3G2VA 3L54A 3LCAA 4KMOA 2X38A 4GYOA 4V3IA 5G55A 4FHJA 4U8HA 3T5XA 4C0EA 5BT1A 3QOUA 3KAEA 4F53A 5BPPA 4GMLA 4N5CA 3FDHA 4XKBA 5DBKA 4LRZA 5J90A 4N3AA 5JJ6A 1A17A 4G23A 4GMJA 4Y6CA 3MJWA 3TJPA 4ATGA 2EQXA 3L16A 1UJKA 4APOA 4WNDA 3VLEA 3B7TA 4CDMA 2WXMA 4HOUA 3CVWA 2X6KA 2IQCA 3DPDA 4IULA 4XI9A 1H2TC 5ANLA 4HOSA 1OUVA 4MS6A 2KATA 2VYIA 3AU5A 3CLJA 4TV3A 4EECA 1XNFA 5KJMA 4DI4A 4WAFA 4AVXA 3CVQA 3CVPA 4J0UA 4Q69A 3NZUA 3DBSA 2X6JA 5A6CA 4JHKA 2YQ8A 3UT8A 2LSUA 5EDSA 2VGXB 5JHAA 2YINA 1QZ2A 3CHRA 3D9KA 5CMYA 1ZU2A 3CHPA 4W9RA 4CT0A 3FU6A 3LPZA 4XIFA 1E8XA 4UWHA 3RRUA 2KM4A 4U63A 2VGXA 5FZQA 4FJYA 4F3VA 3QJZA 3Q4AB 3QARA 1SZ9A 2WB2A 4KBQA 5EX0A 3CQGB 3PRZA 5A7DB 3HDXA 4HS2A 4CEMA 3WXXA 3FP3A 3SBSA 1E7UA 2R59A 3G2UA 5CCMA 2PQNA 2E2EA 2A4ZA 2WMOA 3IEGA 1OWNA 2XGOA 2R17C 4LCTA 4R7LA 4B8CB 5G04J 3ONKA 4N2SA 4GZCA 2A5UA 3FUHA 4HOQA 5G05C 3LS8A 1TJCA 4JHRA 1PAQA 4GZ6A 2IFUA 1Y8MA 4PDXA 3FUNA 1ELKA 2KZTA 2YHCA 3SF4A 3FU5A 3NF1A 4UQXA 4WWOA 3TXMA 4D10C 1INZA 2X6IA 4I2WA 3ZW3A 4GCNA 3SI5A 3FFLA 2IF4A 4RVBA 3UUXA 3VLDA 4CCAA 1H0AA 2BTDA 4U07A 3MKQA 4JA9A 2KC7A 2ONDA 4GZDA 3LEWA 3APCA 4JW1A 2WXOA 4I43A 4B94A 5ENNA 3ZYQA 4EQFA 3B7UX 3ZVVA 2LNIA 4U0SA 3CV0A 2WM9A 1KT0A 4PS8A 3ZIMA 2NXPA 3ZYLA 3SFZA 3Q47B 1HE8A 4I6GA 1OWOA 5CHEE 3D9OA 3FUEA 3JCKC 3PE4A 4YNDA 3I4GA 1GW6A 2XGMA 3CIAA 2L9BA 4ILIA 3S7JA 4ACLA 4IRUA 1KLXA 5HI7A 5T4YA 3RRNB 2J08A 3PS6A 2AWIA 3G2WA 4WNGA 1E90A 4EZLA 2KCKA 3K9IA 2VTBB 4U0UA 4I9CA 3CVLA 2FEZA 4JEUA 4FJZA 5J08A 4L23A 3EDTB 3O48A 5EX3A 5G05J 3CKBA 2WXQA 4BTBA 4QFVA 4JEHA 1OWPA 1Z3XA 3SNXA 3S2AA 4I6EA 1PY1A 4GZ5A 4UWLA 4DPRA 5FZSA 5T8IA 3URZA 3FUJA 1H2UA 5LFAA 4Q94A 4MKTA 4WNFA 3E4BA 3D9MA 5FTPA 4AIFA 2J07A 4G1TA 2J9QA 4JXTA 4UWKA 3T5VA 1JWFA 3QWVA 3CK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHK A;  3RO2 A;  5FT9 A;  2FBN A;  4APO A;  3QWW A;  4WND A;  3VTX A;  4CGV A;  5LCW C;  5FZR A;  3GYZ A;  4HOU A;  2JLB A;  1NA0 A;  2VSN A;  3GZ1 A;  5C1D A;  3LYA A;  4XI9 A;  4GCO A;  3CK9 A;  3MKR A;  1OUV A;  4IN3 B;  4HOS A;  2AVP A;  2KAT A;  2VYI A;  1YA0 A;  3ASH A;  3ULQ A;  3OXF A;  4G26 A;  1XNF A;  3ZHE A;  5KJM A;  3Q15 A;  3CVN A;  3CVQ A;  3CVP A;  2V5F A;  3N71 A;  4GA1 A;  4J0U A;  4Y6W A;  3OXL A;  4J8D A;  4J8E A;  4N3C A;  4UQZ A;  4G2V A;  3ZN3 A;  5A6C A;  2YQ8 A;  2LSU A;  2VGX B;  3CKC A;  1NZN A;  4N3B A;  1HXI A;  4CDR A;  5LCW J;  1QZ2 A;  3FWV A;  4H7X A;  4N39 A;  1ZU2 A;  4W9R A;  4A1S A;  3ASD A;  3MEK A;  4XIF A;  3LPZ A;  4I17 A;  3RJV A;  4G24 A;  4YVO A;  1WAO 1;  3TG5 A;  2PZI A;  2UWJ G;  2VSY A;  2VGX A;  2XCB A;  5FZQ A;  4F3V A;  4CGW A;  3Q4A B;  3GZ2 A;  4RG6 A;  4BT9 A;  2GW1 A;  4KBQ A;  5EX0 A;  4ME2 A;  5A7D B;  3Q49 B;  4NRH B;  4U04 A;  5ARG A;  5CCM A;  3Q5M A;  3WXX A;  3FP3 A;  3QWP A;  2WQH A;  2OOE A;  2FO7 A;  3RIB A;  4AM9 A;  1ZBP A;  2PQN A;  2XEV A;  3ZFW A;  2E2E A;  3IEG A;  4UI9 J;  3UQ3 A;  2XGO A;  3KD7 A;  5JJ7 A;  3UPV A;  5M72 A;  5G04 J;  3RO3 A;  4UI9 C;  3MV2 B;  4N2S A;  1IHG A;  4I9E A;  1HH8 A;  1IYG A;  3AS8 A;  4HOQ A;  2VQ2 A;  1KT1 A;  5G05 C;  4GZ3 A;  1ELR A;  3CK8 A;  4G25 A;  4I2Z A;  1WM5 A;  1TJC A;  4JHR A;  4GZ6 A;  4AY5 A;  2IFU A;  1Y8M A;  3LY7 A;  2YHC A;  3SF4 A;  2Y4T A;  3QKY A;  3NF1 A;  4UQX A;  4ABN A;  4I2W A;  4YVQ C;  3VTY A;  3ZPJ A;  3LY8 A;  1FCH A;  3FFL A;  2IF4 A;  4GCN A;  3S7B A;  3UUX A;  3MA5 A;  2QFC A;  2HR2 A;  4GPK A;  4HOR A;  4U07 A;  2HYZ A;  4JA9 A;  2Q7F A;  5D0Q D;  2KC7 A;  2R5S A;  2C0L A;  2OND A;  2P58 C;  4J8F A;  2NC9 A;  2UY1 A;  4JA7 A;  4RG9 A;  4UQY A;  3OXG A;  4U0Z A;  3QDN A;  4B94 A;  4EQF A;  3QWV A;  1PC2 A;  3RU0 A;  2LNI A;  4U0S A;  1W3B A;  2C2L A;  1KT0 A;  3AS4 A;  3CV0 A;  3HYM B;  4WNE A;  5ARF A;  3MV3 B;  5KJK A;  3Q47 B;  2C0M A;  3JYS A;  3TG4 A;  1ELW A;  3ZHE B;  2VGY A;  5KJL A;  5CHE E;  1HZ4 A;  3PDN A;  3PE4 A;  4YND A;  3CEQ A;  5KJN A;  2I6H A;  1B89 A;  3RKV A;  2LSV A;  2XGM A;  2Y4U A;  5BW8 C;  4XI0 A;  5EKQ D;  4N2Q A;  2PQR A;  4KXK B;  4WUY A;  3S7J A;  2XGS A;  1KLX A;  5HI7 A;  2BUG A;  1P5Q A;  3ASG A;  4JL0 A;  5AYW D;  2FF4 A;  4GYY A;  3GW4 A;  5G04 C;  4I1A A;  2KCL A;  4O6F A;  4WNG A;  3TAX A;  2FI7 A;  1QQE A;  4G23 A;  4Y6C A;  2XPI A;  2KCK A;  3K9I A;  3LY9 A;  4GA2 A;  4I9C A;  3CVL A;  4NQ0 A;  4U0U A;  2FEZ A;  2HO1 A;  4H7Y A;  2KCV A;  5CCL A;  4BWR A;  3EDT B;  5JJT A;  2XCC A;  4KYO B;  3O48 A;  4LEU A;  5EX3 A;  5G05 J;  3CKB A;  3S7D A;  2UY1 B;  2WPV A;  4BTA A;  3AS5 A;  3ASF A;  3PE3 A;  3ESK A;  3S7F A;  4BTB A;  3U3W A;  4AY6 A;  3KS2 A;  1NA3 A;  3LKU A;  4GA0 A;  3BEE A;  4BT8 A;  3TGO A;  3ZGQ A;  1E96 B;  4GZ5 A;  5BNW A;  5DIZ A;  5FZS A;  3URZ A;  3LCA A;  4GYO A;  5BT1 A;  3SZ7 A;  3QOU A;  3KAE A;  4WNF A;  3R9A B;  4GYW A;  3U4T A;  3E4B A;  5FTP A;  5D0O D;  5FJY A;  2L6J A;  4N5C A;  5DBK A;  4AIF A;  4G1T A;  5HQ8 A;  4N3A A;  2J9Q A;  5JJ6 A;  1A17 A;  4HOT A;  4UI9 K;  2PL2 A;  2DBA A;  3CK7 A; 
#chains in the Genus database with same CATH topology
 3FY4 A;  4APF A;  5AEN A;  2CHW A;  3C5R A;  1DNP A;  2R2L A;  5ENS D;  4DLQ A;  3OTN A;  5D66 A;  3SD5 A;  1HXI A;  3PVL A;  1LD8 A;  3E34 A;  5D2M C;  1MQS A;  1S0P A;  4G24 A;  1NP7 A;  2F8X K;  4TRQ A;  4BT9 A;  4J8S A;  3Q49 B;  4NRH B;  1N94 A;  3LJ3 A;  3PH0 C;  1U3D A;  4LER A;  3UPV A;  4URK A;  4I1M A;  3MV2 B;  1X81 A;  1KT1 A;  3AG2 E;  3B13 A;  2P9L G;  3LY7 A;  1DVP A;  3FH5 A;  1N4R A;  4YVQ C;  1O1T A;  3JQ0 A;  3FTS A;  3RU0 A;  1JCS A;  4WNE A;  3LDZ A;  4GTQ A;  2PM7 A;  3PZ2 A;  2VGE A;  4CDN A;  4PS7 A;  1DCQ A;  1HU3 A;  4JL0 A;  2ILR A;  2FF4 A;  2HO1 A;  2WXK A;  5JJT A;  3VLF A;  2KBX A;  5FQ4 A;  2UY1 B;  1TN6 A;  3AS5 A;  1N54 A;  3LVR E;  4E85 A;  5D0O D;  4XE0 A;  1H19 A;  5EN5 D;  2IOL A;  4N5Q A;  3PRE A;  2DBA A;  4FHK A;  1V54 E;  3QWW A;  4A3V A;  2V4L A;  3G2T A;  5FZR A;  4F7A A;  2JLB A;  2VSN A;  2QY7 A;  4K0R A;  1X5B A;  4Y6W A;  1H6O A;  1TYQ G;  3MKQ B;  3ZRH A;  4UUC A;  3RRM B;  4HVB A;  1UG3 A;  2XCB A;  4Q96 A;  3PEV B;  3HG0 D;  3IHY A;  5HS0 A;  3UIP C;  5EYP F;  4CYM D;  5KWD A;  4UI9 C;  4U7E B;  2OEW A;  3BU8 A;  5AAR A;  1IQR A;  4J6I A;  4DLO A;  4PS3 A;  1N0Q A;  4WWN A;  2GGF A;  3UX4 A;  3CHQ A;  4HOR A;  2R5S A;  1JCQ A;  4JA7 A;  3Q9U C;  2C0M A;  1KPS B;  3TG4 A;  1MZC A;  2I6H A;  4PH4 B;  2RFM A;  5CRV A;  2XGS A;  4Z68 A;  5G04 C;  4HRN A;  3PZD A;  4E6H A;  4YDE A;  3TL5 A;  4KYO B;  4DUI A;  2XEE A;  1JUQ A;  3C98 A;  4K5C A;  1E8Y A;  5DIZ A;  5B1B E;  5LP0 A;  3PZ4 A;  4BSX A;  4GYW A;  3AAA C;  2L6J A;  2B0O E;  1S70 B;  2LAI A;  2CHX A;  3VTX A;  4LSZ E;  3UKR G;  1N95 A;  3FUL A;  3FTX A;  3Q9N C;  5CBN A;  2AVP A;  1YA0 A;  1MX4 A;  3EHQ A;  1UN9 A;  4EBA G;  3W9F A;  5BV1 A;  1SZA A;  3ENE A;  3FHE A;  3MCX A;  5LOZ A;  4N3B A;  1TNO A;  1MX6 A;  4M3O A;  4AXH A;  3FTW A;  3TG5 A;  2VJ8 A;  3SGH A;  1E7V A;  4J8Y A;  4B8A A;  3TWV A;  2EIN E;  3MGB A;  3SFX A;  2NSZ A;  1HS6 A;  3UT4 A;  3FUI A;  2ZGG A;  4L2L A;  1WM5 A;  4AY5 A;  5CED B;  3APD A;  5KBA A;  3UTM A;  2CFZ A;  1E8Z A;  4FU3 A;  2P9U G;  4L2Y A;  1TJF A;  3L13 A;  2VGY A;  3CVU A;  2LSV A;  4O1P A;  4YDW A;  1BLX B;  4AEZ C;  4O6F A;  2KCL A;  5B1A E;  2OV8 A;  4F6R D;  5KJK A;  3FTU A;  4BEP A;  3C3R A;  4AY6 A;  3KS2 A;  1HG5 A;  4GA0 A;  3TWW A;  3BEE A;  1SW6 A;  1BU9 A;  3ZGQ A;  4C48 B;  3G2V A;  3DWL G;  4KMO A;  4C0E A;  2X38 A;  3T5X A;  5BPP A;  4XKB A;  1A17 A;  2Y69 E;  1K1A A;  4ATG A;  1UJK A;  4CDM A;  1V55 E;  3CVW A;  2EIK E;  2IQC A;  3DPD A;  2VYI A;  3AU5 A;  1JCR A;  1XNF A;  5KJM A;  4DI4 A;  1OXJ A;  4AVX A;  4Q69 A;  3NBN B;  2X6J A;  4JHK A;  2YQ8 A;  2R03 A;  2VGX B;  3ISM C;  3CHP A;  3FU6 A;  3LPZ A;  4UWH A;  4U63 A;  5EID A;  4F3V A;  3QJZ A;  3QAR A;  4CZ2 D;  2WB2 A;  2NYJ A;  3HDX A;  3WXX A;  4NIK A;  3G2U A;  5CCM A;  2A4Z A;  5CER B;  2XGO A;  3ONK A;  4N2S A;  2A5U A;  4HOQ A;  1AWC B;  1TJC A;  4JHR A;  1S64 A;  3FUN A;  3TXM A;  3VLD A;  3UUX A;  4RVB A;  4JA9 A;  2P9S G;  4XEI G;  3SQV A;  4JW1 A;  1IKN D;  4EQF A;  3ZYQ A;  3PE4 A;  1GW6 A;  2XZD G;  5ENT D;  4WNG A;  2KCK A;  1K8K G;  4I9C A;  2FEZ A;  5J08 A;  1Z3X A;  3SNX A;  4I6E A;  5AQB A;  1WG0 A;  4GZ5 A;  4UWL A;  5T8I A;  1H2U A;  1O1S A;  3E4B A;  3F6Q A;  1U2V G;  4LNU D;  1JWF A;  3QWV A;  1FT1 A;  3QC1 A;  1DC2 A;  2X6F A;  1Q2Z A;  2IO3 C;  2RD0 A;  1K1B A;  5AQ7 A;  3L6A A;  3EHM A;  5BUZ A;  3N71 A;  4C9B B;  4RLY A;  5AQ9 A;  2WMN A;  2KZT B;  2AXV A;  1MX2 A;  3MEK A;  3BG0 B;  3R7R A;  2RG8 A;  3JUI A;  1O1R A;  5CEA A;  3LXU X;  3U9W A;  3CHO A;  2OOE A;  3RIB A;  3SFY A;  4A55 A;  1NL4 A;  4PUC A;  5JJ7 A;  4RQI A;  5H7P A;  1IHG A;  5KCM A;  3T8M A;  1EF1 C;  3SY2 A;  2V5Q C;  3QB2 A;  2QZA A;  4BET A;  2V4H C;  2DYR E;  3VTY A;  3QK0 A;  3LY8 A;  1FCH A;  4BX9 A;  2ETB A;  2QFC A;  4CRW A;  2J4D A;  2C0L A;  4U0Z A;  1BI7 B;  4CT4 A;  1SQM A;  2IJG X;  2DIW A;  3AS4 A;  2P9P G;  3HXD A;  4AV7 A;  1HFA A;  3EHN A;  4XI0 A;  4WUY A;  2DZN A;  3ML8 A;  5BXU A;  2FI7 A;  3U66 A;  1DCE A;  3JQ1 A;  3S7F A;  3PE3 A;  3ESK A;  4JZY A;  3L9T A;  2MOW A;  5BNW A;  5AJL A;  5CMW A;  3X2Q E;  5FJY A;  3EHR A;  3J5Q B;  2WXJ A;  4F1S A;  3ABM E;  5KNG A;  4KZC A;  1N4Q A;  2M63 A;  2FUL A;  4LNB A;  1UW4 B;  5IY5 E;  3TWU A;  3NQP A;  4ILH B;  1OWL A;  1KZO A;  3QAQ A;  3UMV A;  3CHS A;  4JVS A;  2ETC A;  1HO8 A;  2CFU A;  2GRP B;  4HXI A;  1WY6 A;  5G2N A;  2Y0B G;  2GRL A;  1KZP A;  4FA6 A;  5M72 A;  4KVM A;  3SO8 A;  1SA5 A;  3T9K A;  1MYO A;  4ZHB A;  3ZUV B;  3UM2 A;  3PZ1 A;  3ZKJ A;  4A3T A;  1LF8 A;  1NFI E;  2XEN A;  3T8K A;  1TNY A;  1PC2 A;  2DYS E;  1W3B A;  1TN8 A;  3AJI A;  5KJL A;  5HKP A;  4OAU C;  3MX3 A;  2J09 A;  2AXZ A;  3GW4 A;  4K5A B;  2XCC A;  3FU3 A;  2GRN B;  3U3W A;  1E96 B;  3C3O A;  4EZK A;  3SZ7 A;  2J8S D;  5HQ8 A;  2R02 A;  3BUA A;  2LO6 A;  4A63 B;  2XEH A;  4LUN U;  2L0T B;  3L08 A;  3CK9 A;  3TWS A;  4DK5 A;  2X3M A;  2ZU6 B;  3FTY A;  4GTT A;  2V5F A;  2LXM A;  3OAW A;  1INZ A;  4N3C A;  4G2V A;  4TUU A;  2VTB A;  1NZN A;  4G11 A;  1UJJ A;  4U95 D;  2GRQ B;  1EDU A;  2PZI A;  2UWJ G;  2YNQ A;  4RG6 A;  2WXR A;  2DWZ A;  4ME2 A;  4U04 A;  3D9J A;  4JD2 G;  3D9L A;  2R05 A;  3ULY A;  3FTZ A;  3CHM A;  4I9E A;  4JC8 A;  3ZXP A;  3ABK E;  1EPU A;  1IYG A;  2Y1L E;  4GZ3 A;  1ELR A;  3Q75 A;  3Q7A A;  1MJ0 A;  1LD7 A;  1TNZ A;  3UT7 A;  2IY0 C;  1Z3Y A;  3NB2 A;  2P58 C;  2UY1 A;  3OXG A;  3QDN A;  3FUM A;  4HQD A;  3HIZ A;  4DI3 A;  3V30 A;  3ZHE B;  3JYS A;  4BSZ B;  2L0I A;  3RKV A;  5AJD A;  1Z5S C;  2LAH A;  3L17 A;  4KXK B;  4AJW A;  2H6F A;  4M7C A;  4BY6 A;  3O4Z A;  2KCV A;  2J4B A;  3PZ3 A;  4OAV B;  2CHZ A;  2B6C A;  3LKU A;  4FP7 A;  2XHE A;  4BX8 A;  5C2Y A;  4V3I A;  5BT1 A;  4GYO A;  3W9G A;  3FDH A;  4LRZ A;  5JJ6 A;  3V2O A;  4GMJ A;  2EQX A;  5ENP D;  4APO A;  4WND A;  3B7T A;  4HRM B;  1OUV A;  4MS6 A;  4TV3 A;  3CLJ A;  4EEC A;  3CVQ A;  1N4S A;  4GTP A;  3UT8 A;  5JHA A;  2KXP C;  4K5B A;  3EU9 A;  4W9R A;  4CT0 A;  4XIF A;  3DPY A;  5FZQ A;  3Q4A B;  5EYL A;  3PRZ A;  2P9I G;  2R17 C;  3R9M A;  5G04 J;  1RW2 A;  5EIL A;  5G05 C;  2PNN A;  3LS8 A;  1PAQ A;  4GZ6 A;  2IFU A;  4PDX A;  2KZT A;  2YHC A;  3NF1 A;  3Q73 A;  4GCN A;  2OCC E;  4CCA A;  3UKU G;  2ETA A;  3HXE A;  4ATZ D;  4DX5 D;  3APC A;  5ITZ F;  4B94 A;  3B7U X;  3ZVV A;  4U0S A;  3ZIM A;  2NXP A;  4I6G A;  4YND A;  3I4G A;  3CIA A;  5HI7 A;  1KLX A;  5FIO A;  3C72 A;  3K9I A;  2VTB B;  4JEU A;  3BQO A;  1IXV A;  4JEH A;  1G3N B;  1PY1 A;  3V79 K;  3URZ A;  3FUJ A;  4Q94 A;  2J07 A;  4UWK A;  1OT8 A;  3U64 A;  3UM3 A;  4EPZ A;  3NOG D;  2P9N G;  2CG3 A;  4J7W A;  4NUR A;  1L5J A;  2BF0 X;  3LYA A;  3ULQ A;  3APF A;  3V2X A;  3LVQ E;  3CVN A;  1HX8 A;  4FLH A;  3L82 A;  3B7R L;  5LCW J;  4G8L A;  3T5V A;  2IEJ A;  4CGW A;  3HXF A;  2GW1 A;  5ARG A;  1JWG A;  2XEV A;  3ZFW A;  3UQ3 A;  3UIO C;  2XS1 A;  5FQ7 A;  2QYJ A;  3JXJ A;  4FLB A;  4GU5 A;  3CVV A;  1SVX A;  3FEY A;  1OCZ E;  4IYP A;  4ANV A;  4J8F A;  2EIL E;  2MRI A;  1ZB1 A;  5CRU A;  3HYM B;  2WVI A;  2XQ0 A;  1JPL A;  3DEO A;  1B89 A;  5AQA A;  2PQR A;  3CVX A;  3P2B A;  2EIJ E;  3HVE A;  4HB5 A;  3Q78 A;  2J49 A;  5BV0 A;  4GTS A;  3FUK A;  3ML9 A;  3ASF A;  4HNA D;  1NI1 A;  3Q7F A;  4BT8 A;  4XZ4 A;  4DX7 D;  3PUJ A;  3IBE A;  4A1G A;  4GTV A;  2EIM E;  2WXH A;  2FBN A;  3ABL E;  4TXP A;  1H6K A;  1TEZ A;  5C1D A;  4IN3 B;  1QNF A;  3OXF A;  4OVU A;  2DVW A;  3ZN3 A;  3FTV A;  1XGW A;  3CST A;  3PNL B;  3RJV A;  1HG2 A;  3ASN E;  4LNG A;  3D9N A;  1BD8 A;  4F1P A;  3FUD A;  2WQH A;  2FO7 A;  4AM9 A;  3ZYK A;  4UI9 J;  2L6B A;  3EIQ C;  3AS8 A;  3ONL A;  2VQ2 A;  3AG3 E;  4DX6 D;  5JHB A;  3QKY A;  1FVF A;  3IXE A;  2PM6 A;  3S7B A;  4GPK A;  3WG7 E;  2Q7F A;  5D0Q D;  4GB9 A;  5AIJ A;  4JPS A;  4C0M A;  2DCP A;  4I1A A;  1TR4 A;  2DZO A;  2F8Y A;  3LY9 A;  2GRM A;  4LEU A;  3R7Q A;  4N2Q A;  3DST A;  2LUH A;  5E76 A;  1TN7 A;  3QNK A;  2Y3A A;  2ZIR A;  3R9A B;  1QBQ A;  4X8Q A;  2GRR B;  4U96 D;  4BWR A;  2MHK A;  1NA0 A;  2HM8 A;  2MYO A;  2WXG A;  3GZ1 A;  5AN8 A;  1BI8 B;  4KZ0 A;  3ASH A;  4NAC A;  3OXL A;  1VDY A;  4J8D A;  4UQZ A;  3I4R B;  4CDR A;  3ZEF A;  3FWV A;  4ILG A;  4P29 A;  3FUF A;  3EIJ A;  2I9C A;  3P1U A;  4GAA A;  4L7T A;  3E37 A;  2P9K G;  2V0P A;  3UM1 A;  3BG1 B;  3NZS A;  3E33 A;  3EJN A;  2WXL A;  4BES A;  3CQC B;  3RSE G;  3MA5 A;  1MHQ A;  3RAU A;  5LX8 A;  1N11 A;  2XPZ A;  2C2L A;  3DXK G;  2ZIS A;  3MYV A;  3AU4 A;  5KJN A;  2ZXW E;  3CSF A;  3IKO B;  3SHF A;  2WXP A;  1QQE A;  4I6J A;  4NQ0 A;  3ASO E;  4K03 A;  1IHB A;  5CCL A;  4H7Y A;  4TUM A;  4BTA A;  4ZFH A;  1D8D A;  2HE0 A;  3FU0 A;  4OYS A;  3TGO A;  3B7S A;  4JHJ A;  2WXF A;  3LCA A;  3JXI A;  4FHJ A;  4U8H A;  3KAE A;  4GPM A;  3LJN A;  4G23 A;  4Y6C A;  3MJW A;  3TJP A;  4G8K A;  2H6H A;  2X6K A;  4XI9 A;  4IUL A;  5ANL A;  2AJA A;  4YDY A;  2KAT A;  4WAF A;  3CVP A;  3TWX A;  3NZU A;  1FT2 A;  5A6C A;  5EDS A;  1LTX A;  2YIN A;  1QZ2 A;  3CHR A;  3D9K A;  4DX2 A;  2IO2 C;  3RRU A;  2KM4 A;  2VGX A;  4FJY A;  4O1O A;  5EX0 A;  5A7D B;  4HS2 A;  3SBS A;  4U8V D;  2E2E A;  2WMO A;  4LCT A;  5KNH D;  1OWN A;  4B8C B;  4R7L A;  2H6G A;  3B95 A;  4GZC A;  1Y8M A;  1ELK A;  4WWO A;  3ZW3 A;  3SI5 A;  3FFL A;  2QC9 A;  1N9A A;  1H0A A;  2BTD A;  2XS8 A;  3MKQ A;  5B3S E;  4GZD A;  1OCO E;  4I43 A;  5ENN A;  2QYU A;  3CV0 A;  1OY3 D;  3ZYL A;  3Q47 B;  3EU5 A;  1OWO A;  5CHE E;  3D9O A;  3FUE A;  3JCK C;  2XGM A;  1A5E A;  2L9B A;  4ILI A;  4ACL A;  4IRU A;  5T4Y A;  2J08 A;  1O5M A;  2AWI A;  4EZL A;  3CVL A;  5FIN A;  4FJZ A;  4L23 A;  3EDT B;  5G05 J;  1SA4 A;  3UXG A;  1OWP A;  3S2A A;  5JMN D;  4O60 A;  4DPR A;  5FZS A;  2OEV A;  3C3Q A;  4MKT A;  4WNF A;  4AIF A;  2J9Q A;  3KEA A;  3CK7 A;  3RO2 A;  4CGV A;  1FPP A;  4RSY A;  4XKC A;  4KVO A;  4TXQ A;  3HVE B;  5CBO A;  4GCO A;  3MKR A;  3FH7 A;  4G26 A;  3ZHE A;  3Q15 A;  4GA1 A;  5JA4 D;  3DSS A;  4ANW A;  3E30 A;  4H7X A;  4N39 A;  4A1S A;  2BED A;  4DJA A;  4YVO A;  3PNT B;  4OVV A;  4UWF A;  4XX5 A;  3NAW A;  2I2O A;  3D9H A;  3IV0 A;  2RKK A;  2I1K A;  1HH8 A;  3HHM A;  3CVY A;  3CGH A;  2Y4T A;  4FAD A;  4FUL A;  3D3M A;  3KSL A;  2F0Y A;  4UQY A;  4ANU A;  4UWG A;  1HF8 A;  4ABN A;  4EBA A;  1ELW A;  3ZXS A;  3PDN A;  1TNB A;  2Y4U A;  3MZL B;  5EKQ D;  2X6H A;  5AYW D;  4GMR A;  3PUK A;  5BXO A;  3TAX A;  2XPI A;  1EYH A;  5ENQ D;  2E0I A;  3I3N A;  3FH8 A;  1U3C A;  2JEK A;  5CEC B;  3U4T A;  3UI2 A;  4UI9 K;  4HFG A;  2XZT G;  5ENR D;  5LCW C;  4KT6 B;  4FC8 A;  3CR3 A;  1K3Z D;  3E32 A;  3JUE A;  3CKC A;  4ANX A;  3ASD A;  5AAO A;  4I17 A;  4BFR A;  2VSY A;  2ZGD A;  4I1O B;  2GRO B;  2VSX E;  3L22 A;  2IU1 A;  5E75 A;  3G2S A;  3Q5M A;  3QWP A;  3B7B A;  1Y6I A;  3RO3 A;  1UN8 A;  5FQ8 A;  3DRA A;  2WQ7 A;  2F37 A;  3CK8 A;  4G25 A;  1D8E A;  4MLP A;  3SBT B;  2WQ6 A;  1FVH A;  2H6I A;  1H2V C;  4HI9 A;  2OVB A;  5ANR A;  3EUV A;  3D9P A;  1E8W A;  2OVF A;  4GTM A;  5FQ6 A;  1YMP A;  3DSU A;  3MV3 B;  3D9I A;  1HZ4 A;  3CEQ A;  1QYM A;  4B0Z A;  1P5Q A;  3ASG A;  4AOF A;  1Z6T A;  4GA2 A;  4EZJ A;  4B89 A;  1H6P A;  4HLL A;  3S7D A;  2WPV A;  1NA3 A;  2FO1 E;  4WWP A;  3ZYM A;  3Q79 A;  2WXN A;  1S63 A;  3RK6 A;  4HOT A;  2VSO E;  2PL2 A;  3KEZ A;  3HXC A;  5FT9 A;  5T3R A;  3GYZ A;  5FWQ A;  1N0R A;  2BKG A;  3GZS A;  3IHV A;  3HXB A;  4MBG A;  4YDO A;  2XRY A;  4J8E A;  4L1B A;  4DRX E;  2AW6 A;  3AG1 E;  3ESL A;  2WXI A;  1WAO 1;  4QQI A;  3GZ2 A;  2I1J A;  1ZBP A;  1N52 A;  3KD7 A;  2BKK B;  4LG6 A;  4I2Z A;  3UM0 A;  2ION A;  1BPO A;  1IQU A;  3ZPJ A;  3KSQ A;  4MRU A;  4AP2 A;  2XPY A;  2HR2 A;  2HYZ A;  3DSV A;  4EHM A;  4HLE A;  4RG9 A;  2NC9 A;  2V8S E;  2XRZ A;  5ARF A;  3TWR A;  1D9S A;  3TXN A;  2YHE A;  1AP7 A;  5BW8 C;  2BUG A;  2AXU A;  4GYY A;  4ACK A;  3TWQ A;  2RFA A;  3PEU B;  4GTO A;  1OWM A;  4BER A;  5A23 A;  3DSW A;  5HRY A;  3FEX A;  3I5P A;  1YYH A;  3ULE G;  4DX1 A;  2CG2 A;  2IOS A;  3L54 A;  5G55 A;  3QOU A;  4F53 A;  4GML A;  4N5C A;  5DBK A;  1N4P A;  5J90 A;  4N3A A;  3DXM G;  3L16 A;  3ZU7 B;  3VLE A;  2WXM A;  4HOU A;  1H2T C;  4HOS A;  3UIN C;  4J0U A;  4TXR A;  3TWT A;  3DBS A;  2LSU A;  1OCC E;  3V31 A;  5CMY A;  4HRL A;  1ZU2 A;  4U8Y D;  1E8X A;  2P2C P;  1SZ9 A;  4KBQ A;  3CQG B;  4CEM A;  2JAB A;  4HBD A;  3FP3 A;  1E7U A;  2R59 A;  2PQN A;  4B93 B;  3IEG A;  3AG4 E;  3HRA A;  3FUH A;  1YCS B;  1RZ4 A;  1OCR E;  3SF4 A;  3FU5 A;  4UQX A;  3J5P A;  4D10 C;  2X6I A;  2LXL A;  4I2W A;  2IF4 A;  4U07 A;  2A5E A;  3ZNG A;  2KC7 A;  2OND A;  3LEW A;  2WXO A;  2LNI A;  4PS8 A;  2WM9 A;  1KT0 A;  3SFZ A;  1HE8 A;  1TNU A;  5EIB E;  3S7J A;  3RRN B;  3PS6 A;  3G2W A;  1UOH A;  1E90 A;  1WDY A;  4U0U A;  5ENO D;  4JB8 P;  3O48 A;  5EX3 A;  3CKB A;  2WXQ A;  4BTB A;  4QFV A;  3NOC D;  4L9P A;  5LFA A;  4GTR A;  4HI8 A;  5FTP A;  3D9M A;  4G1T A;  4JXT A;  3DSX A;  3DEP A; 
#chains in the Genus database with same CATH homology
 3FY4 A;  3U64 A;  4APF A;  3RO2 A;  3QC1 A;  4EPZ A;  5AEN A;  4CGV A;  2X6F A;  2CHW A;  2CG3 A;  2RD0 A;  4RSY A;  4XKC A;  4NUR A;  4KVO A;  1L5J A;  2BF0 X;  3HVE B;  3LYA A;  4GCO A;  3MKR A;  3L6A A;  1DNP A;  3ULQ A;  3EHM A;  3FH7 A;  4G26 A;  3APF A;  3ZHE A;  3LVQ E;  3Q15 A;  3CVN A;  5BUZ A;  1HX8 A;  3N71 A;  4GA1 A;  4C9B B;  4DLQ A;  4FLH A;  2WMN A;  3B7R L;  2KZT B;  3OTN A;  3SD5 A;  4ANW A;  1HXI A;  2AXV A;  3PVL A;  5LCW J;  4H7X A;  4N39 A;  4A1S A;  3MEK A;  3BG0 B;  3R7R A;  5C2Y A;  1MQS A;  1S0P A;  4G24 A;  2RG8 A;  1NP7 A;  3PNT B;  4TRQ A;  3JUI A;  4OVV A;  4YVO A;  4DJA A;  4UWF A;  3LXU X;  4XX5 A;  4CGW A;  4BT9 A;  2GW1 A;  2I2O A;  3U9W A;  4J8S A;  3CHO A;  3Q49 B;  4NRH B;  5ARG A;  3LJ3 A;  2OOE A;  3IV0 A;  3RIB A;  1JWG A;  2XEV A;  3PH0 C;  3ZFW A;  4A55 A;  1U3D A;  4LER A;  4PUC A;  3UQ3 A;  4URK A;  5JJ7 A;  4I1M A;  3UPV A;  2I1K A;  3MV2 B;  1IHG A;  5KCM A;  3T8M A;  1EF1 C;  1HH8 A;  3HHM A;  5FQ7 A;  3CVY A;  1KT1 A;  3CGH A;  3B13 A;  3QB2 A;  4FLB A;  4GU5 A;  3LY7 A;  1DVP A;  2Y4T A;  3FH5 A;  3CVV A;  3VTY A;  4YVQ C;  4FAD A;  3QK0 A;  3LY8 A;  1FCH A;  4FUL A;  4BX9 A;  3FEY A;  2QFC A;  4CRW A;  2J4D A;  3JQ0 A;  4IYP A;  4ANV A;  3D3M A;  2C0L A;  4J8F A;  4UQY A;  3FTS A;  4ANU A;  4UWG A;  1HF8 A;  4U0Z A;  4CT4 A;  3RU0 A;  2MRI A;  1SQM A;  2IJG X;  2DIW A;  3AS4 A;  4ABN A;  4WNE A;  3LDZ A;  3HYM B;  2PM7 A;  4AV7 A;  1HFA A;  2WVI A;  2XQ0 A;  4EBA A;  1ELW A;  1JPL A;  3ZXS A;  3PDN A;  4CDN A;  3EHN A;  4PS7 A;  1B89 A;  2Y4U A;  3MZL B;  4XI0 A;  5EKQ D;  2PQR A;  4WUY A;  3CVX A;  1HU3 A;  2X6H A;  3P2B A;  3PUK A;  2ILR A;  4JL0 A;  2FF4 A;  5AYW D;  3ML8 A;  3TAX A;  2FI7 A;  3HVE A;  3U66 A;  2XPI A;  1EYH A;  2J49 A;  5BV0 A;  3JQ1 A;  2HO1 A;  2WXK A;  2E0I A;  5JJT A;  3VLF A;  3I3N A;  5FQ4 A;  2UY1 B;  3FUK A;  3ML9 A;  3AS5 A;  3ASF A;  3PE3 A;  3ESK A;  3S7F A;  4JZY A;  2MOW A;  3FH8 A;  1N54 A;  4BT8 A;  1U3C A;  2JEK A;  3LVR E;  5BNW A;  4XZ4 A;  5AJL A;  3PUJ A;  3IBE A;  4A1G A;  5CMW A;  4E85 A;  3U4T A;  5D0O D;  5FJY A;  4XE0 A;  1H19 A;  2IOL A;  4UI9 K;  3PRE A;  2DBA A;  4FHK A;  2WXH A;  2WXJ A;  4HFG A;  4F1S A;  2FBN A;  3QWW A;  5LCW C;  4A3V A;  2V4L A;  3G2T A;  1H6K A;  4KT6 B;  5FZR A;  4F7A A;  2JLB A;  2VSN A;  4FC8 A;  5C1D A;  1TEZ A;  2QY7 A;  3CR3 A;  4IN3 B;  4K0R A;  1QNF A;  1X5B A;  4KZC A;  3OXF A;  2M63 A;  2FUL A;  4Y6W A;  1UW4 B;  3NQP A;  4ILH B;  4OVU A;  3ZN3 A;  3FTV A;  3MKQ B;  3ZRH A;  1OWL A;  1XGW A;  3CKC A;  3CST A;  3RRM B;  4ANX A;  4HVB A;  3PNL B;  3ASD A;  3QAQ A;  1UG3 A;  3UMV A;  4I17 A;  3CHS A;  3RJV A;  4BFR A;  1HG2 A;  4JVS A;  1HO8 A;  2VSY A;  2XCB A;  4Q96 A;  4I1O B;  2CFU A;  3D9N A;  2VSX E;  4HXI A;  3L22 A;  3PEV B;  2IU1 A;  1WY6 A;  5G2N A;  3IHY A;  5E75 A;  3G2S A;  3Q5M A;  3FUD A;  3QWP A;  2WQH A;  2FO7 A;  2GRL A;  4AM9 A;  3ZYK A;  4UI9 J;  4FA6 A;  1Y6I A;  3EIQ C;  5M72 A;  3RO3 A;  4UI9 C;  1UN8 A;  5FQ8 A;  4KVM A;  3AS8 A;  3ONL A;  2WQ7 A;  2VQ2 A;  1IQR A;  4J6I A;  3CK8 A;  4G25 A;  4DLO A;  4MLP A;  4PS3 A;  5JHB A;  3QKY A;  4WWN A;  2GGF A;  1FVF A;  3SBT B;  2WQ6 A;  1FVH A;  2PM6 A;  3S7B A;  3UX4 A;  3CHQ A;  4GPK A;  4HOR A;  1H2V C;  4A3T A;  2OVB A;  5ANR A;  1LF8 A;  2Q7F A;  5D0Q D;  2R5S A;  3D9P A;  4GB9 A;  1E8W A;  4JA7 A;  5AIJ A;  2OVF A;  1PC2 A;  5FQ6 A;  1W3B A;  3MV3 B;  4JPS A;  2C0M A;  3TG4 A;  4C0M A;  5KJL A;  3D9I A;  1HZ4 A;  3CEQ A;  2I6H A;  4PH4 B;  3MX3 A;  2J09 A;  2XGS A;  4B0Z A;  2AXZ A;  1P5Q A;  3ASG A;  2DCP A;  3GW4 A;  5G04 C;  4I1A A;  4AOF A;  1Z6T A;  3PZD A;  4GA2 A;  3LY9 A;  4E6H A;  4EZJ A;  2GRM A;  3TL5 A;  4B89 A;  2XCC A;  4KYO B;  4LEU A;  3FU3 A;  3R7Q A;  3S7D A;  4N2Q A;  2WPV A;  3U3W A;  1NA3 A;  1JUQ A;  5E76 A;  3C98 A;  1E96 B;  3QNK A;  2Y3A A;  1E8Y A;  5DIZ A;  4EZK A;  3SZ7 A;  4WWP A;  3ZYM A;  5LP0 A;  3R9A B;  4BSX A;  4GYW A;  2WXN A;  2L6J A;  5HQ8 A;  3RK6 A;  4HOT A;  2VSO E;  2PL2 A;  4BWR A;  2LAI A;  2MHK A;  3KEZ A;  5T3R A;  2CHX A;  2LO6 A;  5FT9 A;  3VTX A;  3GYZ A;  4LUN U;  5FWQ A;  1NA0 A;  2HM8 A;  3GZ1 A;  2WXG A;  3FUL A;  2L0T B;  3L08 A;  3FTX A;  3CK9 A;  4KZ0 A;  3GZS A;  4DK5 A;  2AVP A;  3IHV A;  3ASH A;  1YA0 A;  2X3M A;  2ZU6 B;  3FTY A;  4NAC A;  1UN9 A;  4EBA G;  2V5F A;  5BV1 A;  3OXL A;  1VDY A;  1SZA A;  2XRY A;  3ENE A;  3OAW A;  4J8D A;  4J8E A;  4G2V A;  3FHE A;  4L1B A;  4N3C A;  4UQZ A;  3I4R B;  3MCX A;  4TUU A;  5LOZ A;  2VTB A;  1NZN A;  2AW6 A;  4N3B A;  4CDR A;  4G11 A;  1UJJ A;  3ZEF A;  3FWV A;  4ILG A;  3ESL A;  2WXI A;  4M3O A;  4P29 A;  1EDU A;  3FUF A;  4AXH A;  3FTW A;  3EIJ A;  1WAO 1;  3TG5 A;  2PZI A;  2UWJ G;  2I9C A;  2VJ8 A;  3P1U A;  2YNQ A;  4GAA A;  3SGH A;  3GZ2 A;  4L7T A;  4RG6 A;  1E7V A;  2WXR A;  4ME2 A;  2V0P A;  4B8A A;  4U04 A;  3D9J A;  2I1J A;  1ZBP A;  3BG1 B;  1N52 A;  3MGB A;  3NZS A;  3D9L A;  3KD7 A;  2NSZ A;  3FTZ A;  1HS6 A;  3CHM A;  4I9E A;  3UT4 A;  3FUI A;  3EJN A;  4JC8 A;  1EPU A;  1IYG A;  2WXL A;  4L2L A;  4GZ3 A;  1ELR A;  4I2Z A;  1WM5 A;  4AY5 A;  2ION A;  3APD A;  3CQC B;  1BPO A;  1IQU A;  3ZPJ A;  4MRU A;  4AP2 A;  2XPY A;  2CFZ A;  3MA5 A;  3UT7 A;  2HR2 A;  1E8Z A;  2HYZ A;  4FU3 A;  1Z3Y A;  1MHQ A;  4HLE A;  2P58 C;  4RG9 A;  2NC9 A;  2UY1 A;  5LX8 A;  3OXG A;  2XPZ A;  4L2Y A;  2V8S E;  3QDN A;  3FUM A;  2XRZ A;  3HIZ A;  5ARF A;  2C2L A;  4DI3 A;  1TJF A;  3ZHE B;  3JYS A;  3L13 A;  2VGY A;  3CVU A;  3MYV A;  3TXN A;  3AU4 A;  2L0I A;  2YHE A;  5KJN A;  3RKV A;  5AJD A;  2LSV A;  3CSF A;  5BW8 C;  3IKO B;  2LAH A;  3L17 A;  4KXK B;  3SHF A;  4AEZ C;  4AJW A;  2BUG A;  2WXP A;  2AXU A;  4GYY A;  4ACK A;  4O6F A;  2KCL A;  1QQE A;  4I6J A;  4K03 A;  3PEU B;  4NQ0 A;  3O4Z A;  2OV8 A;  4H7Y A;  4BY6 A;  2KCV A;  5CCL A;  2J4B A;  5KJK A;  3FTU A;  1OWM A;  4BTA A;  4AY6 A;  5A23 A;  3KS2 A;  1HG5 A;  2CHZ A;  3LKU A;  3FEX A;  3FU0 A;  4FP7 A;  4GA0 A;  3BEE A;  3I5P A;  4OYS A;  2XHE A;  3B7S A;  3TGO A;  3ZGQ A;  4BX8 A;  4JHJ A;  2CG2 A;  2IOS A;  2WXF A;  3G2V A;  3L54 A;  3LCA A;  4KMO A;  2X38 A;  4GYO A;  4V3I A;  5G55 A;  4FHJ A;  4U8H A;  3T5X A;  4C0E A;  5BT1 A;  3QOU A;  3KAE A;  4F53 A;  5BPP A;  4GML A;  4N5C A;  3FDH A;  4XKB A;  5DBK A;  4LRZ A;  5J90 A;  4N3A A;  5JJ6 A;  1A17 A;  4G23 A;  4GMJ A;  4Y6C A;  3MJW A;  3TJP A;  4ATG A;  2EQX A;  3L16 A;  1UJK A;  4APO A;  4WND A;  3VLE A;  3B7T A;  4CDM A;  2WXM A;  4HOU A;  3CVW A;  2X6K A;  2IQC A;  3DPD A;  4IUL A;  4XI9 A;  1H2T C;  5ANL A;  4HOS A;  1OUV A;  4MS6 A;  2KAT A;  2VYI A;  3AU5 A;  3CLJ A;  4TV3 A;  4EEC A;  1XNF A;  5KJM A;  4DI4 A;  4WAF A;  4AVX A;  3CVQ A;  3CVP A;  4J0U A;  4Q69 A;  3NZU A;  3DBS A;  2X6J A;  5A6C A;  4JHK A;  2YQ8 A;  3UT8 A;  2LSU A;  5EDS A;  2VGX B;  5JHA A;  2YIN A;  1QZ2 A;  3CHR A;  3D9K A;  5CMY A;  1ZU2 A;  3CHP A;  4W9R A;  4CT0 A;  3FU6 A;  3LPZ A;  4XIF A;  1E8X A;  4UWH A;  3RRU A;  2KM4 A;  4U63 A;  2VGX A;  5FZQ A;  4FJY A;  4F3V A;  3QJZ A;  3Q4A B;  3QAR A;  1SZ9 A;  2WB2 A;  4KBQ A;  5EX0 A;  3CQG B;  3PRZ A;  5A7D B;  3HDX A;  4HS2 A;  4CEM A;  3WXX A;  3FP3 A;  3SBS A;  1E7U A;  2R59 A;  3G2U A;  5CCM A;  2PQN A;  2E2E A;  2A4Z A;  2WMO A;  3IEG A;  1OWN A;  2XGO A;  2R17 C;  4LCT A;  4R7L A;  4B8C B;  5G04 J;  3ONK A;  4N2S A;  4GZC A;  2A5U A;  3FUH A;  4HOQ A;  5G05 C;  3LS8 A;  1TJC A;  4JHR A;  1PAQ A;  4GZ6 A;  2IFU A;  1Y8M A;  4PDX A;  3FUN A;  1ELK A;  2KZT A;  2YHC A;  3SF4 A;  3FU5 A;  3NF1 A;  4UQX A;  4WWO A;  3TXM A;  4D10 C;  1INZ A;  2X6I A;  4I2W A;  3ZW3 A;  4GCN A;  3SI5 A;  3FFL A;  2IF4 A;  4RVB A;  3UUX A;  3VLD A;  4CCA A;  1H0A A;  2BTD A;  4U07 A;  3MKQ A;  4JA9 A;  2KC7 A;  2OND A;  4GZD A;  3LEW A;  3APC A;  4JW1 A;  2WXO A;  4I43 A;  4B94 A;  5ENN A;  3ZYQ A;  4EQF A;  3B7U X;  3ZVV A;  2LNI A;  4U0S A;  3CV0 A;  2WM9 A;  1KT0 A;  4PS8 A;  3ZIM A;  2NXP A;  3ZYL A;  3SFZ A;  3Q47 B;  1HE8 A;  4I6G A;  1OWO A;  5CHE E;  3D9O A;  3FUE A;  3JCK C;  3PE4 A;  4YND A;  3I4G A;  1GW6 A;  2XGM A;  3CIA A;  2L9B A;  4ILI A;  3S7J A;  4ACL A;  4IRU A;  1KLX A;  5HI7 A;  5T4Y A;  3RRN B;  2J08 A;  3PS6 A;  2AWI A;  3G2W A;  4WNG A;  1E90 A;  4EZL A;  2KCK A;  3K9I A;  2VTB B;  4U0U A;  4I9C A;  3CVL A;  2FEZ A;  4JEU A;  4FJZ A;  5J08 A;  4L23 A;  3EDT B;  3O48 A;  5EX3 A;  5G05 J;  3CKB A;  2WXQ A;  4BTB A;  4QFV A;  4JEH A;  1OWP A;  1Z3X A;  3SNX A;  3S2A A;  4I6E A;  1PY1 A;  4GZ5 A;  4UWL A;  4DPR A;  5FZS A;  5T8I A;  3URZ A;  3FUJ A;  1H2U A;  5LFA A;  4Q94 A;  4MKT A;  4WNF A;  3E4B A;  3D9M A;  5FTP A;  4AIF A;  2J07 A;  4G1T A;  2J9Q A;  4JXT A;  4UWK A;  3T5V A;  1JWF A;  3QWV A;  3CK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...