4N2QA

Crystal structure of tha8 in complex with zm4 rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THA8 RNA binding protein
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Splicing/rna
total genus 69
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n2qA00
4J8DA 3WXXA 4RG9A 3FWVA 5A6CA 2XCCA 4U04A 3LY7A 4BTAA 4GYYA 2VYIA 1PC2A 1QQEA 3CVQA 2P58C 2FO7A 3EDTB 3FP3A 4UI9C 4N3CA 5BT1A 4GZ5A 3PDNA 4RG6A 3JYSA 3GYZA 5FTPA 4AIFA 3KAEA 2XPIA 3OXLA 3CK9A 2FEZA 3CKBA 3GW4A 3UQ3A 3CEQA 3VTYA 4GYOA 5EX3A 4GA2A 4WNFA 2HO1A 4YVQC 3KS2A 4U07A 5ARFA 4WNDA 4CGVA 3S7BA 5KJLA 1FCHA 1IHGA 3LCAA 2KATA 3LPZA 4JA7A 4N3AA 2WQHA 4N2QA 3BEEA 5C1DA 3CVPA 4JL0A 5JJ7A 1NA3A 4BTBA 2UY1A 1HXIA 5CHEE 4YVOA 3CK7A 2FBNA 2L6JA 3RIBA 5AYWD 5ARGA 2QFCA 5FT9A 4H7XA 4GA0A 2NC9A 4J8EA 5HQ8A 3Q49B 4CDRA 3PE4A 4JHRA 3ULQA 2LSVA 3TGOA 3RO2A 5G05C 1TJCA 4B94A 3AS8A 5CCLA 4G23A 4G1TA 4I2ZA 1NZNA 2KCVA 3NF1A 2OOEA 3MEKA 1ZU2A 3QWWA 3SF4A 3LYAA 4GCNA 1HH8A 4UQXA 2E2EA 5DIZA 3S7DA 2XEVA 2LNIA 2I6HA 1KLXA 5HI7A 5FZRA 2Y4TA 2VGXB 4G25A 4CGWA 5M72A 3MA5A 5JJTA 1HZ4A 3PE3A 4UQZA 4N2SA 4WNEA 2VGXA 1KT0A 4UI9J 5D0OD 4XI9A 4F3VA 3ZPJA 2WPVA 5FZQA 3HYMB 2YQ8A 1ZBPA 5A7DB 3Q4AB 4Y6CA 4I9EA 2C2LA 4HOTA 4N39A 1ELWA 4O6FA 2VQ2A 3TG5A 5JJ6A 3VTXA 3R9AB 3RJVA 2R5SA 2GW1A 1W3BA 2FI7A 4W9RA 3SZ7A 3QWVA 3AS5A 2UY1B 4I17A 2KC7A 3ASFA 3OXGA 4I2WA 4BT9A 1A17A 2PQRA 1E96B 1P5QA 5G04J 2VSNA 2HR2A 3K9IA 4GYWA 3CKCA 3RU0A 3ASDA 3U4TA 4J0UA 3IEGA 3ZHEB 3S7JA 2YHCA 3LKUA 2KCKA 3Q15A 3FFLA 3CK8A 3TAXA 1B89A 5D0QD 3ZHEA 4XIFA 2HYZA 2BUGA 5DBKA 4GPKA 4KBQA 3GZ1A 2ONDA 2PQNA 1WAO1 4WNGA 2JLBA 5LCWC 1XNFA 2DBAA 2V5FA 2PZIA 3GZ2A 5BNWA 2VSYA 4HOSA 5EX0A 4AY5A 4N5CA 4NQ0A 4GZ6A 4U0ZA 2LSUA 2C0MA 2KCLA 2MHKA 5KJMA 3URZA 2VGYA 5EKQD 3ESKA 3CVLA 4JA9A 4HOQA 2FF4A 2PL2A 4ABNA 2IF4A 4XI0A 3RKVA 3MV3B 4GCOA 3E4BA 4UQYA 3ASHA 4I1AA 2XGMA 4N3BA 4H7YA 3LY9A 4HOUA 4U0UA 1NA0A 4G24A 3ZN3A 1Y8MA 3N71A 1YA0A 5FZSA 3TG4A 4AM9A 4LEUA 1QZ2A 4ME2A 2XGSA 2C0LA 4BT8A 4APOA 4U0SA 2AVPA 3MV2B 3CV0A 4I9CA 3U3WA 4GZ3A 4KYOB 2XCBA 3Q5MA 4YNDA 4UI9K 3KD7A 2Q7FA 5KJKA 3QOUA 2IFUA 3UPVA 3LY8A 3QDNA 3UUXA 1OUVA 3RO3A 5KJNA 3O48A 3QWPA 1IYGA 5G05J 5G04C 2UWJG 4A1SA 3CVNA 4NRHB 4HORA 3OXFA 3ZGQA 3QKYA 5CCMA 2J9QA 2Y4UA 3S7FA 4EQFA 4G26A 5BW8C 1WM5A 3Q47B 4IN3B 4KXKB 3MKRA 4G2VA 5LCWJ 3ASGA 4J8FA 2XGOA 3ZFWA 5FJYA 4GA1A 4AY6A 1ELRA 3AS4A 4BWRA 1KT1A 4Y6WA 4WUYA
chains in the Genus database with same CATH superfamily
1LTXA 5A6CA 2J07A 2YINA 3B7BA 2QZAA 2EIME 2WB2A 2B6CA 5BV0A 3DWLG 4A3TA 1N0QA 1KZOA 2VYIA 3KEZA 3HG0D 4HXIA 4M3OA 3UT4A 4WAFA 4RLYA 2MYOA 1N95A 2P9IG 3TWWA 5FINA 4XZ4A 1MX6A 2WXHA 5LX8A 4GZ5A 4RG6A 2I9CA 5AAOA 4G8KA 1IKND 2FEZA 1SZ9A 1IXVA 2BKKB 3CQGB 3VTYA 3BU8A 4NACA 5BV1A 3E34A 2ZGGA 3BG1B 3ABME 4YVQC 3LS8A 3CHMA 4U63A 4WNDA 2WMNA 2P9LG 1Q2ZA 1SZAA 3S7BA 2Y0BG 5AIJA 4JB8P 1IHGA 1JWGA 2XEHA 4JA7A 3EIJA 2DZOA 1BD8A 3DPYA 3E37A 4WWNA 5JJ7A 3Q7FA 1TNUA 4CT0A 1HXIA 4YVOA 2L6JA 3RIBA 3SBSA 2QC9A 1E8ZA 4LNBA 3SY2A 3DSTA 3DSSA 4GA0A 4LCTA 3SD5A 4KZCA 2LUHA 3FTVA 3ULQA 2LSVA 4GMJA 2XPYA 4KVMA 2IONA 4DX7D 3L08A 5BUZA 1Z3XA 4G23A 4L2LA 1ZB1A 3CHPA 5AQ9A 2EINE 2NYJA 3LYAA 4FHJA 1TEZA 4UQXA 2E2EA 3CVUA 3EHNA 4AV7A 5FZRA 2Y4TA 3UTMA 4TUMA 2ZIRA 3TL5A 2V0PA 3JXJA 3FU6A 4GTPA 3HXDA 2DCPA 2VGEA 2DYRE 1TYQG 4UQZA 3R7QA 4WNEA 3HRAA 2AJAA 3U66A 5D0OD 4CCAA 2WPVA 4ATZD 1LD7A 4GTRA 4XEIG 1H19A 3KSLA 4ANUA 5A7DB 2WXRA 2RFAA 1ELWA 4O6FA 3L54A 2IU1A 4YDYA 3TWTA 4E85A 3ABKE 5A23A 4LRZA 2R5SA 3RJVA 2GW1A 4W9RA 1OY3D 4FULA 3D9KA 4GMRA 2GRQB 1PY1A 2V4LA 3CVWA 1TN8A 4OYSA 2PQRA 4I6JA 3KSQA 3PS6A 1RW2A 4JHKA 1WY6A 3K9IA 2Y3AA 5AN8A 3ZIMA 3ASDA 4ILGA 2QYUA 3ZU7B 3ULEG 4JZYA 5CECB 3CVVA 3UMVA 3C72A 3ZHEB 3Q73A 3S7JA 2KCKA 4A55A 1HG2A 4Q69A 2GRNB 3DRAA 3UXGA 4WWPA 3DSVA 1EDUA 3V31A 1YYHA 4CEMA 3B95A 3T8KA 4TXRA 1N9AA 2XS1A 4B8CB 2EILE 4GPKA 4KBQA 2X6KA 3GZ1A 2ONDA 3X2QE 5CMWA 1WAO1 4OVUA 3TWVA 2NXPA 3HXEA 5ENRD 4U7EB 1E7VA 1XNFA 4DJAA 3E33A 2PZIA 3GZ2A 4FU3A 4FA6A 3R9MA 1IQRA 4BY6A 4N5CA 4GZ6A 2P9SG 2MHKA 1D8EA 5KJMA 3CHOA 2VGYA 3ESKA 2JABA 3R7RA 1H6KA 4JA9A 2FF4A 4UWKA 4EPZA 3ABLE 4ABNA 4FLBA 3FUIA 3MV3B 3E4BA 3J5PA 3L6AA 2KZTA 1V55E 4I1AA 4N3BA 3LY9A 4F1SA 5E76A 4OAUC 3N71A 3VLDA 3FUJA 2ZXWE 2WQ6A 5AJDA 1YA0A 4APFA 4LEUA 3BQOA 2EIJE 3D3MA 3MV2B 1SVXA 3MGBA 2J8SD 3CHRA 4GTTA 1FT2A 3CHSA 4KYOB 3Q5MA 4ILIA 4DRXE 1UN8A 3HDXA 3QDNA 5EILA 3UUXA 1OUVA 1D9SA 3FUHA 5EN5D 3AU4A 1IYGA 3ZYMA 5G05J 3CHQA 2WXIA 4E6HA 5CEDB 2GGFA 3CVNA 5AQAA 2A5UA 3ULYA 3QKYA 3SFYA 2E0IA 2XRYA 4EQFA 1WM5A 2MRIA 3B7SA 5LCWJ 3ASGA 2B0OE 2XGOA 4GA1A 1ELRA 1HO8A 1KT1A 4Y6WA 1OCZE 4WUYA 4YDEA 4J8YA 3FWVA 2XCCA 1VDYA 4L1BA 4GTQA 1HG5A 3LXUX 3IV0A 4U04A 3LY7A 1INZA 3DXKG 1NFIE 4BTAA 3SBTB 3PREA 5J08A 2GRPB 4JC8A 2X38A 5D2MC 1H2VC 5KCMA 2J4DA 2CFUA 1H2UA 4IRUA 2IY0C 2P58C 5LOZA 1G3NB 4BESA 2IO3C 5AQBA 3Q78A 2KZTB 4GTSA 3TXMA 2KBXA 4B8AA 1DC2A 5FQ7A 2CG2A 3F6QA 4UI9C 4JW1A 4UWFA 5BT1A 2I1JA 3PDNA 3JQ1A 3QJZA 4GTOA 4DX6D 4AIFA 4EZJA 2XPIA 3OXLA 3ML9A 2WMOA 3FU5A 4HLLA 3CK9A 3CKBA 2X6HA 4DI4A 2LXMA 4HLEA 2HO1A 1Y6IA 2F8YA 3KS2A 3FHEA 4IYPA 4K5BA 3EJNA 4HS2A 4ILHB 3OAWA 4X8QA 2KXPC 1D8DA 4I1OB 3HXFA 4N2QA 3BEEA 2CFZA 3E32A 3CVPA 2YHEA 2I2OA 3JUIA 1HS6A 1NA3A 4HNAD 4GZCA 4FLHA 4G11A 3CK7A 5CEAA 3LJ3A 2AWIA 5AYWD 3NQPA 4RVBA 5ARGA 2QFCA 2IEJA 4DPRA 4H7XA 4ATGA 3Q49B 3ZEFA 3UM3A 4CDRA 5ENQD 3UI2A 3LVRE 2RKKA 3TGOA 3FY4A 4AOFA 3L82A 5EYLA 5G05C 1TJCA 2R2LA 2AW6A 3FTWA 3W9FA 2AXZA 3LDZA 3TWQA 5CCLA 4BFRA 3P2BA 1NZNA 2OOEA 1ZU2A 3QWWA 3MYVA 3HXCA 4HB5A 1U3DA 4GCNA 2EIKE 1IQUA 3S7DA 3PUJA 2LNIA 4TXQA 2VGXB 1UJKA 4FADA 5M72A 2F8XK 2OEVA 4JEHA 1KZPA 2XZDG 2R03A 5EDSA 5BXOA 4TRQA 5CBOA 4OVVA 3UIPC 3UT7A 3VLEA 1UW4B 2BTDA 3FULA 3FTUA 1BPOA 3PH0C 5FZQA 2X3MA 3UM0A 4I9EA 1FVHA 4K5CA 2NSZA 5JHAA 3O4ZA 4M7CA 2VQ2A 3RRNB 2L9BA 3CR3A 3UINC 1SQMA 3APDA 3TG5A 5BXUA 5JJ6A 3BUAA 1LD8A 4HI9A 3SZ7A 1OWPA 3QWVA 1SA4A 4LG6A 4A1GA 4I17A 3ZXPA 5T4YA 3ASFA 3OXGA 4NURA 4HI8A 4GU5A 5FIOA 1N4SA 1EF1C 5HS0A 2L0TB 5ANLA 4BT9A 3QAQA 4FJYA 2VJ8A 2H6IA 2P9PG 3FTYA 2HR2A 4GYWA 1IHBA 3AG4E 1N52A 3Q9UC 3RU0A 4A63B 3GZSA 4F6RD 3EIQC 3PRZA 2ZU6B 1OWNA 3IEGA 2ETCA 3EU5A 1BI7B 3LKUA 3Q15A 3FFLA 3CK8A 1K8KG 2XHEA 1TNZA 3C5RA 1UJJA 3ZHEA 1SW6A 4LERA 4Z68A 5DBKA 1MX2A 1O1TA 3QNKA 3C3OA 5CMYA 2A4ZA 3HXBA 4WNGA 3P1UA 3TWRA 3IKOB 4AJWA 1TN7A 1OWLA 2V5FA 3FH7A 3V2OA 2XS8A 4ACKA 4I1MA 4JHJA 3UKUG 5FQ6A 3L9TA 2DIWA 1DCEA 4NIKA 2C0MA 2RG8A 1EYHA 4G8LA 3URZA 5EKQD 4BX9A 2WXNA 1Z5SC 3CVLA 3RAUA 3MZLB 1OCRE 3NOCD 4MS6A 3RKVA 5FWQA 2XENA 3SI5A 2ZGDA 3BG0B 3FH8A 3L16A 4UQYA 3ASHA 3ASOE 3FTXA 3QARA 3CSTA 2OV8A 4H7YA 2XEEA 4O60A 1NA0A 4G24A 3ZN3A 1NL4A 3ONLA 4V3IA 3SQVA 4DLOA 1OXJA 4ME2A 3B7RL 4EZLA 1MYOA 1H2TC 3MKQA 3FTSA 3CV0A 2FO1E 5B3SE 2X6FA 4C48B 4BSZB 4I9CA 4UWLA 3Q7AA 4UI9K 3QOUA 3RRUA 2GRMA 1UG3A 2P9NG 4LSZE 4A3VA 3RO3A 1MHQA 3QWPA 3AG2E 4N5QA 5C2YA 1E90A 1S0PA 4HRNA 5ANRA 3OTNA 2WXLA 3D9IA 2LAHA 4DX1A 2OCCE 3Q75A 3AJIA 2Y4UA 3S7FA 3TWXA 3ZVVA 1V54E 4BEPA 5LP0A 3ZYKA 1N4QA 4FP7A 5J90A 3AS4A 2IJGX 1JCQA 4JPSA 3S2AA 3D9JA 3T9KA 4L9PA 4YDWA 3L22A 2H6HA 3CVQA 5ENPD 2FO7A 3AU5A 1S70B 2R59A 4AVXA 3EDTB 3MJWA 5AENA 2Y69E 4U8HA 2WXFA 1FPPA 5ENNA 3GYZA 4L7TA 4WWOA 3KAEA 1U2VG 4CT4A 3MKQB 3GW4A 2V5QC 4GYOA 3IHVA 3JCKC 4GA2A 3CVXA 1OT8A 4WNFA 3AG3E 3I4RB 4MKTA 3WG7E 4U07A 4K0RA 3B7UX 5ARFA 4CGVA 4LNGA 5B1AE 2EQXA 3NZSA 3LCAA 3G2WA 4N3AA 3QB2A 2GRLA 3PVLA 4HFGA 3D9NA 1NI1A 3ZW3A 2UY1A 2V8SE 3ZYLA 4GAAA 3PEVB 4C9BB 3TJPA 1Z3YA 4BETA 4B0ZA 5FT9A 3IBEA 4UUCA 1MQSA 3G2TA 4KMOA 3CGHA 2P9KG 5HQ8A 5HKPA 2OEWA 3IHYA 3PE4A 4JHRA 2I1KA 4F7AA 3RO2A 3LEWA 3JUEA 1E7UA 3ZUVB 3AS8A 2HM8A 5JHBA 4I2ZA 3NF1A 4TUUA 5CERB 5G2NA 3SF4A 3C98A 4JD2G 5DIZA 2R02A 2XEVA 2I6HA 4DUIA 4FC8A 1NP7A 3LVQE 3PUKA 4PUCA 5CRVA 1SA5A 3MA5A 3DEOA 4I6GA 2XZTG 2QYJA 3UM1A 1XGWA 1HZ4A 3PE3A 2ZISA 2VGXA 5KNGA 3ZRHA 3NOGD 4IULA 4XI9A 2KM4A 4F3VA 3ASNE 3AAAC 3HYMB 1N11A 2YQ8A 4U95D 1ZBPA 4N39A 4CZ2D 1QYMA 5AQ7A 2V4HC 3R9AB 3VTXA 3TWSA 1W3BA 2FI7A 5H7PA 4HRMB 5AARA 2UY1B 3HHMA 2KC7A 3C3QA 4HQDA 1MX4A 4GB9A 1N54A 2WM9A 3ESLA 4CDMA 3TWUA 1BLXB 1OWOA 1P5QA 3UIOC 3L17A 2VSNA 4EZKA 3APFA 5ITZF 4PS8A 3EHQA 4J0UA 1JPLA 4UWHA 5CBNA 1FT1A 2JEKA 2CHWA 4I43A 4JEUA 5EIBE 1QBQA 3FUFA 1B89A 5D0QD 1E8XA 4KT6B 4MLPA 2HYZA 2BUGA 3L13A 4B89A 4ANWA 5ENSD 1JUQA 1A5EA 1LF8A 5LCWC 3DPDA 1O1RA 2VSXE 2VSOE 1N4PA 3EHRA 5BNWA 1X81A 1L5JA 1U3CA 1N94A 3NB2A 1AP7A 1JCRA 5EX0A 3UM2A 4AY5A 4RSYA 3U9WA 4PS3A 2P9UG 4NQ0A 4U0ZA 1TNBA 3SNXA 4FHKA 3HVEB 4HOQA 4K5AB 3JQ0A 2PL2A 3FUMA 3ZXSA 1TNOA 4I6EA 2PNNA 2WQ7A 2XGMA 4U0UA 2A5EA 3RK6A 3TG4A 5FZSA 2WXOA 1QZ2A 4P29A 3MX3A 2XGSA 4APOA 4U0SA 3DBSA 5EIDA 4TV3A 1Z6TA 4K03A 4GZDA 4U8YD 3FUNA 2PM6A 3U3WA 4GZ3A 2XCBA 1WG0A 4LNUD 3FUEA 3KD7A 2Q7FA 2RD0A 1GW6A 1OCCE 1AWCB 3LY8A 2WXQA 1O1SA 1E8YA 1KPSB 3ZKJA 3HIZA 1K1AA 3SGHA 5AJLA 3CLJA 4C0EA 3FUKA 3EU9A 2PM7A 3PNTB 4NRHB 2L6BA 3QC1A 3OXFA 2H6FA 2IQCA 3TXNA 5HRYA 4BSXA 3RRMB 2J9QA 2L0IA 3W9GA 4YDOA 3Q47B 2GRRB 4IN3B 1H6OA 3E30A 3D9OA 3MKRA 3V79K 4J8FA 3SFZA 3ZFWA 4CDNA 4J8DA 4U8VD 3WXXA 4RG9A 5FQ4A 5E75A 2ETBA 3CVYA 5KBAA 1S64A 4GTMA 1TNYA 5T8IA 2H6GA 4Q96A 3PZDA 4GYYA 1H0AA 4EBAG 4PS7A 3PEUB 1PC2A 1QQEA 3MCXA 4Q94A 3ML8A 2ETAA 1DNPA 3UT8A 3FP3A 4N3CA 1MJ0A 3JYSA 4DLQA 4HVBA 3I5PA 5FTPA 2F0YA 2BKGA 3UQ3A 3CEQA 3C3RA 5EX3A 2LO6A 2R17C 3ZNGA 4OAVB 5EYPF 1ELKA 3FTZA 2DVWA 3G2UA 5KJLA 1FCHA 2BF0X 2WXKA 2Y1LE 2KATA 3LPZA 2IO2C 2XRZA 5LFAA 2WQHA 5C1DA 4JL0A 4ANXA 2X6IA 4F53A 3DXMG 3FH5A 4BTBA 1X5BA 1YCSB 5CHEE 3ENEA 1UN9A 2QY7A 2FBNA 3NAWA 4UWGA 2J08A 2J09A 3U64A 4CRWA 3DEPA 4QQIA 2CHZA 2J4BA 2NC9A 4J8EA 1E8WA 3V30A 2VTBA 1K1BA 1BU9A 4HBDA 2WXGA 2FULA 1TJFA 4B94A 4RQIA 4HRLA 3QK0A 3FUDA 2YNQA 3B7TA 4G1TA 1N0RA 2KCVA 3MEKA 4CYMD 3NZUA 1HX8A 1HH8A 3CIAA 3T8MA 2LXLA 5G55A 1KLXA 5HI7A 4AXHA 4G25A 2LAIA 4CGWA 3B13A 3JXIA 5JJTA 2F37A 2WVIA 1EPUA 3PZ3A 1YMPA 2X6JA 4N2SA 3G2VA 4O1PA 3I3NA 1KT0A 4UI9J 4DI3A 4ZHBA 4O1OA 3ZPJA 4DX2A 2IOLA 2J49A 1FVFA 3Q4AB 4Y6CA 4HOTA 2C2LA 2AXUA 1S63A 2MOWA 4LUNU 3FU0A 4U96D 1MZCA 3DSXA 1PAQA 1DVPA 3LJNA 4EECA 2RFMA 4J8SA 3UX4A 4XKBA 2GROB 3AS5A 4BX8A 4FJZA 4I2WA 1HE8A 3FDHA 1H6PA 4JVSA 1A17A 1K3ZD 1E96B 2VTBB 5G04J 2OVBA 4L2YA 3CKCA 4EBAA 3U4TA 4AEZC 1HFAA 4J6IA 4QFVA 4MBGA 4XX5A 3EUVA 2HE0A 3ISMC 4ZFHA 4JXTA 2YHCA 1HU3A 3D9PA 2DZNA 3T5VA 3TAXA 3PNLB 1QNFA 3G2SA 2WXPA 1OCOE 3KEAA 4XIFA 4ANVA 5ENTD 1N4RA 4L23A 4KZ0A 3PZ4A 4PH4B 2PQNA 2WXJA 3FEXA 2JLBA 3UKRG 1OWMA 5CRUA 2DBAA 2WXMA 4PDXA 4F1PA 3SO8A 5ENOD 3ONKA 2XPZA 2VSYA 1BI8B 2AXVA 3AG1E 4HOSA 2P2CP 1JWFA 3V2XA 3EHMA 2LSUA 2ILRA 2KCLA 3APCA 3VLFA 4AP2A 4DK5A 1TR4A 3T5XA 3D9HA 5FQ8A 1WDYA 2IF4A 3CQCB 2R05A 4XI0A 3ZYQA 4D10C 2M63A 3Q79A 4GCOA 3HVEA 3CSFA 4EHMA 3I4GA 4GMLA 4HOUA 4KVOA 5BPPA 4XKCA 3Q9NC 2XQ0A 3SHFA 4TXPA 2DYSE 3RSEG 3SFXA 1Y8MA 3D9LA 2IOSA 4AM9A 5KWDA 5JA4D 1TN6A 4GPMA 2C0LA 4BT8A 5B1BE 5IY5E 2CHXA 2AVPA 5D66A 4B93B 4YNDA 5KJKA 1O5MA 2IFUA 3FU3A 3UPVA 4MRUA 4GTVA 3PZ2A 4C0MA 3D9MA 1JCSA 2DWZA 5JMND 5KJNA 3O48A 3DSUA 2OVFA 2BEDA 3DSWA 1RZ4A 5G04C 2UWJG 4A1SA 4BERA 4HORA 2CG3A 4R7LA 4XE0A 3ZGQA 5T3RA 5CCMA 4J7WA 1HF8A 3PZ1A 3IXEA 4G26A 5BW8C 5KNHD 4KXKB 4G2VA 3J5QB 4ACLA 4DX5D 5FJYA 4AY6A 1DCQA 1UOHA 4BWRA 3FEYA 4URKA 3NBNB
chains in the Genus database with same CATH topology
4J8DA 2IJGX 4JPSA 3WXXA 4RG9A 3S2AA 3FWVA 5FQ4A 3D9JA 5A6CA 2J07A 2YINA 2XCCA 5E75A 1VDYA 4L1BA 3CVYA 1HG5A 3LXUX 3IV0A 2WB2A 4U04A 3LY7A 1INZA 5BV0A 4A3TA 4BTAA 3SBTB 3PREA 5T8IA 5J08A 4JC8A 2X38A 4Q96A 3L22A 3PZDA 2VYIA 3KEZA 4GYYA 1H0AA 4EBAG 1H2VC 4HXIA 4M3OA 4PS7A 5KCMA 2J4DA 1PC2A 2CFUA 3PEUB 1H2UA 1QQEA 3MCXA 4IRUA 4Q94A 3CVQA 4WAFA 2FO7A 2P58C 3UT4A 3ML8A 5LOZA 3AU5A 2R59A 4XZ4A 2KZTB 1DNPA 3TXMA 4AVXA 3UT8A 4B8AA 3EDTB 5FQ7A 2WXHA 3MJWA 5AENA 2CG2A 5LX8A 3FP3A 4JW1A 4UI9C 4UWFA 4N3CA 5BT1A 2I1JA 2WXFA 4GZ5A 4U8HA 3PDNA 4RG6A 5ENNA 2I9CA 3JYSA 4DLQA 4HVBA 3GYZA 4L7TA 3I5PA 3JQ1A 4WWOA 5FTPA 3QJZA 4AIFA 3KAEA 4EZJA 2XPIA 3OXLA 4CT4A 3ML9A 2WMOA 3FU5A 3MKQB 3CK9A 2FEZA 1SZ9A 3CKBA 2X6HA 3GW4A 3UQ3A 3CEQA 3CQGB 3VTYA 4DI4A 4GYOA 5EX3A 3IHVA 2LO6A 2R17C 3JCKC 4GA2A 3CVXA 4NACA 4WNFA 5BV1A 4HLEA 2HO1A 3I4RB 1Y6IA 4MKTA 3BG1B 3KS2A 4U07A 4YVQC 1ELKA 3FHEA 3LS8A 3B7UX 3FTZA 3CHMA 4K0RA 4U63A 4WNDA 5ARFA 4CGVA 2WMNA 1SZAA 3G2UA 4IYPA 2EQXA 3S7BA 5AIJA 5KJLA 3NZSA 3EJNA 4HS2A 1FCHA 2BF0X 1IHGA 1JWGA 2WXKA 3OAWA 4ILHB 3LCAA 2KATA 3LPZA 3G2WA 4I1OB 2XRZA 4JA7A 5LFAA 3EIJA 4N3AA 2WQHA 4N2QA 3BEEA 5C1DA 2CFZA 3QB2A 3CVPA 2YHEA 4WWNA 2GRLA 4JL0A 4ANXA 2I2OA 3JUIA 1HS6A 2X6IA 3PVLA 4HFGA 4F53A 1NA3A 3D9NA 5JJ7A 3ZW3A 3FH5A 4BTBA 2UY1A 1X5BA 2V8SE 1HXIA 5CHEE 4CT0A 4GZCA 4FLHA 3ZYLA 4G11A 4YVOA 3CK7A 3ENEA 1UN9A 2QY7A 2FBNA 3LJ3A 2L6JA 4GAAA 2AWIA 3RIBA 3PEVB 4C9BB 4UWGA 3TJPA 1Z3YA 2J08A 2J09A 5AYWD 3U64A 3NQPA 4CRWA 3SBSA 4RVBA 1E8ZA 5ARGA 2QFCA 4B0ZA 5FT9A 4DPRA 3IBEA 1MQSA 2CHZA 4H7XA 4GA0A 2J4BA 2NC9A 3G2TA 1E8WA 4J8EA 3CGHA 4KMOA 4LCTA 4KZCA 3SD5A 3Q49B 4ATGA 5HQ8A 3ZEFA 4CDRA 2VTBA 3IHYA 3LVRE 3PE4A 4JHRA 3FTVA 2I1KA 3ULQA 2LSVA 4GMJA 3TGOA 3FY4A 4F7AA 2XPYA 4AOFA 2WXGA 3RO2A 5G05C 2FULA 1TJCA 4KVMA 2IONA 2AW6A 1TJFA 3LEWA 3FTWA 4B94A 2AXZA 1E7UA 4AV7A 3L08A 3AS8A 3QK0A 2HM8A 1Z3XA 5BUZA 3LDZA 3FUDA 2YNQA 5CCLA 4G23A 3B7TA 4G1TA 4BFRA 5JHBA 3P2BA 4L2LA 4I2ZA 1NZNA 2KCVA 3NF1A 4TUUA 2OOEA 3CHPA 3MEKA 5G2NA 3NZUA 1HX8A 1ZU2A 3MYVA 3QWWA 3SF4A 3LYAA 1U3DA 3C98A 4GCNA 1HH8A 4FHJA 1TEZA 4UQXA 3CIAA 1IQUA 2E2EA 3CVUA 5DIZA 3S7DA 3T8MA 2XEVA 2LNIA 2I6HA 3PUJA 5G55A 3EHNA 4FC8A 1KLXA 5HI7A 5FZRA 2Y4TA 1NP7A 2LAIA 2VGXB 3LVQE 3PUKA 4G25A 4PUCA 4AXHA 4CGWA 1UJKA 4FADA 3B13A 5M72A 3TL5A 3MA5A 2V0PA 4JEHA 3FU6A 5JJTA 4I6GA 2DCPA 2WVIA 1XGWA 1HZ4A 1EPUA 5EDSA 3PE3A 2X6JA 4TRQA 4UQZA 3R7QA 4WNEA 4N2SA 3G2VA 3I3NA 2VGXA 4OVVA 3ZRHA 1KT0A 3U66A 4UI9J 3UT7A 5D0OD 3VLEA 4IULA 4XI9A 4DI3A 2KM4A 1UW4B 3ZPJA 4F3VA 4CCAA 2BTDA 2WPVA 3FULA 3FTUA 1BPOA 3PH0C 5FZQA 3HYMB 2YQ8A 2X3MA 2IOLA 1H19A 2J49A 4ANUA 1FVFA 1ZBPA 5A7DB 3Q4AB 2WXRA 4I9EA 2C2LA 1FVHA 4Y6CA 2AXUA 4HOTA 4N39A 2MOWA 4LUNU 2NSZA 5JHAA 3FU0A 1ELWA 3O4ZA 4O6FA 2VQ2A 3L54A 2IU1A 3RRNB 4E85A 2L9BA 3CR3A 5A23A 1SQMA 3APDA 4LRZA 3TG5A 1PAQA 5JJ6A 1DVPA 3R9AB 3VTXA 4EECA 2R5SA 3RJVA 2GW1A 1W3BA 4J8SA 2FI7A 4W9RA 3UX4A 4XKBA 3SZ7A 1OWPA 3QWVA 4FULA 3AS5A 2UY1B 4A1GA 3D9KA 3HHMA 4I17A 2KC7A 4BX8A 5T4YA 3ASFA 3OXGA 4FJZA 4I2WA 4NURA 4GU5A 1EF1C 1HE8A 1PY1A 3FDHA 4GB9A 2L0TB 1N54A 2V4LA 4JVSA 5ANLA 4BT9A 2WM9A 3CVWA 3ESLA 3QAQA 4FJYA 4CDMA 1A17A 4OYSA 1OWOA 2PQRA 1E96B 2VTBB 2VJ8A 1P5QA 4I6JA 5G04J 3PS6A 3L17A 2VSNA 3FTYA 4JHKA 1WY6A 2OVBA 2HR2A 3APFA 3K9IA 4L2YA 4GYWA 4EZKA 3CKCA 4EBAA 1N52A 2Y3AA 3RU0A 3ZIMA 3ASDA 3U4TA 4PS8A 4ILGA 4AEZC 3GZSA 1HFAA 3EIQC 3PRZA 4JZYA 4J6IA 4QFVA 4J0UA 2ZU6B 1JPLA 3CVVA 3UMVA 1OWNA 4UWHA 3IEGA 4XX5A 3ZHEB 2JEKA 3S7JA 2CHWA 4I43A 4JXTA 2YHCA 3LKUA 4JEUA 1HU3A 2KCKA 1HG2A 3D9PA 4A55A 3Q15A 4Q69A 3FFLA 3T5VA 3CK8A 3FUFA 3TAXA 1B89A 4WWPA 2XHEA 5D0QD 3PNLB 1QNFA 1EDUA 3G2SA 1E8XA 1UJJA 2WXPA 4KT6B 3ZHEA 4CEMA 4XIFA 4MLPA 4LERA 4ANVA 2HYZA 2BUGA 3L13A 4B89A 4B8CB 5DBKA 4ANWA 4GPKA 4KBQA 4L23A 4KZ0A 2X6KA 3GZ1A 3QNKA 2ONDA 4PH4B 5CMYA 2PQNA 5CMWA 1JUQA 2WXJA 2A4ZA 1WAO1 3FEXA 4OVUA 4WNGA 3P1UA 2NXPA 3IKOB 2JLBA 1LF8A 5LCWC 4AJWA 3DPDA 1E7VA 1XNFA 1OWMA 2VSXE 2WXMA 2DBAA 4PDXA 1OWLA 2VSOE 2V5FA 4DJAA 3FH7A 2PZIA 3GZ2A 4ACKA 3ONKA 5BNWA 2XPZA 2VSYA 4FU3A 4I1MA 2AXVA 4JHJA 1L5JA 4FA6A 4HOSA 1U3CA 5FQ6A 2DIWA 1IQRA 5EX0A 4BY6A 4AY5A 1JWFA 3EHMA 4RSYA 3U9WA 4N5CA 4PS3A 4NQ0A 4GZ6A 4U0ZA 2LSUA 2C0MA 2ILRA 2KCLA 2MHKA 2RG8A 3SNXA 5KJMA 1EYHA 3CHOA 3APCA 3URZA 4URKA 2VGYA 5EKQD 3ESKA 4FHKA 3HVEB 4BX9A 2WXNA 3CVLA 3R7RA 1H6KA 3VLFA 4AP2A 4JA9A 4DK5A 4HOQA 2FF4A 4UWKA 3MZLB 3JQ0A 4EPZA 2PL2A 3T5XA 5FQ8A 4ABNA 2IF4A 3CQCB 4FLBA 4MS6A 3FUIA 4XI0A 3RKVA 3ZYQA 4D10C 5FWQA 3MV3B 3FUMA 3SI5A 2M63A 4GCOA 3BG0B 3FH8A 3HVEA 3E4BA 3CSFA 4I6EA 3ZXSA 3L16A 3L6AA 4UQYA 3I4GA 3ASHA 3FTXA 2KZTA 2WQ7A 4GMLA 3QARA 3CSTA 4I1AA 2OV8A 2XGMA 4N3BA 4H7YA 3LY9A 4HOUA 4KVOA 4U0UA 4XKCA 4F1SA 5BPPA 5E76A 2XQ0A 3SHFA 1NA0A 4G24A 4V3IA 3ONLA 1Y8MA 3N71A 3RK6A 3FUJA 3VLDA 3ZN3A 3D9LA 2WQ6A 5AJDA 1YA0A 5FZSA 2WXOA 3TG4A 2IOSA 4AM9A 4DLOA 4APFA 4LEUA 1QZ2A 4P29A 3MX3A 4ME2A 3D3MA 2XGSA 2C0LA 3B7RL 4BT8A 4EZLA 1H2TC 4APOA 3MKQA 4U0SA 3DBSA 3FTSA 2CHXA 2AVPA 3MV2B 4TV3A 3CV0A 1Z6TA 4K03A 4GZDA 3MGBA 2X6FA 3CHRA 4I9CA 3FUNA 2PM6A 3U3WA 3CHSA 4GZ3A 4KYOB 2XCBA 4UWLA 3Q5MA 4YNDA 3FUEA 4UI9K 3KD7A 2Q7FA 2RD0A 4ILIA 5KJKA 3QOUA 2IFUA 3FU3A 1GW6A 3RRUA 3UPVA 4MRUA 1UN8A 3HDXA 4C0MA 3LY8A 2GRMA 2WXQA 3QDNA 3D9MA 1UG3A 3UUXA 1E8YA 1OUVA 4A3VA 3RO3A 5KJNA 3FUHA 1MHQA 3HIZA 3O48A 3QWPA 3SGHA 3AU4A 1IYGA 5AJLA 3ZYMA 2OVFA 5G05J 3CLJA 4C0EA 3CHQA 3FUKA 5C2YA 1E90A 2WXIA 2PM7A 1S0PA 3PNTB 5ANRA 5G04C 3OTNA 4E6HA 2UWJG 2GGFA 4A1SA 2WXLA 3D9IA 3CVNA 4NRHB 4HORA 2CG3A 3QC1A 4R7LA 2A5UA 3OXFA 2IQCA 3TXNA 4XE0A 4BSXA 3ZGQA 2LAHA 5T3RA 3QKYA 3RRMB 5CCMA 2J9QA 2L0IA 2Y4UA 1HF8A 2E0IA 2XRYA 3S7FA 4EQFA 4G26A 5BW8C 3ZVVA 1WM5A 5LP0A 3Q47B 4IN3B 2MRIA 3ZYKA 3B7SA 3D9OA 4KXKB 3MKRA 4G2VA 5LCWJ 3ASGA 4FP7A 4J8FA 4ACLA 5J90A 3SFZA 2XGOA 3ZFWA 5FJYA 4GA1A 4AY6A 1ELRA 3AS4A 1HO8A 4BWRA 1KT1A 3FEYA 4Y6WA 4WUYA 4CDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8D A;  3WXX A;  4RG9 A;  3FWV A;  5A6C A;  2XCC A;  4U04 A;  3LY7 A;  4BTA A;  4GYY A;  2VYI A;  1PC2 A;  1QQE A;  3CVQ A;  2P58 C;  2FO7 A;  3EDT B;  3FP3 A;  4UI9 C;  4N3C A;  5BT1 A;  4GZ5 A;  3PDN A;  4RG6 A;  3JYS A;  3GYZ A;  5FTP A;  4AIF A;  3KAE A;  2XPI A;  3OXL A;  3CK9 A;  2FEZ A;  3CKB A;  3GW4 A;  3UQ3 A;  3CEQ A;  3VTY A;  4GYO A;  5EX3 A;  4GA2 A;  4WNF A;  2HO1 A;  4YVQ C;  3KS2 A;  4U07 A;  5ARF A;  4WND A;  4CGV A;  3S7B A;  5KJL A;  1FCH A;  1IHG A;  3LCA A;  2KAT A;  3LPZ A;  4JA7 A;  4N3A A;  2WQH A;  4N2Q A;  3BEE A;  5C1D A;  3CVP A;  4JL0 A;  5JJ7 A;  1NA3 A;  4BTB A;  2UY1 A;  1HXI A;  5CHE E;  4YVO A;  3CK7 A;  2FBN A;  2L6J A;  3RIB A;  5AYW D;  5ARG A;  2QFC A;  5FT9 A;  4H7X A;  4GA0 A;  2NC9 A;  4J8E A;  5HQ8 A;  3Q49 B;  4CDR A;  3PE4 A;  4JHR A;  3ULQ A;  2LSV A;  3TGO A;  3RO2 A;  5G05 C;  1TJC A;  4B94 A;  3AS8 A;  5CCL A;  4G23 A;  4G1T A;  4I2Z A;  1NZN A;  2KCV A;  3NF1 A;  2OOE A;  3MEK A;  1ZU2 A;  3QWW A;  3SF4 A;  3LYA A;  4GCN A;  1HH8 A;  4UQX A;  2E2E A;  5DIZ A;  3S7D A;  2XEV A;  2LNI A;  2I6H A;  1KLX A;  5HI7 A;  5FZR A;  2Y4T A;  2VGX B;  4G25 A;  4CGW A;  5M72 A;  3MA5 A;  5JJT A;  1HZ4 A;  3PE3 A;  4UQZ A;  4N2S A;  4WNE A;  2VGX A;  1KT0 A;  4UI9 J;  5D0O D;  4XI9 A;  4F3V A;  3ZPJ A;  2WPV A;  5FZQ A;  3HYM B;  2YQ8 A;  1ZBP A;  5A7D B;  3Q4A B;  4Y6C A;  4I9E A;  2C2L A;  4HOT A;  4N39 A;  1ELW A;  4O6F A;  2VQ2 A;  3TG5 A;  5JJ6 A;  3VTX A;  3R9A B;  3RJV A;  2R5S A;  2GW1 A;  1W3B A;  2FI7 A;  4W9R A;  3SZ7 A;  3QWV A;  3AS5 A;  2UY1 B;  4I17 A;  2KC7 A;  3ASF A;  3OXG A;  4I2W A;  4BT9 A;  1A17 A;  2PQR A;  1E96 B;  1P5Q A;  5G04 J;  2VSN A;  2HR2 A;  3K9I A;  4GYW A;  3CKC A;  3RU0 A;  3ASD A;  3U4T A;  4J0U A;  3IEG A;  3ZHE B;  3S7J A;  2YHC A;  3LKU A;  2KCK A;  3Q15 A;  3FFL A;  3CK8 A;  3TAX A;  1B89 A;  5D0Q D;  3ZHE A;  4XIF A;  2HYZ A;  2BUG A;  5DBK A;  4GPK A;  4KBQ A;  3GZ1 A;  2OND A;  2PQN A;  1WAO 1;  4WNG A;  2JLB A;  5LCW C;  1XNF A;  2DBA A;  2V5F A;  2PZI A;  3GZ2 A;  5BNW A;  2VSY A;  4HOS A;  5EX0 A;  4AY5 A;  4N5C A;  4NQ0 A;  4GZ6 A;  4U0Z A;  2LSU A;  2C0M A;  2KCL A;  2MHK A;  5KJM A;  3URZ A;  2VGY A;  5EKQ D;  3ESK A;  3CVL A;  4JA9 A;  4HOQ A;  2FF4 A;  2PL2 A;  4ABN A;  2IF4 A;  4XI0 A;  3RKV A;  3MV3 B;  4GCO A;  3E4B A;  4UQY A;  3ASH A;  4I1A A;  2XGM A;  4N3B A;  4H7Y A;  3LY9 A;  4HOU A;  4U0U A;  1NA0 A;  4G24 A;  3ZN3 A;  1Y8M A;  3N71 A;  1YA0 A;  5FZS A;  3TG4 A;  4AM9 A;  4LEU A;  1QZ2 A;  4ME2 A;  2XGS A;  2C0L A;  4BT8 A;  4APO A;  4U0S A;  2AVP A;  3MV2 B;  3CV0 A;  4I9C A;  3U3W A;  4GZ3 A;  4KYO B;  2XCB A;  3Q5M A;  4YND A;  4UI9 K;  3KD7 A;  2Q7F A;  5KJK A;  3QOU A;  2IFU A;  3UPV A;  3LY8 A;  3QDN A;  3UUX A;  1OUV A;  3RO3 A;  5KJN A;  3O48 A;  3QWP A;  1IYG A;  5G05 J;  5G04 C;  2UWJ G;  4A1S A;  3CVN A;  4NRH B;  4HOR A;  3OXF A;  3ZGQ A;  3QKY A;  5CCM A;  2J9Q A;  2Y4U A;  3S7F A;  4EQF A;  4G26 A;  5BW8 C;  1WM5 A;  3Q47 B;  4IN3 B;  4KXK B;  3MKR A;  4G2V A;  5LCW J;  3ASG A;  4J8F A;  2XGO A;  3ZFW A;  5FJY A;  4GA1 A;  4AY6 A;  1ELR A;  3AS4 A;  4BWR A;  1KT1 A;  4Y6W A;  4WUY A; 
#chains in the Genus database with same CATH topology
 1LTX A;  5A6C A;  2J07 A;  2YIN A;  3B7B A;  2QZA A;  2EIM E;  2WB2 A;  2B6C A;  5BV0 A;  3DWL G;  4A3T A;  1N0Q A;  1KZO A;  2VYI A;  3KEZ A;  3HG0 D;  4HXI A;  4M3O A;  3UT4 A;  4WAF A;  4RLY A;  2MYO A;  1N95 A;  2P9I G;  3TWW A;  5FIN A;  4XZ4 A;  1MX6 A;  2WXH A;  5LX8 A;  4GZ5 A;  4RG6 A;  2I9C A;  5AAO A;  4G8K A;  1IKN D;  2FEZ A;  1SZ9 A;  1IXV A;  2BKK B;  3CQG B;  3VTY A;  3BU8 A;  4NAC A;  5BV1 A;  3E34 A;  2ZGG A;  3BG1 B;  3ABM E;  4YVQ C;  3LS8 A;  3CHM A;  4U63 A;  4WND A;  2WMN A;  2P9L G;  1Q2Z A;  1SZA A;  3S7B A;  2Y0B G;  5AIJ A;  4JB8 P;  1IHG A;  1JWG A;  2XEH A;  4JA7 A;  3EIJ A;  2DZO A;  1BD8 A;  3DPY A;  3E37 A;  4WWN A;  5JJ7 A;  3Q7F A;  1TNU A;  4CT0 A;  1HXI A;  4YVO A;  2L6J A;  3RIB A;  3SBS A;  2QC9 A;  1E8Z A;  4LNB A;  3SY2 A;  3DST A;  3DSS A;  4GA0 A;  4LCT A;  3SD5 A;  4KZC A;  2LUH A;  3FTV A;  3ULQ A;  2LSV A;  4GMJ A;  2XPY A;  4KVM A;  2ION A;  4DX7 D;  3L08 A;  5BUZ A;  1Z3X A;  4G23 A;  4L2L A;  1ZB1 A;  3CHP A;  5AQ9 A;  2EIN E;  2NYJ A;  3LYA A;  4FHJ A;  1TEZ A;  4UQX A;  2E2E A;  3CVU A;  3EHN A;  4AV7 A;  5FZR A;  2Y4T A;  3UTM A;  4TUM A;  2ZIR A;  3TL5 A;  2V0P A;  3JXJ A;  3FU6 A;  4GTP A;  3HXD A;  2DCP A;  2VGE A;  2DYR E;  1TYQ G;  4UQZ A;  3R7Q A;  4WNE A;  3HRA A;  2AJA A;  3U66 A;  5D0O D;  4CCA A;  2WPV A;  4ATZ D;  1LD7 A;  4GTR A;  4XEI G;  1H19 A;  3KSL A;  4ANU A;  5A7D B;  2WXR A;  2RFA A;  1ELW A;  4O6F A;  3L54 A;  2IU1 A;  4YDY A;  3TWT A;  4E85 A;  3ABK E;  5A23 A;  4LRZ A;  2R5S A;  3RJV A;  2GW1 A;  4W9R A;  1OY3 D;  4FUL A;  3D9K A;  4GMR A;  2GRQ B;  1PY1 A;  2V4L A;  3CVW A;  1TN8 A;  4OYS A;  2PQR A;  4I6J A;  3KSQ A;  3PS6 A;  1RW2 A;  4JHK A;  1WY6 A;  3K9I A;  2Y3A A;  5AN8 A;  3ZIM A;  3ASD A;  4ILG A;  2QYU A;  3ZU7 B;  3ULE G;  4JZY A;  5CEC B;  3CVV A;  3UMV A;  3C72 A;  3ZHE B;  3Q73 A;  3S7J A;  2KCK A;  4A55 A;  1HG2 A;  4Q69 A;  2GRN B;  3DRA A;  3UXG A;  4WWP A;  3DSV A;  1EDU A;  3V31 A;  1YYH A;  4CEM A;  3B95 A;  3T8K A;  4TXR A;  1N9A A;  2XS1 A;  4B8C B;  2EIL E;  4GPK A;  4KBQ A;  2X6K A;  3GZ1 A;  2OND A;  3X2Q E;  5CMW A;  1WAO 1;  4OVU A;  3TWV A;  2NXP A;  3HXE A;  5ENR D;  4U7E B;  1E7V A;  1XNF A;  4DJA A;  3E33 A;  2PZI A;  3GZ2 A;  4FU3 A;  4FA6 A;  3R9M A;  1IQR A;  4BY6 A;  4N5C A;  4GZ6 A;  2P9S G;  2MHK A;  1D8E A;  5KJM A;  3CHO A;  2VGY A;  3ESK A;  2JAB A;  3R7R A;  1H6K A;  4JA9 A;  2FF4 A;  4UWK A;  4EPZ A;  3ABL E;  4ABN A;  4FLB A;  3FUI A;  3MV3 B;  3E4B A;  3J5P A;  3L6A A;  2KZT A;  1V55 E;  4I1A A;  4N3B A;  3LY9 A;  4F1S A;  5E76 A;  4OAU C;  3N71 A;  3VLD A;  3FUJ A;  2ZXW E;  2WQ6 A;  5AJD A;  1YA0 A;  4APF A;  4LEU A;  3BQO A;  2EIJ E;  3D3M A;  3MV2 B;  1SVX A;  3MGB A;  2J8S D;  3CHR A;  4GTT A;  1FT2 A;  3CHS A;  4KYO B;  3Q5M A;  4ILI A;  4DRX E;  1UN8 A;  3HDX A;  3QDN A;  5EIL A;  3UUX A;  1OUV A;  1D9S A;  3FUH A;  5EN5 D;  3AU4 A;  1IYG A;  3ZYM A;  5G05 J;  3CHQ A;  2WXI A;  4E6H A;  5CED B;  2GGF A;  3CVN A;  5AQA A;  2A5U A;  3ULY A;  3QKY A;  3SFY A;  2E0I A;  2XRY A;  4EQF A;  1WM5 A;  2MRI A;  3B7S A;  5LCW J;  3ASG A;  2B0O E;  2XGO A;  4GA1 A;  1ELR A;  1HO8 A;  1KT1 A;  4Y6W A;  1OCZ E;  4WUY A;  4YDE A;  4J8Y A;  3FWV A;  2XCC A;  1VDY A;  4L1B A;  4GTQ A;  1HG5 A;  3LXU X;  3IV0 A;  4U04 A;  3LY7 A;  1INZ A;  3DXK G;  1NFI E;  4BTA A;  3SBT B;  3PRE A;  5J08 A;  2GRP B;  4JC8 A;  2X38 A;  5D2M C;  1H2V C;  5KCM A;  2J4D A;  2CFU A;  1H2U A;  4IRU A;  2IY0 C;  2P58 C;  5LOZ A;  1G3N B;  4BES A;  2IO3 C;  5AQB A;  3Q78 A;  2KZT B;  4GTS A;  3TXM A;  2KBX A;  4B8A A;  1DC2 A;  5FQ7 A;  2CG2 A;  3F6Q A;  4UI9 C;  4JW1 A;  4UWF A;  5BT1 A;  2I1J A;  3PDN A;  3JQ1 A;  3QJZ A;  4GTO A;  4DX6 D;  4AIF A;  4EZJ A;  2XPI A;  3OXL A;  3ML9 A;  2WMO A;  3FU5 A;  4HLL A;  3CK9 A;  3CKB A;  2X6H A;  4DI4 A;  2LXM A;  4HLE A;  2HO1 A;  1Y6I A;  2F8Y A;  3KS2 A;  3FHE A;  4IYP A;  4K5B A;  3EJN A;  4HS2 A;  4ILH B;  3OAW A;  4X8Q A;  2KXP C;  1D8D A;  4I1O B;  3HXF A;  4N2Q A;  3BEE A;  2CFZ A;  3E32 A;  3CVP A;  2YHE A;  2I2O A;  3JUI A;  1HS6 A;  1NA3 A;  4HNA D;  4GZC A;  4FLH A;  4G11 A;  3CK7 A;  5CEA A;  3LJ3 A;  2AWI A;  5AYW D;  3NQP A;  4RVB A;  5ARG A;  2QFC A;  2IEJ A;  4DPR A;  4H7X A;  4ATG A;  3Q49 B;  3ZEF A;  3UM3 A;  4CDR A;  5ENQ D;  3UI2 A;  3LVR E;  2RKK A;  3TGO A;  3FY4 A;  4AOF A;  3L82 A;  5EYL A;  5G05 C;  1TJC A;  2R2L A;  2AW6 A;  3FTW A;  3W9F A;  2AXZ A;  3LDZ A;  3TWQ A;  5CCL A;  4BFR A;  3P2B A;  1NZN A;  2OOE A;  1ZU2 A;  3QWW A;  3MYV A;  3HXC A;  4HB5 A;  1U3D A;  4GCN A;  2EIK E;  1IQU A;  3S7D A;  3PUJ A;  2LNI A;  4TXQ A;  2VGX B;  1UJK A;  4FAD A;  5M72 A;  2F8X K;  2OEV A;  4JEH A;  1KZP A;  2XZD G;  2R03 A;  5EDS A;  5BXO A;  4TRQ A;  5CBO A;  4OVV A;  3UIP C;  3UT7 A;  3VLE A;  1UW4 B;  2BTD A;  3FUL A;  3FTU A;  1BPO A;  3PH0 C;  5FZQ A;  2X3M A;  3UM0 A;  4I9E A;  1FVH A;  4K5C A;  2NSZ A;  5JHA A;  3O4Z A;  4M7C A;  2VQ2 A;  3RRN B;  2L9B A;  3CR3 A;  3UIN C;  1SQM A;  3APD A;  3TG5 A;  5BXU A;  5JJ6 A;  3BUA A;  1LD8 A;  4HI9 A;  3SZ7 A;  1OWP A;  3QWV A;  1SA4 A;  4LG6 A;  4A1G A;  4I17 A;  3ZXP A;  5T4Y A;  3ASF A;  3OXG A;  4NUR A;  4HI8 A;  4GU5 A;  5FIO A;  1N4S A;  1EF1 C;  5HS0 A;  2L0T B;  5ANL A;  4BT9 A;  3QAQ A;  4FJY A;  2VJ8 A;  2H6I A;  2P9P G;  3FTY A;  2HR2 A;  4GYW A;  1IHB A;  3AG4 E;  1N52 A;  3Q9U C;  3RU0 A;  4A63 B;  3GZS A;  4F6R D;  3EIQ C;  3PRZ A;  2ZU6 B;  1OWN A;  3IEG A;  2ETC A;  3EU5 A;  1BI7 B;  3LKU A;  3Q15 A;  3FFL A;  3CK8 A;  1K8K G;  2XHE A;  1TNZ A;  3C5R A;  1UJJ A;  3ZHE A;  1SW6 A;  4LER A;  4Z68 A;  5DBK A;  1MX2 A;  1O1T A;  3QNK A;  3C3O A;  5CMY A;  2A4Z A;  3HXB A;  4WNG A;  3P1U A;  3TWR A;  3IKO B;  4AJW A;  1TN7 A;  1OWL A;  2V5F A;  3FH7 A;  3V2O A;  2XS8 A;  4ACK A;  4I1M A;  4JHJ A;  3UKU G;  5FQ6 A;  3L9T A;  2DIW A;  1DCE A;  4NIK A;  2C0M A;  2RG8 A;  1EYH A;  4G8L A;  3URZ A;  5EKQ D;  4BX9 A;  2WXN A;  1Z5S C;  3CVL A;  3RAU A;  3MZL B;  1OCR E;  3NOC D;  4MS6 A;  3RKV A;  5FWQ A;  2XEN A;  3SI5 A;  2ZGD A;  3BG0 B;  3FH8 A;  3L16 A;  4UQY A;  3ASH A;  3ASO E;  3FTX A;  3QAR A;  3CST A;  2OV8 A;  4H7Y A;  2XEE A;  4O60 A;  1NA0 A;  4G24 A;  3ZN3 A;  1NL4 A;  3ONL A;  4V3I A;  3SQV A;  4DLO A;  1OXJ A;  4ME2 A;  3B7R L;  4EZL A;  1MYO A;  1H2T C;  3MKQ A;  3FTS A;  3CV0 A;  2FO1 E;  5B3S E;  2X6F A;  4C48 B;  4BSZ B;  4I9C A;  4UWL A;  3Q7A A;  4UI9 K;  3QOU A;  3RRU A;  2GRM A;  1UG3 A;  2P9N G;  4LSZ E;  4A3V A;  3RO3 A;  1MHQ A;  3QWP A;  3AG2 E;  4N5Q A;  5C2Y A;  1E90 A;  1S0P A;  4HRN A;  5ANR A;  3OTN A;  2WXL A;  3D9I A;  2LAH A;  4DX1 A;  2OCC E;  3Q75 A;  3AJI A;  2Y4U A;  3S7F A;  3TWX A;  3ZVV A;  1V54 E;  4BEP A;  5LP0 A;  3ZYK A;  1N4Q A;  4FP7 A;  5J90 A;  3AS4 A;  2IJG X;  1JCQ A;  4JPS A;  3S2A A;  3D9J A;  3T9K A;  4L9P A;  4YDW A;  3L22 A;  2H6H A;  3CVQ A;  5ENP D;  2FO7 A;  3AU5 A;  1S70 B;  2R59 A;  4AVX A;  3EDT B;  3MJW A;  5AEN A;  2Y69 E;  4U8H A;  2WXF A;  1FPP A;  5ENN A;  3GYZ A;  4L7T A;  4WWO A;  3KAE A;  1U2V G;  4CT4 A;  3MKQ B;  3GW4 A;  2V5Q C;  4GYO A;  3IHV A;  3JCK C;  4GA2 A;  3CVX A;  1OT8 A;  4WNF A;  3AG3 E;  3I4R B;  4MKT A;  3WG7 E;  4U07 A;  4K0R A;  3B7U X;  5ARF A;  4CGV A;  4LNG A;  5B1A E;  2EQX A;  3NZS A;  3LCA A;  3G2W A;  4N3A A;  3QB2 A;  2GRL A;  3PVL A;  4HFG A;  3D9N A;  1NI1 A;  3ZW3 A;  2UY1 A;  2V8S E;  3ZYL A;  4GAA A;  3PEV B;  4C9B B;  3TJP A;  1Z3Y A;  4BET A;  4B0Z A;  5FT9 A;  3IBE A;  4UUC A;  1MQS A;  3G2T A;  4KMO A;  3CGH A;  2P9K G;  5HQ8 A;  5HKP A;  2OEW A;  3IHY A;  3PE4 A;  4JHR A;  2I1K A;  4F7A A;  3RO2 A;  3LEW A;  3JUE A;  1E7U A;  3ZUV B;  3AS8 A;  2HM8 A;  5JHB A;  4I2Z A;  3NF1 A;  4TUU A;  5CER B;  5G2N A;  3SF4 A;  3C98 A;  4JD2 G;  5DIZ A;  2R02 A;  2XEV A;  2I6H A;  4DUI A;  4FC8 A;  1NP7 A;  3LVQ E;  3PUK A;  4PUC A;  5CRV A;  1SA5 A;  3MA5 A;  3DEO A;  4I6G A;  2XZT G;  2QYJ A;  3UM1 A;  1XGW A;  1HZ4 A;  3PE3 A;  2ZIS A;  2VGX A;  5KNG A;  3ZRH A;  3NOG D;  4IUL A;  4XI9 A;  2KM4 A;  4F3V A;  3ASN E;  3AAA C;  3HYM B;  1N11 A;  2YQ8 A;  4U95 D;  1ZBP A;  4N39 A;  4CZ2 D;  1QYM A;  5AQ7 A;  2V4H C;  3R9A B;  3VTX A;  3TWS A;  1W3B A;  2FI7 A;  5H7P A;  4HRM B;  5AAR A;  2UY1 B;  3HHM A;  2KC7 A;  3C3Q A;  4HQD A;  1MX4 A;  4GB9 A;  1N54 A;  2WM9 A;  3ESL A;  4CDM A;  3TWU A;  1BLX B;  1OWO A;  1P5Q A;  3UIO C;  3L17 A;  2VSN A;  4EZK A;  3APF A;  5ITZ F;  4PS8 A;  3EHQ A;  4J0U A;  1JPL A;  4UWH A;  5CBN A;  1FT1 A;  2JEK A;  2CHW A;  4I43 A;  4JEU A;  5EIB E;  1QBQ A;  3FUF A;  1B89 A;  5D0Q D;  1E8X A;  4KT6 B;  4MLP A;  2HYZ A;  2BUG A;  3L13 A;  4B89 A;  4ANW A;  5ENS D;  1JUQ A;  1A5E A;  1LF8 A;  5LCW C;  3DPD A;  1O1R A;  2VSX E;  2VSO E;  1N4P A;  3EHR A;  5BNW A;  1X81 A;  1L5J A;  1U3C A;  1N94 A;  3NB2 A;  1AP7 A;  1JCR A;  5EX0 A;  3UM2 A;  4AY5 A;  4RSY A;  3U9W A;  4PS3 A;  2P9U G;  4NQ0 A;  4U0Z A;  1TNB A;  3SNX A;  4FHK A;  3HVE B;  4HOQ A;  4K5A B;  3JQ0 A;  2PL2 A;  3FUM A;  3ZXS A;  1TNO A;  4I6E A;  2PNN A;  2WQ7 A;  2XGM A;  4U0U A;  2A5E A;  3RK6 A;  3TG4 A;  5FZS A;  2WXO A;  1QZ2 A;  4P29 A;  3MX3 A;  2XGS A;  4APO A;  4U0S A;  3DBS A;  5EID A;  4TV3 A;  1Z6T A;  4K03 A;  4GZD A;  4U8Y D;  3FUN A;  2PM6 A;  3U3W A;  4GZ3 A;  2XCB A;  1WG0 A;  4LNU D;  3FUE A;  3KD7 A;  2Q7F A;  2RD0 A;  1GW6 A;  1OCC E;  1AWC B;  3LY8 A;  2WXQ A;  1O1S A;  1E8Y A;  1KPS B;  3ZKJ A;  3HIZ A;  1K1A A;  3SGH A;  5AJL A;  3CLJ A;  4C0E A;  3FUK A;  3EU9 A;  2PM7 A;  3PNT B;  4NRH B;  2L6B A;  3QC1 A;  3OXF A;  2H6F A;  2IQC A;  3TXN A;  5HRY A;  4BSX A;  3RRM B;  2J9Q A;  2L0I A;  3W9G A;  4YDO A;  3Q47 B;  2GRR B;  4IN3 B;  1H6O A;  3E30 A;  3D9O A;  3MKR A;  3V79 K;  4J8F A;  3SFZ A;  3ZFW A;  4CDN A;  4J8D A;  4U8V D;  3WXX A;  4RG9 A;  5FQ4 A;  5E75 A;  2ETB A;  3CVY A;  5KBA A;  1S64 A;  4GTM A;  1TNY A;  5T8I A;  2H6G A;  4Q96 A;  3PZD A;  4GYY A;  1H0A A;  4EBA G;  4PS7 A;  3PEU B;  1PC2 A;  1QQE A;  3MCX A;  4Q94 A;  3ML8 A;  2ETA A;  1DNP A;  3UT8 A;  3FP3 A;  4N3C A;  1MJ0 A;  3JYS A;  4DLQ A;  4HVB A;  3I5P A;  5FTP A;  2F0Y A;  2BKG A;  3UQ3 A;  3CEQ A;  3C3R A;  5EX3 A;  2LO6 A;  2R17 C;  3ZNG A;  4OAV B;  5EYP F;  1ELK A;  3FTZ A;  2DVW A;  3G2U A;  5KJL A;  1FCH A;  2BF0 X;  2WXK A;  2Y1L E;  2KAT A;  3LPZ A;  2IO2 C;  2XRZ A;  5LFA A;  2WQH A;  5C1D A;  4JL0 A;  4ANX A;  2X6I A;  4F53 A;  3DXM G;  3FH5 A;  4BTB A;  1X5B A;  1YCS B;  5CHE E;  3ENE A;  1UN9 A;  2QY7 A;  2FBN A;  3NAW A;  4UWG A;  2J08 A;  2J09 A;  3U64 A;  4CRW A;  3DEP A;  4QQI A;  2CHZ A;  2J4B A;  2NC9 A;  4J8E A;  1E8W A;  3V30 A;  2VTB A;  1K1B A;  1BU9 A;  4HBD A;  2WXG A;  2FUL A;  1TJF A;  4B94 A;  4RQI A;  4HRL A;  3QK0 A;  3FUD A;  2YNQ A;  3B7T A;  4G1T A;  1N0R A;  2KCV A;  3MEK A;  4CYM D;  3NZU A;  1HX8 A;  1HH8 A;  3CIA A;  3T8M A;  2LXL A;  5G55 A;  1KLX A;  5HI7 A;  4AXH A;  4G25 A;  2LAI A;  4CGW A;  3B13 A;  3JXI A;  5JJT A;  2F37 A;  2WVI A;  1EPU A;  3PZ3 A;  1YMP A;  2X6J A;  4N2S A;  3G2V A;  4O1P A;  3I3N A;  1KT0 A;  4UI9 J;  4DI3 A;  4ZHB A;  4O1O A;  3ZPJ A;  4DX2 A;  2IOL A;  2J49 A;  1FVF A;  3Q4A B;  4Y6C A;  4HOT A;  2C2L A;  2AXU A;  1S63 A;  2MOW A;  4LUN U;  3FU0 A;  4U96 D;  1MZC A;  3DSX A;  1PAQ A;  1DVP A;  3LJN A;  4EEC A;  2RFM A;  4J8S A;  3UX4 A;  4XKB A;  2GRO B;  3AS5 A;  4BX8 A;  4FJZ A;  4I2W A;  1HE8 A;  3FDH A;  1H6P A;  4JVS A;  1A17 A;  1K3Z D;  1E96 B;  2VTB B;  5G04 J;  2OVB A;  4L2Y A;  3CKC A;  4EBA A;  3U4T A;  4AEZ C;  1HFA A;  4J6I A;  4QFV A;  4MBG A;  4XX5 A;  3EUV A;  2HE0 A;  3ISM C;  4ZFH A;  4JXT A;  2YHC A;  1HU3 A;  3D9P A;  2DZN A;  3T5V A;  3TAX A;  3PNL B;  1QNF A;  3G2S A;  2WXP A;  1OCO E;  3KEA A;  4XIF A;  4ANV A;  5ENT D;  1N4R A;  4L23 A;  4KZ0 A;  3PZ4 A;  4PH4 B;  2PQN A;  2WXJ A;  3FEX A;  2JLB A;  3UKR G;  1OWM A;  5CRU A;  2DBA A;  2WXM A;  4PDX A;  4F1P A;  3SO8 A;  5ENO D;  3ONK A;  2XPZ A;  2VSY A;  1BI8 B;  2AXV A;  3AG1 E;  4HOS A;  2P2C P;  1JWF A;  3V2X A;  3EHM A;  2LSU A;  2ILR A;  2KCL A;  3APC A;  3VLF A;  4AP2 A;  4DK5 A;  1TR4 A;  3T5X A;  3D9H A;  5FQ8 A;  1WDY A;  2IF4 A;  3CQC B;  2R05 A;  4XI0 A;  3ZYQ A;  4D10 C;  2M63 A;  3Q79 A;  4GCO A;  3HVE A;  3CSF A;  4EHM A;  3I4G A;  4GML A;  4HOU A;  4KVO A;  5BPP A;  4XKC A;  3Q9N C;  2XQ0 A;  3SHF A;  4TXP A;  2DYS E;  3RSE G;  3SFX A;  1Y8M A;  3D9L A;  2IOS A;  4AM9 A;  5KWD A;  5JA4 D;  1TN6 A;  4GPM A;  2C0L A;  4BT8 A;  5B1B E;  5IY5 E;  2CHX A;  2AVP A;  5D66 A;  4B93 B;  4YND A;  5KJK A;  1O5M A;  2IFU A;  3FU3 A;  3UPV A;  4MRU A;  4GTV A;  3PZ2 A;  4C0M A;  3D9M A;  1JCS A;  2DWZ A;  5JMN D;  5KJN A;  3O48 A;  3DSU A;  2OVF A;  2BED A;  3DSW A;  1RZ4 A;  5G04 C;  2UWJ G;  4A1S A;  4BER A;  4HOR A;  2CG3 A;  4R7L A;  4XE0 A;  3ZGQ A;  5T3R A;  5CCM A;  4J7W A;  1HF8 A;  3PZ1 A;  3IXE A;  4G26 A;  5BW8 C;  5KNH D;  4KXK B;  4G2V A;  3J5Q B;  4ACL A;  4DX5 D;  5FJY A;  4AY6 A;  1DCQ A;  1UOH A;  4BWR A;  3FEY A;  4URK A;  3NBN B; 
#chains in the Genus database with same CATH homology
 4J8D A;  2IJG X;  4JPS A;  3WXX A;  4RG9 A;  3S2A A;  3FWV A;  5FQ4 A;  3D9J A;  5A6C A;  2J07 A;  2YIN A;  2XCC A;  5E75 A;  1VDY A;  4L1B A;  3CVY A;  1HG5 A;  3LXU X;  3IV0 A;  2WB2 A;  4U04 A;  3LY7 A;  1INZ A;  5BV0 A;  4A3T A;  4BTA A;  3SBT B;  3PRE A;  5T8I A;  5J08 A;  4JC8 A;  2X38 A;  4Q96 A;  3L22 A;  3PZD A;  2VYI A;  3KEZ A;  4GYY A;  1H0A A;  4EBA G;  1H2V C;  4HXI A;  4M3O A;  4PS7 A;  5KCM A;  2J4D A;  1PC2 A;  2CFU A;  3PEU B;  1H2U A;  1QQE A;  3MCX A;  4IRU A;  4Q94 A;  3CVQ A;  4WAF A;  2FO7 A;  2P58 C;  3UT4 A;  3ML8 A;  5LOZ A;  3AU5 A;  2R59 A;  4XZ4 A;  2KZT B;  1DNP A;  3TXM A;  4AVX A;  3UT8 A;  4B8A A;  3EDT B;  5FQ7 A;  2WXH A;  3MJW A;  5AEN A;  2CG2 A;  5LX8 A;  3FP3 A;  4JW1 A;  4UI9 C;  4UWF A;  4N3C A;  5BT1 A;  2I1J A;  2WXF A;  4GZ5 A;  4U8H A;  3PDN A;  4RG6 A;  5ENN A;  2I9C A;  3JYS A;  4DLQ A;  4HVB A;  3GYZ A;  4L7T A;  3I5P A;  3JQ1 A;  4WWO A;  5FTP A;  3QJZ A;  4AIF A;  3KAE A;  4EZJ A;  2XPI A;  3OXL A;  4CT4 A;  3ML9 A;  2WMO A;  3FU5 A;  3MKQ B;  3CK9 A;  2FEZ A;  1SZ9 A;  3CKB A;  2X6H A;  3GW4 A;  3UQ3 A;  3CEQ A;  3CQG B;  3VTY A;  4DI4 A;  4GYO A;  5EX3 A;  3IHV A;  2LO6 A;  2R17 C;  3JCK C;  4GA2 A;  3CVX A;  4NAC A;  4WNF A;  5BV1 A;  4HLE A;  2HO1 A;  3I4R B;  1Y6I A;  4MKT A;  3BG1 B;  3KS2 A;  4U07 A;  4YVQ C;  1ELK A;  3FHE A;  3LS8 A;  3B7U X;  3FTZ A;  3CHM A;  4K0R A;  4U63 A;  4WND A;  5ARF A;  4CGV A;  2WMN A;  1SZA A;  3G2U A;  4IYP A;  2EQX A;  3S7B A;  5AIJ A;  5KJL A;  3NZS A;  3EJN A;  4HS2 A;  1FCH A;  2BF0 X;  1IHG A;  1JWG A;  2WXK A;  3OAW A;  4ILH B;  3LCA A;  2KAT A;  3LPZ A;  3G2W A;  4I1O B;  2XRZ A;  4JA7 A;  5LFA A;  3EIJ A;  4N3A A;  2WQH A;  4N2Q A;  3BEE A;  5C1D A;  2CFZ A;  3QB2 A;  3CVP A;  2YHE A;  4WWN A;  2GRL A;  4JL0 A;  4ANX A;  2I2O A;  3JUI A;  1HS6 A;  2X6I A;  3PVL A;  4HFG A;  4F53 A;  1NA3 A;  3D9N A;  5JJ7 A;  3ZW3 A;  3FH5 A;  4BTB A;  2UY1 A;  1X5B A;  2V8S E;  1HXI A;  5CHE E;  4CT0 A;  4GZC A;  4FLH A;  3ZYL A;  4G11 A;  4YVO A;  3CK7 A;  3ENE A;  1UN9 A;  2QY7 A;  2FBN A;  3LJ3 A;  2L6J A;  4GAA A;  2AWI A;  3RIB A;  3PEV B;  4C9B B;  4UWG A;  3TJP A;  1Z3Y A;  2J08 A;  2J09 A;  5AYW D;  3U64 A;  3NQP A;  4CRW A;  3SBS A;  4RVB A;  1E8Z A;  5ARG A;  2QFC A;  4B0Z A;  5FT9 A;  4DPR A;  3IBE A;  1MQS A;  2CHZ A;  4H7X A;  4GA0 A;  2J4B A;  2NC9 A;  3G2T A;  1E8W A;  4J8E A;  3CGH A;  4KMO A;  4LCT A;  4KZC A;  3SD5 A;  3Q49 B;  4ATG A;  5HQ8 A;  3ZEF A;  4CDR A;  2VTB A;  3IHY A;  3LVR E;  3PE4 A;  4JHR A;  3FTV A;  2I1K A;  3ULQ A;  2LSV A;  4GMJ A;  3TGO A;  3FY4 A;  4F7A A;  2XPY A;  4AOF A;  2WXG A;  3RO2 A;  5G05 C;  2FUL A;  1TJC A;  4KVM A;  2ION A;  2AW6 A;  1TJF A;  3LEW A;  3FTW A;  4B94 A;  2AXZ A;  1E7U A;  4AV7 A;  3L08 A;  3AS8 A;  3QK0 A;  2HM8 A;  1Z3X A;  5BUZ A;  3LDZ A;  3FUD A;  2YNQ A;  5CCL A;  4G23 A;  3B7T A;  4G1T A;  4BFR A;  5JHB A;  3P2B A;  4L2L A;  4I2Z A;  1NZN A;  2KCV A;  3NF1 A;  4TUU A;  2OOE A;  3CHP A;  3MEK A;  5G2N A;  3NZU A;  1HX8 A;  1ZU2 A;  3MYV A;  3QWW A;  3SF4 A;  3LYA A;  1U3D A;  3C98 A;  4GCN A;  1HH8 A;  4FHJ A;  1TEZ A;  4UQX A;  3CIA A;  1IQU A;  2E2E A;  3CVU A;  5DIZ A;  3S7D A;  3T8M A;  2XEV A;  2LNI A;  2I6H A;  3PUJ A;  5G55 A;  3EHN A;  4FC8 A;  1KLX A;  5HI7 A;  5FZR A;  2Y4T A;  1NP7 A;  2LAI A;  2VGX B;  3LVQ E;  3PUK A;  4G25 A;  4PUC A;  4AXH A;  4CGW A;  1UJK A;  4FAD A;  3B13 A;  5M72 A;  3TL5 A;  3MA5 A;  2V0P A;  4JEH A;  3FU6 A;  5JJT A;  4I6G A;  2DCP A;  2WVI A;  1XGW A;  1HZ4 A;  1EPU A;  5EDS A;  3PE3 A;  2X6J A;  4TRQ A;  4UQZ A;  3R7Q A;  4WNE A;  4N2S A;  3G2V A;  3I3N A;  2VGX A;  4OVV A;  3ZRH A;  1KT0 A;  3U66 A;  4UI9 J;  3UT7 A;  5D0O D;  3VLE A;  4IUL A;  4XI9 A;  4DI3 A;  2KM4 A;  1UW4 B;  3ZPJ A;  4F3V A;  4CCA A;  2BTD A;  2WPV A;  3FUL A;  3FTU A;  1BPO A;  3PH0 C;  5FZQ A;  3HYM B;  2YQ8 A;  2X3M A;  2IOL A;  1H19 A;  2J49 A;  4ANU A;  1FVF A;  1ZBP A;  5A7D B;  3Q4A B;  2WXR A;  4I9E A;  2C2L A;  1FVH A;  4Y6C A;  2AXU A;  4HOT A;  4N39 A;  2MOW A;  4LUN U;  2NSZ A;  5JHA A;  3FU0 A;  1ELW A;  3O4Z A;  4O6F A;  2VQ2 A;  3L54 A;  2IU1 A;  3RRN B;  4E85 A;  2L9B A;  3CR3 A;  5A23 A;  1SQM A;  3APD A;  4LRZ A;  3TG5 A;  1PAQ A;  5JJ6 A;  1DVP A;  3R9A B;  3VTX A;  4EEC A;  2R5S A;  3RJV A;  2GW1 A;  1W3B A;  4J8S A;  2FI7 A;  4W9R A;  3UX4 A;  4XKB A;  3SZ7 A;  1OWP A;  3QWV A;  4FUL A;  3AS5 A;  2UY1 B;  4A1G A;  3D9K A;  3HHM A;  4I17 A;  2KC7 A;  4BX8 A;  5T4Y A;  3ASF A;  3OXG A;  4FJZ A;  4I2W A;  4NUR A;  4GU5 A;  1EF1 C;  1HE8 A;  1PY1 A;  3FDH A;  4GB9 A;  2L0T B;  1N54 A;  2V4L A;  4JVS A;  5ANL A;  4BT9 A;  2WM9 A;  3CVW A;  3ESL A;  3QAQ A;  4FJY A;  4CDM A;  1A17 A;  4OYS A;  1OWO A;  2PQR A;  1E96 B;  2VTB B;  2VJ8 A;  1P5Q A;  4I6J A;  5G04 J;  3PS6 A;  3L17 A;  2VSN A;  3FTY A;  4JHK A;  1WY6 A;  2OVB A;  2HR2 A;  3APF A;  3K9I A;  4L2Y A;  4GYW A;  4EZK A;  3CKC A;  4EBA A;  1N52 A;  2Y3A A;  3RU0 A;  3ZIM A;  3ASD A;  3U4T A;  4PS8 A;  4ILG A;  4AEZ C;  3GZS A;  1HFA A;  3EIQ C;  3PRZ A;  4JZY A;  4J6I A;  4QFV A;  4J0U A;  2ZU6 B;  1JPL A;  3CVV A;  3UMV A;  1OWN A;  4UWH A;  3IEG A;  4XX5 A;  3ZHE B;  2JEK A;  3S7J A;  2CHW A;  4I43 A;  4JXT A;  2YHC A;  3LKU A;  4JEU A;  1HU3 A;  2KCK A;  1HG2 A;  3D9P A;  4A55 A;  3Q15 A;  4Q69 A;  3FFL A;  3T5V A;  3CK8 A;  3FUF A;  3TAX A;  1B89 A;  4WWP A;  2XHE A;  5D0Q D;  3PNL B;  1QNF A;  1EDU A;  3G2S A;  1E8X A;  1UJJ A;  2WXP A;  4KT6 B;  3ZHE A;  4CEM A;  4XIF A;  4MLP A;  4LER A;  4ANV A;  2HYZ A;  2BUG A;  3L13 A;  4B89 A;  4B8C B;  5DBK A;  4ANW A;  4GPK A;  4KBQ A;  4L23 A;  4KZ0 A;  2X6K A;  3GZ1 A;  3QNK A;  2OND A;  4PH4 B;  5CMY A;  2PQN A;  5CMW A;  1JUQ A;  2WXJ A;  2A4Z A;  1WAO 1;  3FEX A;  4OVU A;  4WNG A;  3P1U A;  2NXP A;  3IKO B;  2JLB A;  1LF8 A;  5LCW C;  4AJW A;  3DPD A;  1E7V A;  1XNF A;  1OWM A;  2VSX E;  2WXM A;  2DBA A;  4PDX A;  1OWL A;  2VSO E;  2V5F A;  4DJA A;  3FH7 A;  2PZI A;  3GZ2 A;  4ACK A;  3ONK A;  5BNW A;  2XPZ A;  2VSY A;  4FU3 A;  4I1M A;  2AXV A;  4JHJ A;  1L5J A;  4FA6 A;  4HOS A;  1U3C A;  5FQ6 A;  2DIW A;  1IQR A;  5EX0 A;  4BY6 A;  4AY5 A;  1JWF A;  3EHM A;  4RSY A;  3U9W A;  4N5C A;  4PS3 A;  4NQ0 A;  4GZ6 A;  4U0Z A;  2LSU A;  2C0M A;  2ILR A;  2KCL A;  2MHK A;  2RG8 A;  3SNX A;  5KJM A;  1EYH A;  3CHO A;  3APC A;  3URZ A;  4URK A;  2VGY A;  5EKQ D;  3ESK A;  4FHK A;  3HVE B;  4BX9 A;  2WXN A;  3CVL A;  3R7R A;  1H6K A;  3VLF A;  4AP2 A;  4JA9 A;  4DK5 A;  4HOQ A;  2FF4 A;  4UWK A;  3MZL B;  3JQ0 A;  4EPZ A;  2PL2 A;  3T5X A;  5FQ8 A;  4ABN A;  2IF4 A;  3CQC B;  4FLB A;  4MS6 A;  3FUI A;  4XI0 A;  3RKV A;  3ZYQ A;  4D10 C;  5FWQ A;  3MV3 B;  3FUM A;  3SI5 A;  2M63 A;  4GCO A;  3BG0 B;  3FH8 A;  3HVE A;  3E4B A;  3CSF A;  4I6E A;  3ZXS A;  3L16 A;  3L6A A;  4UQY A;  3I4G A;  3ASH A;  3FTX A;  2KZT A;  2WQ7 A;  4GML A;  3QAR A;  3CST A;  4I1A A;  2OV8 A;  2XGM A;  4N3B A;  4H7Y A;  3LY9 A;  4HOU A;  4KVO A;  4U0U A;  4XKC A;  4F1S A;  5BPP A;  5E76 A;  2XQ0 A;  3SHF A;  1NA0 A;  4G24 A;  4V3I A;  3ONL A;  1Y8M A;  3N71 A;  3RK6 A;  3FUJ A;  3VLD A;  3ZN3 A;  3D9L A;  2WQ6 A;  5AJD A;  1YA0 A;  5FZS A;  2WXO A;  3TG4 A;  2IOS A;  4AM9 A;  4DLO A;  4APF A;  4LEU A;  1QZ2 A;  4P29 A;  3MX3 A;  4ME2 A;  3D3M A;  2XGS A;  2C0L A;  3B7R L;  4BT8 A;  4EZL A;  1H2T C;  4APO A;  3MKQ A;  4U0S A;  3DBS A;  3FTS A;  2CHX A;  2AVP A;  3MV2 B;  4TV3 A;  3CV0 A;  1Z6T A;  4K03 A;  4GZD A;  3MGB A;  2X6F A;  3CHR A;  4I9C A;  3FUN A;  2PM6 A;  3U3W A;  3CHS A;  4GZ3 A;  4KYO B;  2XCB A;  4UWL A;  3Q5M A;  4YND A;  3FUE A;  4UI9 K;  3KD7 A;  2Q7F A;  2RD0 A;  4ILI A;  5KJK A;  3QOU A;  2IFU A;  3FU3 A;  1GW6 A;  3RRU A;  3UPV A;  4MRU A;  1UN8 A;  3HDX A;  4C0M A;  3LY8 A;  2GRM A;  2WXQ A;  3QDN A;  3D9M A;  1UG3 A;  3UUX A;  1E8Y A;  1OUV A;  4A3V A;  3RO3 A;  5KJN A;  3FUH A;  1MHQ A;  3HIZ A;  3O48 A;  3QWP A;  3SGH A;  3AU4 A;  1IYG A;  5AJL A;  3ZYM A;  2OVF A;  5G05 J;  3CLJ A;  4C0E A;  3CHQ A;  3FUK A;  5C2Y A;  1E90 A;  2WXI A;  2PM7 A;  1S0P A;  3PNT B;  5ANR A;  5G04 C;  3OTN A;  4E6H A;  2UWJ G;  2GGF A;  4A1S A;  2WXL A;  3D9I A;  3CVN A;  4NRH B;  4HOR A;  2CG3 A;  3QC1 A;  4R7L A;  2A5U A;  3OXF A;  2IQC A;  3TXN A;  4XE0 A;  4BSX A;  3ZGQ A;  2LAH A;  5T3R A;  3QKY A;  3RRM B;  5CCM A;  2J9Q A;  2L0I A;  2Y4U A;  1HF8 A;  2E0I A;  2XRY A;  3S7F A;  4EQF A;  4G26 A;  5BW8 C;  3ZVV A;  1WM5 A;  5LP0 A;  3Q47 B;  4IN3 B;  2MRI A;  3ZYK A;  3B7S A;  3D9O A;  4KXK B;  3MKR A;  4G2V A;  5LCW J;  3ASG A;  4FP7 A;  4J8F A;  4ACL A;  5J90 A;  3SFZ A;  2XGO A;  3ZFW A;  5FJY A;  4GA1 A;  4AY6 A;  1ELR A;  3AS4 A;  1HO8 A;  4BWR A;  1KT1 A;  3FEY A;  4Y6W A;  4WUY A;  4CDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...