4N2QA

Crystal structure of tha8 in complex with zm4 rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Splicing/rna
molecule keywords THA8 RNA binding protein
total genus 69
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n2qA00
2C0LA 3CK8A 4GYWA 3KS2A 4B94A 5KJKA 1IYGA 3R9AB 3MV2B 5CCLA 3Q5MA 4JL0A 2PQNA 1ELWA 3GZ1A 3QWWA 4H7XA 5BT1A 1PC2A 2Y4UA 3LYAA 3RJVA 2FF4A 2GW1A 1TJCA 4AIFA 5CCMA 2PZIA 3KD7A 2PQRA 3LPZA 3S7FA 4IN3B 4J8DA 4I2ZA 2UWJG 4J0UA 1W3BA 4WNFA 3ZGQA 2XGOA 4GA0A 4BTAA 2YHCA 4J8FA 4YVQC 3JYSA 4N39A 2WPVA 5FZQA 4NQ0A 4WNGA 2KCLA 1HZ4A 2VSNA 3FP3A 3K9IA 3PDNA 4NRHB 3ESKA 3AS5A 4W9RA 3KAEA 3S7BA 4HOTA 3LCAA 3AS4A 2MHKA 3FFLA 4G23A 1Y8MA 2KCVA 4CDRA 5BNWA 5FZRA 3PE4A 2AVPA 3LKUA 2XPIA 4KYOB 4I2WA 2UY1A 3CKCA 2BUGA 1A17A 4GCOA 4I9EA 4HOQA 5EKQD 5G04J 3UPVA 3QKYA 4RG6A 3FWVA 5JJ6A 4XI9A 4G1TA 4G24A 3ZPJA 4XI0A 4I1AA 5LCWC 3ASFA 1KLXA 2XEVA 3ASGA 2XCCA 4GZ6A 2Y4TA 3TGOA 3CEQA 3S7JA 3TG4A 3MV3B 2VGYA 4WUYA 2FO7A 4G2VA 4I17A 4O6FA 4CGWA 5HQ8A 4XIFA 1NZNA 3N71A 2R5SA 3Q4AB 3CK7A 5G04C 1ZBPA 3UUXA 3BEEA 3EDTB 1P5QA 4G25A 4N3AA 4YVOA 3AS8A 3TAXA 2ONDA 5EX0A 4KBQA 3QDNA 2V5FA 5C1DA 1NA3A 1NA0A 4J8EA 5FZSA 2LSVA 3LY8A 2OOEA 4YNDA 5BW8C 1KT1A 2P58C 3CV0A 1WAO1 1OUVA 4GA1A 3RO3A 3ZFWA 3U4TA 2XCBA 2LNIA 2XGSA 4GYYA 2XGMA 2LSUA 4UI9J 2HYZA 3Q47B 2C2LA 5KJNA 4WNDA 5DBKA 3TG5A 4A1SA 1ELRA 3ULQA 1B89A 5D0OD 2WQHA 4H7YA 2DBAA 5ARFA 3ASDA 2Q7FA 4CGVA 4WNEA 2KC7A 4Y6CA 4G26A 4ABNA 1XNFA 3SF4A 3ASHA 1QQEA 1FCHA 2VGXA 3S7DA 2HR2A 3GYZA 3UQ3A 1QZ2A 3LY7A 3E4BA 4N3CA 3RKVA 5FTPA 3MEKA 3ZHEA 2C0MA 3QWVA 4UQZA 2J9QA 3HYMB 2L6JA 3Q15A 3QOUA 4N2QA 5DIZA 5D0QD 4GCNA 2VGXB 4N5CA 4LEUA 5A7DB 1E96B 3RU0A 4BTBA 4UQYA 1YA0A 4EQFA 2UY1B 2JLBA 3OXLA 4N2SA 2FEZA 4AM9A 4HOUA 3CVLA 3MKRA 4Y6WA 5HI7A 4GYOA 5FT9A 4U0SA 2FBNA 1HXIA 5G05J 1IHGA 2YQ8A 3QWPA 5KJMA 2KATA 4U07A 3GW4A 4U0UA 2VSYA 5JJTA 4GPKA 3URZA 5JJ7A 3OXFA 2I6HA 4GA2A 3GZ2A 3Q49B 4JA9A 4ME2A 3CVQA 3LY9A 3MA5A 3RIBA 2KCKA 3VTXA 4AY6A 3ZHEB 3NF1A 3IEGA 3U3WA 4U04A 3O48A 2VQ2A 4HORA 3CKBA 3CK9A 4APOA 4UI9K 4UI9C 5G05C 2IFUA 4I9CA 5CHEE 4HOSA 1HH8A 2IF4A 4BT8A 3RO2A 4AY5A 3SZ7A 3CVNA 3CVPA 5EX3A 5ARGA 5M72A 2HO1A 4N3BA 1WM5A 3OXGA 5AYWD 4JA7A 4BWRA 2VYIA 4GZ5A 4RG9A 1ZU2A 3VTYA 4BT9A 5KJLA 2NC9A 4U0ZA 4UQXA 5A6CA 5LCWJ 4JHRA 5FJYA 4GZ3A 2PL2A 4F3VA 1KT0A 2FI7A 2QFCA 4KXKB 3PE3A 3ZN3A 3WXXA 2E2EA
chains in the Genus database with same CATH superfamily
5KJKA 3TJPA 4B94A 2V0PA 3NZUA 2PZIA 3KD7A 2P9SG 4JXTA 2UWJG 5ENTD 4BESA 3MX3A 3PDNA 2PM7A 3AS4A 5KCMA 3D9MA 2ILRA 3UXGA 2AJAA 3Q7AA 3ZPJA 4OVUA 1H6KA 3T8KA 3Q73A 1QBQA 4CCAA 4J8YA 3G2WA 3ESLA 2R5SA 3Q75A 2LUHA 1PY1A 2VSXE 5EIBE 1L5JA 4U7EB 3LVRE 4GTPA 3UQ3A 4N3CA 1PAQA 3RKVA 2IO3C 2C0MA 2J9QA 1H2TC 3SO8A 2UY1B 1E8XA 2Y3AA 3E30A 1DCQA 5B1BE 5AIJA 5AJLA 1K3ZD 2MRIA 3CVYA 2KATA 3DSXA 3BQOA 4GPKA 1U2VG 5LX8A 2ETBA 4G11A 3CKBA 4LRZA 3IKOB 4ANWA 4A63B 5KJLA 3E33A 1KT0A 3ZN3A 1HG2A 4HRMB 4ZFHA 3HHMA 1WY6A 4FP7A 3EHMA 2PQRA 2CHXA 1SZ9A 4GTMA 2X6FA 5ENNA 3KAEA 2DCPA 3IHYA 3E32A 4CEMA 1V54E 4PS8A 2FO7A 3ISMC 2X6IA 2QY7A 1QNFA 1HG5A 3BEEA 4B8AA 5LOZA 3AU4A 4ANVA 3ZNGA 4XKBA 1LD8A 1B89A 1IKND 4GTVA 4WNEA 4PUCA 1FCHA 5B3SE 3CIAA 3ZHEA 4NURA 4KVMA 5CBNA 1DVPA 4CZ2D 5HI7A 1RZ4A 2VTBB 1Z3YA 5JJ7A 4JEHA 1BI7B 2WXGA 1UOHA 4LNGA 4EZLA 2BKGA 5G05C 1EYHA 2CHWA 3UINC 1HX8A 4F53A 4GZ5A 1HFAA 4I6EA 3Q79A 4K03A 3CK8A 3RRMB 2CHZA 5CCMA 4IN3B 2VSOE 2KCLA 3FTSA 4CDNA 4HOTA 1INZA 1Y8MA 3L16A 4JD2G 3LKUA 3CHRA 4LNUD 3I3NA 4Q96A 1UW4B 3ASFA 5EILA 1MYOA 4LSZE 3CSTA 2F8YA 3N71A 4TUUA 3CHPA 4YVOA 2ETCA 2WMNA 1D9SA 3PZ4A 2DIWA 2R59A 3D9JA 2EINE 2AW6A 1E7VA 4A1SA 3RSEG 3B7BA 4IYPA 3BG1B 4UWLA 1LD7A 4FLBA 4U96D 4F1SA 3FTWA 4F7AA 5AAOA 3LEWA 4N2SA 4XEIG 3TWUA 2KZTA 2OV8A 4JHKA 2VGEA 3RIBA 2KCKA 1V55E 3G2SA 3Q9UC 3ABLE 4DRXE 5EX3A 5FQ4A 1OXJA 3U66A 2ZGGA 4BT9A 4JHRA 3UI2A 4FHKA 3CSFA 3MV2B 3QWWA 3SI5A 3NOCD 3FH7A 4ACKA 5HRYA 1D8EA 4XI9A 3K9IA 4E85A 4EHMA 3PE4A 5JMND 4JB8P 5AENA 3QKYA 4WWNA 2OEWA 1H6PA 1UJJA 3AG3E 4G2VA 4O6FA 2OEVA 1O1TA 2H6GA 4MKTA 2IEJA 4N5QA 3SNXA 3I5PA 2IONA 4O1OA 4LCTA 4GA1A 4HB5A 4KVOA 3UM2A 3JXIA 4H7YA 4A55A 4ATZD 3GYZA 4HI9A 3R7RA 4LEUA 3LS8A 5CEAA 4ILGA 3CVVA 2XEEA 5CBOA 2B0OE 1K8KG 3SBTB 3FUNA 2XENA 3TWQA 3AAAC 3UM0A 2AWIA 3FHEA 1O5MA 4HORA 4UI9K 3D9HA 1DNPA 1Z6TA 3ONLA 2I1KA 5LFAA 4L2YA 1WDYA 2V5QC 5H7PA 4OAVB 3VTYA 1SVXA 3PNTB 3VLEA 3KEZA 3GZ1A 1U3DA 4LNBA 5ENOD 1UN8A 2XGOA 1Q2ZA 1N94A 3U64A 4K5AB 3QNKA 3HDXA 3DSVA 2L6BA 5EKQD 3UPVA 1UN9A 3FU3A 3DEPA 1BI8B 4I1AA 2BKKB 4RQIA 4ILIA 3ENEA 4WUYA 4DX6D 5HQ8A 4L9PA 3C5RA 4MRUA 1XGWA 3EDTB 4KBQA 2V5FA 4DX7D 3ZFWA 2P2CP 2QZAA 2HYZA 4K0RA 2XRYA 2WQHA 2XEHA 2Q7FA 1HE8A 3FTYA 1HS6A 1SZAA 4IRUA 3VLFA 3DPYA 1ELKA 4CT0A 2X3MA 3CQGB 3HVEB 5CEDB 3CHSA 3TXNA 2YQ8A 1Z5SC 3ZRHA 5AARA 4CT4A 3URZA 2FULA 3L22A 3L6AA 5CERB 2WXMA 3CGHA 1WM5A 3NAWA 1A5EA 3FDHA 5EYPF 3PUJA 1H19A 5FJYA 1LTXA 4F3VA 3CLJA 2F0YA 4GTSA 4G8LA 3ULYA 1PC2A 1FT1A 4F6RD 2GW1A 4I2ZA 1YYHA 4BTAA 2YHCA 1OCZE 3G2UA 3FU5A 5HS0A 2YINA 2DZNA 4AM9A 5G04J 5JJ6A 3FWVA 4ANXA 3TG4A 3JUEA 4DX5D 1OWLA 4G25A 1HU3A 3ONKA 2P58C 1OUVA 5BXUA 3EJNA 4L7TA 2LAIA 3Q47B 2C2LA 5KBAA 2WXFA 4GZDA 2P9KG 5EYLA 1E8YA 3EUVA 4G26A 4HS2A 1XNFA 3MKQB 3S7DA 4L1BA 2RFMA 2AXVA 3SD5A 2QC9A 3QOUA 5AQBA 4GMJA 5DIZA 3CHMA 1TN7A 3APCA 5E75A 3C72A 1AWCB 3PVLA 2JLBA 3DXMG 2EIKE 4HLEA 4HQDA 3FY4A 2VSYA 2I6HA 4L2LA 3DWLG 3JQ1A 4BX9A 1BD8A 3U3WA 1DCEA 3HVEA 3G2VA 2XS8A 3SFXA 5AYWD 3LXUX 3ML8A 4K5CA 4GZ3A 3B7TA 3SGHA 3PZDA 1N4PA 2QFCA 3I4GA 3JQ0A 3MGBA 2V8SE 1ELWA 1X5BA 4AIFA 5FQ7A 3LPZA 1E8ZA 4N39A 1JCQA 3ESKA 3AS5A 3MJWA 3LCAA 3QC1A 5BNWA 1MX4A 2DYSE 2HE0A 4PDXA 4AP2A 4KYOB 4I2WA 4GTQA 2OVBA 4XKCA 3FUEA 5LCWC 3HRAA 1HO8A 3TGOA 3S7JA 3LJ3A 2JABA 4CGWA 4I17A 3CVWA 2YHEA 4XIFA 3RK6A 1IQRA 3CVUA 3UUXA 1OWNA 3TAXA 3ULQA 3QDNA 2LSVA 4YNDA 4BETA 3CVXA 4C9BB 4YDYA 4C0MA 2RKKA 4M7CA 1SA5A 3SQVA 3B13A 2VGXA 3PZ3A 4FADA 3LY7A 1S70B 5CRUA 5D0QD 4O60A 4TUMA 1FVFA 3T8MA 4HVBA 1N4SA 2V4LA 4B0ZA 5FT9A 1E7UA 3D9OA 3OXFA 4MBGA 3GZ2A 4Q69A 3SHFA 4YDOA 4EZKA 3NQPA 4PS3A 3RRUA 1TNUA 4YDWA 5AJDA 2XPYA 4GAAA 4UWFA 4N3BA 3OXGA 4D10C 5A6CA 3HG0D 4PS7A 4ANUA 5BUZA 3AU5A 5CCLA 2PQNA 2FO1E 2Y4UA 2FF4A 2X38A 3HIZA 1OCRE 4GA0A 1N0QA 1S0PA 5FZQA 2WPVA 4CRWA 2WMOA 3FTZA 1H0AA 3KSQA 4I9EA 4HBDA 3ULEG 2J08A 1KLXA 2WXLA 2XZDG 2L9BA 2EQXA 1NZNA 3KSLA 4URKA 3T5VA 3LDZA 1P5QA 2EILE 2ONDA 5BW8C 2GRMA 4C0EA 5FWQA 3CV0A 3RO3A 1WAO1 2RFAA 4A1GA 3J5PA 2LSUA 4GU5A 5D0OD 4HFGA 4Z68A 3R7QA 3JXJA 2J4DA 3MEKA 1TEZA 3HYMB 2XQ0A 4JC8A 4JEUA 2PNNA 5A23A 4UQYA 2PM6A 5CECB 3FUDA 1JCRA 2FBNA 5G05J 4DI4A 4U07A 3UT4A 2OVFA 4DLOA 1IXVA 3IEGA 2OCCE 3FU0A 4BT8A 3RO2A 1TR4A 3CHOA 4XX5A 5E76A 5M72A 2J8SD 4JA7A 4BSXA 2DVWA 4CYMD 1S63A 3D9KA 1N4RA 1IHBA 2H6IA 2E2EA 4GYWA 3R9MA 5FINA 2IQCA 5ENSD 3RJVA 3ZGQA 3DSWA 1HZ4A 3ZXSA 1NI1A 2MHKA 3UKRG 1H6OA 2XPIA 3CKCA 4GCOA 1A17A 2R17C 2GRQB 4GTRA 2R02A 4J7WA 3UX4A 3V2XA 2VGYA 4KZCA 1BLXB 2X6KA 3Q4AB 3CK7A 5G04C 1NA3A 2L0IA 3EU5A 2WVIA 3TWXA 4P29A 2XGSA 4GYYA 4UI9J 3FUFA 4DX2A 5KJNA 4A3TA 4APFA 1AP7A 3J5QB 1QQEA 3IV0A 1QZ2A 4F1PA 4GPMA 3QWVA 3V79K 2QYJA 4GTTA 3E34A 2FEZA 4JZYA 4U63A 3CVLA 5BXOA 4TXRA 4PH4B 3Q49B 1MJ0A 3NF1A 3ZEFA 3DXKG 4I1OB 4DPRA 3UMVA 1WG0A 4K5BA 1SQMA 3TWWA 3NOGD 3PUKA 4OAUC 4RLYA 3R9AB 3Q5MA 5BT1A 4AVXA 2GGFA 2XS1A 3S7FA 2H6FA 4GB9A 3L9TA 3TL5A 4BFRA 4WWOA 2BEDA 5KWDA 3MCXA 2CG3A 2P9NG 1OT8A 3ZVVA 2GRRB 1N95A 3TWVA 4HRNA 3SY2A 3WG7E 3B7SA 5T4YA 2P9IG 4U8VD 1OWMA 1KT1A 2WXHA 1U3CA 2CG2A 3MZLB 4QFVA 4KZ0A 3SFZA 2NYJA 1JWGA 5G55A 1E96B 1N52A 3QARA 1N11A 3D3MA 4BTBA 1EDUA 1G3NB 3L08A 5KJMA 3GW4A 4JVSA 1OCCE 3T9KA 4ME2A 3O48A 4IULA 4R7LA 4UI9C 2IOLA 2IF4A 3NB2A 4NIKA 1NP7A 4U8HA 4RVBA 4U0ZA 1TNYA 4X8QA 2QYUA 1KZPA 3D9PA 2R05A 3LYAA 1FPPA 2XRZA 3T5XA 3AG2E 3FUHA 2HM8A 3JYSA 4UWHA 1ZB1A 3C3QA 4G23A 2WXKA 2KCVA 5LP0A 2UY1A 3TWTA 2BUGA 1KPSB 2KZTB 3AG1E 2EIME 3ML9A 4DK5A 3P1UA 1BU9A 3Q7FA 5FZSA 1MQSA 3DEOA 2YNQA 4V3IA 3UIOC 3I4RB 1X81A 2ZXWE 4O1PA 1N9AA 1ELRA 3AG4E 2DBAA 4CGVA 3ZXPA 3V30A 2NXPA 4AOFA 4FA6A 2WXIA 3ZUVB 3S2AA 4GCNA 4FC8A 3W9GA 2X6HA 5EIDA 4MS6A 2VTBA 4EQFA 4GMLA 3OXLA 4EPZA 1S64A 3JCKC 1IHGA 3ZYKA 1DC2A 5FQ6A 2LXMA 2P9LG 3ZHEB 3CK9A 4APOA 5JHBA 3APDA 5BV1A 4I1MA 5ENQD 2JEKA 3QJZA 4HNAD 2NC9A 4UQXA 3DSUA 3C3RA 3QAQA 4JL0A 3EHRA 3DRAA 3PEVB 5D2MC 4M3OA 1W3BA 5J08A 3PZ1A 1H2UA 2KM4A 4WAFA 4BERA 3LJNA 4NQ0A 3FULA 1E90A 4CDRA 4C48B 4HI8A 3P2BA 5KNGA 2CFZA 4E6HA 2AXZA 4L23A 3ASOE 4UUCA 2XEVA 2XCCA 4GZ6A 2Y4TA 5CRVA 3FEXA 4WWPA 5KNHD 2J07A 4B8CB 3L17A 3QB2A 4N3AA 3BU8A 3PNLB 3LY8A 4JPSA 3PH0C 3B95A 2A5UA 2XCBA 4MLPA 3OTNA 4WNDA 5DBKA 3V2OA 5ARFA 4Y6CA 4DI3A 4FLHA 2E0IA 5FTPA 4BSZB 2ZIRA 3CQCB 3UTMA 4JHJA 4AEZC 4KT6B 3IBEA 5FIOA 3MKRA 3HXEA 2IO2C 1NFIE 4ILHB 1QYMA 2ZGDA 3QWPA 3ZW3A 3VTXA 3CVQA 3LY9A 5AQAA 2VQ2A 4AY5A 4GTOA 1MX2A 4TRQA 3UKUG 5ARGA 1TN8A 3E37A 3D9NA 4J8SA 1Z3XA 4KMOA 3HXFA 3IHVA 2EIJE 3SFYA 4FJZA 3PRZA 4UWGA 3RRNB 4LUNU 5CMYA 3PZ2A 4J8DA 4BEPA 2X6JA 3FUMA 4J8FA 1K1AA 1Y6IA 4AJWA 1N54A 3S7BA 2GRNB 3EIQC 3FFLA 5ENRD 5J90A 4ATGA 4AXHA 2ZU6B 2Y69E 3U9WA 4G24A 4XI0A 1E8WA 3UT8A 3QK0A 5IY5E 3MYVA 1OY3D 3TWRA 2VJ8A 5C1DA 3AS8A 2GRPB 5C2YA 1JPLA 3ZU7B 4ABNA 1TNBA 3ASHA 4J6IA 2HR2A 4HXIA 1O1RA 2NSZA 4TV3A 3F6QA 2LO6A 2J09A 3PS6A 3C98A 2L6JA 1MX6A 2VGXB 1H2VC 5EDSA 5CMWA 4OVVA 4LG6A 1YA0A 3NZSA 4B89A 1YMPA 2WXJA 2AXUA 1IQUA 3MKQA 3GZSA 4FHJA 4GYOA 1HXIA 2MOWA 5G2NA 1TJFA 4U0UA 1N4QA 5JJTA 1TYQG 3JUIA 3EHNA 1JWFA 4EZJA 1UJKA 3FUKA 3SBSA 4NACA 3APFA 4I9CA 1GW6A 1HH8A 3D9IA 3V31A 3FH8A 3FEYA 5AQ7A 3EU9A 1NL4A 2WXQA 4A3VA 5LCWJ 1EPUA 5AQ9A 1IYGA 4BX8A 3UT7A 4OYSA 1LF8A 4I43A 1SW6A 4J0UA 4WNFA 3NBNB 1O1SA 4YVQC 2IY0C 5BPPA 5FZRA 2AVPA 2WQ7A 4BY6A 2R2LA 3FH5A 2A5EA 2F8XK 3CEQA 4XE0A 3FTXA 4DJAA 3L54A 3ZKJA 1NA0A 5ANLA 2OOEA 3ZYQA 2RD0A 4DX1A 3FUIA 3DSTA 2A4ZA 3ASDA 3EIJA 1RW2A 3EHQA 3Q78A 4U95D 2F37A 3VLDA 3Q9NC 3CR3A 4I6GA 3IXEA 2BF0X 3FU6A 4UQZA 3TXMA 3ABME 2WXPA 4HOUA 4QQIA 1MZCA 2DYRE 2KXPC 4GA2A 4JA9A 3HXCA 5ITZF 2J49A 4FJYA 4HOSA 4FULA 3CHQA 3HXBA 3SZ7A 2DWZA 2WM9A 3OAWA 2I1JA 2VYIA 4CDMA 3FTVA 3UM3A 1EF1C 2FI7A 2Y1LE 4KXKB 3PE3A 4FU3A 2DZOA 2H6HA 3RAUA 3B7RL 4H7XA 3ABKE 4TXQA 1MHQA 2IU1A 2BTDA 4YDEA 2VSNA 1TNZA 2RG8A 4LERA 2LAHA 4HOQA 1KZOA 4G1TA 2KBXA 4B93B 3ASGA 3D9LA 5HKPA 5JHAA 1ZBPA 5EX0A 2XHEA 4J8EA 3X2QE 3UM1A 3ZYMA 4GMRA 3U4TA 2B6CA 2XGMA 1TNOA 3DPDA 1K1BA 3TG5A 4GZCA 2IOSA 4U8YD 1SA4A 2I9CA 5D66A 3AJIA 1JCSA 2ZISA 3KEAA 3E4BA 3FTUA 4XZ4A 4DLQA 4N2QA 3Q15A 4EBAA 3FUJA 2J4BA 4N5CA 5T8IA 4EECA 4U0SA 3LVQE 4Q94A 2V4HC 5T3RA 3TWSA 1OCOE 3DSSA 5JA4D 5CHEE 1YCSB 2LXLA 2HO1A 1TN6A 4JW1A 4BWRA 1ZU2A 5FQ8A 3UIPC 5ENPD 3HXDA 3L82A 2WXRA 1UG3A 2C0LA 3KS2A 2P9UG 3BG0B 1TJCA 3W9FA 1OWPA 3O4ZA 1VDYA 2IJGX 4EBAG 1FT2A 4WNGA 3ASNE 4W9RA 5A7DB 3FP3A 2ETAA 4NRHB 1FVHA 4DUIA 2M63A 2P9PG 5ANRA 3PREA 1N0RA 3C3OA 3WXXA 4ACLA 4RG6A 4RSYA 3DBSA 2XZTG 1HF8A 3MV3B 2WQ6A 2WXOA 5BV0A 2WXNA 2Y0BG 3BUAA 3ZYLA 4ZHBA 1JUQA 4UWKA 2LNIA 3PEUB 4I6JA 2WB2A 2KC7A 3G2TA 3SF4A 2L0TB 2GROB 4G8KA 3RU0A 4AV7A 2XPZA 4Y6WA 3B7UX 5EN5D 3ZIMA 4HRLA 2R03A 4TXPA 3MA5A 4AY6A 5B1AE 1BPOA 4U04A 2IFUA 2I2OA 2GRLA 3CVNA 3CVPA 2MYOA 1OWOA 3L13A 4RG9A 1D8DA 4HLLA 2PL2A 5AN8A 2CFUA
chains in the Genus database with same CATH topology
4GYWA 3TJPA 5KJKA 4B94A 3KEZA 4FJZA 3GZ1A 3PRZA 4UWGA 2IQCA 1U3DA 3RJVA 2V0PA 3NZUA 3RRNB 2PZIA 3KD7A 4LUNU 5CMYA 4JXTA 4J8DA 2UWJG 2X6JA 3FUMA 3ZGQA 1UN8A 2XGOA 3MX3A 4J8FA 1Y6IA 3U64A 4AJWA 1HZ4A 3PDNA 1N54A 3ZXSA 3S7BA 2PM7A 3AS4A 2MHKA 3EIQC 3FFLA 3QNKA 5KCMA 3D9MA 3HDXA 5J90A 2XPIA 4ATGA 2ZU6B 4AXHA 2ILRA 3CKCA 5EKQD 4GCOA 1A17A 3UPVA 1UN9A 2R17C 3FU3A 3U9WA 3ZPJA 4G24A 4XI0A 4I1AA 1E8WA 1H6KA 4OVUA 3UT8A 3UX4A 3QK0A 4CCAA 4ILIA 3ENEA 2VGYA 3G2WA 4KZCA 4WUYA 3ESLA 3MYVA 5HQ8A 2R5SA 2VJ8A 2X6KA 3CK7A 3Q4AB 5G04C 4MRUA 1XGWA 3EDTB 5C1DA 3AS8A 4KBQA 2V5FA 1NA3A 1PY1A 2L0IA 2VSXE 2WVIA 4P29A 3ZFWA 5C2YA 2XGSA 4GYYA 4UI9J 1JPLA 3FUFA 1L5JA 2HYZA 4K0RA 2XRYA 5KJNA 4A3TA 4APFA 2WQHA 2Q7FA 1HE8A 3LVRE 3FTYA 4ABNA 1HS6A 3ASHA 1QQEA 4J6IA 3IV0A 1SZAA 2HR2A 3UQ3A 1QZ2A 4HXIA 4IRUA 4N3CA 1PAQA 3RKVA 2NSZA 4TV3A 2C0MA 2LO6A 3QWVA 2J09A 2J9QA 3C98A 2L6JA 3PS6A 3VLFA 1H2TC 2VGXB 1H2VC 5EDSA 1ELKA 5CMWA 4CT0A 4OVVA 2X3MA 1YA0A 3NZSA 2UY1B 1E8XA 2Y3AA 3CQGB 3HVEB 4B89A 2FEZA 2WXJA 3CHSA 2AXUA 4JZYA 4U63A 3CVLA 1IQUA 3MKQA 3GZSA 4FHJA 4GYOA 3TXNA 5AIJA 5AJLA 4PH4B 1HXIA 2MOWA 2MRIA 2YQ8A 5G2NA 3ZRHA 1TJFA 2KATA 4U0UA 3CVYA 4CT4A 5JJTA 4GPKA 3URZA 3JUIA 5LX8A 3Q49B 2FULA 3NF1A 3EHNA 3L22A 3L6AA 1JWFA 4G11A 3ZEFA 3CKBA 1UJKA 4EZJA 3FUKA 3SBSA 4NACA 3APFA 4I9CA 4LRZA 1GW6A 1HH8A 3D9IA 4I1OB 3IKOB 3FH8A 4DPRA 2WXMA 3UMVA 3CGHA 1SQMA 1WM5A 3FEYA 4ANWA 2WXQA 5KJLA 4A3VA 3FDHA 3PUJA 5LCWJ 1H19A 3PUKA 5FJYA 4F3VA 1EPUA 1KT0A 3CLJA 3ZN3A 1HG2A 1IYGA 3R9AB 3Q5MA 4BX8A 5BT1A 1PC2A 3HHMA 1WY6A 4FP7A 2GW1A 4OYSA 1LF8A 2GGFA 3UT7A 4AVXA 4I43A 3S7FA 3EHMA 2PQRA 2CHXA 1SZ9A 2X6FA 4GB9A 4I2ZA 4J0UA 4WNFA 4WWOA 3TL5A 5ENNA 4BTAA 4BFRA 3MCXA 2YHCA 4YVQC 2CG3A 3G2UA 3FU5A 3KAEA 5BPPA 2DCPA 2YINA 5FZRA 3ZVVA 2AVPA 4AM9A 3IHYA 2WQ7A 4BY6A 5G04J 5JJ6A 3FWVA 4ANXA 4CEMA 3FH5A 4PS8A 3CEQA 3TG4A 2FO7A 4XE0A 2X6IA 3FTXA 4DJAA 2QY7A 3B7SA 5T4YA 1QNFA 1OWLA 1HG5A 3L54A 3BEEA 4G25A 1HU3A 4B8AA 5LOZA 1NA0A 5ANLA 2OOEA 3AU4A 1OWMA 3ONKA 1KT1A 2P58C 2WXHA 3ZYQA 1OUVA 2RD0A 1U3CA 3EJNA 4L7TA 2CG2A 3MZLB 4ANVA 2LAIA 3FUIA 3Q47B 2C2LA 4XKBA 4QFVA 2WXFA 4KZ0A 1B89A 2A4ZA 3ASDA 4GZDA 3EIJA 4WNEA 3SFZA 1E8YA 4G26A 4HS2A 3VLDA 1XNFA 3MKQB 4PUCA 3CR3A 1JWGA 1FCHA 4I6GA 4L1BA 3S7DA 2BF0X 2AXVA 3CIAA 3SD5A 3FU6A 3ZHEA 5G55A 4UQZA 4NURA 3QOUA 4KVMA 4GMJA 5DIZA 3CHMA 3APCA 1DVPA 1E96B 3TXMA 1N52A 5E75A 3QARA 3D3MA 4BTBA 3PVLA 2JLBA 1EDUA 2WXPA 4HLEA 4HOUA 5HI7A 2VTBB 3L08A 5KJMA 3GW4A 3FY4A 1Z3YA 2VSYA 4JVSA 5JJ7A 2I6HA 4GA2A 4JA9A 4JEHA 4L2LA 4ME2A 3JQ1A 4BX9A 2J49A 2WXGA 3U3WA 3O48A 4FJYA 4IULA 4R7LA 4EZLA 4HOSA 4UI9C 5G05C 1EYHA 2IOLA 3CHQA 3HVEA 2CHWA 2IF4A 4FULA 3G2VA 3SZ7A 2WM9A 1HX8A 3OAWA 4F53A 5AYWD 2I1JA 3LXUX 2VYIA 4GZ5A 4CDMA 3FTVA 3ML8A 1NP7A 4U8HA 1HFAA 4I6EA 4RVBA 4U0ZA 4GZ3A 3B7TA 1EF1C 3SGHA 3PZDA 2FI7A 2QFCA 4KXKB 3PE3A 4K03A 3I4GA 3JQ0A 3MGBA 3CK8A 4FU3A 3RRMB 2V8SE 1ELWA 3B7RL 4H7XA 2CHZA 1X5BA 3D9PA 3LYAA 4AIFA 5CCMA 5FQ7A 3LPZA 2XRZA 3T5XA 1MHQA 4IN3B 3FUHA 2IU1A 2BTDA 2HM8A 1E8ZA 2VSOE 3JYSA 4N39A 4UWHA 2KCLA 3FTSA 2VSNA 4CDNA 3ESKA 3AS5A 4HOTA 2RG8A 3MJWA 3LCAA 3QC1A 4LERA 5BNWA 4G23A 1INZA 1Y8MA 2KCVA 2WXKA 3L16A 5LP0A 3LKUA 3CHRA 4PDXA 4AP2A 4KYOB 3I3NA 2LAHA 2UY1A 4I2WA 2BUGA 4Q96A 4HOQA 4XKCA 2OVBA 4G1TA 3FUEA 2KZTB 5LCWC 1UW4B 3ASFA 3ASGA 3D9LA 1HO8A 3TGOA 3S7JA 3LJ3A 3ML9A 5JHAA 4CGWA 3CSTA 4I17A 4DK5A 3CVWA 2YHEA 3P1UA 4XIFA 3RK6A 1IQRA 3N71A 1ZBPA 4TUUA 3UUXA 3CVUA 1OWNA 3CHPA 3TAXA 3ULQA 4YVOA 5EX0A 3QDNA 2XHEA 5FZSA 4J8EA 1MQSA 2LSVA 4YNDA 2WMNA 2YNQA 2DIWA 2R59A 4V3IA 3ZYMA 3D9JA 3I4RB 3CVXA 3U4TA 4C9BB 2XGMA 4C0MA 2AW6A 3DPDA 3TG5A 1E7VA 1ELRA 4GZCA 4A1SA 2DBAA 4CGVA 2IOSA 2I9CA 3B13A 2NXPA 4IYPA 3BG1B 2VGXA 4UWLA 4FADA 4AOFA 3LY7A 3E4BA 4FA6A 3FTUA 4XZ4A 2WXIA 4DLQA 3S2AA 4FLBA 4N2QA 3Q15A 4EBAA 5D0QD 4GCNA 3FUJA 2J4BA 4FC8A 4N5CA 4F1SA 3FTWA 4F7AA 5T8IA 1FVFA 2X6HA 3T8MA 4HVBA 4MS6A 2VTBA 4EQFA 4GMLA 3LEWA 3OXLA 4N2SA 4EECA 4EPZA 2V4LA 4B0ZA 2KZTA 3JCKC 4U0SA 5FT9A 1E7UA 1IHGA 3D9OA 2OV8A 3LVQE 4Q94A 4JHKA 3ZYKA 3OXFA 5FQ6A 3GZ2A 3RIBA 4Q69A 2KCKA 3ZHEB 3G2SA 3SHFA 5T3RA 3CK9A 4APOA 4EZKA 3NQPA 5JHBA 4PS3A 5CHEE 3APDA 3RRUA 5BV1A 5AJDA 4I1MA 2JEKA 2XPYA 5EX3A 4GAAA 3QJZA 2HO1A 4UWFA 4N3BA 5FQ4A 3OXGA 4JW1A 3U66A 4BWRA 4BT9A 1ZU2A 4D10C 2NC9A 4UQXA 5A6CA 5FQ8A 4JHRA 2WXRA 4FHKA 1UG3A 4PS7A 4ANUA 2C0LA 3CSFA 3KS2A 5BUZA 3MV2B 3AU5A 3BG0B 3QAQA 2PQNA 4JL0A 5CCLA 3QWWA 2Y4UA 3SI5A 2FF4A 3PEVB 1TJCA 2X38A 1OWPA 3FH7A 3HIZA 3O4ZA 4M3OA 4ACKA 1VDYA 1W3BA 4GA0A 2IJGX 5J08A 1H2UA 2KM4A 4WAFA 4EBAG 1S0PA 5FZQA 2WPVA 4NQ0A 4WNGA 4W9RA 4XI9A 5A7DB 3FP3A 3K9IA 4NRHB 4E85A 3FULA 1FVHA 1E90A 2M63A 4CRWA 4CDRA 2WMOA 3FTZA 1H0AA 3PE4A 5ANRA 3PREA 3WXXA 4I9EA 3P2BA 4ACLA 3QKYA 2CFZA 2AXZA 4RG6A 4L23A 4RSYA 4WWNA 4E6HA 5AENA 1UJJA 2J08A 1KLXA 2XEVA 2XCCA 3DBSA 4GZ6A 2Y4TA 1HF8A 3FEXA 4WWPA 3MV3B 4G2VA 4O6FA 2WXLA 2L9BA 2WQ6A 2EQXA 2WXOA 1NZNA 5BV0A 2J07A 4MKTA 2WXNA 4URKA 3T5VA 4B8CB 3LDZA 3SNXA 3L17A 3I5PA 2IONA 1P5QA 3QB2A 4N3AA 3ZYLA 2ONDA 1JUQA 3PNLB 3LY8A 5BW8C 2GRMA 4C0EA 5FWQA 4UWKA 3CV0A 4JPSA 3PH0C 1WAO1 4GA1A 4LCTA 3RO3A 2A5UA 4KVOA 2XCBA 4MLPA 2LNIA 4A1GA 2LSUA 3PEUB 3OTNA 4WNDA 4GU5A 4I6JA 5DBKA 5D0OD 2WB2A 4H7YA 5ARFA 4HFGA 2KC7A 3G2TA 4Y6CA 4A55A 3SF4A 4DI3A 4FLHA 2L0TB 3R7QA 2J4DA 3GYZA 2E0IA 5FTPA 3MEKA 1TEZA 3HYMB 3CQCB 3R7RA 2XQ0A 4JC8A 4JHJA 4LEUA 4JEUA 4AEZC 5A23A 3LS8A 3RU0A 4ILGA 3CVVA 4UQYA 2PM6A 4AV7A 4KT6B 2XPZA 3IBEA 4Y6WA 3MKRA 3FUDA 3SBTB 3B7UX 2FBNA 3FUNA 3ZW3A 4ILHB 5G05J 3QWPA 4DI4A 4U07A 3ZIMA 3UT4A 2OVFA 4DLOA 3VTXA 3CVQA 3LY9A 3MA5A 4AY6A 2AWIA 3IEGA 3FHEA 1BPOA 4U04A 2VQ2A 4HORA 4UI9K 2IFUA 3FU0A 2I2OA 4BT8A 3RO2A 4AY5A 3CHOA 2GRLA 4TRQA 3CVNA 4XX5A 3CVPA 1DNPA 1Z6TA 3ONLA 5E76A 5ARGA 5M72A 2I1KA 3D9NA 4J8SA 1OWOA 5LFAA 3L13A 4JA7A 4L2YA 4RG9A 4BSXA 3VTYA 3PNTB 1Z3XA 4KMOA 2PL2A 3IHVA 3D9KA 3VLEA 2CFUA 2E2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0L A;  3CK8 A;  4GYW A;  3KS2 A;  4B94 A;  5KJK A;  1IYG A;  3R9A B;  3MV2 B;  5CCL A;  3Q5M A;  4JL0 A;  2PQN A;  1ELW A;  3GZ1 A;  3QWW A;  4H7X A;  5BT1 A;  1PC2 A;  2Y4U A;  3LYA A;  3RJV A;  2FF4 A;  2GW1 A;  1TJC A;  4AIF A;  5CCM A;  2PZI A;  3KD7 A;  2PQR A;  3LPZ A;  3S7F A;  4IN3 B;  4J8D A;  4I2Z A;  2UWJ G;  4J0U A;  1W3B A;  4WNF A;  3ZGQ A;  2XGO A;  4GA0 A;  4BTA A;  2YHC A;  4J8F A;  4YVQ C;  3JYS A;  4N39 A;  2WPV A;  5FZQ A;  4NQ0 A;  4WNG A;  2KCL A;  1HZ4 A;  2VSN A;  3FP3 A;  3K9I A;  3PDN A;  4NRH B;  3ESK A;  3AS5 A;  4W9R A;  3KAE A;  3S7B A;  4HOT A;  3LCA A;  3AS4 A;  2MHK A;  3FFL A;  4G23 A;  1Y8M A;  2KCV A;  4CDR A;  5BNW A;  5FZR A;  3PE4 A;  2AVP A;  3LKU A;  2XPI A;  4KYO B;  4I2W A;  2UY1 A;  3CKC A;  2BUG A;  1A17 A;  4GCO A;  4I9E A;  4HOQ A;  5EKQ D;  5G04 J;  3UPV A;  3QKY A;  4RG6 A;  3FWV A;  5JJ6 A;  4XI9 A;  4G1T A;  4G24 A;  3ZPJ A;  4XI0 A;  4I1A A;  5LCW C;  3ASF A;  1KLX A;  2XEV A;  3ASG A;  2XCC A;  4GZ6 A;  2Y4T A;  3TGO A;  3CEQ A;  3S7J A;  3TG4 A;  3MV3 B;  2VGY A;  4WUY A;  2FO7 A;  4G2V A;  4I17 A;  4O6F A;  4CGW A;  5HQ8 A;  4XIF A;  1NZN A;  3N71 A;  2R5S A;  3Q4A B;  3CK7 A;  5G04 C;  1ZBP A;  3UUX A;  3BEE A;  3EDT B;  1P5Q A;  4G25 A;  4N3A A;  4YVO A;  3AS8 A;  3TAX A;  2OND A;  5EX0 A;  4KBQ A;  3QDN A;  2V5F A;  5C1D A;  1NA3 A;  1NA0 A;  4J8E A;  5FZS A;  2LSV A;  3LY8 A;  2OOE A;  4YND A;  5BW8 C;  1KT1 A;  2P58 C;  3CV0 A;  1WAO 1;  1OUV A;  4GA1 A;  3RO3 A;  3ZFW A;  3U4T A;  2XCB A;  2LNI A;  2XGS A;  4GYY A;  2XGM A;  2LSU A;  4UI9 J;  2HYZ A;  3Q47 B;  2C2L A;  5KJN A;  4WND A;  5DBK A;  3TG5 A;  4A1S A;  1ELR A;  3ULQ A;  1B89 A;  5D0O D;  2WQH A;  4H7Y A;  2DBA A;  5ARF A;  3ASD A;  2Q7F A;  4CGV A;  4WNE A;  2KC7 A;  4Y6C A;  4G26 A;  4ABN A;  1XNF A;  3SF4 A;  3ASH A;  1QQE A;  1FCH A;  2VGX A;  3S7D A;  2HR2 A;  3GYZ A;  3UQ3 A;  1QZ2 A;  3LY7 A;  3E4B A;  4N3C A;  3RKV A;  5FTP A;  3MEK A;  3ZHE A;  2C0M A;  3QWV A;  4UQZ A;  2J9Q A;  3HYM B;  2L6J A;  3Q15 A;  3QOU A;  4N2Q A;  5DIZ A;  5D0Q D;  4GCN A;  2VGX B;  4N5C A;  4LEU A;  5A7D B;  1E96 B;  3RU0 A;  4BTB A;  4UQY A;  1YA0 A;  4EQF A;  2UY1 B;  2JLB A;  3OXL A;  4N2S A;  2FEZ A;  4AM9 A;  4HOU A;  3CVL A;  3MKR A;  4Y6W A;  5HI7 A;  4GYO A;  5FT9 A;  4U0S A;  2FBN A;  1HXI A;  5G05 J;  1IHG A;  2YQ8 A;  3QWP A;  5KJM A;  2KAT A;  4U07 A;  3GW4 A;  4U0U A;  2VSY A;  5JJT A;  4GPK A;  3URZ A;  5JJ7 A;  3OXF A;  2I6H A;  4GA2 A;  3GZ2 A;  3Q49 B;  4JA9 A;  4ME2 A;  3CVQ A;  3LY9 A;  3MA5 A;  3RIB A;  2KCK A;  3VTX A;  4AY6 A;  3ZHE B;  3NF1 A;  3IEG A;  3U3W A;  4U04 A;  3O48 A;  2VQ2 A;  4HOR A;  3CKB A;  3CK9 A;  4APO A;  4UI9 K;  4UI9 C;  5G05 C;  2IFU A;  4I9C A;  5CHE E;  4HOS A;  1HH8 A;  2IF4 A;  4BT8 A;  3RO2 A;  4AY5 A;  3SZ7 A;  3CVN A;  3CVP A;  5EX3 A;  5ARG A;  5M72 A;  2HO1 A;  4N3B A;  1WM5 A;  3OXG A;  5AYW D;  4JA7 A;  4BWR A;  2VYI A;  4GZ5 A;  4RG9 A;  1ZU2 A;  3VTY A;  4BT9 A;  5KJL A;  2NC9 A;  4U0Z A;  4UQX A;  5A6C A;  5LCW J;  4JHR A;  5FJY A;  4GZ3 A;  2PL2 A;  4F3V A;  1KT0 A;  2FI7 A;  2QFC A;  4KXK B;  3PE3 A;  3ZN3 A;  3WXX A;  2E2E A; 
#chains in the Genus database with same CATH topology
 5KJK A;  3TJP A;  4B94 A;  2V0P A;  3NZU A;  2PZI A;  3KD7 A;  2P9S G;  4JXT A;  2UWJ G;  5ENT D;  4BES A;  3MX3 A;  3PDN A;  2PM7 A;  3AS4 A;  5KCM A;  3D9M A;  2ILR A;  3UXG A;  2AJA A;  3Q7A A;  3ZPJ A;  4OVU A;  1H6K A;  3T8K A;  3Q73 A;  1QBQ A;  4CCA A;  4J8Y A;  3G2W A;  3ESL A;  2R5S A;  3Q75 A;  2LUH A;  1PY1 A;  2VSX E;  5EIB E;  1L5J A;  4U7E B;  3LVR E;  4GTP A;  3UQ3 A;  4N3C A;  1PAQ A;  3RKV A;  2IO3 C;  2C0M A;  2J9Q A;  1H2T C;  3SO8 A;  2UY1 B;  1E8X A;  2Y3A A;  3E30 A;  1DCQ A;  5B1B E;  5AIJ A;  5AJL A;  1K3Z D;  2MRI A;  3CVY A;  2KAT A;  3DSX A;  3BQO A;  4GPK A;  1U2V G;  5LX8 A;  2ETB A;  4G11 A;  3CKB A;  4LRZ A;  3IKO B;  4ANW A;  4A63 B;  5KJL A;  3E33 A;  1KT0 A;  3ZN3 A;  1HG2 A;  4HRM B;  4ZFH A;  3HHM A;  1WY6 A;  4FP7 A;  3EHM A;  2PQR A;  2CHX A;  1SZ9 A;  4GTM A;  2X6F A;  5ENN A;  3KAE A;  2DCP A;  3IHY A;  3E32 A;  4CEM A;  1V54 E;  4PS8 A;  2FO7 A;  3ISM C;  2X6I A;  2QY7 A;  1QNF A;  1HG5 A;  3BEE A;  4B8A A;  5LOZ A;  3AU4 A;  4ANV A;  3ZNG A;  4XKB A;  1LD8 A;  1B89 A;  1IKN D;  4GTV A;  4WNE A;  4PUC A;  1FCH A;  5B3S E;  3CIA A;  3ZHE A;  4NUR A;  4KVM A;  5CBN A;  1DVP A;  4CZ2 D;  5HI7 A;  1RZ4 A;  2VTB B;  1Z3Y A;  5JJ7 A;  4JEH A;  1BI7 B;  2WXG A;  1UOH A;  4LNG A;  4EZL A;  2BKG A;  5G05 C;  1EYH A;  2CHW A;  3UIN C;  1HX8 A;  4F53 A;  4GZ5 A;  1HFA A;  4I6E A;  3Q79 A;  4K03 A;  3CK8 A;  3RRM B;  2CHZ A;  5CCM A;  4IN3 B;  2VSO E;  2KCL A;  3FTS A;  4CDN A;  4HOT A;  1INZ A;  1Y8M A;  3L16 A;  4JD2 G;  3LKU A;  3CHR A;  4LNU D;  3I3N A;  4Q96 A;  1UW4 B;  3ASF A;  5EIL A;  1MYO A;  4LSZ E;  3CST A;  2F8Y A;  3N71 A;  4TUU A;  3CHP A;  4YVO A;  2ETC A;  2WMN A;  1D9S A;  3PZ4 A;  2DIW A;  2R59 A;  3D9J A;  2EIN E;  2AW6 A;  1E7V A;  4A1S A;  3RSE G;  3B7B A;  4IYP A;  3BG1 B;  4UWL A;  1LD7 A;  4FLB A;  4U96 D;  4F1S A;  3FTW A;  4F7A A;  5AAO A;  3LEW A;  4N2S A;  4XEI G;  3TWU A;  2KZT A;  2OV8 A;  4JHK A;  2VGE A;  3RIB A;  2KCK A;  1V55 E;  3G2S A;  3Q9U C;  3ABL E;  4DRX E;  5EX3 A;  5FQ4 A;  1OXJ A;  3U66 A;  2ZGG A;  4BT9 A;  4JHR A;  3UI2 A;  4FHK A;  3CSF A;  3MV2 B;  3QWW A;  3SI5 A;  3NOC D;  3FH7 A;  4ACK A;  5HRY A;  1D8E A;  4XI9 A;  3K9I A;  4E85 A;  4EHM A;  3PE4 A;  5JMN D;  4JB8 P;  5AEN A;  3QKY A;  4WWN A;  2OEW A;  1H6P A;  1UJJ A;  3AG3 E;  4G2V A;  4O6F A;  2OEV A;  1O1T A;  2H6G A;  4MKT A;  2IEJ A;  4N5Q A;  3SNX A;  3I5P A;  2ION A;  4O1O A;  4LCT A;  4GA1 A;  4HB5 A;  4KVO A;  3UM2 A;  3JXI A;  4H7Y A;  4A55 A;  4ATZ D;  3GYZ A;  4HI9 A;  3R7R A;  4LEU A;  3LS8 A;  5CEA A;  4ILG A;  3CVV A;  2XEE A;  5CBO A;  2B0O E;  1K8K G;  3SBT B;  3FUN A;  2XEN A;  3TWQ A;  3AAA C;  3UM0 A;  2AWI A;  3FHE A;  1O5M A;  4HOR A;  4UI9 K;  3D9H A;  1DNP A;  1Z6T A;  3ONL A;  2I1K A;  5LFA A;  4L2Y A;  1WDY A;  2V5Q C;  5H7P A;  4OAV B;  3VTY A;  1SVX A;  3PNT B;  3VLE A;  3KEZ A;  3GZ1 A;  1U3D A;  4LNB A;  5ENO D;  1UN8 A;  2XGO A;  1Q2Z A;  1N94 A;  3U64 A;  4K5A B;  3QNK A;  3HDX A;  3DSV A;  2L6B A;  5EKQ D;  3UPV A;  1UN9 A;  3FU3 A;  3DEP A;  1BI8 B;  4I1A A;  2BKK B;  4RQI A;  4ILI A;  3ENE A;  4WUY A;  4DX6 D;  5HQ8 A;  4L9P A;  3C5R A;  4MRU A;  1XGW A;  3EDT B;  4KBQ A;  2V5F A;  4DX7 D;  3ZFW A;  2P2C P;  2QZA A;  2HYZ A;  4K0R A;  2XRY A;  2WQH A;  2XEH A;  2Q7F A;  1HE8 A;  3FTY A;  1HS6 A;  1SZA A;  4IRU A;  3VLF A;  3DPY A;  1ELK A;  4CT0 A;  2X3M A;  3CQG B;  3HVE B;  5CED B;  3CHS A;  3TXN A;  2YQ8 A;  1Z5S C;  3ZRH A;  5AAR A;  4CT4 A;  3URZ A;  2FUL A;  3L22 A;  3L6A A;  5CER B;  2WXM A;  3CGH A;  1WM5 A;  3NAW A;  1A5E A;  3FDH A;  5EYP F;  3PUJ A;  1H19 A;  5FJY A;  1LTX A;  4F3V A;  3CLJ A;  2F0Y A;  4GTS A;  4G8L A;  3ULY A;  1PC2 A;  1FT1 A;  4F6R D;  2GW1 A;  4I2Z A;  1YYH A;  4BTA A;  2YHC A;  1OCZ E;  3G2U A;  3FU5 A;  5HS0 A;  2YIN A;  2DZN A;  4AM9 A;  5G04 J;  5JJ6 A;  3FWV A;  4ANX A;  3TG4 A;  3JUE A;  4DX5 D;  1OWL A;  4G25 A;  1HU3 A;  3ONK A;  2P58 C;  1OUV A;  5BXU A;  3EJN A;  4L7T A;  2LAI A;  3Q47 B;  2C2L A;  5KBA A;  2WXF A;  4GZD A;  2P9K G;  5EYL A;  1E8Y A;  3EUV A;  4G26 A;  4HS2 A;  1XNF A;  3MKQ B;  3S7D A;  4L1B A;  2RFM A;  2AXV A;  3SD5 A;  2QC9 A;  3QOU A;  5AQB A;  4GMJ A;  5DIZ A;  3CHM A;  1TN7 A;  3APC A;  5E75 A;  3C72 A;  1AWC B;  3PVL A;  2JLB A;  3DXM G;  2EIK E;  4HLE A;  4HQD A;  3FY4 A;  2VSY A;  2I6H A;  4L2L A;  3DWL G;  3JQ1 A;  4BX9 A;  1BD8 A;  3U3W A;  1DCE A;  3HVE A;  3G2V A;  2XS8 A;  3SFX A;  5AYW D;  3LXU X;  3ML8 A;  4K5C A;  4GZ3 A;  3B7T A;  3SGH A;  3PZD A;  1N4P A;  2QFC A;  3I4G A;  3JQ0 A;  3MGB A;  2V8S E;  1ELW A;  1X5B A;  4AIF A;  5FQ7 A;  3LPZ A;  1E8Z A;  4N39 A;  1JCQ A;  3ESK A;  3AS5 A;  3MJW A;  3LCA A;  3QC1 A;  5BNW A;  1MX4 A;  2DYS E;  2HE0 A;  4PDX A;  4AP2 A;  4KYO B;  4I2W A;  4GTQ A;  2OVB A;  4XKC A;  3FUE A;  5LCW C;  3HRA A;  1HO8 A;  3TGO A;  3S7J A;  3LJ3 A;  2JAB A;  4CGW A;  4I17 A;  3CVW A;  2YHE A;  4XIF A;  3RK6 A;  1IQR A;  3CVU A;  3UUX A;  1OWN A;  3TAX A;  3ULQ A;  3QDN A;  2LSV A;  4YND A;  4BET A;  3CVX A;  4C9B B;  4YDY A;  4C0M A;  2RKK A;  4M7C A;  1SA5 A;  3SQV A;  3B13 A;  2VGX A;  3PZ3 A;  4FAD A;  3LY7 A;  1S70 B;  5CRU A;  5D0Q D;  4O60 A;  4TUM A;  1FVF A;  3T8M A;  4HVB A;  1N4S A;  2V4L A;  4B0Z A;  5FT9 A;  1E7U A;  3D9O A;  3OXF A;  4MBG A;  3GZ2 A;  4Q69 A;  3SHF A;  4YDO A;  4EZK A;  3NQP A;  4PS3 A;  3RRU A;  1TNU A;  4YDW A;  5AJD A;  2XPY A;  4GAA A;  4UWF A;  4N3B A;  3OXG A;  4D10 C;  5A6C A;  3HG0 D;  4PS7 A;  4ANU A;  5BUZ A;  3AU5 A;  5CCL A;  2PQN A;  2FO1 E;  2Y4U A;  2FF4 A;  2X38 A;  3HIZ A;  1OCR E;  4GA0 A;  1N0Q A;  1S0P A;  5FZQ A;  2WPV A;  4CRW A;  2WMO A;  3FTZ A;  1H0A A;  3KSQ A;  4I9E A;  4HBD A;  3ULE G;  2J08 A;  1KLX A;  2WXL A;  2XZD G;  2L9B A;  2EQX A;  1NZN A;  3KSL A;  4URK A;  3T5V A;  3LDZ A;  1P5Q A;  2EIL E;  2OND A;  5BW8 C;  2GRM A;  4C0E A;  5FWQ A;  3CV0 A;  3RO3 A;  1WAO 1;  2RFA A;  4A1G A;  3J5P A;  2LSU A;  4GU5 A;  5D0O D;  4HFG A;  4Z68 A;  3R7Q A;  3JXJ A;  2J4D A;  3MEK A;  1TEZ A;  3HYM B;  2XQ0 A;  4JC8 A;  4JEU A;  2PNN A;  5A23 A;  4UQY A;  2PM6 A;  5CEC B;  3FUD A;  1JCR A;  2FBN A;  5G05 J;  4DI4 A;  4U07 A;  3UT4 A;  2OVF A;  4DLO A;  1IXV A;  3IEG A;  2OCC E;  3FU0 A;  4BT8 A;  3RO2 A;  1TR4 A;  3CHO A;  4XX5 A;  5E76 A;  5M72 A;  2J8S D;  4JA7 A;  4BSX A;  2DVW A;  4CYM D;  1S63 A;  3D9K A;  1N4R A;  1IHB A;  2H6I A;  2E2E A;  4GYW A;  3R9M A;  5FIN A;  2IQC A;  5ENS D;  3RJV A;  3ZGQ A;  3DSW A;  1HZ4 A;  3ZXS A;  1NI1 A;  2MHK A;  3UKR G;  1H6O A;  2XPI A;  3CKC A;  4GCO A;  1A17 A;  2R17 C;  2GRQ B;  4GTR A;  2R02 A;  4J7W A;  3UX4 A;  3V2X A;  2VGY A;  4KZC A;  1BLX B;  2X6K A;  3Q4A B;  3CK7 A;  5G04 C;  1NA3 A;  2L0I A;  3EU5 A;  2WVI A;  3TWX A;  4P29 A;  2XGS A;  4GYY A;  4UI9 J;  3FUF A;  4DX2 A;  5KJN A;  4A3T A;  4APF A;  1AP7 A;  3J5Q B;  1QQE A;  3IV0 A;  1QZ2 A;  4F1P A;  4GPM A;  3QWV A;  3V79 K;  2QYJ A;  4GTT A;  3E34 A;  2FEZ A;  4JZY A;  4U63 A;  3CVL A;  5BXO A;  4TXR A;  4PH4 B;  3Q49 B;  1MJ0 A;  3NF1 A;  3ZEF A;  3DXK G;  4I1O B;  4DPR A;  3UMV A;  1WG0 A;  4K5B A;  1SQM A;  3TWW A;  3NOG D;  3PUK A;  4OAU C;  4RLY A;  3R9A B;  3Q5M A;  5BT1 A;  4AVX A;  2GGF A;  2XS1 A;  3S7F A;  2H6F A;  4GB9 A;  3L9T A;  3TL5 A;  4BFR A;  4WWO A;  2BED A;  5KWD A;  3MCX A;  2CG3 A;  2P9N G;  1OT8 A;  3ZVV A;  2GRR B;  1N95 A;  3TWV A;  4HRN A;  3SY2 A;  3WG7 E;  3B7S A;  5T4Y A;  2P9I G;  4U8V D;  1OWM A;  1KT1 A;  2WXH A;  1U3C A;  2CG2 A;  3MZL B;  4QFV A;  4KZ0 A;  3SFZ A;  2NYJ A;  1JWG A;  5G55 A;  1E96 B;  1N52 A;  3QAR A;  1N11 A;  3D3M A;  4BTB A;  1EDU A;  1G3N B;  3L08 A;  5KJM A;  3GW4 A;  4JVS A;  1OCC E;  3T9K A;  4ME2 A;  3O48 A;  4IUL A;  4R7L A;  4UI9 C;  2IOL A;  2IF4 A;  3NB2 A;  4NIK A;  1NP7 A;  4U8H A;  4RVB A;  4U0Z A;  1TNY A;  4X8Q A;  2QYU A;  1KZP A;  3D9P A;  2R05 A;  3LYA A;  1FPP A;  2XRZ A;  3T5X A;  3AG2 E;  3FUH A;  2HM8 A;  3JYS A;  4UWH A;  1ZB1 A;  3C3Q A;  4G23 A;  2WXK A;  2KCV A;  5LP0 A;  2UY1 A;  3TWT A;  2BUG A;  1KPS B;  2KZT B;  3AG1 E;  2EIM E;  3ML9 A;  4DK5 A;  3P1U A;  1BU9 A;  3Q7F A;  5FZS A;  1MQS A;  3DEO A;  2YNQ A;  4V3I A;  3UIO C;  3I4R B;  1X81 A;  2ZXW E;  4O1P A;  1N9A A;  1ELR A;  3AG4 E;  2DBA A;  4CGV A;  3ZXP A;  3V30 A;  2NXP A;  4AOF A;  4FA6 A;  2WXI A;  3ZUV B;  3S2A A;  4GCN A;  4FC8 A;  3W9G A;  2X6H A;  5EID A;  4MS6 A;  2VTB A;  4EQF A;  4GML A;  3OXL A;  4EPZ A;  1S64 A;  3JCK C;  1IHG A;  3ZYK A;  1DC2 A;  5FQ6 A;  2LXM A;  2P9L G;  3ZHE B;  3CK9 A;  4APO A;  5JHB A;  3APD A;  5BV1 A;  4I1M A;  5ENQ D;  2JEK A;  3QJZ A;  4HNA D;  2NC9 A;  4UQX A;  3DSU A;  3C3R A;  3QAQ A;  4JL0 A;  3EHR A;  3DRA A;  3PEV B;  5D2M C;  4M3O A;  1W3B A;  5J08 A;  3PZ1 A;  1H2U A;  2KM4 A;  4WAF A;  4BER A;  3LJN A;  4NQ0 A;  3FUL A;  1E90 A;  4CDR A;  4C48 B;  4HI8 A;  3P2B A;  5KNG A;  2CFZ A;  4E6H A;  2AXZ A;  4L23 A;  3ASO E;  4UUC A;  2XEV A;  2XCC A;  4GZ6 A;  2Y4T A;  5CRV A;  3FEX A;  4WWP A;  5KNH D;  2J07 A;  4B8C B;  3L17 A;  3QB2 A;  4N3A A;  3BU8 A;  3PNL B;  3LY8 A;  4JPS A;  3PH0 C;  3B95 A;  2A5U A;  2XCB A;  4MLP A;  3OTN A;  4WND A;  5DBK A;  3V2O A;  5ARF A;  4Y6C A;  4DI3 A;  4FLH A;  2E0I A;  5FTP A;  4BSZ B;  2ZIR A;  3CQC B;  3UTM A;  4JHJ A;  4AEZ C;  4KT6 B;  3IBE A;  5FIO A;  3MKR A;  3HXE A;  2IO2 C;  1NFI E;  4ILH B;  1QYM A;  2ZGD A;  3QWP A;  3ZW3 A;  3VTX A;  3CVQ A;  3LY9 A;  5AQA A;  2VQ2 A;  4AY5 A;  4GTO A;  1MX2 A;  4TRQ A;  3UKU G;  5ARG A;  1TN8 A;  3E37 A;  3D9N A;  4J8S A;  1Z3X A;  4KMO A;  3HXF A;  3IHV A;  2EIJ E;  3SFY A;  4FJZ A;  3PRZ A;  4UWG A;  3RRN B;  4LUN U;  5CMY A;  3PZ2 A;  4J8D A;  4BEP A;  2X6J A;  3FUM A;  4J8F A;  1K1A A;  1Y6I A;  4AJW A;  1N54 A;  3S7B A;  2GRN B;  3EIQ C;  3FFL A;  5ENR D;  5J90 A;  4ATG A;  4AXH A;  2ZU6 B;  2Y69 E;  3U9W A;  4G24 A;  4XI0 A;  1E8W A;  3UT8 A;  3QK0 A;  5IY5 E;  3MYV A;  1OY3 D;  3TWR A;  2VJ8 A;  5C1D A;  3AS8 A;  2GRP B;  5C2Y A;  1JPL A;  3ZU7 B;  4ABN A;  1TNB A;  3ASH A;  4J6I A;  2HR2 A;  4HXI A;  1O1R A;  2NSZ A;  4TV3 A;  3F6Q A;  2LO6 A;  2J09 A;  3PS6 A;  3C98 A;  2L6J A;  1MX6 A;  2VGX B;  1H2V C;  5EDS A;  5CMW A;  4OVV A;  4LG6 A;  1YA0 A;  3NZS A;  4B89 A;  1YMP A;  2WXJ A;  2AXU A;  1IQU A;  3MKQ A;  3GZS A;  4FHJ A;  4GYO A;  1HXI A;  2MOW A;  5G2N A;  1TJF A;  4U0U A;  1N4Q A;  5JJT A;  1TYQ G;  3JUI A;  3EHN A;  1JWF A;  4EZJ A;  1UJK A;  3FUK A;  3SBS A;  4NAC A;  3APF A;  4I9C A;  1GW6 A;  1HH8 A;  3D9I A;  3V31 A;  3FH8 A;  3FEY A;  5AQ7 A;  3EU9 A;  1NL4 A;  2WXQ A;  4A3V A;  5LCW J;  1EPU A;  5AQ9 A;  1IYG A;  4BX8 A;  3UT7 A;  4OYS A;  1LF8 A;  4I43 A;  1SW6 A;  4J0U A;  4WNF A;  3NBN B;  1O1S A;  4YVQ C;  2IY0 C;  5BPP A;  5FZR A;  2AVP A;  2WQ7 A;  4BY6 A;  2R2L A;  3FH5 A;  2A5E A;  2F8X K;  3CEQ A;  4XE0 A;  3FTX A;  4DJA A;  3L54 A;  3ZKJ A;  1NA0 A;  5ANL A;  2OOE A;  3ZYQ A;  2RD0 A;  4DX1 A;  3FUI A;  3DST A;  2A4Z A;  3ASD A;  3EIJ A;  1RW2 A;  3EHQ A;  3Q78 A;  4U95 D;  2F37 A;  3VLD A;  3Q9N C;  3CR3 A;  4I6G A;  3IXE A;  2BF0 X;  3FU6 A;  4UQZ A;  3TXM A;  3ABM E;  2WXP A;  4HOU A;  4QQI A;  1MZC A;  2DYR E;  2KXP C;  4GA2 A;  4JA9 A;  3HXC A;  5ITZ F;  2J49 A;  4FJY A;  4HOS A;  4FUL A;  3CHQ A;  3HXB A;  3SZ7 A;  2DWZ A;  2WM9 A;  3OAW A;  2I1J A;  2VYI A;  4CDM A;  3FTV A;  3UM3 A;  1EF1 C;  2FI7 A;  2Y1L E;  4KXK B;  3PE3 A;  4FU3 A;  2DZO A;  2H6H A;  3RAU A;  3B7R L;  4H7X A;  3ABK E;  4TXQ A;  1MHQ A;  2IU1 A;  2BTD A;  4YDE A;  2VSN A;  1TNZ A;  2RG8 A;  4LER A;  2LAH A;  4HOQ A;  1KZO A;  4G1T A;  2KBX A;  4B93 B;  3ASG A;  3D9L A;  5HKP A;  5JHA A;  1ZBP A;  5EX0 A;  2XHE A;  4J8E A;  3X2Q E;  3UM1 A;  3ZYM A;  4GMR A;  3U4T A;  2B6C A;  2XGM A;  1TNO A;  3DPD A;  1K1B A;  3TG5 A;  4GZC A;  2IOS A;  4U8Y D;  1SA4 A;  2I9C A;  5D66 A;  3AJI A;  1JCS A;  2ZIS A;  3KEA A;  3E4B A;  3FTU A;  4XZ4 A;  4DLQ A;  4N2Q A;  3Q15 A;  4EBA A;  3FUJ A;  2J4B A;  4N5C A;  5T8I A;  4EEC A;  4U0S A;  3LVQ E;  4Q94 A;  2V4H C;  5T3R A;  3TWS A;  1OCO E;  3DSS A;  5JA4 D;  5CHE E;  1YCS B;  2LXL A;  2HO1 A;  1TN6 A;  4JW1 A;  4BWR A;  1ZU2 A;  5FQ8 A;  3UIP C;  5ENP D;  3HXD A;  3L82 A;  2WXR A;  1UG3 A;  2C0L A;  3KS2 A;  2P9U G;  3BG0 B;  1TJC A;  3W9F A;  1OWP A;  3O4Z A;  1VDY A;  2IJG X;  4EBA G;  1FT2 A;  4WNG A;  3ASN E;  4W9R A;  5A7D B;  3FP3 A;  2ETA A;  4NRH B;  1FVH A;  4DUI A;  2M63 A;  2P9P G;  5ANR A;  3PRE A;  1N0R A;  3C3O A;  3WXX A;  4ACL A;  4RG6 A;  4RSY A;  3DBS A;  2XZT G;  1HF8 A;  3MV3 B;  2WQ6 A;  2WXO A;  5BV0 A;  2WXN A;  2Y0B G;  3BUA A;  3ZYL A;  4ZHB A;  1JUQ A;  4UWK A;  2LNI A;  3PEU B;  4I6J A;  2WB2 A;  2KC7 A;  3G2T A;  3SF4 A;  2L0T B;  2GRO B;  4G8K A;  3RU0 A;  4AV7 A;  2XPZ A;  4Y6W A;  3B7U X;  5EN5 D;  3ZIM A;  4HRL A;  2R03 A;  4TXP A;  3MA5 A;  4AY6 A;  5B1A E;  1BPO A;  4U04 A;  2IFU A;  2I2O A;  2GRL A;  3CVN A;  3CVP A;  2MYO A;  1OWO A;  3L13 A;  4RG9 A;  1D8D A;  4HLL A;  2PL2 A;  5AN8 A;  2CFU A; 
#chains in the Genus database with same CATH homology
 4GYW A;  3TJP A;  5KJK A;  4B94 A;  3KEZ A;  4FJZ A;  3GZ1 A;  3PRZ A;  4UWG A;  2IQC A;  1U3D A;  3RJV A;  2V0P A;  3NZU A;  3RRN B;  2PZI A;  3KD7 A;  4LUN U;  5CMY A;  4JXT A;  4J8D A;  2UWJ G;  2X6J A;  3FUM A;  3ZGQ A;  1UN8 A;  2XGO A;  3MX3 A;  4J8F A;  1Y6I A;  3U64 A;  4AJW A;  1HZ4 A;  3PDN A;  1N54 A;  3ZXS A;  3S7B A;  2PM7 A;  3AS4 A;  2MHK A;  3EIQ C;  3FFL A;  3QNK A;  5KCM A;  3D9M A;  3HDX A;  5J90 A;  2XPI A;  4ATG A;  2ZU6 B;  4AXH A;  2ILR A;  3CKC A;  5EKQ D;  4GCO A;  1A17 A;  3UPV A;  1UN9 A;  2R17 C;  3FU3 A;  3U9W A;  3ZPJ A;  4G24 A;  4XI0 A;  4I1A A;  1E8W A;  1H6K A;  4OVU A;  3UT8 A;  3UX4 A;  3QK0 A;  4CCA A;  4ILI A;  3ENE A;  2VGY A;  3G2W A;  4KZC A;  4WUY A;  3ESL A;  3MYV A;  5HQ8 A;  2R5S A;  2VJ8 A;  2X6K A;  3CK7 A;  3Q4A B;  5G04 C;  4MRU A;  1XGW A;  3EDT B;  5C1D A;  3AS8 A;  4KBQ A;  2V5F A;  1NA3 A;  1PY1 A;  2L0I A;  2VSX E;  2WVI A;  4P29 A;  3ZFW A;  5C2Y A;  2XGS A;  4GYY A;  4UI9 J;  1JPL A;  3FUF A;  1L5J A;  2HYZ A;  4K0R A;  2XRY A;  5KJN A;  4A3T A;  4APF A;  2WQH A;  2Q7F A;  1HE8 A;  3LVR E;  3FTY A;  4ABN A;  1HS6 A;  3ASH A;  1QQE A;  4J6I A;  3IV0 A;  1SZA A;  2HR2 A;  3UQ3 A;  1QZ2 A;  4HXI A;  4IRU A;  4N3C A;  1PAQ A;  3RKV A;  2NSZ A;  4TV3 A;  2C0M A;  2LO6 A;  3QWV A;  2J09 A;  2J9Q A;  3C98 A;  2L6J A;  3PS6 A;  3VLF A;  1H2T C;  2VGX B;  1H2V C;  5EDS A;  1ELK A;  5CMW A;  4CT0 A;  4OVV A;  2X3M A;  1YA0 A;  3NZS A;  2UY1 B;  1E8X A;  2Y3A A;  3CQG B;  3HVE B;  4B89 A;  2FEZ A;  2WXJ A;  3CHS A;  2AXU A;  4JZY A;  4U63 A;  3CVL A;  1IQU A;  3MKQ A;  3GZS A;  4FHJ A;  4GYO A;  3TXN A;  5AIJ A;  5AJL A;  4PH4 B;  1HXI A;  2MOW A;  2MRI A;  2YQ8 A;  5G2N A;  3ZRH A;  1TJF A;  2KAT A;  4U0U A;  3CVY A;  4CT4 A;  5JJT A;  4GPK A;  3URZ A;  3JUI A;  5LX8 A;  3Q49 B;  2FUL A;  3NF1 A;  3EHN A;  3L22 A;  3L6A A;  1JWF A;  4G11 A;  3ZEF A;  3CKB A;  1UJK A;  4EZJ A;  3FUK A;  3SBS A;  4NAC A;  3APF A;  4I9C A;  4LRZ A;  1GW6 A;  1HH8 A;  3D9I A;  4I1O B;  3IKO B;  3FH8 A;  4DPR A;  2WXM A;  3UMV A;  3CGH A;  1SQM A;  1WM5 A;  3FEY A;  4ANW A;  2WXQ A;  5KJL A;  4A3V A;  3FDH A;  3PUJ A;  5LCW J;  1H19 A;  3PUK A;  5FJY A;  4F3V A;  1EPU A;  1KT0 A;  3CLJ A;  3ZN3 A;  1HG2 A;  1IYG A;  3R9A B;  3Q5M A;  4BX8 A;  5BT1 A;  1PC2 A;  3HHM A;  1WY6 A;  4FP7 A;  2GW1 A;  4OYS A;  1LF8 A;  2GGF A;  3UT7 A;  4AVX A;  4I43 A;  3S7F A;  3EHM A;  2PQR A;  2CHX A;  1SZ9 A;  2X6F A;  4GB9 A;  4I2Z A;  4J0U A;  4WNF A;  4WWO A;  3TL5 A;  5ENN A;  4BTA A;  4BFR A;  3MCX A;  2YHC A;  4YVQ C;  2CG3 A;  3G2U A;  3FU5 A;  3KAE A;  5BPP A;  2DCP A;  2YIN A;  5FZR A;  3ZVV A;  2AVP A;  4AM9 A;  3IHY A;  2WQ7 A;  4BY6 A;  5G04 J;  5JJ6 A;  3FWV A;  4ANX A;  4CEM A;  3FH5 A;  4PS8 A;  3CEQ A;  3TG4 A;  2FO7 A;  4XE0 A;  2X6I A;  3FTX A;  4DJA A;  2QY7 A;  3B7S A;  5T4Y A;  1QNF A;  1OWL A;  1HG5 A;  3L54 A;  3BEE A;  4G25 A;  1HU3 A;  4B8A A;  5LOZ A;  1NA0 A;  5ANL A;  2OOE A;  3AU4 A;  1OWM A;  3ONK A;  1KT1 A;  2P58 C;  2WXH A;  3ZYQ A;  1OUV A;  2RD0 A;  1U3C A;  3EJN A;  4L7T A;  2CG2 A;  3MZL B;  4ANV A;  2LAI A;  3FUI A;  3Q47 B;  2C2L A;  4XKB A;  4QFV A;  2WXF A;  4KZ0 A;  1B89 A;  2A4Z A;  3ASD A;  4GZD A;  3EIJ A;  4WNE A;  3SFZ A;  1E8Y A;  4G26 A;  4HS2 A;  3VLD A;  1XNF A;  3MKQ B;  4PUC A;  3CR3 A;  1JWG A;  1FCH A;  4I6G A;  4L1B A;  3S7D A;  2BF0 X;  2AXV A;  3CIA A;  3SD5 A;  3FU6 A;  3ZHE A;  5G55 A;  4UQZ A;  4NUR A;  3QOU A;  4KVM A;  4GMJ A;  5DIZ A;  3CHM A;  3APC A;  1DVP A;  1E96 B;  3TXM A;  1N52 A;  5E75 A;  3QAR A;  3D3M A;  4BTB A;  3PVL A;  2JLB A;  1EDU A;  2WXP A;  4HLE A;  4HOU A;  5HI7 A;  2VTB B;  3L08 A;  5KJM A;  3GW4 A;  3FY4 A;  1Z3Y A;  2VSY A;  4JVS A;  5JJ7 A;  2I6H A;  4GA2 A;  4JA9 A;  4JEH A;  4L2L A;  4ME2 A;  3JQ1 A;  4BX9 A;  2J49 A;  2WXG A;  3U3W A;  3O48 A;  4FJY A;  4IUL A;  4R7L A;  4EZL A;  4HOS A;  4UI9 C;  5G05 C;  1EYH A;  2IOL A;  3CHQ A;  3HVE A;  2CHW A;  2IF4 A;  4FUL A;  3G2V A;  3SZ7 A;  2WM9 A;  1HX8 A;  3OAW A;  4F53 A;  5AYW D;  2I1J A;  3LXU X;  2VYI A;  4GZ5 A;  4CDM A;  3FTV A;  3ML8 A;  1NP7 A;  4U8H A;  1HFA A;  4I6E A;  4RVB A;  4U0Z A;  4GZ3 A;  3B7T A;  1EF1 C;  3SGH A;  3PZD A;  2FI7 A;  2QFC A;  4KXK B;  3PE3 A;  4K03 A;  3I4G A;  3JQ0 A;  3MGB A;  3CK8 A;  4FU3 A;  3RRM B;  2V8S E;  1ELW A;  3B7R L;  4H7X A;  2CHZ A;  1X5B A;  3D9P A;  3LYA A;  4AIF A;  5CCM A;  5FQ7 A;  3LPZ A;  2XRZ A;  3T5X A;  1MHQ A;  4IN3 B;  3FUH A;  2IU1 A;  2BTD A;  2HM8 A;  1E8Z A;  2VSO E;  3JYS A;  4N39 A;  4UWH A;  2KCL A;  3FTS A;  2VSN A;  4CDN A;  3ESK A;  3AS5 A;  4HOT A;  2RG8 A;  3MJW A;  3LCA A;  3QC1 A;  4LER A;  5BNW A;  4G23 A;  1INZ A;  1Y8M A;  2KCV A;  2WXK A;  3L16 A;  5LP0 A;  3LKU A;  3CHR A;  4PDX A;  4AP2 A;  4KYO B;  3I3N A;  2LAH A;  2UY1 A;  4I2W A;  2BUG A;  4Q96 A;  4HOQ A;  4XKC A;  2OVB A;  4G1T A;  3FUE A;  2KZT B;  5LCW C;  1UW4 B;  3ASF A;  3ASG A;  3D9L A;  1HO8 A;  3TGO A;  3S7J A;  3LJ3 A;  3ML9 A;  5JHA A;  4CGW A;  3CST A;  4I17 A;  4DK5 A;  3CVW A;  2YHE A;  3P1U A;  4XIF A;  3RK6 A;  1IQR A;  3N71 A;  1ZBP A;  4TUU A;  3UUX A;  3CVU A;  1OWN A;  3CHP A;  3TAX A;  3ULQ A;  4YVO A;  5EX0 A;  3QDN A;  2XHE A;  5FZS A;  4J8E A;  1MQS A;  2LSV A;  4YND A;  2WMN A;  2YNQ A;  2DIW A;  2R59 A;  4V3I A;  3ZYM A;  3D9J A;  3I4R B;  3CVX A;  3U4T A;  4C9B B;  2XGM A;  4C0M A;  2AW6 A;  3DPD A;  3TG5 A;  1E7V A;  1ELR A;  4GZC A;  4A1S A;  2DBA A;  4CGV A;  2IOS A;  2I9C A;  3B13 A;  2NXP A;  4IYP A;  3BG1 B;  2VGX A;  4UWL A;  4FAD A;  4AOF A;  3LY7 A;  3E4B A;  4FA6 A;  3FTU A;  4XZ4 A;  2WXI A;  4DLQ A;  3S2A A;  4FLB A;  4N2Q A;  3Q15 A;  4EBA A;  5D0Q D;  4GCN A;  3FUJ A;  2J4B A;  4FC8 A;  4N5C A;  4F1S A;  3FTW A;  4F7A A;  5T8I A;  1FVF A;  2X6H A;  3T8M A;  4HVB A;  4MS6 A;  2VTB A;  4EQF A;  4GML A;  3LEW A;  3OXL A;  4N2S A;  4EEC A;  4EPZ A;  2V4L A;  4B0Z A;  2KZT A;  3JCK C;  4U0S A;  5FT9 A;  1E7U A;  1IHG A;  3D9O A;  2OV8 A;  3LVQ E;  4Q94 A;  4JHK A;  3ZYK A;  3OXF A;  5FQ6 A;  3GZ2 A;  3RIB A;  4Q69 A;  2KCK A;  3ZHE B;  3G2S A;  3SHF A;  5T3R A;  3CK9 A;  4APO A;  4EZK A;  3NQP A;  5JHB A;  4PS3 A;  5CHE E;  3APD A;  3RRU A;  5BV1 A;  5AJD A;  4I1M A;  2JEK A;  2XPY A;  5EX3 A;  4GAA A;  3QJZ A;  2HO1 A;  4UWF A;  4N3B A;  5FQ4 A;  3OXG A;  4JW1 A;  3U66 A;  4BWR A;  4BT9 A;  1ZU2 A;  4D10 C;  2NC9 A;  4UQX A;  5A6C A;  5FQ8 A;  4JHR A;  2WXR A;  4FHK A;  1UG3 A;  4PS7 A;  4ANU A;  2C0L A;  3CSF A;  3KS2 A;  5BUZ A;  3MV2 B;  3AU5 A;  3BG0 B;  3QAQ A;  2PQN A;  4JL0 A;  5CCL A;  3QWW A;  2Y4U A;  3SI5 A;  2FF4 A;  3PEV B;  1TJC A;  2X38 A;  1OWP A;  3FH7 A;  3HIZ A;  3O4Z A;  4M3O A;  4ACK A;  1VDY A;  1W3B A;  4GA0 A;  2IJG X;  5J08 A;  1H2U A;  2KM4 A;  4WAF A;  4EBA G;  1S0P A;  5FZQ A;  2WPV A;  4NQ0 A;  4WNG A;  4W9R A;  4XI9 A;  5A7D B;  3FP3 A;  3K9I A;  4NRH B;  4E85 A;  3FUL A;  1FVH A;  1E90 A;  2M63 A;  4CRW A;  4CDR A;  2WMO A;  3FTZ A;  1H0A A;  3PE4 A;  5ANR A;  3PRE A;  3WXX A;  4I9E A;  3P2B A;  4ACL A;  3QKY A;  2CFZ A;  2AXZ A;  4RG6 A;  4L23 A;  4RSY A;  4WWN A;  4E6H A;  5AEN A;  1UJJ A;  2J08 A;  1KLX A;  2XEV A;  2XCC A;  3DBS A;  4GZ6 A;  2Y4T A;  1HF8 A;  3FEX A;  4WWP A;  3MV3 B;  4G2V A;  4O6F A;  2WXL A;  2L9B A;  2WQ6 A;  2EQX A;  2WXO A;  1NZN A;  5BV0 A;  2J07 A;  4MKT A;  2WXN A;  4URK A;  3T5V A;  4B8C B;  3LDZ A;  3SNX A;  3L17 A;  3I5P A;  2ION A;  1P5Q A;  3QB2 A;  4N3A A;  3ZYL A;  2OND A;  1JUQ A;  3PNL B;  3LY8 A;  5BW8 C;  2GRM A;  4C0E A;  5FWQ A;  4UWK A;  3CV0 A;  4JPS A;  3PH0 C;  1WAO 1;  4GA1 A;  4LCT A;  3RO3 A;  2A5U A;  4KVO A;  2XCB A;  4MLP A;  2LNI A;  4A1G A;  2LSU A;  3PEU B;  3OTN A;  4WND A;  4GU5 A;  4I6J A;  5DBK A;  5D0O D;  2WB2 A;  4H7Y A;  5ARF A;  4HFG A;  2KC7 A;  3G2T A;  4Y6C A;  4A55 A;  3SF4 A;  4DI3 A;  4FLH A;  2L0T B;  3R7Q A;  2J4D A;  3GYZ A;  2E0I A;  5FTP A;  3MEK A;  1TEZ A;  3HYM B;  3CQC B;  3R7R A;  2XQ0 A;  4JC8 A;  4JHJ A;  4LEU A;  4JEU A;  4AEZ C;  5A23 A;  3LS8 A;  3RU0 A;  4ILG A;  3CVV A;  4UQY A;  2PM6 A;  4AV7 A;  4KT6 B;  2XPZ A;  3IBE A;  4Y6W A;  3MKR A;  3FUD A;  3SBT B;  3B7U X;  2FBN A;  3FUN A;  3ZW3 A;  4ILH B;  5G05 J;  3QWP A;  4DI4 A;  4U07 A;  3ZIM A;  3UT4 A;  2OVF A;  4DLO A;  3VTX A;  3CVQ A;  3LY9 A;  3MA5 A;  4AY6 A;  2AWI A;  3IEG A;  3FHE A;  1BPO A;  4U04 A;  2VQ2 A;  4HOR A;  4UI9 K;  2IFU A;  3FU0 A;  2I2O A;  4BT8 A;  3RO2 A;  4AY5 A;  3CHO A;  2GRL A;  4TRQ A;  3CVN A;  4XX5 A;  3CVP A;  1DNP A;  1Z6T A;  3ONL A;  5E76 A;  5ARG A;  5M72 A;  2I1K A;  3D9N A;  4J8S A;  1OWO A;  5LFA A;  3L13 A;  4JA7 A;  4L2Y A;  4RG9 A;  4BSX A;  3VTY A;  3PNT B;  1Z3X A;  4KMO A;  2PL2 A;  3IHV A;  3D9K A;  3VLE A;  2CFU A;  2E2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...