4N2QA

Crystal structure of tha8 in complex with zm4 rna
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THA8 RNA binding protein
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Splicing/rna
total genus 69
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n2qA00
3MEKA 5BW8C 2XEVA 4GA0A 4UQZA 2HR2A 2QFCA 5C1DA 3IEGA 4U0ZA 3NF1A 4HOUA 4GYWA 2LSUA 3EDTB 2VQ2A 2VYIA 5BNWA 3S7BA 2MHKA 1P5QA 3LPZA 5CCLA 4HOSA 4AM9A 3ASHA 4U07A 3ESKA 3CVQA 4XIFA 3K9IA 2VSNA 3BEEA 2XGOA 4U0UA 1NZNA 4CGVA 4GZ5A 4ABNA 2XCBA 4N3BA 2VGYA 5HQ8A 4WNEA 1IHGA 4UI9K 1QZ2A 2IFUA 3Q4AB 1A17A 3KD7A 2FO7A 4AY6A 4GPKA 4EQFA 2LSVA 4KXKB 5CCMA 2UWJG 3S7JA 2PL2A 3VTXA 5G04J 1WM5A 1HZ4A 4G26A 3E4BA 4GZ3A 3GYZA 4U0SA 3QWVA 5DIZA 3GZ2A 2IF4A 3LCAA 4NRHB 2J9QA 4NQ0A 5LCWJ 4WUYA 1E96B 5KJNA 4GCOA 3CKBA 4I9EA 4JA9A 2WPVA 3ASGA 5EKQD 2Q7FA 2VGXB 5A7DB 3QWWA 2Y4UA 1W3BA 2HO1A 2KCLA 3QKYA 2PQRA 2PZIA 3VTYA 4GA1A 3QOUA 1NA0A 5LCWC 4H7XA 3LYAA 3SZ7A 3KS2A 3AS5A 2XCCA 2FF4A 4UQYA 5JJTA 4JL0A 2C0MA 2PQNA 3CVNA 4N2QA 5HI7A 4AIFA 4G2VA 3UPVA 1TJCA 5EX0A 4N39A 3URZA 3RKVA 1WAO1 4CDRA 1HH8A 3OXGA 2E2EA 4BT9A 4BTBA 1ELRA 1NA3A 3MA5A 4KYOB 2Y4TA 5JJ6A 4N2SA 4B94A 4APOA 2XPIA 4HORA 1ZU2A 5EX3A 4Y6WA 2FBNA 3RO2A 2I6HA 4ME2A 3ULQA 3UUXA 3UQ3A 4BT8A 2KCKA 4XI0A 4Y6CA 1OUVA 5KJLA 5M72A 1QQEA 4I1AA 3OXFA 1KLXA 3ASFA 3ZGQA 3PE4A 3SF4A 4JA7A 5ARFA 4JHRA 4GA2A 5ARGA 5CHEE 4LEUA 5FZSA 4J0UA 3ZPJA 1KT1A 3JYSA 2UY1A 5D0OD 3Q5MA 4G1TA 3CK7A 3RU0A 3AS4A 4G23A 5FJYA 4GCNA 3Q47B 1ZBPA 5D0QD 1KT0A 2DBAA 1HXIA 2FI7A 3FFLA 4W9RA 2C0LA 3LKUA 4HOTA 4WNFA 4GYYA 4YVOA 3CVLA 2KCVA 4IN3B 3RO3A 3N71A 2WQHA 4GYOA 5FZRA 1FCHA 3CKCA 3TGOA 4WNGA 2C2LA 4I9CA 4CGWA 3CK8A 2BUGA 5KJMA 5JJ7A 3U3WA 3Q49B 3FP3A 3CK9A 1PC2A 2VSYA 1YA0A 3RIBA 4UI9C 3R9AB 3MV2B 4F3VA 5FZQA 4A1SA 4I17A 2ONDA 5DBKA 1XNFA 4XI9A 5FTPA 4AY5A 3O48A 3ZFWA 3WXXA 3ZHEA 5A6CA 3MKRA 2GW1A 2YHCA 3LY8A 4RG9A 1ELWA 3ZHEB 5BT1A 1Y8MA 2XGMA 2FEZA 3CVPA 4J8EA 3S7FA 2P58C 3CV0A 2V5FA 4I2WA 3QDNA 3PDNA 4G24A 1IYGA 4O6FA 3TG4A 4YNDA 2OOEA 5AYWD 3S7DA 2NC9A 1B89A 3CEQA 4H7YA 5G05J 3Q15A 2KC7A 3TAXA 3ZN3A 2R5SA 3MV3B 4J8FA 3LY7A 4BWRA 3QWPA 4UQXA 5KJKA 4GZ6A 3LY9A 2UY1B 3U4TA 2JLBA 4I2ZA 4N3CA 2KATA 3OXLA 3TG5A 4U04A 3KAEA 4RG6A 3HYMB 2L6JA 5FT9A 4N3AA 2YQ8A 4BTAA 2LNIA 2HYZA 4YVQC 3PE3A 5G05C 4UI9J 4N5CA 3GW4A 3GZ1A 2VGXA 3RJVA 2XGSA 3FWVA 2AVPA 4WNDA 4J8DA 5G04C 3AS8A 3ASDA 4G25A 4KBQA 4HOQA
chains in the Genus database with same CATH superfamily
5BW8C 2XEVA 4BSXA 4GTMA 4EHMA 4U0ZA 3NF1A 1UN8A 4F7AA 4HLEA 3EDTB 2P9LG 4PDXA 5A23A 4CDNA 3B7SA 3S7BA 1OWMA 2DYSE 5CCLA 3TXMA 3C5RA 1FT2A 4U07A 3DXKG 3EUVA 5AQ7A 4G8KA 2XGOA 4U0UA 4ABNA 2XCBA 3L13A 4N3BA 3S2AA 1A5EA 1KZOA 2J09A 4G8LA 4GMLA 2X6FA 4UI9K 4EZLA 5CRVA 4PS3A 3DSVA 1ZB1A 3LS8A 4GPKA 2LSVA 4KXKB 5ENPD 5T3RA 4XKBA 3HXDA 4N5QA 3EU5A 2AJAA 2PL2A 3VTXA 1UW4B 3G2WA 4AV7A 3C98A 4F53A 2PM7A 3HVEA 3UM1A 2WMOA 1MX2A 3GYZA 3O4ZA 3CVWA 4FA6A 1E90A 4NRHB 4EBAG 2NSZA 3B7UX 3ML9A 1SZAA 4J8YA 1E96B 4GCOA 3CKBA 1Z5SC 1TNOA 4HNAD 4AP2A 5BV0A 5EKQD 3J5PA 3B13A 3QWWA 1BU9A 2Y4UA 4K03A 3EJNA 3C3QA 2HO1A 4FLHA 2KCLA 2ILRA 2A5EA 5T8IA 2AXZA 3TWRA 5ENNA 5BXOA 4I6JA 3ZXPA 2L9BA 1NA0A 4BY6A 4H7XA 1E8YA 2L0IA 3G2SA 1BD8A 3UM3A 2F8YA 2CG2A 2WXOA 5H7PA 4AOFA 4I1OB 2I9CA 3D9NA 3ABLE 3IV0A 5JJTA 3ZW3A 2LAIA 3CVUA 4PS8A 3CQGB 2WXIA 5EX0A 1EF1C 1D8EA 5ANRA 1X5BA 4CDRA 1HH8A 3OXGA 4TUUA 3L54A 4BTBA 1ELRA 4O60A 3PRZA 1NA3A 1N94A 4C48B 3HXBA 2LAHA 2WXJA 4B94A 4APOA 2MYOA 1HX8A 2WXPA 4A3TA 1N4QA 4ME2A 4E6HA 2KCKA 5FIOA 5KJLA 4OVUA 5M72A 1OY3D 3E34A 1RZ4A 2KBXA 3OXFA 1KLXA 1U3DA 3ZGQA 4B93B 3NAWA 3SF4A 4GZCA 4HS2A 4JA7A 5LX8A 4A63B 5J08A 5JHBA 4EECA 3D9KA 4XZ4A 2IQCA 3CSFA 1IHBA 1KT1A 3PEVB 2UY1A 2RKKA 5D0OD 4G1TA 4GTRA 2MRIA 2JABA 3Q78A 3PH0C 3JUIA 3B7BA 3AG3E 1N11A 4CCAA 3Q47B 1ZBPA 3BQOA 5ENSD 1UOHA 1HXIA 4ATGA 2XPYA 4DI4A 4HOTA 2VSOE 2KXPC 4GTSA 3CVLA 3AU5A 3CHSA 4DUIA 5FZRA 4MBGA 3U64A 4BSZB 3NOGD 2EIJE 4WNGA 4CGWA 3BG0B 2MOWA 3NOCD 4OAVB 4DX2A 5EYPF 1WG0A 3DRAA 4OVVA 3NB2A 3LJNA 5JJ7A 2IJGX 3HXEA 3CK9A 3KSQA 5ENQD 3RIBA 2LUHA 2IO3C 3G2TA 3R9AB 5HS0A 4BERA 1UG3A 4U96D 1S0PA 4M3OA 4AJWA 3ZHEA 2KZTB 3RRMB 5BT1A 1O1TA 4DRXE 3FTVA 1MHQA 4CT4A 4GZDA 2FEZA 3X2QE 2GROB 4RVBA 3S7FA 3PEUB 3D9OA 1TN6A 2IONA 2EILE 1H2UA 3UX4A 3QDNA 2A5UA 1AWCB 2I2OA 3UMVA 2OOEA 1N52A 1LD7A 1S63A 5G05J 4JD2G 3TAXA 2WXGA 3L08A 4YDYA 3Q79A 3FULA 4BWRA 3QWPA 1FVFA 3IXEA 2QY7A 5AQBA 4UQXA 1UJKA 3MCXA 3T8MA 2WXKA 3U4TA 2OEVA 3B95A 3CHPA 3SHFA 2GRPB 3FU6A 3HYMB 3HG0D 5FT9A 4MRUA 5KWDA 2LNIA 4YVQC 3JQ1A 4U8YD 1JCQA 3HXFA 3RJVA 1Y6IA 2XGSA 4YDWA 3BUAA 1H2TC 2AVPA 1H0AA 4WNDA 3ASDA 4KBQA 3SO8A 4A3VA 4RQIA 3LXUX 4BX8A 3C72A 4G11A 3DBSA 1EPUA 5G2NA 1YMPA 2VYIA 2XRZA 1YCSB 2MHKA 1P5QA 1JUQA 3LPZA 4HOSA 3D9MA 1BI8B 3G2VA 4AM9A 5BXUA 4K5CA 2V5QC 3FUKA 3DEPA 4IYPA 3EHRA 4JEUA 2VSNA 3JUEA 2EQXA 3BEEA 1NZNA 4GZ5A 3L6AA 1LD8A 3DWLG 4UWHA 2FULA 1OWNA 3DEOA 2BEDA 2Y69E 3R9MA 4JC8A 5BPPA 3E32A 4KZ0A 1FVHA 3Q4AB 1A17A 2QYJA 3SBTB 4J6IA 3ZIMA 3PUKA 1Z3XA 3L16A 4EQFA 5AIJA 1NL4A 1Q2ZA 4MKTA 3DSTA 5E76A 5CCMA 1TJFA 2UWJG 4URKA 4XE0A 3FUIA 1JPLA 4OYSA 1N4PA 2DCPA 1WM5A 4B89A 4RSYA 1HZ4A 3D9HA 2AWIA 4GZ3A 4DX6D 3CVXA 4U0SA 1IQRA 2CHXA 2IF4A 4ILGA 3LCAA 3RRUA 1IKND 3ABME 4LRZA 2EIME 2XQ0A 3LVRE 5LCWJ 3MX3A 3UIPC 5LP0A 2Y1LE 3F6QA 1MX4A 3SGHA 2P9KG 5KJNA 2RFMA 1SW6A 4JA9A 2WPVA 3P2BA 3DSSA 1U3CA 2IOSA 4FJYA 3ULEG 3EHMA 3FU3A 2VGXB 5A7DB 4AVXA 2GRMA 3IHYA 3TWVA 3QKYA 2PQRA 3FUDA 2PZIA 3APFA 1QYMA 3V2XA 3TJPA 4FJZA 1BI7B 4AXHA 4WWPA 4XEIG 2IO2C 3LYAA 2V8SE 3AS5A 2XCCA 2RG8A 1GW6A 4Q94A 4WAFA 4JL0A 2PQNA 1JWFA 1HG2A 4GMRA 1V55E 3D9IA 4AIFA 5CECB 3EHNA 4DLQA 5ENOD 3Q73A 1TN7A 5E75A 5T4YA 3PZ3A 5JJ6A 4DPRA 1ZU2A 2LXLA 2EIKE 4Q96A 4Y6WA 2FBNA 2I6HA 2I1JA 3ULQA 2WXHA 4BT8A 2WM9A 4Y6CA 1OCZE 1QQEA 4I1AA 4PS7A 3KSLA 3PE4A 2GRNB 4JHRA 4GA2A 5ARGA 3U9WA 5AAOA 5EIBE 5FZSA 3PZ2A 2DZNA 4J0UA 1S64A 3ZPJA 3Q7FA 3UXGA 1NP7A 4TUMA 3TXNA 3AS4A 4QFVA 2OVBA 2OCCE 5IY5E 3CR3A 2V0PA 2KM4A 3MYVA 1U2VG 3MGBA 2DBAA 5AENA 3CIAA 4W9RA 2ETBA 2C0LA 3LKUA 2LXMA 3OAWA 3CHRA 1TN8A 4IN3B 3RO3A 3N71A 2WQHA 4GYOA 1O5MA 3B7TA 3I4RB 1E7UA 3PNTB 5HKPA 2J4DA 2YHEA 2HE0A 3FU5A 3ZVVA 3FP3A 4R7LA 3ZEFA 3NBNB 2PNNA 3IBEA 4F3VA 4A1SA 4I17A 3ZXSA 3E37A 3FTWA 4ACKA 1DCEA 5ENTD 4AY5A 5FTPA 4HB5A 1DC2A 1TNZA 3UT4A 3ZFWA 4MLPA 5EILA 1ELWA 1E7VA 3ZHEB 3L17A 3ZNGA 2L0TB 3T9KA 3CSTA 4GTOA 4ATZD 4L7TA 3FUJA 4I6EA 5BUZA 3NQPA 2XENA 5EDSA 2F0YA 2IY0C 1N9AA 3AG4E 4I2WA 4Q69A 4EBAA 4O1OA 1IYGA 3TG4A 1H6KA 3D3MA 5AYWD 4TXRA 4LSZE 3APDA 1TR4A 2KC7A 4ILHB 3SNXA 1N4SA 4DX7D 3ABKE 3MV3B 4ZHBA 4J8FA 3SI5A 2WXQA 3FDHA 4LNGA 3LY9A 2JLBA 1K3ZD 4IULA 4ACLA 1X81A 4N3CA 4ANVA 3OXLA 1RW2A 3TG5A 2V4LA 3CVYA 3Q9NC 2VGEA 3GZSA 1HU3A 5CMYA 1KZPA 1HO8A 3PE3A 5G05C 2GGFA 3EHQA 3U66A 4FULA 4TXQA 4GPMA 3V2OA 2XEEA 3ZYMA 1JCSA 3FWVA 3B7RL 5G04C 3AS8A 3HRAA 4M7CA 4GTTA 4BX9A 4DK5A 3FEXA 4GA0A 2XS1A 2HR2A 5C1DA 3IEGA 1K1AA 4GYWA 1N54A 3IKOB 5J90A 2VQ2A 1SA5A 4MS6A 4TV3A 5CRUA 4GTQA 5FWQA 3RK6A 1TNYA 2V4HC 4CRWA 4HI8A 4XX5A 2JEKA 1NI1A 3ESKA 4XIFA 4JB8P 3K9IA 4CGVA 2Y0BG 2VGYA 1G3NB 3PREA 3FH7A 4FADA 1IHGA 3FTYA 3ULYA 4APFA 4K5BA 4L2YA 3FUFA 4L1BA 3UTMA 3KEZA 4AY6A 5JA4D 4K5AB 4U8HA 1Z6TA 1LTXA 1DVPA 1EYHA 2F37A 4KVMA 5G04J 4TRQA 2AXUA 3IHVA 4G26A 3E4BA 4DI3A 2YINA 3GZ2A 3Q75A 5DIZA 2J49A 2P9IG 4NQ0A 1OCOE 3MKQB 3DSUA 4JZYA 3CHOA 4LNBA 3QK0A 4EZKA 4I9EA 2DVWA 3ASGA 3V79K 3RSEG 3ASOE 2QZAA 4CZ2D 2ZGDA 3T5VA 3ZRHA 3VLDA 5CMWA 4KVOA 5CEDB 4JEHA 2ZXWE 3UINC 1SQMA 4JW1A 4L9PA 2L6BA 3QOUA 5LCWC 1HG5A 4IRUA 3KS2A 3FTZA 3ESLA 2FF4A 4UQYA 3DPDA 3FH5A 1E8WA 2C0MA 2AW6A 4JPSA 5AARA 2B0OE 3CVNA 4N2QA 5HI7A 3UPVA 1TJCA 2ZIRA 2DZOA 4V3IA 1SVXA 3I4GA 2P9UG 4U63A 1BLXB 4A55A 3UIOC 2WQ7A 4DJAA 3FUHA 4D10C 4NACA 2KZTA 4K0RA 2E2EA 2Y4TA 2J08A 4HRMB 3QC1A 3RO2A 4KT6B 3ZUVB 3UUXA 2IOLA 4DLOA 4XI0A 1OUVA 4I6GA 3RRNB 5B1BE 2OEWA 4AEZC 2XEHA 4C0EA 1H19A 3QJZA 4FU3A 1HF8A 3CGHA 3HVEB 3T8KA 1WY6A 1UN9A 2BF0X 2R2LA 2CHWA 3Q5MA 3CLJA 1DNPA 3CK7A 1OWOA 3PZDA 2XZTG 4G23A 5ITZF 1XGWA 2RFAA 3FUNA 3JCKC 5AQ9A 5AJLA 1JCRA 3L22A 1OXJA 3HHMA 5FQ8A 5D0QD 1KT0A 5AQAA 2H6FA 3FFLA 1N0QA 3ZYQA 4WNFA 4GYYA 1OCCE 3NZUA 4LCTA 3KEAA 4YVOA 3CVVA 2X3MA 3J5QB 2DIWA 3FTXA 3HDXA 3PVLA 3UT7A 4B8CB 4XKCA 3TGOA 4J7WA 4KZCA 1OWPA 1TNUA 4EPZA 2WB2A 3JQ0A 2BUGA 1E8ZA 5KJMA 4UWKA 3FH8A 5CBOA 3TWWA 4ANUA 3Q49B 1PC2A 2VSYA 2XPZA 3CQCB 3ONLA 1MJ0A 4L2LA 2VTBA 5D66A 2GRQB 3E33A 3AG2E 5DBKA 4JHKA 2VJ8A 2J4BA 1KPSB 1SA4A 3WXXA 5A6CA 3MKRA 2YHCA 3LY8A 4CYMD 4RLYA 4RG9A 4HI9A 3WG7E 4LUNU 2XGMA 4ILIA 3ZYLA 3OTNA 3TWTA 1MQSA 4B8AA 1H6PA 2H6IA 3ML8A 4FHJA 2P58C 1OWLA 1N0RA 4NURA 3PDNA 4FC8A 4GTVA 4O6FA 4QQIA 4YNDA 4JVSA 5B1AE 3TWXA 5CERB 5CEAA 2WXMA 4H7YA 3Q15A 5EIDA 3HXCA 4U7EB 2R5SA 4I1MA 3LY7A 4CEMA 3DSWA 3BG1B 4DX1A 2GRLA 2CFZA 4GZ6A 1HE8A 4F6RD 2UY1B 3MJWA 5ENRD 5KNGA 3BU8A 3ZU7B 4I2ZA 2KATA 3CHQA 4U04A 5D2MC 2VSXE 2J07A 1YYHA 3KAEA 2L6JA 2YQ8A 3FTUA 2RD0A 2WXRA 2HYZA 4C0MA 1D8DA 3GW4A 3GZ1A 3UM0A 2VGXA 1VDYA 4UWFA 4G25A 1PY1A 3AJIA 4WWOA 3Q7AA 2NXPA 4HOQA 2ETCA 3MEKA 1S70B 4HXIA 4UQZA 3LEWA 2I1KA 2WQ6A 2QFCA 1TNBA 3I5PA 3FHEA 4HOUA 3EIJA 4U95D 2LSUA 3TL5A 2EINE 2WXFA 3QARA 5BNWA 3CHMA 4FP7A 2NYJA 5LOZA 3TWUA 5HRYA 3W9GA 1EDUA 3ASHA 3I3NA 2ETAA 4UWLA 2B6CA 3CVQA 2BKKB 1FT1A 2XHEA 3FUMA 4P29A 1SZ9A 4L23A 2PM6A 4FHKA 2WXLA 3APCA 3FEYA 3SBSA 3L9TA 5BV1A 5HQ8A 4WNEA 4ANXA 1HFAA 2P9PG 2J8SD 2CG3A 1QZ2A 1IXVA 2H6HA 5AN8A 2IFUA 4GMJA 2X6HA 1INZA 3G2UA 3KD7A 2FO7A 3V30A 3L82A 2IEJA 3FY4A 3S7JA 3T5XA 3D9PA 4HFGA 3MZLB 3PNLB 3EU9A 1H2VC 4GTPA 3QWVA 1AP7A 3HIZA 4FLBA 4LERA 2E0IA 2J9QA 3C3OA 3TWSA 4HRLA 1QBQA 1WDYA 3C3RA 4WUYA 4BESA 2QC9A 3ASNE 1L5JA 3V31A 1JWGA 1TYQG 4LNUD 1IQUA 2Q7FA 4J8SA 4O1PA 3DXMG 3UKUG 3LJ3A 4KMOA 1W3BA 1TEZA 1ELKA 4ZFHA 1MX6A 3DPYA 3VTYA 3EIQC 4GA1A 1BPOA 3SZ7A 2X6JA 5AJDA 4ANWA 4E85A 4B0ZA 5FQ7A 2HM8A 3ZKJA 4CT0A 3NZSA 3QB2A 2WMNA 5FQ6A 3FTSA 2ZGGA 4G2VA 5KCMA 3D9LA 3E30A 4YDOA 4N39A 3URZA 2F8XK 2GRRB 2XS8A 3RKVA 4EZJA 3JXIA 1WAO1 3ENEA 4PUCA 4C9BB 4BT9A 3R7RA 4A1GA 3MA5A 4KYOB 3ISMC 4N2SA 5LFAA 2XPIA 4HORA 2ZISA 4WWNA 1H6OA 5EX3A 3AU4A 3LVQE 3Q9UC 4GAAA 1MZCA 3UQ3A 1K1BA 3W9FA 3SFZA 1MYOA 3ASFA 4PH4B 2XRYA 4U8VD 4HRNA 5CBNA 5ARFA 5B3SE 3JXJA 4F1SA 5CHEE 3UI2A 4LEUA 4BETA 5EYLA 3AAAC 1OT8A 3SQVA 4F1PA 3JYSA 3RU0A 2A4ZA 5C2YA 2Y3AA 2R02A 2DWZA 4CDMA 1N4RA 5FJYA 4GCNA 1UJJA 3SD5A 1O1SA 5KNHD 3LDZA 1HS6A 4BFRA 2FI7A 2OV8A 2BTDA 3SY2A 2KCVA 3PS6A 1NFIE 4JHJA 3AG1E 3SFYA 1FCHA 3CKCA 2C2LA 4I9CA 3QNKA 3QAQA 1Z3YA 2FO1E 3VLFA 2M63A 3CK8A 5FINA 4I43A 4DX5D 2WVIA 2ZU6B 3U3WA 3UKRG 1PAQA 5JMND 1YA0A 4UI9C 5FQ4A 4HVBA 3MV2B 5FZQA 3R7QA 2ONDA 3ZYKA 1K8KG 1XNFA 3DSXA 4XI9A 3O48A 2VTBB 2AXVA 4TXPA 1QNFA 2P9NG 2GW1A 1D9SA 5JHAA 5G55A 2CHZA 2OVFA 5KBAA 3D9JA 1Y8MA 4JXTA 3PUJA 3CVPA 2X38A 2WXNA 4J8EA 2H6GA 3UM2A 3CV0A 4GB9A 2V5FA 2X6IA 3PZ4A 1O1RA 2R05A 2YNQA 4G24A 2P2CP 4UWGA 3S7DA 2NC9A 1B89A 4NIKA 3CEQA 3UT8A 3ZN3A 1E8XA 1V54E 4YDEA 2X6KA 2R17C 2BKGA 5KJKA 4HLLA 4HQDA 4OAUC 3ONKA 4BEPA 5ANLA 2XZDG 2R03A 3PZ1A 1FPPA 3RAUA 3FU0A 4GU5A 3P1UA 4UUCA 4Z68A 1N95A 2QYUA 3FUEA 1OCRE 2R59A 3MKQA 1DCQA 4RG6A 4N3AA 4BTAA 4UI9J 4N5CA 4X8QA 2P9SG 3SFXA 2CFUA 4LG6A 3TWQA 4HBDA 2IU1A 2DYRE 4J8DA 5EN5D 1LF8A 3VLEA 2LO6A
chains in the Genus database with same CATH topology
3MEKA 3LXUX 5BW8C 4BX8A 2XEVA 4BX9A 4DK5A 3FEXA 4G11A 4GA0A 4HXIA 4BSXA 4UQZA 3DBSA 3LEWA 2I1KA 2WQ6A 2HR2A 2QFCA 1EPUA 5C1DA 3IEGA 4U0ZA 3I5PA 1UN8A 3NF1A 3FHEA 4HOUA 3EIJA 5G2NA 4F7AA 4GYWA 2LSUA 4HLEA 1N54A 3TL5A 3EDTB 3IKOB 5J90A 4PDXA 2VQ2A 5A23A 4CDNA 2VYIA 2WXFA 3QARA 2XRZA 5BNWA 3B7SA 3S7BA 3CHMA 2MHKA 1P5QA 4MS6A 1JUQA 1OWMA 4TV3A 3LPZA 4FP7A 5LOZA 5CCLA 4HOSA 3TXMA 3D9MA 5FWQA 3RK6A 3G2VA 4CRWA 4AM9A 1EDUA 3ASHA 4U07A 3I3NA 4XX5A 2JEKA 3ESKA 4UWLA 3FUKA 4IYPA 3CVQA 4XIFA 3K9IA 4JEUA 2VSNA 2EQXA 3BEEA 2XHEA 2XGOA 3FUMA 4U0UA 4P29A 1NZNA 4CGVA 4GZ5A 1SZ9A 4ABNA 4L23A 2XCBA 3L6AA 2PM6A 3L13A 4N3BA 3S2AA 4FHKA 2WXLA 3APCA 3FEYA 2VGYA 3SBSA 4UWHA 5BV1A 2FULA 5HQ8A 3PREA 2J09A 4GMLA 3FH7A 1OWNA 4WNEA 4FADA 1IHGA 4ANXA 1HFAA 2X6FA 3FTYA 2CG3A 4UI9K 1QZ2A 4EZLA 4JC8A 4APFA 5BPPA 4L2YA 2IFUA 3FUFA 4GMJA 4KZ0A 1FVHA 2X6HA 3Q4AB 1INZA 1A17A 4L1BA 3SBTB 4J6IA 3G2UA 3KD7A 2FO7A 3KEZA 3ZIMA 3PUKA 4PS3A 4AY6A 1Z3XA 3L16A 3LS8A 4GPKA 4EQFA 5AIJA 2LSVA 4MKTA 4KXKB 5E76A 5CCMA 1TJFA 3FY4A 2UWJG 4U8HA 4URKA 5T3RA 4XKBA 1Z6TA 4XE0A 3FUIA 3S7JA 3T5XA 1DVPA 3D9PA 1EYHA 1JPLA 2PL2A 3VTXA 1UW4B 4KVMA 5G04J 3G2WA 4TRQA 4OYSA 4AV7A 4HFGA 2AXUA 2DCPA 3C98A 4F53A 2PM7A 3HVEA 3MZLB 3PNLB 1WM5A 3IHVA 4B89A 4RSYA 1HZ4A 2WMOA 1H2VC 2AWIA 4G26A 3E4BA 4GZ3A 4DI3A 3CVXA 3GYZA 2YINA 3O4ZA 4U0SA 3QWVA 1IQRA 3GZ2A 2CHXA 3HIZA 5DIZA 3CVWA 2IF4A 4FLBA 4ILGA 2J49A 3LCAA 4LERA 3RRUA 1E90A 2E0IA 4NRHB 4EBAG 4FA6A 4LRZA 2J9QA 2NSZA 2XQ0A 3LVRE 4NQ0A 5LCWJ 3B7UX 3MX3A 3ML9A 1SZAA 5LP0A 3MKQB 4JZYA 3CHOA 4WUYA 1E96B 3SGHA 5KJNA 4GCOA 3QK0A 3CKBA 4EZKA 1L5JA 4I9EA 4JA9A 2WPVA 3P2BA 3ASGA 1JWGA 1U3CA 1IQUA 2IOSA 4FJYA 4AP2A 5BV0A 5EKQD 2Q7FA 3EHMA 3FU3A 2VGXB 4J8SA 5A7DB 4AVXA 3B13A 2GRMA 3IHYA 3LJ3A 3QWWA 4KMOA 2Y4UA 4K03A 3T5VA 3ZRHA 3EJNA 3VLDA 5CMWA 1W3BA 2HO1A 4FLHA 1TEZA 1ELKA 2KCLA 2ILRA 3QKYA 4KVOA 2PQRA 3FUDA 2PZIA 5T8IA 4JEHA 3VTYA 3APFA 1SQMA 4FJZA 4JW1A 3TJPA 2AXZA 4AXHA 3EIQC 4WWPA 5ENNA 4GA1A 4I6JA 2L9BA 3QOUA 1NA0A 4BY6A 5LCWC 4H7XA 1BPOA 1E8YA 2L0IA 3LYAA 1HG5A 3SZ7A 3G2SA 2V8SE 2X6JA 3KS2A 4IRUA 5AJDA 3AS5A 3FTZA 2XCCA 4ANWA 4E85A 3ESLA 4B0ZA 2CG2A 5FQ7A 2RG8A 2WXOA 4AOFA 1GW6A 2HM8A 4Q94A 2FF4A 4I1OB 2I9CA 3DPDA 3FH5A 3D9NA 4UQYA 4CT0A 3IV0A 5JJTA 1E8WA 4WAFA 4JL0A 2C0MA 2AW6A 2LAIA 2PQNA 2WMNA 3NZSA 3QB2A 4JPSA 3ZW3A 3CVNA 5FQ6A 3CVUA 3FTSA 4PS8A 1JWFA 4N2QA 1HG2A 3CQGB 3D9IA 5HI7A 2WXIA 4G2VA 4AIFA 3UPVA 1TJCA 5EX0A 5KCMA 3D9LA 4V3IA 3EHNA 1EF1C 4DLQA 4N39A 3URZA 3RKVA 3I4GA 4EZJA 4U63A 1WAO1 5ANRA 1X5BA 3ENEA 4A55A 2WQ7A 4CDRA 4DJAA 3FUHA 4D10C 4NACA 5E75A 1HH8A 2KZTA 3OXGA 4K0RA 4TUUA 2E2EA 4PUCA 3L54A 4C9BB 4BT9A 4BTBA 1ELRA 5T4YA 3R7RA 3PRZA 4A1GA 1NA3A 3MA5A 4KYOB 2Y4TA 5JJ6A 2LAHA 2WXJA 4N2SA 2J08A 4B94A 4APOA 2XPIA 4DPRA 5LFAA 1ZU2A 4HORA 3QC1A 4WWNA 4Q96A 5EX3A 4Y6WA 3AU4A 1HX8A 3LVQE 2FBNA 2WXPA 3RO2A 2I6HA 4A3TA 2I1JA 4KT6B 4GAAA 4ME2A 3ULQA 2WXHA 3UUXA 3UQ3A 4BT8A 2KCKA 4E6HA 2IOLA 2WM9A 4XI0A 4OVUA 1OUVA 4I6GA 4Y6CA 3SFZA 4DLOA 5KJLA 5M72A 3RRNB 1QQEA 4I1AA 4PS7A 3OXFA 1KLXA 3ASFA 4PH4B 1U3DA 2XRYA 3ZGQA 3PE4A 3SF4A 4GZCA 4HS2A 4JA7A 4AEZC 5ARFA 4JHRA 4C0EA 1H19A 4GA2A 5LX8A 5ARGA 4F1SA 3U9WA 3QJZA 5CHEE 5J08A 5JHBA 4EECA 4FU3A 4LEUA 3D9KA 5FZSA 4XZ4A 1HF8A 2IQCA 3CGHA 4J0UA 3CSFA 3HVEB 3ZPJA 1WY6A 1KT1A 1UN9A 2BF0X 3PEVB 3JYSA 2UY1A 5D0OD 2CHWA 3Q5MA 4G1TA 3CLJA 1DNPA 3CK7A 2MRIA 3RU0A 1NP7A 3TXNA 3AS4A 3PH0C 1OWOA 2A4ZA 4QFVA 3JUIA 3PZDA 5C2YA 2Y3AA 2OVBA 4G23A 1XGWA 3CR3A 3FUNA 3JCKC 4CDMA 5FJYA 4CCAA 2V0PA 4GCNA 5AJLA 3Q47B 1ZBPA 2KM4A 3MYVA 3L22A 1UJJA 3HHMA 3SD5A 5FQ8A 5D0QD 3MGBA 1KT0A 2DBAA 5AENA 3LDZA 1HS6A 4BFRA 1HXIA 4ATGA 2FI7A 2XPYA 2OV8A 3CIAA 3FFLA 4W9RA 4DI4A 2C0LA 3LKUA 4HOTA 3ZYQA 2VSOE 4WNFA 4GYYA 2BTDA 4LCTA 3NZUA 4YVOA 3CVVA 3OAWA 3CHRA 2X3MA 3CVLA 2KCVA 3PS6A 4JHJA 2DIWA 3AU5A 3CHSA 3FTXA 3HDXA 4IN3B 3RO3A 3N71A 2WQHA 3PVLA 3UT7A 4B8CB 4GYOA 5FZRA 3U64A 1FCHA 3B7TA 3CKCA 4XKCA 3TGOA 4WNGA 3I4RB 2C2LA 1E7UA 3PNTB 4KZCA 1OWPA 4I9CA 4CGWA 3BG0B 2MOWA 3QNKA 4EPZA 3QAQA 2WB2A 1Z3YA 3JQ0A 2J4DA 3VLFA 2YHEA 2M63A 3CK8A 3FU5A 2BUGA 1E8ZA 5KJMA 4I43A 4OVVA 4UWKA 3FH8A 5JJ7A 2WVIA 2IJGX 2ZU6B 3U3WA 3ZVVA 4ANUA 3Q49B 3FP3A 3CK9A 1PAQA 1PC2A 4R7LA 3ZEFA 2VSYA 2XPZA 3CQCB 1YA0A 3ONLA 4UI9C 5FQ4A 3RIBA 3G2TA 4HVBA 3R9AB 3IBEA 4L2LA 3MV2B 4F3VA 5FZQA 3R7QA 4A1SA 1UG3A 4I17A 2ONDA 3ZXSA 2VTBA 5DBKA 3ZYKA 3FTWA 1S0PA 4ACKA 4JHKA 1XNFA 4XI9A 5FTPA 4M3OA 4AY5A 2VJ8A 3O48A 2VTBB 3UT4A 2J4BA 3ZFWA 2AXVA 4MLPA 4AJWA 3WXXA 3ZHEA 2KZTB 1QNFA 5A6CA 3MKRA 2GW1A 2YHCA 3RRMB 5JHAA 3LY8A 5G55A 4RG9A 1ELWA 2CHZA 1E7VA 3ZHEB 5BT1A 2OVFA 3L17A 3D9JA 1Y8MA 3FTVA 1MHQA 2L0TB 4GZDA 4LUNU 4JXTA 4CT4A 2XGMA 3PUJA 4ILIA 3ZYLA 2FEZA 2X38A 3CVPA 3OTNA 3CSTA 2WXNA 1MQSA 4B8AA 4L7TA 3FUJA 4I6EA 5BUZA 4RVBA 3ML8A 4FHJA 4J8EA 3NQPA 5EDSA 3S7FA 2P58C 3CV0A 3PEUB 3D9OA 4GB9A 1OWLA 2IONA 2V5FA 2X6IA 4I2WA 4NURA 4Q69A 1H2UA 3UX4A 4EBAA 3QDNA 2A5UA 2YNQA 2I2OA 3PDNA 4FC8A 4G24A 1IYGA 4UWGA 4O6FA 3TG4A 1H6KA 3UMVA 4YNDA 4JVSA 3D3MA 2OOEA 5AYWD 3S7DA 2NC9A 1N52A 1B89A 2WXMA 3APDA 3CEQA 4H7YA 5G05J 3Q15A 2KC7A 3TAXA 3UT8A 2WXGA 3ZN3A 3L08A 1E8XA 4ILHB 3SNXA 2R5SA 3FULA 3MV3B 4I1MA 4J8FA 3LY7A 4CEMA 4BWRA 3QWPA 2X6KA 2R17C 3BG1B 1FVFA 2QY7A 2WXQA 3SI5A 2GRLA 4UQXA 2CFZA 5KJKA 1UJKA 3FDHA 3ONKA 4GZ6A 1HE8A 5ANLA 3LY9A 2UY1B 3MCXA 3MJWA 3T8MA 2WXKA 3U4TA 2JLBA 3FU0A 4IULA 4ACLA 4GU5A 3P1UA 4I2ZA 4N3CA 2KATA 4ANVA 3CHQA 3OXLA 3TG5A 3FUEA 4U04A 2V4LA 2VSXE 2J07A 3CHPA 3CVYA 3SHFA 2R59A 3KAEA 3GZSA 3FU6A 3MKQA 1HU3A 3HYMB 4RG6A 2L6JA 5CMYA 5FT9A 4MRUA 4N3AA 2YQ8A 3FTUA 2RD0A 4BTAA 2WXRA 2LNIA 1HO8A 2HYZA 4YVQC 3PE3A 5G05C 3JQ1A 4UI9J 4C0MA 4N5CA 2GGFA 3GW4A 3U66A 3GZ1A 2CFUA 4FULA 2VGXA 3RJVA 1Y6IA 3ZYMA 2XGSA 2IU1A 1H2TC 2AVPA 1H0AA 3B7RL 3FWVA 1VDYA 4J8DA 4UWFA 4WNDA 1LF8A 3AS8A 3ASDA 5G04C 4G25A 1PY1A 3VLEA 4KBQA 4A3VA 4WWOA 2NXPA 2LO6A 4HOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEK A;  5BW8 C;  2XEV A;  4GA0 A;  4UQZ A;  2HR2 A;  2QFC A;  5C1D A;  3IEG A;  4U0Z A;  3NF1 A;  4HOU A;  4GYW A;  2LSU A;  3EDT B;  2VQ2 A;  2VYI A;  5BNW A;  3S7B A;  2MHK A;  1P5Q A;  3LPZ A;  5CCL A;  4HOS A;  4AM9 A;  3ASH A;  4U07 A;  3ESK A;  3CVQ A;  4XIF A;  3K9I A;  2VSN A;  3BEE A;  2XGO A;  4U0U A;  1NZN A;  4CGV A;  4GZ5 A;  4ABN A;  2XCB A;  4N3B A;  2VGY A;  5HQ8 A;  4WNE A;  1IHG A;  4UI9 K;  1QZ2 A;  2IFU A;  3Q4A B;  1A17 A;  3KD7 A;  2FO7 A;  4AY6 A;  4GPK A;  4EQF A;  2LSV A;  4KXK B;  5CCM A;  2UWJ G;  3S7J A;  2PL2 A;  3VTX A;  5G04 J;  1WM5 A;  1HZ4 A;  4G26 A;  3E4B A;  4GZ3 A;  3GYZ A;  4U0S A;  3QWV A;  5DIZ A;  3GZ2 A;  2IF4 A;  3LCA A;  4NRH B;  2J9Q A;  4NQ0 A;  5LCW J;  4WUY A;  1E96 B;  5KJN A;  4GCO A;  3CKB A;  4I9E A;  4JA9 A;  2WPV A;  3ASG A;  5EKQ D;  2Q7F A;  2VGX B;  5A7D B;  3QWW A;  2Y4U A;  1W3B A;  2HO1 A;  2KCL A;  3QKY A;  2PQR A;  2PZI A;  3VTY A;  4GA1 A;  3QOU A;  1NA0 A;  5LCW C;  4H7X A;  3LYA A;  3SZ7 A;  3KS2 A;  3AS5 A;  2XCC A;  2FF4 A;  4UQY A;  5JJT A;  4JL0 A;  2C0M A;  2PQN A;  3CVN A;  4N2Q A;  5HI7 A;  4AIF A;  4G2V A;  3UPV A;  1TJC A;  5EX0 A;  4N39 A;  3URZ A;  3RKV A;  1WAO 1;  4CDR A;  1HH8 A;  3OXG A;  2E2E A;  4BT9 A;  4BTB A;  1ELR A;  1NA3 A;  3MA5 A;  4KYO B;  2Y4T A;  5JJ6 A;  4N2S A;  4B94 A;  4APO A;  2XPI A;  4HOR A;  1ZU2 A;  5EX3 A;  4Y6W A;  2FBN A;  3RO2 A;  2I6H A;  4ME2 A;  3ULQ A;  3UUX A;  3UQ3 A;  4BT8 A;  2KCK A;  4XI0 A;  4Y6C A;  1OUV A;  5KJL A;  5M72 A;  1QQE A;  4I1A A;  3OXF A;  1KLX A;  3ASF A;  3ZGQ A;  3PE4 A;  3SF4 A;  4JA7 A;  5ARF A;  4JHR A;  4GA2 A;  5ARG A;  5CHE E;  4LEU A;  5FZS A;  4J0U A;  3ZPJ A;  1KT1 A;  3JYS A;  2UY1 A;  5D0O D;  3Q5M A;  4G1T A;  3CK7 A;  3RU0 A;  3AS4 A;  4G23 A;  5FJY A;  4GCN A;  3Q47 B;  1ZBP A;  5D0Q D;  1KT0 A;  2DBA A;  1HXI A;  2FI7 A;  3FFL A;  4W9R A;  2C0L A;  3LKU A;  4HOT A;  4WNF A;  4GYY A;  4YVO A;  3CVL A;  2KCV A;  4IN3 B;  3RO3 A;  3N71 A;  2WQH A;  4GYO A;  5FZR A;  1FCH A;  3CKC A;  3TGO A;  4WNG A;  2C2L A;  4I9C A;  4CGW A;  3CK8 A;  2BUG A;  5KJM A;  5JJ7 A;  3U3W A;  3Q49 B;  3FP3 A;  3CK9 A;  1PC2 A;  2VSY A;  1YA0 A;  3RIB A;  4UI9 C;  3R9A B;  3MV2 B;  4F3V A;  5FZQ A;  4A1S A;  4I17 A;  2OND A;  5DBK A;  1XNF A;  4XI9 A;  5FTP A;  4AY5 A;  3O48 A;  3ZFW A;  3WXX A;  3ZHE A;  5A6C A;  3MKR A;  2GW1 A;  2YHC A;  3LY8 A;  4RG9 A;  1ELW A;  3ZHE B;  5BT1 A;  1Y8M A;  2XGM A;  2FEZ A;  3CVP A;  4J8E A;  3S7F A;  2P58 C;  3CV0 A;  2V5F A;  4I2W A;  3QDN A;  3PDN A;  4G24 A;  1IYG A;  4O6F A;  3TG4 A;  4YND A;  2OOE A;  5AYW D;  3S7D A;  2NC9 A;  1B89 A;  3CEQ A;  4H7Y A;  5G05 J;  3Q15 A;  2KC7 A;  3TAX A;  3ZN3 A;  2R5S A;  3MV3 B;  4J8F A;  3LY7 A;  4BWR A;  3QWP A;  4UQX A;  5KJK A;  4GZ6 A;  3LY9 A;  2UY1 B;  3U4T A;  2JLB A;  4I2Z A;  4N3C A;  2KAT A;  3OXL A;  3TG5 A;  4U04 A;  3KAE A;  4RG6 A;  3HYM B;  2L6J A;  5FT9 A;  4N3A A;  2YQ8 A;  4BTA A;  2LNI A;  2HYZ A;  4YVQ C;  3PE3 A;  5G05 C;  4UI9 J;  4N5C A;  3GW4 A;  3GZ1 A;  2VGX A;  3RJV A;  2XGS A;  3FWV A;  2AVP A;  4WND A;  4J8D A;  5G04 C;  3AS8 A;  3ASD A;  4G25 A;  4KBQ A;  4HOQ A; 
#chains in the Genus database with same CATH topology
 5BW8 C;  2XEV A;  4BSX A;  4GTM A;  4EHM A;  4U0Z A;  3NF1 A;  1UN8 A;  4F7A A;  4HLE A;  3EDT B;  2P9L G;  4PDX A;  5A23 A;  4CDN A;  3B7S A;  3S7B A;  1OWM A;  2DYS E;  5CCL A;  3TXM A;  3C5R A;  1FT2 A;  4U07 A;  3DXK G;  3EUV A;  5AQ7 A;  4G8K A;  2XGO A;  4U0U A;  4ABN A;  2XCB A;  3L13 A;  4N3B A;  3S2A A;  1A5E A;  1KZO A;  2J09 A;  4G8L A;  4GML A;  2X6F A;  4UI9 K;  4EZL A;  5CRV A;  4PS3 A;  3DSV A;  1ZB1 A;  3LS8 A;  4GPK A;  2LSV A;  4KXK B;  5ENP D;  5T3R A;  4XKB A;  3HXD A;  4N5Q A;  3EU5 A;  2AJA A;  2PL2 A;  3VTX A;  1UW4 B;  3G2W A;  4AV7 A;  3C98 A;  4F53 A;  2PM7 A;  3HVE A;  3UM1 A;  2WMO A;  1MX2 A;  3GYZ A;  3O4Z A;  3CVW A;  4FA6 A;  1E90 A;  4NRH B;  4EBA G;  2NSZ A;  3B7U X;  3ML9 A;  1SZA A;  4J8Y A;  1E96 B;  4GCO A;  3CKB A;  1Z5S C;  1TNO A;  4HNA D;  4AP2 A;  5BV0 A;  5EKQ D;  3J5P A;  3B13 A;  3QWW A;  1BU9 A;  2Y4U A;  4K03 A;  3EJN A;  3C3Q A;  2HO1 A;  4FLH A;  2KCL A;  2ILR A;  2A5E A;  5T8I A;  2AXZ A;  3TWR A;  5ENN A;  5BXO A;  4I6J A;  3ZXP A;  2L9B A;  1NA0 A;  4BY6 A;  4H7X A;  1E8Y A;  2L0I A;  3G2S A;  1BD8 A;  3UM3 A;  2F8Y A;  2CG2 A;  2WXO A;  5H7P A;  4AOF A;  4I1O B;  2I9C A;  3D9N A;  3ABL E;  3IV0 A;  5JJT A;  3ZW3 A;  2LAI A;  3CVU A;  4PS8 A;  3CQG B;  2WXI A;  5EX0 A;  1EF1 C;  1D8E A;  5ANR A;  1X5B A;  4CDR A;  1HH8 A;  3OXG A;  4TUU A;  3L54 A;  4BTB A;  1ELR A;  4O60 A;  3PRZ A;  1NA3 A;  1N94 A;  4C48 B;  3HXB A;  2LAH A;  2WXJ A;  4B94 A;  4APO A;  2MYO A;  1HX8 A;  2WXP A;  4A3T A;  1N4Q A;  4ME2 A;  4E6H A;  2KCK A;  5FIO A;  5KJL A;  4OVU A;  5M72 A;  1OY3 D;  3E34 A;  1RZ4 A;  2KBX A;  3OXF A;  1KLX A;  1U3D A;  3ZGQ A;  4B93 B;  3NAW A;  3SF4 A;  4GZC A;  4HS2 A;  4JA7 A;  5LX8 A;  4A63 B;  5J08 A;  5JHB A;  4EEC A;  3D9K A;  4XZ4 A;  2IQC A;  3CSF A;  1IHB A;  1KT1 A;  3PEV B;  2UY1 A;  2RKK A;  5D0O D;  4G1T A;  4GTR A;  2MRI A;  2JAB A;  3Q78 A;  3PH0 C;  3JUI A;  3B7B A;  3AG3 E;  1N11 A;  4CCA A;  3Q47 B;  1ZBP A;  3BQO A;  5ENS D;  1UOH A;  1HXI A;  4ATG A;  2XPY A;  4DI4 A;  4HOT A;  2VSO E;  2KXP C;  4GTS A;  3CVL A;  3AU5 A;  3CHS A;  4DUI A;  5FZR A;  4MBG A;  3U64 A;  4BSZ B;  3NOG D;  2EIJ E;  4WNG A;  4CGW A;  3BG0 B;  2MOW A;  3NOC D;  4OAV B;  4DX2 A;  5EYP F;  1WG0 A;  3DRA A;  4OVV A;  3NB2 A;  3LJN A;  5JJ7 A;  2IJG X;  3HXE A;  3CK9 A;  3KSQ A;  5ENQ D;  3RIB A;  2LUH A;  2IO3 C;  3G2T A;  3R9A B;  5HS0 A;  4BER A;  1UG3 A;  4U96 D;  1S0P A;  4M3O A;  4AJW A;  3ZHE A;  2KZT B;  3RRM B;  5BT1 A;  1O1T A;  4DRX E;  3FTV A;  1MHQ A;  4CT4 A;  4GZD A;  2FEZ A;  3X2Q E;  2GRO B;  4RVB A;  3S7F A;  3PEU B;  3D9O A;  1TN6 A;  2ION A;  2EIL E;  1H2U A;  3UX4 A;  3QDN A;  2A5U A;  1AWC B;  2I2O A;  3UMV A;  2OOE A;  1N52 A;  1LD7 A;  1S63 A;  5G05 J;  4JD2 G;  3TAX A;  2WXG A;  3L08 A;  4YDY A;  3Q79 A;  3FUL A;  4BWR A;  3QWP A;  1FVF A;  3IXE A;  2QY7 A;  5AQB A;  4UQX A;  1UJK A;  3MCX A;  3T8M A;  2WXK A;  3U4T A;  2OEV A;  3B95 A;  3CHP A;  3SHF A;  2GRP B;  3FU6 A;  3HYM B;  3HG0 D;  5FT9 A;  4MRU A;  5KWD A;  2LNI A;  4YVQ C;  3JQ1 A;  4U8Y D;  1JCQ A;  3HXF A;  3RJV A;  1Y6I A;  2XGS A;  4YDW A;  3BUA A;  1H2T C;  2AVP A;  1H0A A;  4WND A;  3ASD A;  4KBQ A;  3SO8 A;  4A3V A;  4RQI A;  3LXU X;  4BX8 A;  3C72 A;  4G11 A;  3DBS A;  1EPU A;  5G2N A;  1YMP A;  2VYI A;  2XRZ A;  1YCS B;  2MHK A;  1P5Q A;  1JUQ A;  3LPZ A;  4HOS A;  3D9M A;  1BI8 B;  3G2V A;  4AM9 A;  5BXU A;  4K5C A;  2V5Q C;  3FUK A;  3DEP A;  4IYP A;  3EHR A;  4JEU A;  2VSN A;  3JUE A;  2EQX A;  3BEE A;  1NZN A;  4GZ5 A;  3L6A A;  1LD8 A;  3DWL G;  4UWH A;  2FUL A;  1OWN A;  3DEO A;  2BED A;  2Y69 E;  3R9M A;  4JC8 A;  5BPP A;  3E32 A;  4KZ0 A;  1FVH A;  3Q4A B;  1A17 A;  2QYJ A;  3SBT B;  4J6I A;  3ZIM A;  3PUK A;  1Z3X A;  3L16 A;  4EQF A;  5AIJ A;  1NL4 A;  1Q2Z A;  4MKT A;  3DST A;  5E76 A;  5CCM A;  1TJF A;  2UWJ G;  4URK A;  4XE0 A;  3FUI A;  1JPL A;  4OYS A;  1N4P A;  2DCP A;  1WM5 A;  4B89 A;  4RSY A;  1HZ4 A;  3D9H A;  2AWI A;  4GZ3 A;  4DX6 D;  3CVX A;  4U0S A;  1IQR A;  2CHX A;  2IF4 A;  4ILG A;  3LCA A;  3RRU A;  1IKN D;  3ABM E;  4LRZ A;  2EIM E;  2XQ0 A;  3LVR E;  5LCW J;  3MX3 A;  3UIP C;  5LP0 A;  2Y1L E;  3F6Q A;  1MX4 A;  3SGH A;  2P9K G;  5KJN A;  2RFM A;  1SW6 A;  4JA9 A;  2WPV A;  3P2B A;  3DSS A;  1U3C A;  2IOS A;  4FJY A;  3ULE G;  3EHM A;  3FU3 A;  2VGX B;  5A7D B;  4AVX A;  2GRM A;  3IHY A;  3TWV A;  3QKY A;  2PQR A;  3FUD A;  2PZI A;  3APF A;  1QYM A;  3V2X A;  3TJP A;  4FJZ A;  1BI7 B;  4AXH A;  4WWP A;  4XEI G;  2IO2 C;  3LYA A;  2V8S E;  3AS5 A;  2XCC A;  2RG8 A;  1GW6 A;  4Q94 A;  4WAF A;  4JL0 A;  2PQN A;  1JWF A;  1HG2 A;  4GMR A;  1V55 E;  3D9I A;  4AIF A;  5CEC B;  3EHN A;  4DLQ A;  5ENO D;  3Q73 A;  1TN7 A;  5E75 A;  5T4Y A;  3PZ3 A;  5JJ6 A;  4DPR A;  1ZU2 A;  2LXL A;  2EIK E;  4Q96 A;  4Y6W A;  2FBN A;  2I6H A;  2I1J A;  3ULQ A;  2WXH A;  4BT8 A;  2WM9 A;  4Y6C A;  1OCZ E;  1QQE A;  4I1A A;  4PS7 A;  3KSL A;  3PE4 A;  2GRN B;  4JHR A;  4GA2 A;  5ARG A;  3U9W A;  5AAO A;  5EIB E;  5FZS A;  3PZ2 A;  2DZN A;  4J0U A;  1S64 A;  3ZPJ A;  3Q7F A;  3UXG A;  1NP7 A;  4TUM A;  3TXN A;  3AS4 A;  4QFV A;  2OVB A;  2OCC E;  5IY5 E;  3CR3 A;  2V0P A;  2KM4 A;  3MYV A;  1U2V G;  3MGB A;  2DBA A;  5AEN A;  3CIA A;  4W9R A;  2ETB A;  2C0L A;  3LKU A;  2LXM A;  3OAW A;  3CHR A;  1TN8 A;  4IN3 B;  3RO3 A;  3N71 A;  2WQH A;  4GYO A;  1O5M A;  3B7T A;  3I4R B;  1E7U A;  3PNT B;  5HKP A;  2J4D A;  2YHE A;  2HE0 A;  3FU5 A;  3ZVV A;  3FP3 A;  4R7L A;  3ZEF A;  3NBN B;  2PNN A;  3IBE A;  4F3V A;  4A1S A;  4I17 A;  3ZXS A;  3E37 A;  3FTW A;  4ACK A;  1DCE A;  5ENT D;  4AY5 A;  5FTP A;  4HB5 A;  1DC2 A;  1TNZ A;  3UT4 A;  3ZFW A;  4MLP A;  5EIL A;  1ELW A;  1E7V A;  3ZHE B;  3L17 A;  3ZNG A;  2L0T B;  3T9K A;  3CST A;  4GTO A;  4ATZ D;  4L7T A;  3FUJ A;  4I6E A;  5BUZ A;  3NQP A;  2XEN A;  5EDS A;  2F0Y A;  2IY0 C;  1N9A A;  3AG4 E;  4I2W A;  4Q69 A;  4EBA A;  4O1O A;  1IYG A;  3TG4 A;  1H6K A;  3D3M A;  5AYW D;  4TXR A;  4LSZ E;  3APD A;  1TR4 A;  2KC7 A;  4ILH B;  3SNX A;  1N4S A;  4DX7 D;  3ABK E;  3MV3 B;  4ZHB A;  4J8F A;  3SI5 A;  2WXQ A;  3FDH A;  4LNG A;  3LY9 A;  2JLB A;  1K3Z D;  4IUL A;  4ACL A;  1X81 A;  4N3C A;  4ANV A;  3OXL A;  1RW2 A;  3TG5 A;  2V4L A;  3CVY A;  3Q9N C;  2VGE A;  3GZS A;  1HU3 A;  5CMY A;  1KZP A;  1HO8 A;  3PE3 A;  5G05 C;  2GGF A;  3EHQ A;  3U66 A;  4FUL A;  4TXQ A;  4GPM A;  3V2O A;  2XEE A;  3ZYM A;  1JCS A;  3FWV A;  3B7R L;  5G04 C;  3AS8 A;  3HRA A;  4M7C A;  4GTT A;  4BX9 A;  4DK5 A;  3FEX A;  4GA0 A;  2XS1 A;  2HR2 A;  5C1D A;  3IEG A;  1K1A A;  4GYW A;  1N54 A;  3IKO B;  5J90 A;  2VQ2 A;  1SA5 A;  4MS6 A;  4TV3 A;  5CRU A;  4GTQ A;  5FWQ A;  3RK6 A;  1TNY A;  2V4H C;  4CRW A;  4HI8 A;  4XX5 A;  2JEK A;  1NI1 A;  3ESK A;  4XIF A;  4JB8 P;  3K9I A;  4CGV A;  2Y0B G;  2VGY A;  1G3N B;  3PRE A;  3FH7 A;  4FAD A;  1IHG A;  3FTY A;  3ULY A;  4APF A;  4K5B A;  4L2Y A;  3FUF A;  4L1B A;  3UTM A;  3KEZ A;  4AY6 A;  5JA4 D;  4K5A B;  4U8H A;  1Z6T A;  1LTX A;  1DVP A;  1EYH A;  2F37 A;  4KVM A;  5G04 J;  4TRQ A;  2AXU A;  3IHV A;  4G26 A;  3E4B A;  4DI3 A;  2YIN A;  3GZ2 A;  3Q75 A;  5DIZ A;  2J49 A;  2P9I G;  4NQ0 A;  1OCO E;  3MKQ B;  3DSU A;  4JZY A;  3CHO A;  4LNB A;  3QK0 A;  4EZK A;  4I9E A;  2DVW A;  3ASG A;  3V79 K;  3RSE G;  3ASO E;  2QZA A;  4CZ2 D;  2ZGD A;  3T5V A;  3ZRH A;  3VLD A;  5CMW A;  4KVO A;  5CED B;  4JEH A;  2ZXW E;  3UIN C;  1SQM A;  4JW1 A;  4L9P A;  2L6B A;  3QOU A;  5LCW C;  1HG5 A;  4IRU A;  3KS2 A;  3FTZ A;  3ESL A;  2FF4 A;  4UQY A;  3DPD A;  3FH5 A;  1E8W A;  2C0M A;  2AW6 A;  4JPS A;  5AAR A;  2B0O E;  3CVN A;  4N2Q A;  5HI7 A;  3UPV A;  1TJC A;  2ZIR A;  2DZO A;  4V3I A;  1SVX A;  3I4G A;  2P9U G;  4U63 A;  1BLX B;  4A55 A;  3UIO C;  2WQ7 A;  4DJA A;  3FUH A;  4D10 C;  4NAC A;  2KZT A;  4K0R A;  2E2E A;  2Y4T A;  2J08 A;  4HRM B;  3QC1 A;  3RO2 A;  4KT6 B;  3ZUV B;  3UUX A;  2IOL A;  4DLO A;  4XI0 A;  1OUV A;  4I6G A;  3RRN B;  5B1B E;  2OEW A;  4AEZ C;  2XEH A;  4C0E A;  1H19 A;  3QJZ A;  4FU3 A;  1HF8 A;  3CGH A;  3HVE B;  3T8K A;  1WY6 A;  1UN9 A;  2BF0 X;  2R2L A;  2CHW A;  3Q5M A;  3CLJ A;  1DNP A;  3CK7 A;  1OWO A;  3PZD A;  2XZT G;  4G23 A;  5ITZ F;  1XGW A;  2RFA A;  3FUN A;  3JCK C;  5AQ9 A;  5AJL A;  1JCR A;  3L22 A;  1OXJ A;  3HHM A;  5FQ8 A;  5D0Q D;  1KT0 A;  5AQA A;  2H6F A;  3FFL A;  1N0Q A;  3ZYQ A;  4WNF A;  4GYY A;  1OCC E;  3NZU A;  4LCT A;  3KEA A;  4YVO A;  3CVV A;  2X3M A;  3J5Q B;  2DIW A;  3FTX A;  3HDX A;  3PVL A;  3UT7 A;  4B8C B;  4XKC A;  3TGO A;  4J7W A;  4KZC A;  1OWP A;  1TNU A;  4EPZ A;  2WB2 A;  3JQ0 A;  2BUG A;  1E8Z A;  5KJM A;  4UWK A;  3FH8 A;  5CBO A;  3TWW A;  4ANU A;  3Q49 B;  1PC2 A;  2VSY A;  2XPZ A;  3CQC B;  3ONL A;  1MJ0 A;  4L2L A;  2VTB A;  5D66 A;  2GRQ B;  3E33 A;  3AG2 E;  5DBK A;  4JHK A;  2VJ8 A;  2J4B A;  1KPS B;  1SA4 A;  3WXX A;  5A6C A;  3MKR A;  2YHC A;  3LY8 A;  4CYM D;  4RLY A;  4RG9 A;  4HI9 A;  3WG7 E;  4LUN U;  2XGM A;  4ILI A;  3ZYL A;  3OTN A;  3TWT A;  1MQS A;  4B8A A;  1H6P A;  2H6I A;  3ML8 A;  4FHJ A;  2P58 C;  1OWL A;  1N0R A;  4NUR A;  3PDN A;  4FC8 A;  4GTV A;  4O6F A;  4QQI A;  4YND A;  4JVS A;  5B1A E;  3TWX A;  5CER B;  5CEA A;  2WXM A;  4H7Y A;  3Q15 A;  5EID A;  3HXC A;  4U7E B;  2R5S A;  4I1M A;  3LY7 A;  4CEM A;  3DSW A;  3BG1 B;  4DX1 A;  2GRL A;  2CFZ A;  4GZ6 A;  1HE8 A;  4F6R D;  2UY1 B;  3MJW A;  5ENR D;  5KNG A;  3BU8 A;  3ZU7 B;  4I2Z A;  2KAT A;  3CHQ A;  4U04 A;  5D2M C;  2VSX E;  2J07 A;  1YYH A;  3KAE A;  2L6J A;  2YQ8 A;  3FTU A;  2RD0 A;  2WXR A;  2HYZ A;  4C0M A;  1D8D A;  3GW4 A;  3GZ1 A;  3UM0 A;  2VGX A;  1VDY A;  4UWF A;  4G25 A;  1PY1 A;  3AJI A;  4WWO A;  3Q7A A;  2NXP A;  4HOQ A;  2ETC A;  3MEK A;  1S70 B;  4HXI A;  4UQZ A;  3LEW A;  2I1K A;  2WQ6 A;  2QFC A;  1TNB A;  3I5P A;  3FHE A;  4HOU A;  3EIJ A;  4U95 D;  2LSU A;  3TL5 A;  2EIN E;  2WXF A;  3QAR A;  5BNW A;  3CHM A;  4FP7 A;  2NYJ A;  5LOZ A;  3TWU A;  5HRY A;  3W9G A;  1EDU A;  3ASH A;  3I3N A;  2ETA A;  4UWL A;  2B6C A;  3CVQ A;  2BKK B;  1FT1 A;  2XHE A;  3FUM A;  4P29 A;  1SZ9 A;  4L23 A;  2PM6 A;  4FHK A;  2WXL A;  3APC A;  3FEY A;  3SBS A;  3L9T A;  5BV1 A;  5HQ8 A;  4WNE A;  4ANX A;  1HFA A;  2P9P G;  2J8S D;  2CG3 A;  1QZ2 A;  1IXV A;  2H6H A;  5AN8 A;  2IFU A;  4GMJ A;  2X6H A;  1INZ A;  3G2U A;  3KD7 A;  2FO7 A;  3V30 A;  3L82 A;  2IEJ A;  3FY4 A;  3S7J A;  3T5X A;  3D9P A;  4HFG A;  3MZL B;  3PNL B;  3EU9 A;  1H2V C;  4GTP A;  3QWV A;  1AP7 A;  3HIZ A;  4FLB A;  4LER A;  2E0I A;  2J9Q A;  3C3O A;  3TWS A;  4HRL A;  1QBQ A;  1WDY A;  3C3R A;  4WUY A;  4BES A;  2QC9 A;  3ASN E;  1L5J A;  3V31 A;  1JWG A;  1TYQ G;  4LNU D;  1IQU A;  2Q7F A;  4J8S A;  4O1P A;  3DXM G;  3UKU G;  3LJ3 A;  4KMO A;  1W3B A;  1TEZ A;  1ELK A;  4ZFH A;  1MX6 A;  3DPY A;  3VTY A;  3EIQ C;  4GA1 A;  1BPO A;  3SZ7 A;  2X6J A;  5AJD A;  4ANW A;  4E85 A;  4B0Z A;  5FQ7 A;  2HM8 A;  3ZKJ A;  4CT0 A;  3NZS A;  3QB2 A;  2WMN A;  5FQ6 A;  3FTS A;  2ZGG A;  4G2V A;  5KCM A;  3D9L A;  3E30 A;  4YDO A;  4N39 A;  3URZ A;  2F8X K;  2GRR B;  2XS8 A;  3RKV A;  4EZJ A;  3JXI A;  1WAO 1;  3ENE A;  4PUC A;  4C9B B;  4BT9 A;  3R7R A;  4A1G A;  3MA5 A;  4KYO B;  3ISM C;  4N2S A;  5LFA A;  2XPI A;  4HOR A;  2ZIS A;  4WWN A;  1H6O A;  5EX3 A;  3AU4 A;  3LVQ E;  3Q9U C;  4GAA A;  1MZC A;  3UQ3 A;  1K1B A;  3W9F A;  3SFZ A;  1MYO A;  3ASF A;  4PH4 B;  2XRY A;  4U8V D;  4HRN A;  5CBN A;  5ARF A;  5B3S E;  3JXJ A;  4F1S A;  5CHE E;  3UI2 A;  4LEU A;  4BET A;  5EYL A;  3AAA C;  1OT8 A;  3SQV A;  4F1P A;  3JYS A;  3RU0 A;  2A4Z A;  5C2Y A;  2Y3A A;  2R02 A;  2DWZ A;  4CDM A;  1N4R A;  5FJY A;  4GCN A;  1UJJ A;  3SD5 A;  1O1S A;  5KNH D;  3LDZ A;  1HS6 A;  4BFR A;  2FI7 A;  2OV8 A;  2BTD A;  3SY2 A;  2KCV A;  3PS6 A;  1NFI E;  4JHJ A;  3AG1 E;  3SFY A;  1FCH A;  3CKC A;  2C2L A;  4I9C A;  3QNK A;  3QAQ A;  1Z3Y A;  2FO1 E;  3VLF A;  2M63 A;  3CK8 A;  5FIN A;  4I43 A;  4DX5 D;  2WVI A;  2ZU6 B;  3U3W A;  3UKR G;  1PAQ A;  5JMN D;  1YA0 A;  4UI9 C;  5FQ4 A;  4HVB A;  3MV2 B;  5FZQ A;  3R7Q A;  2OND A;  3ZYK A;  1K8K G;  1XNF A;  3DSX A;  4XI9 A;  3O48 A;  2VTB B;  2AXV A;  4TXP A;  1QNF A;  2P9N G;  2GW1 A;  1D9S A;  5JHA A;  5G55 A;  2CHZ A;  2OVF A;  5KBA A;  3D9J A;  1Y8M A;  4JXT A;  3PUJ A;  3CVP A;  2X38 A;  2WXN A;  4J8E A;  2H6G A;  3UM2 A;  3CV0 A;  4GB9 A;  2V5F A;  2X6I A;  3PZ4 A;  1O1R A;  2R05 A;  2YNQ A;  4G24 A;  2P2C P;  4UWG A;  3S7D A;  2NC9 A;  1B89 A;  4NIK A;  3CEQ A;  3UT8 A;  3ZN3 A;  1E8X A;  1V54 E;  4YDE A;  2X6K A;  2R17 C;  2BKG A;  5KJK A;  4HLL A;  4HQD A;  4OAU C;  3ONK A;  4BEP A;  5ANL A;  2XZD G;  2R03 A;  3PZ1 A;  1FPP A;  3RAU A;  3FU0 A;  4GU5 A;  3P1U A;  4UUC A;  4Z68 A;  1N95 A;  2QYU A;  3FUE A;  1OCR E;  2R59 A;  3MKQ A;  1DCQ A;  4RG6 A;  4N3A A;  4BTA A;  4UI9 J;  4N5C A;  4X8Q A;  2P9S G;  3SFX A;  2CFU A;  4LG6 A;  3TWQ A;  4HBD A;  2IU1 A;  2DYR E;  4J8D A;  5EN5 D;  1LF8 A;  3VLE A;  2LO6 A; 
#chains in the Genus database with same CATH homology
 3MEK A;  3LXU X;  5BW8 C;  4BX8 A;  2XEV A;  4BX9 A;  4DK5 A;  3FEX A;  4G11 A;  4GA0 A;  4HXI A;  4BSX A;  4UQZ A;  3DBS A;  3LEW A;  2I1K A;  2WQ6 A;  2HR2 A;  2QFC A;  1EPU A;  5C1D A;  3IEG A;  4U0Z A;  3I5P A;  1UN8 A;  3NF1 A;  3FHE A;  4HOU A;  3EIJ A;  5G2N A;  4F7A A;  4GYW A;  2LSU A;  4HLE A;  1N54 A;  3TL5 A;  3EDT B;  3IKO B;  5J90 A;  4PDX A;  2VQ2 A;  5A23 A;  4CDN A;  2VYI A;  2WXF A;  3QAR A;  2XRZ A;  5BNW A;  3B7S A;  3S7B A;  3CHM A;  2MHK A;  1P5Q A;  4MS6 A;  1JUQ A;  1OWM A;  4TV3 A;  3LPZ A;  4FP7 A;  5LOZ A;  5CCL A;  4HOS A;  3TXM A;  3D9M A;  5FWQ A;  3RK6 A;  3G2V A;  4CRW A;  4AM9 A;  1EDU A;  3ASH A;  4U07 A;  3I3N A;  4XX5 A;  2JEK A;  3ESK A;  4UWL A;  3FUK A;  4IYP A;  3CVQ A;  4XIF A;  3K9I A;  4JEU A;  2VSN A;  2EQX A;  3BEE A;  2XHE A;  2XGO A;  3FUM A;  4U0U A;  4P29 A;  1NZN A;  4CGV A;  4GZ5 A;  1SZ9 A;  4ABN A;  4L23 A;  2XCB A;  3L6A A;  2PM6 A;  3L13 A;  4N3B A;  3S2A A;  4FHK A;  2WXL A;  3APC A;  3FEY A;  2VGY A;  3SBS A;  4UWH A;  5BV1 A;  2FUL A;  5HQ8 A;  3PRE A;  2J09 A;  4GML A;  3FH7 A;  1OWN A;  4WNE A;  4FAD A;  1IHG A;  4ANX A;  1HFA A;  2X6F A;  3FTY A;  2CG3 A;  4UI9 K;  1QZ2 A;  4EZL A;  4JC8 A;  4APF A;  5BPP A;  4L2Y A;  2IFU A;  3FUF A;  4GMJ A;  4KZ0 A;  1FVH A;  2X6H A;  3Q4A B;  1INZ A;  1A17 A;  4L1B A;  3SBT B;  4J6I A;  3G2U A;  3KD7 A;  2FO7 A;  3KEZ A;  3ZIM A;  3PUK A;  4PS3 A;  4AY6 A;  1Z3X A;  3L16 A;  3LS8 A;  4GPK A;  4EQF A;  5AIJ A;  2LSV A;  4MKT A;  4KXK B;  5E76 A;  5CCM A;  1TJF A;  3FY4 A;  2UWJ G;  4U8H A;  4URK A;  5T3R A;  4XKB A;  1Z6T A;  4XE0 A;  3FUI A;  3S7J A;  3T5X A;  1DVP A;  3D9P A;  1EYH A;  1JPL A;  2PL2 A;  3VTX A;  1UW4 B;  4KVM A;  5G04 J;  3G2W A;  4TRQ A;  4OYS A;  4AV7 A;  4HFG A;  2AXU A;  2DCP A;  3C98 A;  4F53 A;  2PM7 A;  3HVE A;  3MZL B;  3PNL B;  1WM5 A;  3IHV A;  4B89 A;  4RSY A;  1HZ4 A;  2WMO A;  1H2V C;  2AWI A;  4G26 A;  3E4B A;  4GZ3 A;  4DI3 A;  3CVX A;  3GYZ A;  2YIN A;  3O4Z A;  4U0S A;  3QWV A;  1IQR A;  3GZ2 A;  2CHX A;  3HIZ A;  5DIZ A;  3CVW A;  2IF4 A;  4FLB A;  4ILG A;  2J49 A;  3LCA A;  4LER A;  3RRU A;  1E90 A;  2E0I A;  4NRH B;  4EBA G;  4FA6 A;  4LRZ A;  2J9Q A;  2NSZ A;  2XQ0 A;  3LVR E;  4NQ0 A;  5LCW J;  3B7U X;  3MX3 A;  3ML9 A;  1SZA A;  5LP0 A;  3MKQ B;  4JZY A;  3CHO A;  4WUY A;  1E96 B;  3SGH A;  5KJN A;  4GCO A;  3QK0 A;  3CKB A;  4EZK A;  1L5J A;  4I9E A;  4JA9 A;  2WPV A;  3P2B A;  3ASG A;  1JWG A;  1U3C A;  1IQU A;  2IOS A;  4FJY A;  4AP2 A;  5BV0 A;  5EKQ D;  2Q7F A;  3EHM A;  3FU3 A;  2VGX B;  4J8S A;  5A7D B;  4AVX A;  3B13 A;  2GRM A;  3IHY A;  3LJ3 A;  3QWW A;  4KMO A;  2Y4U A;  4K03 A;  3T5V A;  3ZRH A;  3EJN A;  3VLD A;  5CMW A;  1W3B A;  2HO1 A;  4FLH A;  1TEZ A;  1ELK A;  2KCL A;  2ILR A;  3QKY A;  4KVO A;  2PQR A;  3FUD A;  2PZI A;  5T8I A;  4JEH A;  3VTY A;  3APF A;  1SQM A;  4FJZ A;  4JW1 A;  3TJP A;  2AXZ A;  4AXH A;  3EIQ C;  4WWP A;  5ENN A;  4GA1 A;  4I6J A;  2L9B A;  3QOU A;  1NA0 A;  4BY6 A;  5LCW C;  4H7X A;  1BPO A;  1E8Y A;  2L0I A;  3LYA A;  1HG5 A;  3SZ7 A;  3G2S A;  2V8S E;  2X6J A;  3KS2 A;  4IRU A;  5AJD A;  3AS5 A;  3FTZ A;  2XCC A;  4ANW A;  4E85 A;  3ESL A;  4B0Z A;  2CG2 A;  5FQ7 A;  2RG8 A;  2WXO A;  4AOF A;  1GW6 A;  2HM8 A;  4Q94 A;  2FF4 A;  4I1O B;  2I9C A;  3DPD A;  3FH5 A;  3D9N A;  4UQY A;  4CT0 A;  3IV0 A;  5JJT A;  1E8W A;  4WAF A;  4JL0 A;  2C0M A;  2AW6 A;  2LAI A;  2PQN A;  2WMN A;  3NZS A;  3QB2 A;  4JPS A;  3ZW3 A;  3CVN A;  5FQ6 A;  3CVU A;  3FTS A;  4PS8 A;  1JWF A;  4N2Q A;  1HG2 A;  3CQG B;  3D9I A;  5HI7 A;  2WXI A;  4G2V A;  4AIF A;  3UPV A;  1TJC A;  5EX0 A;  5KCM A;  3D9L A;  4V3I A;  3EHN A;  1EF1 C;  4DLQ A;  4N39 A;  3URZ A;  3RKV A;  3I4G A;  4EZJ A;  4U63 A;  1WAO 1;  5ANR A;  1X5B A;  3ENE A;  4A55 A;  2WQ7 A;  4CDR A;  4DJA A;  3FUH A;  4D10 C;  4NAC A;  5E75 A;  1HH8 A;  2KZT A;  3OXG A;  4K0R A;  4TUU A;  2E2E A;  4PUC A;  3L54 A;  4C9B B;  4BT9 A;  4BTB A;  1ELR A;  5T4Y A;  3R7R A;  3PRZ A;  4A1G A;  1NA3 A;  3MA5 A;  4KYO B;  2Y4T A;  5JJ6 A;  2LAH A;  2WXJ A;  4N2S A;  2J08 A;  4B94 A;  4APO A;  2XPI A;  4DPR A;  5LFA A;  1ZU2 A;  4HOR A;  3QC1 A;  4WWN A;  4Q96 A;  5EX3 A;  4Y6W A;  3AU4 A;  1HX8 A;  3LVQ E;  2FBN A;  2WXP A;  3RO2 A;  2I6H A;  4A3T A;  2I1J A;  4KT6 B;  4GAA A;  4ME2 A;  3ULQ A;  2WXH A;  3UUX A;  3UQ3 A;  4BT8 A;  2KCK A;  4E6H A;  2IOL A;  2WM9 A;  4XI0 A;  4OVU A;  1OUV A;  4I6G A;  4Y6C A;  3SFZ A;  4DLO A;  5KJL A;  5M72 A;  3RRN B;  1QQE A;  4I1A A;  4PS7 A;  3OXF A;  1KLX A;  3ASF A;  4PH4 B;  1U3D A;  2XRY A;  3ZGQ A;  3PE4 A;  3SF4 A;  4GZC A;  4HS2 A;  4JA7 A;  4AEZ C;  5ARF A;  4JHR A;  4C0E A;  1H19 A;  4GA2 A;  5LX8 A;  5ARG A;  4F1S A;  3U9W A;  3QJZ A;  5CHE E;  5J08 A;  5JHB A;  4EEC A;  4FU3 A;  4LEU A;  3D9K A;  5FZS A;  4XZ4 A;  1HF8 A;  2IQC A;  3CGH A;  4J0U A;  3CSF A;  3HVE B;  3ZPJ A;  1WY6 A;  1KT1 A;  1UN9 A;  2BF0 X;  3PEV B;  3JYS A;  2UY1 A;  5D0O D;  2CHW A;  3Q5M A;  4G1T A;  3CLJ A;  1DNP A;  3CK7 A;  2MRI A;  3RU0 A;  1NP7 A;  3TXN A;  3AS4 A;  3PH0 C;  1OWO A;  2A4Z A;  4QFV A;  3JUI A;  3PZD A;  5C2Y A;  2Y3A A;  2OVB A;  4G23 A;  1XGW A;  3CR3 A;  3FUN A;  3JCK C;  4CDM A;  5FJY A;  4CCA A;  2V0P A;  4GCN A;  5AJL A;  3Q47 B;  1ZBP A;  2KM4 A;  3MYV A;  3L22 A;  1UJJ A;  3HHM A;  3SD5 A;  5FQ8 A;  5D0Q D;  3MGB A;  1KT0 A;  2DBA A;  5AEN A;  3LDZ A;  1HS6 A;  4BFR A;  1HXI A;  4ATG A;  2FI7 A;  2XPY A;  2OV8 A;  3CIA A;  3FFL A;  4W9R A;  4DI4 A;  2C0L A;  3LKU A;  4HOT A;  3ZYQ A;  2VSO E;  4WNF A;  4GYY A;  2BTD A;  4LCT A;  3NZU A;  4YVO A;  3CVV A;  3OAW A;  3CHR A;  2X3M A;  3CVL A;  2KCV A;  3PS6 A;  4JHJ A;  2DIW A;  3AU5 A;  3CHS A;  3FTX A;  3HDX A;  4IN3 B;  3RO3 A;  3N71 A;  2WQH A;  3PVL A;  3UT7 A;  4B8C B;  4GYO A;  5FZR A;  3U64 A;  1FCH A;  3B7T A;  3CKC A;  4XKC A;  3TGO A;  4WNG A;  3I4R B;  2C2L A;  1E7U A;  3PNT B;  4KZC A;  1OWP A;  4I9C A;  4CGW A;  3BG0 B;  2MOW A;  3QNK A;  4EPZ A;  3QAQ A;  2WB2 A;  1Z3Y A;  3JQ0 A;  2J4D A;  3VLF A;  2YHE A;  2M63 A;  3CK8 A;  3FU5 A;  2BUG A;  1E8Z A;  5KJM A;  4I43 A;  4OVV A;  4UWK A;  3FH8 A;  5JJ7 A;  2WVI A;  2IJG X;  2ZU6 B;  3U3W A;  3ZVV A;  4ANU A;  3Q49 B;  3FP3 A;  3CK9 A;  1PAQ A;  1PC2 A;  4R7L A;  3ZEF A;  2VSY A;  2XPZ A;  3CQC B;  1YA0 A;  3ONL A;  4UI9 C;  5FQ4 A;  3RIB A;  3G2T A;  4HVB A;  3R9A B;  3IBE A;  4L2L A;  3MV2 B;  4F3V A;  5FZQ A;  3R7Q A;  4A1S A;  1UG3 A;  4I17 A;  2OND A;  3ZXS A;  2VTB A;  5DBK A;  3ZYK A;  3FTW A;  1S0P A;  4ACK A;  4JHK A;  1XNF A;  4XI9 A;  5FTP A;  4M3O A;  4AY5 A;  2VJ8 A;  3O48 A;  2VTB B;  3UT4 A;  2J4B A;  3ZFW A;  2AXV A;  4MLP A;  4AJW A;  3WXX A;  3ZHE A;  2KZT B;  1QNF A;  5A6C A;  3MKR A;  2GW1 A;  2YHC A;  3RRM B;  5JHA A;  3LY8 A;  5G55 A;  4RG9 A;  1ELW A;  2CHZ A;  1E7V A;  3ZHE B;  5BT1 A;  2OVF A;  3L17 A;  3D9J A;  1Y8M A;  3FTV A;  1MHQ A;  2L0T B;  4GZD A;  4LUN U;  4JXT A;  4CT4 A;  2XGM A;  3PUJ A;  4ILI A;  3ZYL A;  2FEZ A;  2X38 A;  3CVP A;  3OTN A;  3CST A;  2WXN A;  1MQS A;  4B8A A;  4L7T A;  3FUJ A;  4I6E A;  5BUZ A;  4RVB A;  3ML8 A;  4FHJ A;  4J8E A;  3NQP A;  5EDS A;  3S7F A;  2P58 C;  3CV0 A;  3PEU B;  3D9O A;  4GB9 A;  1OWL A;  2ION A;  2V5F A;  2X6I A;  4I2W A;  4NUR A;  4Q69 A;  1H2U A;  3UX4 A;  4EBA A;  3QDN A;  2A5U A;  2YNQ A;  2I2O A;  3PDN A;  4FC8 A;  4G24 A;  1IYG A;  4UWG A;  4O6F A;  3TG4 A;  1H6K A;  3UMV A;  4YND A;  4JVS A;  3D3M A;  2OOE A;  5AYW D;  3S7D A;  2NC9 A;  1N52 A;  1B89 A;  2WXM A;  3APD A;  3CEQ A;  4H7Y A;  5G05 J;  3Q15 A;  2KC7 A;  3TAX A;  3UT8 A;  2WXG A;  3ZN3 A;  3L08 A;  1E8X A;  4ILH B;  3SNX A;  2R5S A;  3FUL A;  3MV3 B;  4I1M A;  4J8F A;  3LY7 A;  4CEM A;  4BWR A;  3QWP A;  2X6K A;  2R17 C;  3BG1 B;  1FVF A;  2QY7 A;  2WXQ A;  3SI5 A;  2GRL A;  4UQX A;  2CFZ A;  5KJK A;  1UJK A;  3FDH A;  3ONK A;  4GZ6 A;  1HE8 A;  5ANL A;  3LY9 A;  2UY1 B;  3MCX A;  3MJW A;  3T8M A;  2WXK A;  3U4T A;  2JLB A;  3FU0 A;  4IUL A;  4ACL A;  4GU5 A;  3P1U A;  4I2Z A;  4N3C A;  2KAT A;  4ANV A;  3CHQ A;  3OXL A;  3TG5 A;  3FUE A;  4U04 A;  2V4L A;  2VSX E;  2J07 A;  3CHP A;  3CVY A;  3SHF A;  2R59 A;  3KAE A;  3GZS A;  3FU6 A;  3MKQ A;  1HU3 A;  3HYM B;  4RG6 A;  2L6J A;  5CMY A;  5FT9 A;  4MRU A;  4N3A A;  2YQ8 A;  3FTU A;  2RD0 A;  4BTA A;  2WXR A;  2LNI A;  1HO8 A;  2HYZ A;  4YVQ C;  3PE3 A;  5G05 C;  3JQ1 A;  4UI9 J;  4C0M A;  4N5C A;  2GGF A;  3GW4 A;  3U66 A;  3GZ1 A;  2CFU A;  4FUL A;  2VGX A;  3RJV A;  1Y6I A;  3ZYM A;  2XGS A;  2IU1 A;  1H2T C;  2AVP A;  1H0A A;  3B7R L;  3FWV A;  1VDY A;  4J8D A;  4UWF A;  4WND A;  1LF8 A;  3AS8 A;  3ASD A;  5G04 C;  4G25 A;  1PY1 A;  3VLE A;  4KBQ A;  4A3V A;  4WWO A;  2NXP A;  2LO6 A;  4HOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...