4N3AA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (1-26)e10a
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3aA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3aA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3aA03
3QOUA 4CGVA 2J9QA 2FBNA 4X7PA 1C8LA 4EJ2A 1ELRA 1JIXA 4B94A 3ZHEB 4KQMA 2FEZA 3VTXA 3E4BA 1P2GA 3OTGA 4N3CA 5JTUA 2XEVA 4HORA 3CV3A 2SKCA 4H7XA 4APOA 4WNFA 3IA7A 3NPAA 4KQ1A 4HOUA 1XKXA 1NA3A 4XI0A 3TGOA 2HYZA 2XA1A 3COPA 4RIHA 3MT9A 4RIIA 2E2EA 4YI5A 4U0UA 2GT1A 2G9RA 3QWPA 2GPNA 1XOIA 2C2LA 2PQ6A 2VGYA 2AVPA 2GM9A 1A17A 2VGXA 2BUGA 1QM5A 1E96B 2LSVA 2F9FA 3LYAA 4GZ6A 4GZ3A 3CVPA 4MHSA 2FF5A 1FTWA 3QWVA 2PQNA 4YUAA 2OOEA 2IUYA 2VG8A 2VSYA 3BCUA 1IXYA 4HLNA 1WM5A 3VUEA 1Z62A 1K06A 2R68A 3Q15A 4O6FA 1WW3A 2KCLA 4GCNA 3MTAA 5GPBA 3OTHA 1P2BA 3CKBA 5FT9A 4RENA 4XIFA 3CEMA 3HYMB 2Q6VA 1F6DA 4A1SA 3Q49B 1V4VA 5ENZA 3WC4A 3FP3A 5EKQD 5FZSA 3UYKA 3RHZA 3CV0A 3L01A 4U0ZA 2LSUA 1JEJA 1P29A 3C4VA 2HR2A 4BTBA 2XA2A 3T3IA 3CUWA 1PN3A 2YJNA 1L7XA 2QLMA 2QRPA 3PE4A 2IF4A 3GZ1A 2GEJA 2G9QA 5TMEA 4I17A 5D01A 2XCUA 5A7DB 3MS4A 4YI3A 3O48A 1GFZA 3QKYA 4HOTA 1GPBA 4ME2A 3Q3IA 2PRIA 4F9FA 1F0KA 2JZCA 4AMGA 3MSCA 3ZCPA 3OKCA 2LNIA 3BEEA 3L7BA 4RBNA 3S29A 3MQFA 3RKVA 4N3AA 5IKOA 3CK7A 4MHOA 2QRMA 2I6HA 2O6LA 3NB0A 3T3DA 1O6CA 3TAXA 2X0EA 4NQ0A 2QN9A 4BTAA 1Y8MA 2IYAA 3WADA 5LQDA 3WXXA 2BGUA 1PNVA 3CVNA 4J8DA 3GYZA 3LY8A 2C1XA 2C4MA 2OFFA 3JYSA 1IIRA 1WUYA 1EXVA 2FF4A 4KXKB 4Y6WA 1KT0A 3S7DA 4Z5XA 2FFRA 2X6QA 3CEJA 1QQEA 3Q47B 3HBMA 3ASGA 2BISA 3H4TA 5KJMA 3QWWA 2FI7A 3ASFA 1FU8A 2GJ4A 2X6RA 1HZ4A 4CGWA 3NCHA 4GCOA 3OKPA 3NAZA 2R4UA 4XI9A 3WAGA 1NOIA 3DD1A 3ZCRA 3ZGQA 1E4OA 3FFLA 3QHPA 4BFCA 3UPVA 1HH8A 2ATIA 7GPBA 1ELWA 2BGTA 1OUVA 4MI9A 3D0QA 3SF4A 4CTOA 3HBNA 3MTBA 4BQEA 3CK8A 5KJKA 5G04J 3N71A 4I9CA 1NLMA 1B89A 5D0QD 2VCHA 5CCMA 5A6CA 4F97A 2JLBA 2QN7A 4G2VA 4M7PA 5DIZA 5BW8C 2IYFA 1C50A 4F3VA 1A8IA 2JJMA 3TG5A 2QRGA 3E3OA 5C1DA 4Y6CA 4FKZA 1H5UA 2C1ZA 2XGOA 2QN1A 4RIFA 3HBFA 4MRAA 4NRHB 1EM6A 1WUTA 2ACWA 2FO7A 3SYRA 3E3LA 3NP7A 4X7RA 3L7CA 1UZUA 3ULQA 1RRVA 4UQXA 2QNBA 3GUHA 1E1YA 1JG6A 3LCAA 3BD8A 2QFCA 4RELA 1SXPA 1HLFA 2GEKA 2DBAA 3H4IA 3DDSA 4J8EA 1P2DA 5EX3A 2KS6A 3G2JA 3KD7A 4G1TA 4BT9A 1J39A 4WADA 2G9VA 4GYWA 1Y6GA 1P4GA 1B4DA 2XMPA 3E3NA 2V5FA 1K08A 4X7MA 3PE3A 2XCIA 3ZCVA 4N39A 2ZB2A 1Z8DA 3T3GA 3OKAA 3SZ7A 2VCEA 4UQYA 2PZIA 2C0LA 3MRTA 4UI9J 4EKEA 1Z6QA 3URZA 3MTDA 2GPBA 3ESKA 5HQ8A 3OTIA 3QDNA 2R60A 3MRXA 2IV7A 1SXQA 1RZVA 1WAO1 3VUFA 2G9UA 3RJVA 3CX4A 1XNFA 3D1JA 3MBOA 1NOKA 4FZRA 5IKPA 4LEIA 5AYWD 3CK9A 1M5RA 3GPBA 1NOJA 2SKDA 3ZCSA 1YA6A 1NZNA 3CUUA 4GPBA 5TMDA 4HOSA 2KCVA 4G2TA 3ZPJA 3S28A 5FTPA 3AS5A 1GPAA 4N2SA 1VGVA 4ABNA 4WNEA 2KCKA 3ZCUA 1LWOA 1FTYA 2UY1B 2X0FA 3T3HA 3K9IA 4JA9A 1W3BA 3EBPA 4GPKA 4GYOA 3TG4A 1IHGA 3Q5MA 2QLLA 3BD7A 4WNDA 4N5CA 3RIBA 4IN3B 4U07A 1JG7A 1JIUA 4L22A 1PSWA 5G05C 2AV6A 3IEGA 9GPBA 4WHMA 3T7DA 1AHPA 1XL1A 2F3SA 5D0OD 4KQ2A 4CDRA 3L79A 4HWGA 2AMVA 3FROA 4JA7A 2QN3A 5JJ6A 4HOQA 1NVKA 1LWNA 3UUXA 5CHEE 1YGPA 2PQRA 4YNDA 2F3UA 4U0SA 3ZFWA 3VTYA 2F3QA 1FTQA 2GW1A 3ZN3A 4BT8A 1XL0A 1YA0A 6GPBA 1L5SA 3Q3HA 1HXIA 3MEKA 4EQFA 3Q3EA 3RO3A 1GG8A 2WQHA 2HY7A 3ASDA 4M60A 2L6JA 5FZQA 4F96A 5G04C 2YHCA 2Q7FA 4G25A 1XC7A 1NZDA 2IEIA 3G2IA 3RO2A 1WV1A 3IAAA 2H1HA 4WACA 4I9EA 4AM9A 1IYGA 2Y4UA 4GZ5A 3OT5A 3AMVA 1FU7A 5M72A 4UQZA 4NEQA 4BQFA 2MHKA 1Y6FA 4U04A 2VYIA 3ZCTA 2XCCA 3CKCA 4UI9K 2WTXA 5I45A 2ONDA 1C8KA 3DZCA 2ASVA 4QLBA 2QRQA 1P4HA 2QN2A 3PDNA 3G2KA 4WNGA 3S7FA 3HBJA 5DLDA 1FCHA 2PYIA 1Y8ZA 2AZDA 3CEQA 3OY7A 5TMBA 2PL2A 5DXFA 1P5QA 3U4TA 3CEHA 3OXFA 3CUTA 2XGMA 1P4JA 1BX3A 3T3EA 2IFUA 4G23A 3AS4A 3MKRA 5JTTA 4KYOB 3S27A 5D00A 1L5WA 5CCLA 2BFWA 4EL0A 4AN4A 3VDMA 2VQ2A 4G26A 3OXGA 5DBKA 3LY9A 2C0MA 2IV3A 4NC9A 3MT8A 2IEGA 3MA5A 1WV0A 3BCSA 3EBOA 3S2UA 3G2NA 1TJCA 3UYLA 1UQTA 3S7BA 4GA2A 4YVOA 3L7DA 1KTIA 1KT1A 2HO1A 3KAEA 5ARFA 4BQIA 1FU4A 3CVQA 1RZUA 2XCBA 3R9AB 3MV2B 4AY5A 3FWVA 5ARGA 2ACVA 3UQ3A 3ZHEA 1L6IA 3MRVA 4REMA 4M83A 3ASHA 4RIEA 4I2WA 3NF1A 3NC4A 3LPZA 4RG9A 1L5RA 3TOVA 5KJNA 3OY2A 4X6LA 5JJTA 3C48A 1WW2A 2QLNA 3BCRA 3T5TA 2KC7A 3L7AA 1L5QA 3S0JA 4G24A 3KS2A 2XA9A 1NA0A 4BWRA 1L5VA 5G05J 3LY7A 4EL5A 1GGNA 2WPVA 4KBQA 5FZRA 5KJLA 5LCWJ 2F3PA 3OXLA 3BD6A 3BDAA 3D0RA 4MI6A 3ZCQA 5EX0A 1GZ5A 1GPYA 3DDWA 3G2LA 2UY1A 4WUYA 2PRJA 1KLXA 4GA1A 1ZU2A 2VGXB 1FA9A 3AS8A 2YQ8A 4I1AA 4W6QA 1PC2A 1FS4A 1JIVA 3MV3B 1NZFA 1QZ2A 2P58C 4AY6A 4N3BA 2QRHA 5BT1A 5HI7A 4AIFA 4CTNA 4N2QA 2KATA 4CTMA 1PYGA 3CUYA 1UQUA 2XPIA 4YVQC 2X0DA 3RSZA 3RT1A 1ZBPA 5TVGA 4H7YA 2QN8A 4J8FA 3MS7A 4EKYA 4GA0A 2UWJG 4I2ZA 4MI3A 4NESA 3GW4A 3VDNB 3MT7A 2R5SA 3CUVA 4W9RA 2C9ZA 4PQGA 4MICA 3SYMA 2VSNA 2GPAA 3TSAA 2PYDA 1ABBA 1C3JA 5HXAA 2P6PA 2AW3A 4AMBA 4N9WA 5FJYA 1FC0A 2XGSA 5LCWC 3CVLA 2R4TA 3S7JA 2R66A 3O3CA 3RU0A 2IW1A 4RIGA 3RSCA 2QZSA 4JHRA 3LKUA 2ECPA 3MS2A 3GZ2A 3NP9A 3U3WA 2H1FA 2SKEA 5JJ7A 2Y4TA 1Z6PA 4J0UA 1QKJA 4RG6A 4JL0A 4LEUA 3EDTB 2FETA 4UI9C 1AXRA 3BEOA 3QKWA 5DU2A 4LDPA 1XV5A 3Q4AB 8GPBA 5BNWA 3G2HA 3C4QA 4GYYA 2NC9A
chains in the Genus database with same CATH superfamily
4MKHA 1Q5PA 2YWDA 1X7DA 2B5VA 3F1KA 1PK9A 4V2UA 5EE5B 2GM3A 1F8XA 3UMVA 3W4JA 2Y92A 4HXYA 4LV8B 1JIXA 2IHBA 2W4MA 4H1WA 4WXEA 4UNSA 5AXBA 1XVTA 2PM6A 1UDBA 2PGOA 4IOKA 4L6IA 3TLKA 8ATCA 2Z30A 2O8FB 4CV2A 3ZHOA 4IULA 3CN7A 2FI1A 1Z2AA 2O20A 2BCEA 2VF4X 3AUUA 3O03A 4X1YB 4L9RA 1F9EA 1AB6A 2XGGA 1HDXA 3M34A 4YALA 2FLKA 4LSZA 5H59A 3WV4A 1JXAA 4BNZA 1KGDA 1P2SA 2Y27A 1Z82A 3KOMA 3LUHA 1LPOA 3OX2A 4BUJA 2B35A 1KO4A 3G8AA 3V7NA 4ENVA 3I9FA 1HURA 3WHPA 3JQGA 3V4RA 3D6JA 2WUFA 4FEAA 2GT1A 4JBIA 4K26A 3TLYA 2Z6UA 1M0EA 3WMGA 2GYVA 4D02A 1I3NA 2W43A 3RKRA 3O26A 3GNQA 2VGXA 2P6OA 5F35A 2GKOA 1INLA 5JO9A 2VJLA 4CMGA 4BX2A 1BEEA 2VRWA 1ZJ5A 4PLGA 1T9GR 3D6TB 4CL8A 1QC5B 3BWCA 1MV8A 5HZKA 4HATA 4ZO7A 3UXGA 4BV8A 2QW8A 3BCUA 5DMXA 2DBYA 3IT3A 3K6KA 4EF4A 4ZREA 1G8SA 1QLJA 3RM3A 2C29D 2OV2A 3PUWA 1XZQA 1PJTA 2Q3BA 5T6MA 3VUEA 1K06A 5EWLB 4PLCA 3Q15A 1U0NA 1JR3E 3FUDA 1YHNA 3AHDA 3DCIA 1MIHA 3L6AA 1YL7A 2FOXA 3FZQA 1FT2A 4GCNA 4TLDA 4Z2YA 3ROQA 5DHTA 1P2BA 5EDSA 1XLWA 1UKCA 1H85A 2FFQA 2I6FA 1MX1A 1EDOA 1V96A 4JN6B 4QXAA 5LWHA 3B1XA 2Q6VA 2Q8NA 4HLCA 5JXHA 3BTSA 3B1WA 1T8TA 3C3AA 3WYBA 4RLQA 4FX5A 3ZNGA 4WY2A 3INYA 3LXXA 3J7AC 3MGKA 1KI9A 2J5QA 1KTVA 3DE0X 2A92A 5JVDA 4ERXA 4G5OA 4X24A 2P65A 3LBAA 3RSGA 1TM7E 4D9KA 2GGFA 3C3QA 1N9GB 1DARA 4YMWA 3PWKA 2Y6VA 4GR4A 1PV2A 3NBYC 4P80A 4H60A 2O1SA 4LGCA 1WCIB 4P6VF 1YR7A 5CH5A 3GLGE 4LMRA 2V1UA 4NCBA 5IMBA 5FBVB 3J5QB 2AC4A 1LTKA 1Y7IA 3K9HA 3KSRA 4A6DA 2NO6A 4OCZA 4GM0A 5HM6A 5JH7B 4RDHA 4WKCA 2FN8A 1LNSA 1DOZA 1GCAA 3F96A 3H7IA 5A7DB 3EBLA 4HF7A 5B3AA 4FBGA 4LJ6A 1MCZA 1GFZA 3VR0A 2WWFA 4PQRA 3ZOKA 2V5UA 4UPVA 3IAFA 3D9NA 1Q91A 4KUGA 4XOIA 5BT8A 2CDNA 1DAKA 3H18A 2PT6A 4I5EA 1RD4A 4Y1RB 2NU9B 1W9HA 4Z7QB 1A50B 2RFAA 1QYWA 3HWSA 1U7OA 3LF2A 3SD5A 3L7MA 3R3SA 1W9MA 4BQRA 4ALLA 3FHLA 3PZ1A 3TCXB 5K4GA 4UD6A 5KYTA 1GLGA 1BW9B 1MHPA 1P31A 3ASZA 3CK7A 4KYTA 1ZY2A 1DFHA 1XMQB 4BXOA 4PYIA 1ODKA 4FB4A 3ADDA 4GXQA 2QRMA 2CEKA 2X22A 3G7SA 3NBXX 1NC1A 2G6TA 4IDCA 4JIMA 3KR0A 3T0IA 4YMUA 5HQ3B 3DJYA 2TYSB 4YAOA 4ZHBA 3OOWA 3O2JA 4NBLA 1QMOE 3KQMA 1J8VA 1PNVA 2ZTSA 3JD0A 3H1AA 3MYYA 3OZDA 4CKBA 1R5JA 1BH6A 3ZW8A 5KHLB 2XMDA 1BFDA 3RTGA 2PHZA 3ISVA 1V7CA 1SURA 2PZJA 2B0JA 1QO9A 2VEOA 3HM2A 1MIOB 1DC4A 1U8CB 3P2JA 2PUHA 4C3UA 1BAPA 1RI4A 3ESQA 3NATA 1GGMA 3Q3VA 4FW9A 4L0CA 3TDKA 3OU2A 4M7WA 4OXIA 2X9LA 3O93A 4ZAWA 1J2YA 1YASA 3K32A 4XA8A 4E7OA 3CKMA 4HB5A 1USGA 3FTWA 4PX9A 4HPJB 1NVAA 2VWPA 1RWBA 1YVRA 1JDTA 3U3DA 3TW4A 1S9HA 5DTQA 2I2DA 3ZDBA 2Q1WA 3U44B 4CLOB 1P81A 4IIJB 1WIWA 1U6IA 2ZIVB 1U1GA 1WMBA 2EZTA 4H0FA 4MGYR 3ZJVA 3B1FA 1GFSA 2B1QA 3DT9A 1MNQA 2E0IA 2BY4A 2QLJA 4K5AB 1JZQA 4PO8A 3TOCA 1ODLA 1UK8A 5C5CA 1NJ6A 2PANA 4IUDS 5GONA 7GPBA 5CA1B 4EB6A 5K0SA 4O3MA 2WG1A 2WKSA 1OV6A 2GVNA 2QNRA 3BTOA 3JQGB 4J0CA 3JRXA 4YP1A 2PIAA 1FDVA 5KJEA 4EF6A 1FP1D 1CZHA 3HO6A 3QY0A 4II3A 3MUNA 4PG4A 1XMJA 2QD5A 3SKYA 3IMGA 1N8SA 1A98A 4IXTA 2OBMA 3QSYA 1X7XB 4EG4A 3NETA 3PI6A 4YJFA 2PUFA 1JALA 2D74A 2C3YA 2XWQA 4LCTA 3G79A 2EU8A 4QYSA 1WMAA 4C6TA 3ZK9A 3MCTA 4B75A 5J5VA 3L6EA 5ARCA 3QFHA 3IIEA 5J4KA 4R41A 3U1VA 1VMKA 1T2AA 1BGXT 2CKMA 1REQA 1WUTA 2ACWA 2BFOA 3FZNA 3O9MA 2P30A 3WYNA 1S1CA 5AJDA 5LDDC 3KSZO 1H6CA 4L74A 4N3GA 2FGJA 3D31A 3K9QO 5EINA 1FEZA 3U4MA 3SJZA 3D0KA 4JC5A 2ZJOA 3K2QA 4PIVA 4DLQA 3K9GA 4E15A 1F0PA 4E70A 3LCAA 5D86A 5LQRA 5J2TA 5FUYA 3ZD8A 4GGPA 4TXPA 4DNFA 2Q0SA 2X1LA 3FR7A 2ZUBA 3VAYA 3RYIA 4QTYA 2H6HA 2F62A 4Q1BA 4X5OA 2C4UA 2C42A 3EWSA 2E55A 5SZHB 1P1RA 4PZEA 4BJ6A 1OJ7A 5ES4B 1C4WA 3ONEA 4RC9A 3MIZA 3PVSA 2XNJA 5CH8A 1CS4C 2GWHA 2R8OA 3T99A 2WT4A 2F4NA 2YZ7A 2CNNA 1WMSA 3EW7A 2BUBA 1J2EA 5L7TA 3ANXA 2P6RA 5K09A 2AMLA 3R8CA 1W75A 1K08A 2DBZA 4WZAA 4G5XA 3UXEA 5EJ2A 1EVQA 1RAAA 4RAOA 4DXAA 1S01A 4HNGA 3OKAA 2VCEA 1FYXA 3OEED 5TS2A 4YPVA 1MVNA 1Q17A 4ZT3A 4D3SA 1XZEA 2XZDG 1QOPB 1E9AA 1TKRA 2WSSA 3AYZB 3MTDA 4V0LA 2YW9A 4M9RA 3B6JA 3GCXA 5K0BA 3NOOA 2EOAA 3FGPA 3DF7A 1TAGA 5JZSA 3WWZA 3VUFA 2WAMA 1G8HA 1FTSA 4FR0A 3VSAA 1NURA 3HACA 2N46A 5T3RA 3RGGA 4HS4A 4HG2A 2YXPX 1SVMA 3HXDA 5AYWD 3HI6A 3RS8A 1S3SA 3HGQA 4XGIA 4HQNA 1UMDA 2Y76A 3CRNA 2SKDA 1G7RA 1VYUA 4C7BA 4DLUA 5AQBA 2I2WA 2OGZA 4OSEA 4TSRA 2F1IA 4B7CA 5CYOA 4V3IA 2V7WA 1L4MA 3ZQUA 3ETGA 2GHRA 4XZ3A 5TV2A 2O7NA 1L5GB 4WNIA 1N6IA 4OK5A 4KTVE 3FCXA 2WXGA 1DIRA 2PLNA 5T64A 1MO2A 2ATCA 4MPDA 3Q5MA 1Y9DA 3CMCO 3DMHA 4P58A 2REOA 3WG9A 4H4CA 1THZA 1QRTA 4J8SA 2AFHE 3AF0A 4EA9A 4U07A 5HRAA 1EFPA 1Q0RA 3C1OA 4WK6A 5HFAA 4U8HA 3A9SA 2O2ZA 3AU5A 3AP1A 4Q4DA 3SZGA 1KSJA 3TEMA 1N5DA 4GM4A 2ZKLA 4MQMA 2D2EA 1QNLA 2C8LA 3UV6A 1G5TA 4ZOEA 3NHAA 2Q8PA 1GV0A 2E37A 3FPKA 3D1LA 3LM8A 3OT1B 5NULA 1JAYA 3TRJA 1M2JA 2AMVA 1RBYA 1A2KC 3FROA 3M89A 4DUIA 5TX7A 3TR0A 3W8EA 4AXXA 2JFNA 4OHZA 3ESDA 2AUTA 3NQPA 2VC2B 3BX1A 2QJRA 3LUPA 1AA6A 4H59A 1Z5ZA 5MFZA 1F38A 3FOWA 5CVCA 1NW5A 2IPNA 3V4ZA 2F3QA 5A3JA 1NFIE 2GW1A 1GUDA 2A1TR 1KIFA 5IDWA 4BYMA 1MO4A 1W1WA 3IQZA 4R9SA 4CEJB 2ISCA 3BWBA 3ASDA 3HP7A 3BXXA 4BMSA 3KYIB 5TVKA 3KPJA 2I2OA 2XYPA 4KQIA 1UZNA 3EIFA 4MWBA 5EE3A 4POOA 3VR2D 2HJHA 2P67A 3TXXA 3LZCA 1FFXB 2HA0A 1SIOA 3GXBA 3YASA 1USVA 2QHXA 3CRZA 3HFRA 1AX9A 1A5BB 1HE1C 4KIJA 2Q9BA 1IMOA 4UQZA 1CHNA 1SKYE 5JWHA 4QOFA 2VZEA 1KFJB 2WIGA 1M75A 3I5MA 4OHFA 4WINA 5SYNA 4NYIR 1KSGA 1B3RA 1GPLA 5LJIA 4X9XA 5JIBA 2BIFA 2B5WA 3FCSB 4FUTA 1O89A 1W4CA 5DRYA 1H0KA 2X5JO 3LI2A 2F1RA 2DR3A 3L0ZA 4QO7A 3W5SA 2AMFA 4BU0A 4AJJA 1F5SA 2QN2A 2QAJA 2Y1KA 4YRGA 4Q3OA 3G8CA 4NOJA 2WYUA 3S7FA 1SRQA 4H1HA 2XB4A 4AU1A 1XZIA 5ALZA 5JNVA 1YDEA 3RYFA 1PLLA 4UQOA 1E2FA 3RYTC 3G0BA 2R6FA 3FMGA 4FOTA 4JB0A 3ZHQA 3W2EA 5L51A 1GW6A 1S3GA 4RH3A 3MWYW 3CG4A 2QLTA 1IDOA 2W8BA 3K1YA 4RE6A 3NANA 1VKHA 5KX5F 2RGYA 1I36A 1SWWA 5HKKD 1SXJA 1NRXA 4FD2A 2MSCB 4KRYA 5KOYA 1M72A 1SUWA 3BSFA 3JWJA 2OBYA 3LHIA 3M6LA 3N59A 4FWBA 1UMKA 2CG3A 3A1TA 4RZIA 3V8MA 1WXXA 2E7ZA 4KI7A 2Q1SA 3CH5A 3KDPA 3WB9A 4C78A 3HXCA 1OQAA 2VK8A 2VT2A 1AXGA 3MT8A 4K28A 3X43A 5AVVA 3BIOA 1TQHA 2XT6A 4RA9A 5J4VA 5AOAA 1TJCA 3EYAA 1JLLB 1JDPA 2VDMB 5SZJA 1GZ4A 4F3KA 1I7DA 4F46A 2DWOA 3QMVA 1FNSA 4FK8A 1NNLA 4DCSA 5ARFA 2NTNA 2M63A 4OHWA 1FIUA 5FUWA 4QM6A 1E32A 3I5UA 3UTDA 5CA0B 3A28A 4DWOA 1T1EA 2FHPA 2OWEA 1UM8A 3DQPA 4KRGA 4EQ6A 1V9CA 4RPJA 5I47A 3THXB 3GLHA 4E08A 1NVTA 3KOUA 3LDFA 1TNUA 1PQ4A 5BUQA 1L4FA 3S8MA 1E5XA 3E9RA 5LFAA 3R5TA 4GVXA 2K6GA 2WHRA 3HHMA 3ASHA 1WJGA 2VDWA 4QC2A 1VSVA 4S12A 3PQ8A 3RUHA 4B4KA 3OZUA 1EP2B 2QTZA 2QZ9A 2W6OA 3AYXB 1OXSC 3OY2A 5AOXA 3B9RA 1XWWA 4OYSA 1GUAA 1ZISA 1ADGA 4LXYA 3T0GA 4KE6A 3ZJ5A 5F2NA 5K6RA 3FKJA 4QG3A 2YRFA 4CODB 1NMSA 2QY7A 4F7DA 2WP0A 1V8OA 3BGOS 3PIIA 4ROSA 1WHTB 4M54A 4O4IA 5C1PA 2D5CA 2HWUA 2XIJA 1J5EB 5C46F 2P40A 1VHQA 2VI5A 4KE7A 3TW0A 5BXQC 1WEHA 4LDQA 5IU6A 1K66A 2NQTA 5E2BA 2DZNA 3TPCA 1GGNA 4B76A 4YHHB 2O5VA 3GP3A 1FLVA 1NQOA 2NZYA 2VKQA 1AWCB 2C8KA 4IL5A 3D0RA 5CB0A 3ZHBA 2FFHA 3G2LA 3KEZA 4RETA 2VP0A 1RHMA 2UY1A 1K0UA 3QWFA 1G6OA 2VUSA 2IKSA 4GA1A 2GJ9A 3CGWA 1UBKS 5D51S 5AUPB 4A0GA 3HCFA 4RJKA 3HQ4O 1JQLB 4DCPA 2VA9A 4J0JA 2QUAA 3GAFA 4GWGA 1MV5A 4DNXA 3PX7A 1YFLA 4BIIA 4LYHA 3M82A 4BPBA 3M5CA 4FIZA 4GEGA 5KJCA 1XPUA 4HQLA 4KXYA 1WUHS 2GZ3A 4N3BA 4BL5A 1EPUA 2I3GA 2JGNA 3D6MA 4QU5A 2IY0C 2JASA 4AP5A 1Z74A 3KU1A 1YOBA 5ALOA 2AXVA 5J63A 4LRSB 4S1TA 1JU9A 2RC5A 1E79D 2VRCD 4MZXA 5AW5A 3U5TA 3Q87B 3DEFA 4OK6A 3B53X 5AK6A 2X0NA 1KZ4A 4GI1A 4X1YA 3RSZA 3RYHA 1EYZA 4LECA 3IQIX 3B3JA 1YTLA 1L7OA 3D2BA 3JYHA 1RLOA 3MS7A 4R6XA 3H0EA 3NV9A 1UT8A 2R8RA 2Q07A 5IWCA 3PRKE 2VJMB 3PEWA 3HJFA 3D4LA 2I1WA 4KLAA 4F04A 1NE7A 2ZI7A 4EVSA 3JXJA 2JB9A 1SB9A 3AZOA 3GRCA 4CG2A 2GPAA 4A10A 1NP7A 2PYDA 3PHHA 5EWMA 1NVEA 3QK7A 3EC2A 1KMCA 2GBLC 2D3TA 2O3QA 1TQ6A 5PGMA 3RWBA 3QKUA 4G0OA 4H3VA 2QDKA 4GE3A 3LS2A 4GPIB 1M73E 1X2EA 5SY9A 3R9WA 4UE3S 1QMPA 1SH7A 1D4FA 4G8DA 3ABOB 3SBSA 2QTNA 2RBEA 4HQKA 3TQHA 1H2BA 4JUCA 4BE9A 1RHUA 4LSGA 3MTIA 5CHEA 5B1IA 3ZGOA 4UUNA 4YRZA 1E8OB 4UOEA 1XTBA 3DTVA 3CF2A 3F2IA 1N3BA 3OT4A 5LQKA 4E4TA 3SM9A 1JI0A 3T61A 3UY4A 1OU4A 3SR4A 2DPMA 1T6ZA 3HVIA 4JQCA 4URWR 4B3RB 2WE7A 1RE0A 2R7AA 4ZOAA 4ZZ2A 3RAJA 5KNDA 3FOFC 5HG0A 2NTJA 3PDWA 1O94C 4GSYA 5EE9A 3O4RA 3ZWQA 1E2NA 4LFAB 1EFVB 1XU4A 2CB0A 3GIWA 5B36A 1YQEA 3BPSA 3JVIA 3TCKA 4B3CA 2BFEB 5CB8A 4AP2A 3DYBA 4IMJB 1DHTA 2J3EA 2O2IA 1GSOA 1XRLA 1Z5UA 4B94A 1VRWA 1K3UB 1I2AA 2ATXA 4TT3A 4AZVA 4ETWA 1OZFA 2I4IA 3UGTA 4IFTA 3AV0B 3IL2A 4AQYB 4AYWA 4MKIA 2V7QD 4WNCA 2HL6A 4S35A 1Y3HA 4OHVA 4UUPA 5LQUA 2IIQA 5KYYA 1J7JA 2BH9A 4C04A 3JQAA 4C0BA 4C4AA 4QGSA 3FTFA 4U8VD 4ENTA 2GRQB 2FQWA 2H7CA 3AF1A 3EGXA 4RGYA 4WK4B 4ZO8A 3R24A 5AI6A 2PWZA 2N3ZA 2W2PA 3AH8A 1RKQA 4Y2SA 2AHRA 5IF3A 3VO2A 1QGUB 3COPA 1QZZA 1U9YA 2EQAA 4YI5A 3FRHA 2BGIA 4U0UA 4ZDJA 2G9RA 4HRLA 1KOFA 2CFRA 2QVLA 2FUKA 4JVSB 1NMZA 1ZC4A 2PXCA 3G5MA 1E7RA 4FWIB 2QKYA 1RKXA 2A0FA 1S63A 2B9EA 3FNIA 2ZI6A 3H0CA 3U7HB 3I9LA 2JHFA 2QMQA 2X0RA 3Q85A 1WEKA 3V8QA 3NWBA 6CHYA 3LOPA 3KETA 5AQAA 2E9SA 2CF6A 4J1QA 1AKNA 3TKLA 1JZSA 3GJRA 4Q15A 1L7BA 4DB4A 2I1LA 1G5RA 1Z12A 5JD3A 4B48A 4Y3UA 2PUCA 4H4DA 2FWPA 4ILHB 3R8FA 4HUQB 2Y67A 4QQFA 3JWEA 4XJTA 3L05A 1KEEA 1PVVA 4DEVA 4B3TB 2IEYA 4U5XA 3ZHXA 2IEJA 1ODSA 1B15A 4NR0A 1R50A 5FI1B 4P2GA 4Y6SA 4ZAYA 4PPNA 2Y6UA 4QSHA 5LYJB 2YUIA 1IH8A 1RS0A 5BN4B 4AQDA 4B33A 1DCMA 2JAWA 5EMLA 3VU9A 1K8RA 2G3YA 3NG1A 2HIMA 1L4NA 2COEA 4O2BA 2BV3A 3FGOA 4DV0B 1B8PA 1TJ4A 1TEXA 4H6XA 3CB2A 3CV0A 4Z4CA 2ZS9A 2ZWOA 3ZS9A 1A9PA 1JEYA 3SX4A 4ZFNA 1KVSA 3D6VA 3V30A 3GB9A 3EIQC 3BHNA 1GPH1 4D45A 3I39X 1PN3A 1U65A 1U2DA 2XTJA 4QBHA 2V7BA 1TZ2A 4P0PB 2O5EA 4Z4GA 5T5QA 1P8AA 4BB9A 4CGZA 3VOTA 3C7DB 2V9CA 4BO5A 4B9EA 1E0DA 3SQVA 1MO3A 2QP3A 3B1ZA 5C8VA 4Z9XA 1AQLA 3BTUA 3CKKA 3NO4A 5JNLA 4AEZC 2HPAA 1SXJE 3EIUA 4N18A 1JEEA 2OP1A 4X8MA 3UC5A 4U2KA 3JATB 1E0KA 2YN4A 3HR7A 1VKJA 2H2AA 2YIMA 3LY5A 3QZUA 5FA8A 3HJRA 1RWOA 3QSGA 1KXZA 4TROA 1E59A 3NHZA 1CNMA 1X38A 3W4KA 1QP4A 3ELYA 4MVJP 2ZB7A 4RQTA 1M2FA 3OFJA 3TPFA 3T5VA 1GKUB 4QYXA 4TUYB 2R1ZA 3MG9A 1E1NA 4FI3F 5FFMA 2FRDA 3MN1A 3P5BA 3NB0A 5IZCA 1CUIA 4CEIA 4Q47A 3A3PA 4JYZA 4EZIA 2HJVA 4RCYA 5EUBA 5K9ZA 5KSPA 1QAOA 2GROB 4HTFB 1ZD8A 2EIME 1XZ8A 1MB2A 4QKQA 2BGUA 5JHAA 1P6UA 2H4XA 1E6LA 2ISQA 3NDIA 3R3UA 4N7BA 5HDQA 4WLEA 3K9FC 1IJEA 3QWAA 2XDQB 1CP3A 5DYGA 4B8YA 4EI7A 5BY2A 4BMNA 1GV1A 3N8KA 4KDEA 2WTNA 4DGQA 5SICE 1K8QA 4YAJA 1BO6A 1IY9A 5DNVA 1TF7A 2ZRBA 2XUHA 3EC1A 3INRA 3FUVA 3QXJA 4S1PA 2G9NA 4C4OA 1ZK1A 1C4XA 1MFZA 2VNHA 1IG0A 2YDXA 2G1UA 5I7FA 1EK6A 1QGAA 2ETXA 4FFDA 2FPMA 4AKGA 4PO1A 3ED5A 3L46A 3ND9A 5JCPA 1J8FA 1QHNA 2RHMA 3BRCA 2IHVA 1NJ8A 2BISA 1QH8A 2TECE 3BXFA 5JZBA 3CNLA 1W30A 5IBPA 4WDQA 2H5JA 4RPKA 1H8EA 2ZWAA 3OFSA 4Q03A 1X92A 3DB2A 1E1CA 2X0KA 3EZGA 4RHCA 2FI7A 1WA5A 1TIBA 2G0AA 2XUPA 1MO5A 4XQ0A 4EB0A 2VEDA 4G0MA 1CETA 4URZR 5HEKA 3Q3JB 1BMFA 4ZKDA 2Z2KA 3L6OO 4XQGA 1J9GA 1FS6A 3A1UA 3C7TA 4GOOD 4PLZA 3DR5A 1VP9A 4TZTA 1YR3A 3NAQA 2ATIA 4DLWA 5L6LB 2J85A 3LFUA 3IAM6 5F3WB 3L6CA 3V4OA 3USCS 4LYJA 1HSZA 4XE0A 1RI1A 1UH5A 2QRLA 3U26A 1JLKA 2RHWA 5G02A 5AJZA 1FNCA 3JQ7A 3KQTA 1Y8RB 2RG8A 3QBJA 2G4CA 1E9RA 3I45A 1NF9A 3SFZA 3MTBA 1JDUA 1HQDA 1QYRA 3TSWA 5IJ9B 3LX8A 2DQYA 2I71A 3O8QA 4GG1A 4G2VA 1V6CA 1UJNA 3F46A 1BS1A 4ZVRA 2IY7A 1A8IA 3KJQA 5DBOA 3A2MA 4MGHA 1Y8QB 3NRBA 3RS5A 5LMCA 1YL5A 5B30A 1I5EA 3QOXA 2HCRA 1SZJG 2CYCA 1V8BA 3HJCA 5K0LA 4CV1A 1J5PA 1K5DA 1UJ2A 2C4VA 2QN1A 2X2EA 4NACA 2UUOA 4Z6KA 4D26A 1DC5A 1KETA 4DS3A 4U4AA 1CRWG 5E2IA 3CCFA 3IELA 1C7QA 1YKFA 3TL6A 2J31A 3RK0A 2R5WA 2GRLA 4A8JA 1C9DB 1LK5A 2D62A 2JGRA 3A06A 4CM4A 4Q93A 3ZJUA 1TYAE 4TTQA 1OXKB 1NKTA 3I32A 3LU1A 2ETVA 1D1QA 3K8QA 1GAQA 3FAKA 4D9MA 3D5TA 4M9CA 3WGNA 2CLFB 4JP1A 2ZIGA 3DSVA 3UT4A 7ABPA 2Q8QA 1YIAA 3KB6A 4G1MB 1C7JA 5ILQA 2VSFA 1UMCA 4D4HA 5MN4A 1GRVA 1TPZA 1WABA 1WO8A 2WHYA 5KMGA 3R1IA 2XE7A 3UB4A 1U3VA 1CDOA 1RM5A 5FBZA 1VDMA 4JHJA 4LVUA 4DW8A 1QE3A 3Q8KA 4O2RA 3LCJA 3VDRA 1SB8A 4OH7A 4EPWA 2H8KA 3P2IA 3RTAA 1KOGA 1IXSB 3AKCA 4FU3A 3TLBA 1QPGA 2VDRB 4LYYA 2NYRA 2IOFK 4A6EA 5LYJF 1S2DA 2ZCUA 3N5CA 3PQCA 2WWGA 3G0IA 1I7NA 4HNAB 2A5EA 2NZJA 1RQ2A 4JLNA 4LBVA 5CVVA 1YRYE 4J07A 1C0LA 4UHHA 3QUSA 4QXOA 4JBGA 2L69A 1V39A 2ZE8A 2HBQA 4YRBA 2UZ4A 1PFGA 1ST2A 1LW6E 2F1OA 2IO2C 2WIBA 3C6KA 3CT6A 2IYZA 2QE6A 1QTIA 1E3QA 4BFVA 5BSGA 5G0WA 3HY6A 3HHEA 4R81A 2O2JA 1M5RA 2FW7A 3E3MA 2ZIWB 3FU6A 3JQ8B 1WOYA 3PCXA 4IWXA 3T1QA 1QSGA 1DO2A 3EN0A 4IIVA 1QZXA 1G19A 5TMDA 4E09A 3OZBA 1H0AA 1M2OA 1QGOA 4OAOA 1BOFA 4KQWA 1I0LA 3HVJA 4OXNA 5B3JC 4CF7A 5AVQA 5JALA 3N75A 4GQBA 4MQEA 4LI0A 1HYGA 2Q5LA 5FO1A 1HE8B 4KEAA 4ZV7A 2VHQA 4NICA 1ESCA 3SSAA 1BHJA 3MZLB 2HOQA 4YR9A 2ZRIA 4ZEMA 1C9YA 3HXEA 1AU9A 2XH8A 5T3YA 4KNYA 3FUUA 2RI0A 1PSWA 4FJZA 5G05C 2C3PA 4HY3A 1IN4A 2I80A 4OLHA 4EJSB 4TTRA 2JGKA 1YC2A 2MSKA 4AIRA 3WGZA 4DQDA 5TS3A 3UAGA 4JJ4A 2F0YA 4TMKA 4AZWA 1VSQA 4BU1A 2PMKA 3GFQA 4CDRA 1E1CB 1PBNA 2FSVC 3WK5A 4AY3A 4JA7A 2Q7XA 4E5NA 3D6HA 5DW3A 2ZAOA 1K0FA 1J25A 1DTEA 4E2FA 3PSAA 1GJRA 3ZHRA 2P0YA 2PKQO 4YP7A 4J90A 2WJ4A 3AWDA 4U0SA 4AKTA 4UPEA 2HF7A 5KYGA 2P5YA 4JK3A 3AY7A 3VO9A 2GD2A 2H4WA 4KQFA 5DNYB 3D9KA 3B20A 4UM7A 2QAGC 4ISCA 5JH7F 1RZRD 2OBXA 5FBHA 1WXEA 3TR6A 4LJRA 3IKTA 3GEGA 3RBVA 1N9ZA 1IE3A 1PD0A 1O96B 4GECA 4V0NA 3FWKA 3MTGA 5AUQA 2O0MA 3SJCA 1T5LA 4EYEA 1FNMA 2ZSBA 4CT4B 3KLOA 4OMDA 4B74A 4BLVA 1BNCA 2Y4UA 4GZ5A 1P61B 1DFIA 2SECE 3AMVA 4XFDA 4ZQEA 2W7TA 4JH0A 5IJ9A 3GEHA 5H5JA 3OZEA 2DHQA 3QUBA 2VT7A 1E5LA 3CVYA 1GYPA 1YCHA 3UIEA 3IUYA 4US0R 4G5QA 1PGJA 3DGEC 5EQDA 5FWDA 3G9XA 4OAUC 1SO8A 3B7GA 3LWBA 3LECA 2J7KA 5B53A 3THSA 2PGAA 4J6FA 5FUVA 3ZCTA 4PGFA 4W5TA 4UKDA 2NWQA 3W3AD 3KPVA 1KFEB 5E1MA 4JI6B 4D74A 3RD5A 4FGSA 3AETA 3UWSA 3LCRA 1CQXA 5KNCA 1OBFO 5UKDA 4ZN6A 5LP6C 5JBQA 2LVBA 3QUQA 4TWBA 1O2DA 1E8XA 4YRMA 2FR1A 4FWTA 1Y8ZA 1Z34A 2PL2A 3HPQA 4LVNA 1QO0D 4RDCA 3A4MA 2OXIA 4LTNA 5JLJA 3GJXC 4HAYA 5K0ZA 1AZLA 2OHFA 4X3OA 2VHUA 4U7EB 4Q00A 1FZTA 1Z0FA 5HS6A 3I61A 3UX4A 1NYRA 3HMQA 1XCPA 1TE2A 4RW0A 1Z5PA 2PM8A 1LS1A 2ZSIA 3DP7A 5DYYA 3FUXA 4F4DA 8ABPA 1X81A 3WNCA 2HEGA 3OXGA 2FLVA 5T7BA 3IAS6 1GU1A 4AUNA 3DXFA 5HFJA 1KY2A 5JG7A 3HEAA 5JEDA 1Y1QA 3WKBA 1KZPA 2VJNA 4B82A 4V1CB 2Z6AA 1JDJA 1PX0A 2BM9A 5ALFA 1I3LA 2JAHA 4MP3A 5DGTA 4NCAA 3RAGA 1TA0A 1CZNA 5DRTA 2ZU0C 3TEJA 1L5ZA 1H6BA 1UBEA 4IHJF 5F73A 5JVDB 4AIIA 5BPHA 5A7HA 4CQMB 2DETA 5DBGA 1G6Q1 5ERGB 3NUZA 4ZK6A 1G20E 2DTXA 2QGNA 4EMTA 2FFJA 3ZDZB 4F1JA 4C4XA 3S1AB 3PKZA 2P9UG 3UQ3A 2BHLA 3NYIA 4FT2A 4LPKA 4B4OA 4EW6A 4GTPA 3PLRA 1EXNA 2OC9A 1XKTA 2CUTA 2TMGA 4ABYA 3KKKA 2HSEA 1IKND 1K4KA 2O7SA 2REQB 3MGAA 1GT91 1QK5A 3HUEA 3SSNA 4MHTA 1N33B 3QWHA 1JG3A 2AOUA 1NI5A 5C3UA 1G64A 4S2EA 1JU3A 4CI0B 1OHHD 3FFAA 1RYMA 2J0VA 4IRMA 2KC7A 3EVGA 1N2CA 5FF9A 3SLGA 1J70A 4S0ZA 3GJYA 3Q8LA 1IZZA 1N5KA 1X77A 3AQIA 3RRMA 1EBUA 1NU6A 2CLOB 4EVIA 3C2QA 4MYDA 4PPQA 2DLNA 3EHNA 2PH7A 2C2BA 3FI0A 3FNGA 4XGQA 2F3PA 4JELA 3V1NA 1HNZB 1LD7A 1TC2A 2YJZA 1X9IA 3PBKA 5LZ4A 3GLGB 5EX0A 1S2OA 2X6TA 2B8JA 3Q9LA 2BMEA 4QYIA 3TSOA 2JG3A 4U96D 4CU5A 3BFPA 2PRJA 3ZNNA 4JJGA 1KLXA 1GYRA 3SCZA 2G07A 4DMCA 1HEUA 3WLEA 3KTOA 3HDVA 1E4EA 3VSCA 4E4RA 1FJ2A 3REFA 3GMTA 3NYRA 3R7WA 4NNOA 4RVHA 1RACA 4KN5A 3UT0A 4LJ4A 5CCXA 3QQPA 4TYYA 1JNXX 1Z28A 1Z2OX 4X97A 3X2FA 1WKCA 1AKVA 3FRJA 1NZFA 1AQUA 1RKBA 2Z5GA 5JQGA 1FPPA 2IA5A 4L9PA 2JIOA 2VCYA 4IJKA 4OSOA 1GNTA 3O91A 2JATA 4W7SA 4GW3A 5BT1A 1FYWA 3CT4A 1CQWA 3PENA 2GCEA 5DJ5A 3PJGA 3OCYA 2HU2A 3K92A 3AONB 5B2EA 2HMSA 2FJ0A 4QUDA 2OOSA 3ZDDA 4LA4A 5FXMA 4AOFA 3A4LA 4EY8A 3UK2A 4J1TC 4GA0A 4FN5A 4WN9B 3GW4A 4HV4A 4L73A 2QM3A 3WMEA 2R5SA 3LSTA 1RAGA 2ZBRA 4ZKEA 3KJNA 1NQWA 5GJCA 2ZIRA 4PQGA 4ZFHA 1PR2A 4XM1A 3M5PA 1LZKA 4M1YA 4I4CA 1TJPB 5FJYA 2R4TA 3QVWA 3U39A 3S7JA 5FWYA 2BR3A 1UBCA 2ZQ5A 4J6IA 3LO8A 2WWIA 2KW5A 1P2FA 3DGFC 2QZSA 1WBJB 2YNMC 2ECPA 3IOCA 3C43A 2IW3A 3NP9A 1MN6A 4N0DA 1Z4NA 1HNNA 4OYHA 2P9CA 4E5YA 1A82A 1MGPA 5TNXA 5FTMA 1AKEA 1HMPA 4QQ8A 5TDHA 3JSXA 3TR5A 4KX5A 1EGVB 3B6EA 4HS2A 2P78A 5BSUA 3PDCA 4B45A 4E5DA 1R8XA 1YDGA 1L7MA 4DPLA 5AVXA 3IP8A 1X1DA 2D2FA 3UAOA 2WTBA 3ESXA 3JALB 2PMWB 3P52A 1SNYA 2FW0A 3DYIA 4PRKA 4M1MA 1JDNA 4RNCA 1MAAA 4N6OA 4EMSA 8GPBA 2WUGA 3CX6A 4A6PA 2UU9B 2AUMA 3PDIB 4QGGA 2JPDA 1IAQA 1PK7A 2YJ4A 3DFMA 3NNNA 3Q98A 4IHJA 4IIFA 4BBZA 1DIBA 2MINB 4Q3EA 1C80A 4P3XA 5T3UA 4BQQA 2IP2A 1XP8A 2HJ9A 2NUPA 4EZJA 3P45A 2HFJA 4MS4B 4N8EA 3UENA 1M8KA 1UBRS 2W6QA 4BOYA 9LDTA 2N47A 3RAPR 2J6CA 3SF8A 1CJCA 1CNFA 4TSFA 1XJWA 4B46A 4KR3A 3RYHB 1YKSA 3DKKA 3H2GA 4HORA 1YA4A 2PUJA 3P9ZA 3UKDA 2MTBA 2C5BA 3JZMA 3EVBA 1TJNA 3O8LA 5HYVA 4TYPA 5D3KA 2XB6A 3TKAA 3OE1A 4COKA 4DN6A 2OYCA 2HW8A 1OLUB 2FCRA 3DZ8A 4YV2A 4AS3A 3IFSA 4YLGA 4UULA 4OYLA 4XB1A 3KVYA 2BZ0A 4RIHA 2WFLA 2H31A 3W9FA 4LFBB 4CI9A 1CVIA 2ONCA 3A0RB 2LCFA 5JAMA 4JXXA 1ODJA 2EGHA 5FHRA 3BREA 2CHUA 4Q1CA 5CJPA 1F51E 2JNWA 1Z7WA 2PZ8A 1NRIA 2FPXA 5DE3A 1KZOA 3UWPA 4D79A 4YJ3B 1JFLA 2Z2XA 2ZRFA 3AJ8A 4JQOA 2JEZA 3DTVB 4GZ6A 5LMNB 3A11A 4RK1A 3WRYC 3DPIA 4MQFA 3RSOA 2WZQA 2FF5A 3NHLA 3TTWA 5HKBA 1O95A 4P54A 1T1JA 2IYTA 4QULA 4PLFA 3BBLA 5LA6F 3S7TA 4LC0A 2V6FA 3EXG1 2XB9A 1YB1A 1U9ZA 2EBWA 3A14A 4L07A 4NZZA 4JYCA 5E1BA 3W8FA 1Z4QA 4ZVKA 4HWKA 1AGRA 4ZI5A 3B7UX 3V3KA 2H5LA 5TF4A 4D96A 2QD2A 4N47A 4ZYTA 5I01A 3BUSA 2ZDQA 1YB7A 3VX3A 4L6CA 1RXEA 2FE4A 1QRUA 4MV5A 2GK4A 1RFGE 3AR8A 4QBKA 4UBLA 2QBYA 1HC7A 4UYJA 2LO6A 5FO0A 1OZAA 2E21A 4OF4A 4PQYA 3I72A 1ESDA 1G8FA 5AW1A 3HU3A 1ZK0A 4K8RB 3WLSA 3DPYA 5K4HA 3HVRA 3RAFC 3ZY2A 1QHIA 5ENZA 2OLKA 1A88A 3PR1A 2W58A 1VOTA 2EQXA 3JQ1A 3NWOA 1YSCA 3K1AB 1L7PA 3H9JA 2SNIE 4I1UA 2MWMA 4FMCF 1U99A 4EB3A 1V5FA 5IAJA 5C5DA 3M4XA 4Y0AA 3NHWA 5BYJA 2PUVA 2OUIA 5CCBA 4A1GA 4K2AA 3SOPA 2X0JA 4B81A 2FZWA 2UXDB 4G8CA 3CC8A 3REQB 3IE1A 3HCWA 1S8FA 3AJRA 5BP7A 1N2CE 2QRPA 3PITA 4B0ZA 4OTZA 4BNWA 2C2ZA 4XEHA 1VHTA 1FP2A 2RAVA 1R6XA 4MWZA 4UHFA 4O1HA 1JN0A 2OO7A 4I9UA 3QU5A 1JEQB 2Z4TA 3RS0A 1PKXA 3GRFA 5DGHA 3M6IA 2VTEA 2EJCA 3DUFA 4AMGA 4BCDA 4PYNA 3PQEA 3JASA 3O4ZA 1EWTA 1PEKE 4ACAA 5IXYA 3PHLA 2IU0A 3UJBA 4I6GA 1XNQB 3BTVA 5EKDA 3HBAA 1AS3A 4YX9A 1BE1A 1TIKA 1U6KA 4LNUD 1MXHA 3G9QA 2JAXA 2Q28A 1BRMA 1PEYA 3M6WA 4QFBA 4TMFA 4XOUA 2C04A 2J6HA 4MO9A 1ULBA 1H69A 3CVVA 4EY4A 3MMNA 5CFNA 4BNJA 4D8YA 4NQ0A 4RGQA 3ESRA 1NVMB 2WE8A 3HUDA 3RJ9A 3WXXA 1TLLA 3HVHA 3ONNA 3WRXC 5CXQA 2C5EA 2XDYA 4PBSA 4DCTA 1XZAA 2D5AA 2NTYC 3JQRA 3KJHA 3ESYA 3NLLA 1XEXB 5BUZA 2NO7A 3VR5H 2GFHA 2E82A 4ALJA 1D6NA 2RK4A 2CG2A 1QOZA 1ZOPA 3WRXA 1DKQA 3PNQA 3ZWCA 1JKJB 3AGPA 4Q4HA 3SS7X 4CKCB 4CN8A 3FMOB 1NVDA 3SC4A 5AK4A 1W4LA 3TWWA 3QB2A 2OBBA 1NVVR 2B99A 4FGJA 5LNK6 1N2BA 2C03A 2O7RA 4QUBA 4OG2A 1NTRA 1Q1GA 1ZUNA 4IXWA 1W0JD 3ASFA 1P1JA 4G89A 2GJ4A 4MULA 4XD2A 1V3TA 2J1LA 4Q82A 5A9RA 1FJHA 4WNAB 1GTJ1 2GCOB 4F5DA 4MR7B 2ECFA 2HWXA 2IZ0A 5JSYA 2G06A 3GH3A 2RB4A 2L82A 3IUBA 3O38A 4MR9A 3W6PA 4DIMA 3NWJA 3ZU6A 1XLUA 1XZPA 4LQ4A 1W85B 4ACKA 3RWOA 2XYRA 1HH8A 2I6SA 3W9BA 5DNCA 3WVNA 4UM9B 3CB4A 1MVOA 1IUPA 3KS9A 3KQPA 3CQCB 4NNPA 1Z7EA 3UHOA 2HA5A 2FMKA 2HQRA 3GLTA 1RHJA 1EFAA 1CUHA 1GQFA 3L6BA 2QMEA 1NLYA 3OD5A 1GPMA 1A5EA 1H3FA 1FW8A 2Y9PB 5D7BA 5CCMA 1VSUA 2E4XA 2BHRA 1D1SA 2CJYA 1GTG1 2WINI 3IH5A 3L92A 3NEAA 4OMFG 1C50A 1KDTA 1LDBA 2BGNA 4WX2B 1G9TA 5EMHA 3AHGA 1F1JA 2HD4A 3KBOA 2ZVQX 2IEZA 3WQBA 1GY8A 2GKSA 3NOQA 4GNKA 4O02B 4OI4A 5D5PA 3BGSA 5AAOA 2VF2A 4ZHQA 1CJTC 2EILE 1GZUA 4QOHA 2J49A 3I1YA 4IG9A 2IYQA 4BFUA 1OROA 4EUKA 4AUEA 5GTDA 4KVFA 2ENUA 5IFLA 2QX7A 2JDID 1LEHA 1H5NA 2N42A 1U2GC 1WP9A 4UQXA 2IYUA 4MV7A 2X6JA 1A9QA 5MGBA 3FPHA 4TT3D 1PT9A 2OXCA 4RELA 1DBSA 1SQ5A 2YHIB 2AWOA 2J9ZB 2BONA 3I37X 3PHJA 4KN6A 2XWJI 4RK0A 4XWKA 2I66A 3L2OB 5IF9A 3U3JA 3KEFA 3QFCA 2UVPB 1GPJA 3VTZA 2GNAA 2XTNA 2DPGA 3P9RA 4MRSA 4AP9A 4ANUA 1KDZA 3FVWA 3T5GA 1P4GA 4ZIRB 1HKHA 4NU8X 2B83A 3PR3A 5A02A 4R40A 4ZPXA 2HH9A 2CD7A 3AOEC 4XLZA 5KNDD 4JCCA 1SCUB 4IHKA 4F1WA 4X7MA 5K3BA 1P7CA 2B7CA 2Z3WA 1TM5E 1PFYA 4EUNA 2GM5A 1ENOA 3PYMA 5B58T 4CEHA 5JS6A 3MRTA 2QMOA 1G42A 4TTJA 5C0OE 4D3ZA 5TGTA 4TS9A 4MKZA 4BJ3A 4ESHA 4KXXA 5K6TA 1LDYA 2O2XA 4RSHA 2IKQA 3KSAC 1K92A 4NJOA 3G1WA 2HHAA 4YPFA 1H0RA 3ZQKA 3WGQA 3N53A 3MJDA 3O8BA 3Q73A 1TK3A 3ZRHA 2GN2A 3GG9A 1BKYA 3U7RA 3ZDXB 1D8DA 4RZSA 4DPKA 3UI2A 2G70A 4IILA 4PH4B 3CF6R 1SBHA 3JVUA 4U3JA 3PF8A 5LVAA 1O5OA 1SZCA 3MGGA 4QO8A 4ILEA 4H3SA 4PGHA 2RGDA 2WHPB 2I29A 2YY7A 3H87A 2RFMA 4JQSA 5FQNA 5TQVA 4ADSG 1IDN1 4L2IB 4WN3A 1ZVMA 4TSKA 1NZNA 1YA6A 1CWUA 1X1RA 2O2GA 1J0CA 2HC9A 4A0SA 3OQJA 1QU3A 3WDMA 2C57A 1US8A 1XEWY 3C7AA 2P41A 1KKUA 4EHAA 4ABNA 2NV2B 4RX1A 3EGDB 4UBOA 2IYNA 5C4GB 2AMJA 3ZOZA 2UY1B 4LGMA 1CQIB 4EUEA 1W3BA 3NEPX 4HDCA 3UTCA 2PXHA 4GYOA 5I5GA 5ALNA 1KYIA 3DD5A 3ZI7A 1ZNQO 3FUCA 2DWZA 4NDZA 3JQEA 3OQOA 1E6WA 3BAZA 4WOBA 1GTVA 1HH4A 1SIUA 2HMAA 1JF8A 2EJTA 5G4KA 4C9BA 4B8AA 2PA3A 1E3EA 2WZDA 2HHCA 2YFKA 2JI7A 1Y6QA 1PRYA 4XPZA 3DBVO 5IX8A 4MX8A 5K0GA 4WHMA 1JJFA 4KGZA 4W63A 3V6LA 1ULAA 2OG2A 3TTYA 3FNRA 4ZCQA 1QMGA 2SICE 5I9IA 4C0QC 2JAPA 4JQZA 4NZOA 2PKEA 4TYQA 5CFMA 2GCOA 2GD6A 1Z33A 1GNRA 2PXAA 4P3KA 5AVOA 5ICEA 2VF5X 3FOAA 3I5AA 3KZCA 1II9A 4L9SA 4D4LA 1QCDA 5EEGA 2V8SE 1FTQA 1U90A 2IYLD 1RJEA 3BERA 3ZN3A 1XL0A 3H1PA 3WGLA 5AVWA 1VI6A 5EP4A 1ZOLA 2YASA 2Q3DA 4Z0PA 1JIIA 3OOSA 4EB6B 3A6GA 1A7AA 2EKLA 2DCUA 2V7VA 5C1BA 1QE0A 4UBNA 4F6LA 3L4JA 4M1EA 1WPXA 1LX7A 5BV2P 4I4LA 2ADOA 4OGGA 4I9EA 3OE7D 1X7XA 3K70C 2KQUA 5LA6A 4Q1FA 4ALMA 1JSCA 3DHNA 3LCMA 5TGZA 4PG6A 1WSAA 3MLEA 4B84A 5EJEA 5KYUB 5HJ2A 1K88A 4NEQA 4NE2A 4ARZB 3E0XA 3WNVA 2EW2A 3W7BA 2QWXA 1Q50A 4A92A 4EPTA 2VYIA 1AQYA 3AUAA 1UEJA 1UM9A 2WICA 2P3OA 4R5HA 1QJ4A 2RJOA 5AK3A 1FUUA 2WTXA 1ZJJA 3U80A 5I45A 1QYXA 3ADKA 1SXQA 3GLFA 4GDFA 1X80A 5REQA 4YJ2A 2JGDB 2GCPA 4KFUA 1PHRA 3EIEA 4WNGA 1I7LA 3LIPA 1UAYA 1P2TA 3VAZA 3WKDA 4E88A 5THKA 2PYIA 1C7FA 4P4GA 1YCSB 2AG6A 4GAAA 1AIPA 1P75A 3NVAA 3UAZA 2VL7A 1DQZA 4ZOLF 4P86A 3T1YB 1KDPA 2RK6A 3CBGA 3UMRA 1UJRA 1LV7A 4G9EA 2H1CA 2Y1LE 3TOSA 2GRUA 1HS6A 1G8AA 2RIRA 2R85A 2ZUSA 4HYTA 3RUAA 2X15A 3TM5A 5JROA 2HMVA 2WNSA 1J49A 2ILVA 5JTTA 3MKRA 5EIBE 4IXDA 3RIGA 1QF7A 2DQSA 2YOHA 4O2LA 4EKDA 4MVJF 2VP4A 1X70A 2BI7A 3LBFA 4WKBA 3RREA 5LQCA 4NS4A 3VHLB 2FRXA 1NFRA 4G84A 3UK7A 1E0JA 1EDBA 3ENWA 4HZGA 4OM7A 2W8BB 3PFCA 3WIBA 5COQA 1Q22A 4KAFA 1WVIA 4ITVA 2EG9A 2AXUA 4ZEWA 3DV9A 3BMCB 2YXLA 3I52A 5GADl 1Z4OA 4DTCA 1DXQA 2B0CA 1DP4A 3E34A 4D92A 1XQXA 4EHHA 4GA2A 1JDVA 1QS0A 2G1AA 3D6AA 3ROXA 2HO1A 1B76A 1ZNWA 1K5HA 1ONOA 3P9CA 1TCAA 4IDQA 4R16A 4RA9B 3GELA 4MUHA 3UEOA 1PKEA 4IF6A 2GVZC 3RJMA 2OVBA 1ZI8A 1RTTA 3V8NA 1ZJZA 1EJBA 3UZUA 1RCTE 4K9PA 3ZJ4A 1XO1A 1XQ1A 3L7OA 4R71A 4E14A 1HL7A 4LWZA 4M83A 2QSZA 3BXGA 2XHZA 3DWEX 5JJBA 1CT9A 3LYLA 5K4AA 4EOGA 2FPLA 1H0HA 3HVEA 5EZSA 1ZI9A 3GEMA 3D9MA 3GMDA 3MWEA 1B74A 4L3OA 5IAAA 1MAWA 1YS1X 4C0JA 2R1VA 4CKXA 2Z8ZA 4UOQA 3HCRA 4FCTA 1ZHFA 3FRIA 3S0JA 4ZDIA 3MAJA 2C59A 4LJAA 5F7JA 1OYWA 3RSQA 2YV1A 4XVCA 3PG5A 5JYDA 1MAHA 1N9KA 1Q1NA 2OEVA 4PDXA 2R6R1 3MLAA 5A5GA 4ZOLA 4E03A 2NM0A 3WI7A 2GF9A 2P7HA 4A82A 2WPVA 3JVEA 3T9CA 3ZI0A 4TM7A 5JXWA 4XR9A 1O6BA 1P6QA 1VG9B 1C14A 3HXBA 3Q9NA 1J07A 5FWQA 2EIJE 3QAQA 3K0CA 4DM4A 5JQGB 5K2OA 3NTRA 4MDHA 1ZIXA 5E7JA 3P2OA 4BFZA 3F6YA 4C4RA 2KBFA 5LP6A 5AIBA 3JALA 1SUBA 2BF7A 4UM9D 4W6QA 2KLHA 3I2JA 4MA4A 4KR7A 1AS0A 4P53A 4KO8A 4PZYA 1FS4A 4NI5A 3USES 3DPDA 4D7AA 1Y8CA 3DMTA 1KEZA 3F6EX 3SK0A 2RH9B 1QZ2A 1E92A 1BCSA 1LBHA 4TUYF 3DG9A 1RZRA 3UWKA 2OORA 2KBXA 3FJOA 5ALTA 2Y1FA 5BN5B 3H9UA 4O0MA 1TW2A 3A8TA 2Q6LA 5CYFA 1PGOA 1HZZC 3P1JA 4M53A 5IT5A 4ZVUA 1AJEA 1G7TA 2BI8A 2PJRA 1VC2A 4J0EA 1BA3A 5IAOA 2K87A 3WX0A 5B6PA 5SV2A 4KPGA 1XEWX 3MYVA 5FBKA 1U2ZA 1VJRA 2J9RA 1Y4AE 4MI3A 4KR0A 3KG2A 2H59A 2VF7A 2A7QA 1GNVA 3KBBA 3SZMA 1UL1X 3NBNB 3L1JA 3WLIA 2HRDA 4GQIA 2B4TO 2F8LA 2R8PA 3JD1A 4NENB 4MICA 1JT9A 3U13A 1C3JA 1PR6A 1JNRB 1JVNA 1WL8A 2X5XA 3MJTA 1BVYF 4FQ5A 4PS0A 1PJSA 4J8YA 1FC0A 1T6NA 4H9GA 3CVLA 1JLSA 3S3TA 4GMXA 3BU8A 2ONJA 1O7JA 3O21A 4DV1B 1VMDA 1P0IA 4EBAA 1KI4A 4PGAA 4X8QA 4NDAA 4Q21A 3RK6A 1W49A 4X54A 3BRWA 2ODPA 1OXXK 1XFAA 2A33A 2X2PA 5U4XA 5JJ7A 4KE8A 3ZJTA 1EM8B 5LDHA 5ESWA 2VDLB 4B6RA 4EFMA 1PJQA 2C82A 3FYUB 1WUJS 4G01B 4J7UA 2QVXX 4WZ6A 2IBSA 4NS1A 1KNQA 3GGOA 5C2YA 3ILXA 2FETA 1ZH6A 2Q62A 2Y0PA 3SYTA 1E4EB 1R5OA 4GPAA 4PM4A 3PNTB 4XSHA 5DU2A 1KVUA 2IO3C 5J4HA 3DC7A 2F37A 4AXHA 5BNWA 1EK2A 1HL3A 2RGGA 2V5AA 3E5HA 3OLZA 4I4TF 1R0CA 2NZUG 2O50A 3E18A 4UZEA 4NCIA 3TSCA 2J48A 2NAPA 2FWIA 3O1HB 4MHSA 3X1XA 1AP7A 1TQ4A 1U8YA 4MS1B 5FPQA 3TOZA 5A4JA 2J45A 2C5GA 4Z68A 1GR1A 3KPUA 4BCCA 2DVWA 1L3CA 2BKEA 3JQ6A 1OFIA 4FDMA 4HN2A 4Q4CA 4FFLA 3MVEA 1QWSA 3DE1X 3AKDA 3UXYA 5JWOA 4O4HA 5LKAA 3ICQB 2COUA 2OKGA 3AY3A 3HN2A 1JJIA 2B7BA 4X61A 1NWHA 1VE6A 1DCFA 4EW2A 3R7LA 3Q79A 4K9NA 5JPCA 3U3XA 2YKGA 2ONKA 4G5GA 2GXUA 1Y1KE 4QATA 5JY1A 5BVHA 4UDOA 4ILGA 1SKMA 4D44A 5I9NA 2RARA 4US1R 3GVXA 2F67A 4Z51A 3CF4A 3STXA 1GDHA 2GPNA 4N54A 4Y6QA 4OJMX 1QONA 4QASA 3ONFA 2IVFA 1Z7YA 2QSUA 1ZLYA 4MWOA 1MOQA 2NU6A 1LC0A 2WU3A 4B4DA 3MBKA 4UXHA 4BZZA 1AK2A 3L0BA 1E3SA 3HKDB 1R5NA 2CNOA 3OEWA 3PLAE 1Z29A 2XUQA 1WR8A 1XIVA 3EAFA 1YIOA 3DZGA 3LW7A 4MRNA 1UIRA 4B32A 5I8PA 2IUTA 5IT0A 5ISMA 3Q7FA 2FR8A 2H4JA 4MRRA 1XK6A 1RIIA 3DDCA 1EWKA 4ZOLB 4KXQA 4FTWA 5PNTA 2QQFA 2WFMA 1KSFX 1KZGB 2V7EA 3EWAA 4J2OA 4PFSA 1WY5A 3OIWA 2D1FA 3K9WA 4QG7A 5JSZA 3R0VA 2AGVA 4LV5B 3SS9X 3L1UA 5ENOD 5G2NA 4RFSA 1NMXA 4N0MA 1YF3A 2BTEA 3CKBA 1P0CA 2XDAA 5FT9A 4HNUA 2FN3A 1J2TA 3HYMB 1AS2A 1ETUA 1B8NA 2XUKA 3NBQA 4LIPD 4W1SA 1ZNXA 2MSNA 2EFDB 3UUFA 2OHJA 3AM1A 3VNQA 3N8DA 4P93A 3RVOA 4GKBA 3A1NA 1IB6A 4KWEA 3PDJA 3U6KA 4U0ZA 3GPCA 5DHQA 5IDXA 3LJKA 4JI0B 3CURA 1QBKC 2GARA 2I62A 4P92A 4U5QA 4Y2QA 5K0TA 3QK0A 2LDXA 3DVQX 5ESXA 1XCGB 1HU3A 2CVOA 4J0FA 5ADHA 4MR8A 2XYGA 4RXMA 4EAAA 3GRKA 4IJ5A 1PJAA 4NDNE 3RTCA 2XUOA 4OQYA 1ZN9A 3NHKA 4PZUA 1V11A 4IIJF 3PNYA 3V4SA 4CFYA 4EX7A 2VDVE 5EJIA 1N5JA 4U7FA 1KY3A 3BFXA 2CXHA 4XB2A 2VO1A 1IAVA 5HIJA 1TM4E 5AM0A 4DSNA 4HOTA 4ME2A 3Q3IA 4GBJA 4KO4S 4FE3A 2OHOA 3GFVA 3UUWA 4CM7A 5DHAA 2FZ5A 3HCPA 3IT2A 3MSCA 3TMAA 2O3UA 1RFLA 1Z4IA 4ZU6X 1DRKA 2LNIA 3MHPA 3AINA 1N5MA 3M49A 3RS2A 2NG1A 1NVXQ 5IKOA 4CM6A 2HKIA 2XYHA 6PFKA 2RKOA 3LRXA 4RCZA 4MDEA 3NHYA 4WT7A 5K8VA 3EZXA 4WXYB 3I42A 1GL3A 4Q6BA 4A27A 5ALSA 3PVCA 3RR2A 4EEKA 3IXQA 4MWTA 3A3NA 3M3PA 3WZMA 4R69A 2XCTB 4DSTA 3WGJA 3N07A 5L4SA 3HCEA 3OZWA 1J5XA 2ZP1A 2O52A 4Q66C 3TJRA 1DDOA 2HXYA 3CVNA 3AL2A 3O9ZA 3B5IA 2AQIA 2ZYDA 4X1KA 3UFXA 2C0PA 2C4MA 5E8JA 3C6QA 3E3AA 3C5WP 3EODA 4L5JA 4MLZA 2VK4A 3IOMA 1N77A 5KU1A 3V3TA 2K7FA 3S7DA 1YQ9A 3ZQ4A 1V26A 3HFJA 4CL3A 1BEUB 1Q1AA 2X6QA 3GYXB 2R6DA 3CEJA 3FKSA 1PFVA 2PZGA 4Q48A 3V42A 2OKCA 1PEAA 4BVGA 5IZCC 3FOZA 3Q7AA 1O1TA 3ZWYA 2R4QA 5ALMA 4FFNA 5C7OO 1VB5A 3A31A 5CLLA 1E2MA 4M86A 3FKQA 4CGWA 1H94A 2CLLB 2Q9AA 2D5LA 3AU8A 3NAZA 4K9LA 1ZESA 1RLTA 3LT4A 2R1UA 4G37A 1W88B 3IUJA 4YV0A 3Q2KA 1VBMA 2BF4A 1MTZA 4UEOA 2IXBA 3AP2A 4I3GA 5BNFA 2JLSA 1M1NB 1OI2A 2AL7A 1GKIA 1PTJA 2KB0A 3JQFA 2A0WA 4LMAA 5ER9A 4C3OB 1QF6A 4UAUA 1H1LB 2O4CA 1O4WA 2VPZA 4EM6A 3Q72A 3WK8A 2VN8A 1E7VA 1G8PA 1KI2A 1HI9A 2YZGA 2P77A 2P8JA 3BGVA 3DL2A 2BW0A 4YRAA 2EEPA 1N0HA 5AI8A 3ND8A 2XHEA 4M0EA 5JJKA 3NASA 5BPPA 1S70B 2FSUA 4EF5A 1BD4A 1E61A 3MINB 4QRDA 5BW8C 3D7RA 2BFNA 2F1KA 2WQ6A 2XJ9A 3EAQA 4K8OA 3UCEA 1LC3A 4K5CA 1KORA 3LE8A 3PEFA 4MVWA 3NXKA 1SQGA 5C1DA 1AGYA 5LLSA 1R9GA 4M87A 4MEAA 4A8HA 4HWTA 1N1DA 4G0UA 1KRXA 4ZTUB 1WDLA 2QX6A 4DSAA 3EPLA 1K9SA 5FQ6A 1QRAA 4EJSC 5JFGA 3BDIA 3KQKA 1DTWB 1LK7A 4OMCA 2JFQA 1TFRA 1MRSA 3FTEA 2BFCA 2C54A 3DEKA 3KV1A 4J03A 4QAJA 4QUHA 4RS4A 4LGYA 3RIYA 3VC2A 4WZBA 3PH0C 2QNBA 3D3WA 1XZNA 3PJFA 4W5WA 3WV5A 3UT8A 5LZ9A 1GL7A 1T5HX 4EGAA 1Z9BA 4KQMA 2PVSA 5E7QA 5FPSA 4XD7D 3DVAA 2AJTA 4AG5A 4DJ5X 4P36A 1J4AA 1P2DA 2N75A 3D3KA 3G2JA 5T67A 1KQNA 2QM7A 4AG3A 3N58A 1ABEA 3IP9A 4JSYA 4KNVA 1X6VA 2X40A 3CTPA 1OILA 1EA5A 5GWXA 3AEUB 4NMMA 4KQGA 1DKPA 1TT5B 2RSFA 2HSDA 3R6TA 2Z3VA 3RC1A 1G4HA 3WSVA 2PUGA 3I9JA 4J3JA 1ZN8A 1TCCA 4M1WA 2CNLA 4DR2B 1NPDA 2XCIA 4HDAA 2CCGA 2YYZA 4QOGA 4ZO9A 3K8YA 4PZZA 4HI0E 4ZI7A 4Q1VA 2JGLA 1IEQA 1KU0A 3C87A 1XVLA 2UDPA 3JZFA 3PWZA 5KQRA 4MWGA 3KQYA 4TYMA 5KQPA 1YS7A 2R62A 5CEFA 3T34A 4JB3A 1V5WA 1XX6A 4LY6A 5K03A 1Z35A 4JW1A 2JEKA 2PL5A 1UDWA 1OA0A 3EA0A 3GBVA 3UJPA 2ZRCA 3KLPX 3NHJA 2A5YB 1MH1A 3Q10A 2WEKA 1CUEA 3O9VA 3ZIAD 5MFPA 5KNHD 3V7FA 4YXWA 2HN9A 3GLFE 4LHVA 5DM0A 1CE8B 1YZKA 4LEIA 1XVIA 5BYBA 3U3MA 5C52B 2ZPUA 4P8RA 4BX0A 4Q05A 1A69A 4PCVA 3JYLA 3O3OB 3ZV3A 1MP0A 1W87A 2NZ8A 4MGKR 4B3XA 3M3DA 1Z08A 3GLKA 3Q9UA 5EJGA 3NGMA 1ZITA 2YJ6A 3TNFA 5BSVA 5FEUA 3THXA 4LF5B 2QMZA 3GT7A 5E2AA 2Q9UA 1KYQA 4POAA 1TYCA 3T8KA 3VZSA 2VWGA 1TJ3A 2E87A 3FLEA 2P2CP 4BMXA 5HSGA 5EN5D 2FCAA 2JJ1D 10MHA 4Q01A 4Z3DA 3T3MB 5KYWB 1XKLA 3WZLA 1II8B 1Y8QA 2EW8A 4L1KA 1XTSA 4GXTA 5LBUA 2X5HA 5AIJA 2JFZA 1MOZA 2YWRA 3DFIA 1I4WA 4E21A 2FYTA 4I50A 2IQ5A 4W5RA 3AF6A 3JD3A 5L3ZA 1WULS 3DQZA 4JU8A 3Q6MA 5P8WA 3DLPX 3T7DA 2IHYA 3UANA 1U1IA 5AJXA 4YR7A 5KX5B 4DJTA 1G20A 2YN2A 4XXHA 4FOOA 5I7RA 4ZVTA 3FTXA 1DG3A 1H9AA 1PJLA 3QFFA 4TV9B 5E9JA 5AXCA 2H1LA 3MJHA 4EJ0A 2NLOA 4N49A 1UJCA 4F38A 3E30A 2G1KA 2R25B 3EZLA 5HF8A 3SZLA 2ZCJA 3DBHB 4NCHA 1NR1A 1ZRHA 2X6KA 4C0EA 1T3HA 2I99A 1LDMA 2SCUA 5IDVA 5TRTA 4MUGA 1EESA 2JFXA 1VI2A 2F8SA 4L8VA 5EYLA 4B6OA 3ZCXA 4DX5D 1TECE 2II6A 5IYZA 2ZBQA 4HXEB 5HF5A 2RSLA 3BF7A 4EI8A 1P7YA 4L4XA 4G25A 3IHYA 3T3PB 4L0MA 3NJ4A 3VYSB 1J7KA 1OAOA 1N8KA 3BE5A 1NDHA 3WFZA 3THYA 3SWWA 2IS2A 3TO5A 4JXJA 4Z7NB 3IEPA 2NNLD 3KUKA 4BASA 1TKBA 1SD5A 2F7SA 4LX0A 1OFVA 3UT7A 1IY0A 1DT3A 3GJTA 4BN4A 1XGWA 3OA2A 1D5CA 1JNZB 1ODTC 4Q9KA 1W0CA 1GM5A 2B0OE 4DC0A 1WX1A 5ECYA 4QT4A 3BD9A 3AW8A 1NBMA 3CQ9A 3IIJA 3NXSA 1JQEA 2H4ZA 3KIPA 3KHUA 2PBRA 2K2WA 4LDZA 2XTZA 1VPEA 1U8ZA 1KMHA 1M33A 3C5HA 4Q39A 3VPXA 2QRQA 2VJ8A 1KY5A 2QTFA 2V0PA 3PGMA 1JDBC 4AWBA 3ML1A 3U7GA 5KSZA 3ZDQA 5K0JA 1NWCA 2Q3FA 4YGXB 2E4YA 4MH0R 4J7WA 4WASA 5IEJA 1UKEA 1Y5MA 2WPNA 4DLTA 2L0IA 2I22A 5DHPA 1WBDA 2RG7A 3DL0A 3U60B 4QTZA 1EFDN 3C24A 4YRKA 3DJFA 1G3NB 3C3EA 1KZ6A 3ONWA 1O6GA 2ID8A 1V25A 3QLVA 3VHXA 3COZA 2WKQA 3DTTA 1ZM2A 1ORRA 5SYMA 3VSDA 1PY1A 4E2XA 2ONZA 3HSSA 2BMFA 1UJJA 1MJGM 2UUPA 5J2UF 3PIDA 2VHYA 4BP8A 2AEJA 4BE7B 3MMZA 5ICSA 1RWNA 3NWEA 1ZKMA 1LZLA 1KYYA 3PRYA 3ZV4A 5A2QA 1NSTA 2HMYB 5LU8A 4MEBA 2KZTB 4CUJA 1QK3A 3PFGA 1RMQA 1WXIA 1NXVA 2Z4RA 3VH2A 4CGYA 1SW6A 1KERA 1QVZA 2IPOA 5KQGA 3KE9A 4MYSA 2IJGX 4TT8A 5ALVA 3S7BA 1E2EA 5TQ2B 1VJCA 1KT1A 1M2NA 1U9IC 2FGKA 3N2IA 4DCMA 1LQTA 2RAFA 2GAIA 4CYMA 1JHAA 2JI6A 3WLQA 1U1FA 1WUKS 5IJ0B 3RIEA 5FLXA 3L4KA 3VZQA 2CDAA 4IM7A 1JFRA 2CWDA 2QD3A 3IHTA 3IXMA 4DJJA 5AI0A 3B89A 5EZYB 2VYFA 3RU9A 4X6YA 4DV5B 5JRJA 2I55A 4MVJI 1L6RA 2WB4A 1MZPA 1L6IA 3KALA 3WGHA 4NY1A 4GTQA 1ZICA 3TL5A 4RIEA 1OKKA 1T34A 2VQDA 2BFFA 4RG9A 1DI0A 3TOVA 5KJNA 4JKOA 1QQ7A 1CVLA 2WU8A 3H5LA 2IV2X 1CQZA 3IQEA 3WSTA 4J4BA 4TRJA 1CDDA 2PQ0A 2H06A 1VECA 1QWOA 3NH9A 2HDWA 3ER6A 2QC9A 1EE2A 1NONA 2HUNA 2QDXA 4V0OA 3U49A 1Z8NA 3ZX4A 2A9KA 2C84A 2IYYA 1ZYUA 2G9ZA 4YDYA 4WNYA 2ZJ0A 4DAOA 3LUJA 3OIUA 4UYJB 1IZ8A 4FYWA 4NU0A 1X5BA 5F3RA 5AVSA 1SCNE 2OM2A 2R48A 2IDZA 1ZXBA 2C4WA 5CT4A 2ISSD 2QD4A 3TAUA 5JMTA 4MJLA 4MQLA 1EUCB 2OV4A 1BXRB 3QF4A 1IUKA 3W3ZB 3A6FA 3IQGX 5EP1A 1X8JA 1R4MA 3MBIA 5LMUB 2O2SA 5IZ4A 4J1NA 3EEBA 5HK8A 2ATVA 3HCOA 3QHAA 2WILA 1PC2A 3I04M 3GFFA 2BHTA 1P3DA 3KVVA 1DTSA 1G20B 1LCIA 1L7EA 2ZBUA 3NYWA 1Y1TA 3QMMA 4LSWA 4LSZE 5JSUA 3Q8MA 4P3YA 9MHTA 2Q1XA 3N0WA 3WDSA 5AVZA 4PXAA 3PHCA 5CXXA 3DOHA 4FNGA 1GSAA 2CJWA 2ZT5A 4RSRA 4EDHA 1Z0KA 2SCUB 3KKMA 2FY8A 4HX9A 4F2GA 4EMUA 4ZICA 3QNUA 2Z4SA 4B3IA 4CFZA 4P3PA 2FWBA 1WY6A 2X41A 2RD2A 4WLFA 1ZBPA 2XT0A 3SIXA 4H7PA 4QOIA 3VISA 2FPKA 3D9OA 1EGMB 5B1HA 3BQNB 4I2ZA 5C37A 3ASNE 4JD5A 2L2QA 2NV6A 3MT7A 1AZSC 4QUAA 1D6MA 4AKIA 4KXFB 1JR6A 2CL5A 3FTQA 3RGWS 5AI4A 3FYTA 4GYJA 4YHBA 1XTUA 4B3BA 5J40A 1I6MA 1ZVQA 4GI2A 3ISMC 4DXDA 2BFCB 3DT6A 3U48A 1B93A 5FOXA 3ZTWA 3D2CA 2MSLA 3DKIA 1PHPA 1SCAA 5J2TF 4YDOA 3PUHA 3KC2A 2DQ4A 2CNDA 4OI1A 3NAGA 3S2EA 4HI9A 4Z9AA 4YFYA 4I66A 3LHKA 1U1CA 4AI6A 1U2PA 3DVAB 3SVLA 2PMDA 1IHXA 1JQJC 1M7HA 4FFMA 4I46A 4LN1A 2AFIB 2F8XK 2PS1A 1PO7A 3M6MD 4CIYA 3ZYLA 4D3XA 1VMAA 3B6ZA 2VNAA 1K1EA 1LPSA 2NZWA 1D9SA 4MDFA 4U95D 3CZQA 5IT9A 1JPVA 4P31A 3VYTB 1TT5A 5KWEA 3JVVA 1OXBB 4DUYB 1CZOA 2LXMA 1FFCA 1NP3A 3DEYX 3K4HA 1ZUD1 2CV2A 2AN4A 3TW6A 3G2HA 5ANRB 2G8LA 2OO5A 2VK1A 3GR6A 3CCCA 1N0QA 3DE6X 1I30A 3EZ6A 3H2SA 3TI9A 4AJOA 4DLKA 5BN5A 2V0GA 3CPEA 1QV7A 4L7QA 1BKSB 3WWPA 1TMOA 4LZWA 3LJNA 3KSDO 3S70A 3U81A 1DEKA 1Q14A 3QITA 3KB2A 5B3KA 2XRFA 4L4YA 4UNRA 1FLNA 2BF0X 4I99A 2NVBA 3IR5A 3QJ5A 1N0RA 2XEVA 1NRWA 2SKCA 1SBNE 2GCIA 4MS4A 5EG5A 4V3CA 5JQWA 3NPAA 4C7KA 2XF2A 2X6FA 1EAYA 2XOEA 3FZGA 3ECSA 1EQUA 3IILA 3KEQA 4NJEB 4X95A 5CH3A 3WLPA 4RF3A 2Q2WA 4LF4B 5EPOA 1SCUA 4PLHA 1TVCA 3UOWA 3V9PA 3QVKA 4EECA 4WXHA 1F8UA 2OFPA 4QDKA 5IH3A 1V1RB 2XA1A 4XCXA 1GPKA 2ID7A 1EQAA 5GJWC 1HFJA 4RIIA 3MCXA 1DC8A 4TV9F 5DM60 1E3WA 1VIAA 2PH1A 3AV3A 1MDFA 2PQ6A 3RQIA 4WK2B 3E22B 4MUIA 1Z15A 2BP7A 4A2CA 3FHEA 2DU8A 1PE0A 3IPXA 2HRRA 4ZYUA 3RC8A 2WU4A 5B5SA 2LSVA 1B0AA 2F9FA 4MB6A 4Y2UA 1K97A 2E3JA 3IBCA 5JDCA 4OVUA 1K27A 1O0SA 1EGHA 4IKEA 4M6WB 4PHHA 1MC1A 3WYEA 1HZZA 1W5TA 2W98A 4DIEA 1ZDMA 3EWIA 2VRBA 4XVUA 4O1PA 4Y6RA 3T0FA 2P9IG 4KXMA 2QTMA 2DWCA 1PT8A 3R44A 4UCQA 3JQ7B 4PIMA 2PYZA 2DF8A 1Z6GA 3V1KA 5LD2C 4RZUA 4Y2XA 2QRJA 3WGKA 4OHOA 1ZZGA 1OIXA 2RHOA 1N3LA 3AWIA 1L7AA 1JPLA 2TMDA 3CZAA 3RUCA 3DSUA 2IDKA 2LD4A 5KSWB 2O8BA 3QYPA 1EE9A 4DJEC 3ZV7A 5KHOC 4FLFA 4WCFC 1I2DA 1R0ZA 3AI3A 2J5BA 2XDWA 2DBQA 3D7SA 3OTQA 3K0CC 3L1IA 1QH8B 1V45E 3BWMA 4JQYA 3OPQA 1PL7A 2WHQA 4MUEA 4UU8A 4BVKA 3ME5A 3QKTA 3SNHA 2YNMD 3NPMA 2PU5A 4ZT4A 2GN6A 1T1GA 2PRSA 1WMEA 5F12A 1OWPA 1K6XA 2OFOA 4ZV9A 1E63A 5C8ZA 2C96A 1JZTA 3DOCA 1V4NA 4H3HB 4JYMA 1PT5A 4TLEA 4IVRA 4LI3X 1FYVA 1Z2EA 3IE2A 5FKJA 3VM6A 1Z06A 2WJAA 4F8YA 1ZRSA 4P4LA 4KMOA 1PNTA 2V58A 3AHCA 3ZDEA 4XUGB 1SBTA 5A3RA 2WXIA 1RQGA 1QS0B 3VHQA 1NXTA 3H2HA 3ZD7A 4LCEA 2XCUA 1G6KA 2DMRA 5CM2Z 5CA0A 4ME6A 2DTEA 1BIFA 3MCAA 3OWOA 4E5KA 4HAUA 3D8HA 2VOEA 3GLHE 4HGZA 4F9FA 3MHTA 1HE4A 3EJNA 2C5AA 3NAMA 5LM3A 2PSDA 3G5AA 4QLOA 1P74A 3VV2A 1QGYA 3MGBA 4KO2S 2Y66A 2P9EA 4RXTA 5CNIA 4BIMA 3DUWA 2WSBA 1MO6A 4RHYA 1BW9A 3KZOA 3CMMA 1OFHA 2JIMA 3V32A 2CE2X 4UVHA 2QTHA 1F60A 2ZYRA 3CN9A 1DX4A 3UCFA 1P19A 2I87A 3RWMB 5AXDA 1TM1E 3X1JA 1KKLA 1VLVA 4Q3DA 1OLXB 3KEOA 1NW9B 5CVEA 1Q7CA 1I01A 4DBLE 2DCMA 2ZI9A 3CUKA 4KACA 1R4NA 4R7LA 2JFWA 2PLFA 4IGEA 4LUNU 3PSHA 2ON6A 1E98A 1QIGA 2B9VA 3PP8A 4RFSB 2QUBA 3ZVLA 2LDBA 4BO9A 4HRYA 1HY3A 5BORA 5J23A 5IN5A 3B7BA 1VPVA 4WDRA 5A03A 1E5TA 1RC8A 5H81A 4X92A 4ZAXA 4F5EA 1I2CA 2ROQA 4YDRA 4AJ9A 4BQOA 3AUXA 2JLUA 1ZCFA 3OCUA 3B1KA 3DLCA 3I8OA 3VZPA 2BMDA 1WXHA 4XX5A 6REQB 1XLTA 4JLWA 2H16A 3GN2A 1P6XA 1C9NA 4J16A 3FWNA 5C5IA 1O9HA 4UDYX 4TLBA 4D6YA 4PIPA 1FU8A 3D3JA 3WGTA 1ANKA 1X86B 3A4IA 4GCOA 2Q1YA 2W2XA 3P4YA 1RVV1 2FMUA 2IT1A 2LIPA 3F4LA 1FXSA 2PGJA 1FUKA 3F97A 4GPEA