4N3AA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (1-26)e10a
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
b'CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3aA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3aA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3aA03
2VQ2A 2VG8A 4J8EA 4O6FA 4F96A 3ULQA 5M72A 5TMEA 3TSAA 1IIRA 2XCCA 4AMGA 2JJMA 3Q47B 2IEGA 4WNDA 2HO1A 3RU0A 3LCAA 4XI9A 2R66A 1GPBA 4J8FA 3QOUA 2IFUA 3G2HA 2VSNA 3VTYA 3OXFA 5HXAA 4GA0A 2PRIA 3G2LA 4GYWA 4U0UA 3S28A 3ASHA 8GPBA 1B4DA 3FROA 2GM9A 4PQGA 2AV6A 3RHZA 1M5RA 2GT1A 2VGYA 3QDNA 4I17A 2QN9A 3MTBA 3BDAA 1NZFA 3CVLA 3GW4A 3DDWA 3MS4A 5KJNA 4N3BA 5EKQD 2KS6A 5CHEE 3HYMB 2GPAA 3FP3A 3MTAA 5KJMA 3MTDA 3UYKA 5LCWJ 3CUWA 3TGOA 1V4VA 4AY6A 1P4HA 3G2JA 3VDNB 2LSVA 1WW3A 1FU8A 1K06A 5D00A 1PN3A 2VSYA 3NB0A 1YA6A 2C1XA 1ABBA 4YNDA 1JIXA 4BQFA 3T3GA 4ABNA 4RIIA 2BGUA 3UUXA 3R9AB 1XNFA 4B94A 3S7FA 1JIUA 3ZGQA 5CCMA 2Q7FA 5G04J 1W3BA 3CUUA 1ZU2A 2Y4UA 3QKYA 5D0QD 4CGWA 2QRHA 4RIHA 3WADA 4AIFA 1QKJA 3QHPA 2VGXB 1XL1A 2AW3A 3ZN3A 3OY2A 1TJCA 3MT8A 1LWOA 4EL0A 1XL0A 4H7XA 1ELWA 2DBAA 4I2ZA 4RBNA 2ASVA 4UI9J 2JZCA 2FEZA 3T3IA 3UQ3A 4U07A 2J9QA 1O6CA 2XA2A 4RIFA 4JL0A 2LNIA 3KD7A 2SKEA 3ZCSA 4EKEA 3QKWA 2F3PA 1SXPA 3HBMA 2F9FA 4MI3A 4F97A 3C4VA 5JTUA 2OOEA 3GYZA 1L6IA 1ELRA 1UQTA 2FFRA 1RZVA 3HBFA 2X0EA 4N3CA 2ATIA 3BEOA 3OXLA 2ZB2A 3S7DA 2Y4TA 3U3WA 4KQ1A 4BT9A 5FTPA 2AZDA 2X0DA 3ZCVA 3LKUA 2H1FA 1FU7A 2QRGA 2QN7A 2MHKA 3AMVA 1Y8MA 3BD6A 3ZHEB 2IF4A 4BTBA 4BT8A 3CV0A 2WQHA 3ZHEA 1C3JA 1EM6A 2FBNA 4MICA 3H4IA 3OKPA 2LSUA 5FJYA 2VCEA 3RO2A 1B89A 1L7XA 5C1DA 3T3DA 2V5FA 5DIZA 4UQZA 2PRJA 3MT7A 3OTHA 3Q3HA 2KCLA 3CVPA 4CDRA 1EXVA 4WNEA 3CEHA 4YUAA 2XCBA 3NF1A 3GZ2A 4AY5A 4G2VA 5LCWC 1NZNA 2P6PA 1C50A 4N2QA 4ME2A 3CKCA 1GFZA 4GPKA 3MBOA 2QLLA 2O6LA 2PQRA 4N39A 1QZ2A 4I9CA 4MI9A 4W9RA 3G2IA 3HBJA 3OKAA 2F3QA 4G2TA 3URZA 2QN8A 3LY9A 3S29A 2AMVA 1XOIA 4YI5A 4LEIA 1Z8DA 5G04C 4U0ZA 2YHCA 5HI7A 1C8LA 1P2GA 4RG6A 4HOUA 3UYLA 5A6CA 1YA0A 2QN2A 3RSCA 2AVPA 4GZ6A 3EBOA 3FWVA 1E4OA 2GEKA 3JYSA 5DBKA 3CV3A 4RIGA 5BT1A 1A8IA 1Y6GA 2GW1A 1AXRA 4JA9A 3VTXA 3L01A 4I1AA 3CK8A 2H1HA 3D0RA 2XGOA 4X7PA 1NLMA 2FF4A 3ASDA 1P29A 4KYOB 2F3UA 3H4TA 3SYMA 3OKCA 4UI9C 5HQ8A 4GCNA 3HBNA 4EQFA 3S0JA 4N2SA 1PYGA 2R60A 4HOQA 3U4TA 2XCIA 1HZ4A 3CVQA 4GYYA 1NOIA 1UZUA 2GJ4A 1AHPA 5FT9A 3PE4A 2XGSA 2C0MA 5JJ6A 2WTXA 3WXXA 4HORA 3L7AA 1GG8A 2KCVA 2ACVA 3K9IA 4EJ2A 3QWWA 2X6RA 2E2EA 5JJTA 1YGPA 2SKDA 3BCSA 4EL5A 3UPVA 2XCUA 3S27A 3LY8A 4RELA 3MRXA 2P58C 1F6DA 1GZ5A 3CEMA 5JTTA 3EBPA 3RJVA 5AYWD 1WV0A 3MSCA 3PE3A 2IV7A 4AMBA 5DLDA 1K08A 2X0FA 3RKVA 3N71A 3IA7A 5LQDA 2QFCA 3MEKA 2XGMA 2IUYA 2PQNA 3SZ7A 3OTGA 5IKOA 3O48A 3Q4AB 1PSWA 4CTOA 4X7RA 3S7JA 4HLNA 4MI6A 1WV1A 2VYIA 3CK9A 3VDMA 1FU4A 2KC7A 4JHRA 3BD7A 4HOSA 3OY7A 2PYDA 4WHMA 3ZCRA 3MS7A 2QN1A 2GPBA 5BW8C 4I2WA 1LWNA 4H7YA 1XC7A 4G25A 2ACWA 2UY1A 1L5QA 1XKXA 4QLBA 2XA1A 4Y6CA 1P2BA 2C4MA 1JG7A 3Q49B 4NRHB 4GA1A 5TMBA 3E4BA 3QWPA 4YVOA 2GEJA 2X6QA 4MRAA 4U0SA 1F0KA 2XA9A 3NAZA 1QM5A 1Z6PA 3C48A 3TAXA 4Z5XA 2PYIA 4BTAA 3NP7A 2QLMA 3S2UA 3C4QA 5G05C 1Z6QA 3E3OA 2R68A 2G9UA 2YJNA 3L7DA 4G1TA 1PC2A 3CEQA 4KXKB 2HYZA 4GYOA 3DD1A 5JJ7A 1IXYA 4JA7A 1IYGA 1KT0A 4F3VA 3CUYA 4CTMA 4GPBA 5EX3A 1OUVA 3RO3A 3CX4A 3G2KA 1P4JA 4UQYA 2NC9A 3SF4A 2R4TA 3D1JA 4BQEA 2PL2A 3BD8A 5A7DB 4A1SA 2BGTA 3T3HA 4RIEA 1VGVA 4WNGA 3L7BA 4G23A 5ENZA 2IEIA 3AS5A 3BCUA 3DZCA 3LY7A 4KQMA 2UWJG 2SKCA 4HOTA 1UQUA 5EX0A 1GPYA 1NA3A 2FI7A 3WAGA 4UI9K 4HWGA 3OT5A 1E96B 2FETA 3ZFWA 1WM5A 5TMDA 3DDSA 2PZIA 4CTNA 4M7PA 9GPBA 2Q6VA 3NP9A 3LPZA 3RSZA 1GGNA 3ZCTA 5DU2A 1KT1A 3CEJA 1SXQA 3ESKA 3KAEA 3GUHA 2IV3A 1KTIA 3T7DA 4IN3B 4NC9A 4M60A 5G05J 1RZUA 3KS2A 3MKRA 2ECPA 1KLXA 6GPBA 2G9VA 3MV2B 1WUTA 3NCHA 2R5SA 3Q15A 5CCLA 1WW2A 4NEQA 3VUFA 3VUEA 4GCOA 3L7CA 4APOA 3O3CA 1P4GA 4UQXA 5FZRA 3OTIA 3CUVA 3NC4A 3GPBA 1A17A 1RRVA 5D0OD 4G26A 2VCHA 4J8DA 3MRVA 4REMA 3ZCQA 3SYRA 5DXFA 3TG5A 4LDPA 3ASGA 4XIFA 3ZCPA 5GPBA 2KATA 3RIBA 4N3AA 5KJKA 2XMPA 1E1YA 1FTYA 4M83A 4RENA 3MT9A 2QNBA 2HY7A 4FKZA 4YVQC 4GA2A 3CVNA 2C2LA 5ARGA 3S7BA 4FZRA 1WAO1 2C9ZA 1GPAA 3MV3B 4KQ2A 2BFWA 1NOJA 4W6QA 2QRQA 4NQ0A 4WUYA 3IAAA 4U04A 2BISA 4N5CA 2XPIA 4AN4A 1JIVA 4EKYA 1JEJA 2F3SA 3TG4A 1NVKA 3FFLA 1L5RA 5ARFA 2FO7A 2IYAA 1C8KA 3E3NA 2WPVA 1BX3A 1IHGA 1Y8ZA 3MQFA 2UY1B 2PQ6A 2VGXA 2QLNA 1HH8A 4BFCA 1HXIA 4GZ3A 4RG9A 2L6JA 1ZBPA 4GZ5A 2OFFA 4G24A 2HR2A 4X7MA 4NESA 1XV5A 3LYAA 2QRMA 1FTWA 2XEVA 4BWRA 4L22A 4F9FA 4CGVA 4N9WA 3CKBA 2QRPA 3QWVA 4KBQA 3MS2A 1P2DA 3CK7A 4BQIA 3MRTA 2FF5A 1FTQA 5IKPA 2GPNA 3AS4A 2I6HA 4AM9A 1J39A 1L5WA 2G9QA 3CUTA 2IW1A 7GPBA 3Q3EA 3T5TA 1Y6FA 1FS4A 4J0UA 2ONDA 3TOVA 4XI0A 3COPA 1WUYA 3NPAA 1H5UA 2JLBA 3OXGA 3PDNA 2G9RA 3RT1A 3BCRA 2KCKA 2BUGA 4LEUA 3ZCUA 1L5VA 2R4UA 4Y6WA 4WACA 4WADA 3E3LA 5KJLA 1P5QA 1JG6A 2QN3A 3IEGA 4I9EA 1FA9A 3AS8A 3BEEA 3G2NA 4X6LA 1Z62A 5TVGA 1FC0A 1L5SA 4YI3A 2C1ZA 3T3EA 3GZ1A 3Q5MA 1PNVA 2YQ8A 3D0QA 2QZSA 1NOKA 3MA5A 5FZQA 3Q3IA 3WC4A 2C0LA 5FZSA 4MHOA 5I45A 1QQEA 1NZDA 4MHSA 1HLFA 4WNFA 1NA0A 3ASFA 5BNWA 3L79A 3EDTB 3ZPJA 5D01A 1FCHA 2IYFA
chains in the Genus database with same CATH superfamily
5I8WA 2NYVA 1Z74A 2BBOA 3KOZA 4EA6A 2ILVA 1G4HA 4P53A 3K0SA 1XHEA 4K0RA 4PLGA 5KTKA 4TVOA 3CISA 3PUKA 1N2OA 2Q3MA 3DZBA 3LBFA 2QD3A 1SA0B 3OZFA 2FV8A 4HNQA 5L7YA 4FT2A 4CZ2A 2WOJA 3A27A 3ZWVA 4NFHA 3K0BA 2EEZA 4MWEA 4CCSA 2FCAA 2ORVA 1MC4A 13PKA 1KZ6A 3RUHA 4L0MA 2HD4A 2ZVPX 4ARZA 4F85A 1W1IA 2RGAA 3UJHA 3PC7A 2C2ZA 4G0QA 1ZW1A 4C87A 4Z2AA 1OPXA 1DAFA 2LBPA 4BUCA 1GA4A 3B3FA 4AZWA 2C5AA 4QJ3A 3FPLA 4I55A 5BUSA 4CM3A 3EZ6A 3MWEA 2IDMA 3HBAA 1GARA 4WCFC 1U7OA 2HKIA 4RZSA 1ZI6A 4PS8A 4GPKA 2Y92A 2Z98A 2G25A 2PQRA 3EU5A 2NSZA 3JZFA 5AKIA 1P18A 2HTEA 3UGTA 1XDWA 1TZKA 1DCMA 1SRRA 5A6CA 3OZAA 3C7CB 1V7PC 3E1SA 2P62A 4Q0MA 1AXRA 2CNDA 3L01A 4HAUA 2XGOA 3OFVA 3G1WA 4JLNA 1F6BA 1SRQA 1HDGO 1ZS9A 1NQVA 4G8CA 4F9TA 4JQZA 2XGJA 3OLCX 1GG2A 2GN6A 4FN4A 3HXBA 2O59A 2ET6A 3P7MA 1UAGA 1DAHA 1GZ5A 2ZSFA 1SZCA 3RSFA 1HA3A 1PJBA 4DLOA 1W1WA 2ZP1A 3X44A 4LBWA 4M9XA 4LOHA 3A1EA 2DK6A 2PQNA 4GTRA 2WHRA 1UT8A 4GWKA 4B74A 3HSSA 1U5AA 3Q87B 1KO5A 2OESA 4CM5A 1L4YA 3T7TA 4E5DA 5TRTA 1YI0A 4IJKA 1T3SA 4J07A 5LB2A 2V7VA 2VYNA 5K0ZA 3FZNA 3N5CA 3NX4A 3CXUA 3L8DA 4ZV9A 2VHZA 4YACA 5BYKA 4TXRA 4D5EA 2DT5A 3CLTD 5EKUA 3ZBQA 1I7DA 5KNHD 3S1AB 3H17A 1CS0A 2PMCA 4LCJA 4QX6A 4NG5A 4L8WB 4HOTA 2EBWA 4OGGA 2HM8A 2FETA 3IH5A 4O8CA 4O02B 1E69A 1A9TA 4CI0B 2Z2XA 2JGLA 4ABYA 3GWZA 3NRJA 5HIIA 3OCUA 2CY0A 1NUSA 4O3FA 4IJ5A 2EERA 3PXCX 3KB6A 4NECA 1JALA 3VU0A 3NHPA 1F9AA 1EUCA 4ZEOA 3E5RA 1N5RA 1JEEA 4A92A 5GPBA 2W2KB 2WSLA 4I8DA 5HM6A 4KIJA 1U7UA 1UJ4A 2QMYA 4DNPA 1GPJA 3W2GA 1ESCA 2QRQA 1D1PA 2I6SA 3HJCA 2XPIA 4MP6A 4PFSA 4JLBA 1E9RA 2VKTA 4U2BA 3D02A 3Q7EA 1QUFA 5J9FA 1NPTO 4ZCIA 1J0XO 5ED0A 3KHSA 4TV9A 1LTHR 4I81A 1GSAA 1R6BX 1IUNA 2QAGC 1J2UA 1JW9B 2BELA 4TUYA 3BBPA 1UBOS 3EQ6A 1ZH0A 2ONDA 3FDZA 5ALGA 2I8LA 1YH3A 5D7NA 2QQFA 3ABME 3L4EA 5KJ6A 2R4UA 4F9GA 5KQRA 3EVTA 2J09A 4OF4A 2VWPA 1SCNE 2IHUA 4F72A 3GLHE 4ZI7B 1TTPB 4GG1A 5IM4F 2YQ8A 3T1TA 2G1AA 3CW2A 1C5KA 3OJOA 4XYLA 5C52B 4J8EA 4HGYA 1M6WA 4MWTA 1SR8A 1ZWKA 2AZ4A 3G2SA 4GA0A 3G2LA 1Z0KA 3VMFA 4JUBA 1SOAA 5G4LA 8MHTA 1DUSA 3BE4A 5JNLA 2BP7B 2Y0CA 4RF2A 1N33B 1IBCA 1VPTA 4BMOB 3DV0A 3EFOB 4F4IA 3BE6A 2ST1A 1F4LA 3B48A 1QIJA 5BT9A 2EX1A 5T3RA 2QX9A 4EYSA 3OQIA 4N5IX 1UC8A 4B31A 1QKJA 1UBNA 3M4ZA 3WWCA 1J8QA 4EL0A 3ZWCA 3QLVC 5JBNA 5BNIA 3SSOA 3H84A 3EQZA 4QNNA 3ANLA 3T3IA 3H86A 3OU7A 1GYRA 3Q6IA 2Z30A 2P0YA 1SVUA 3MELA 3T1NA 4QYSA 2C5SA 4MYHA 3DTTA 2P2ZA 1FU7A 1TFRA 4C2AA 5ICCA 2C9DA 1JIQA 5JQWA 1JQAA 3QLUA 2CC2A 3X3HA 4MOWA 4PHTA 4B80A 2A90A 2OHOA 4BTEA 1YQ9A 1BEUB 1JR3D 1N6HA 4QECA 3D59A 1E1DA 2QN8A 5K8UA 1R50A 3KOOA 4KGZA 1VSBA 4HOUA 1NULA 2IO3C 2YNMA 3X2EA 5IMBA 3RT7A 4NHEA 4TSKA 3D64A 5G4KB 1DBVO 4FR2A 1P8JA 4F12A 1R8SA 2O8CB 4ESHA 2WU4A 5EPEA 3HI4A 1TMKA 1JFVA 1QIEA 2DP4E 1XX6A 5JI3E 4QG7A 3JAKA 3EPKA 4ZK2A 2HDOA 1B1AA 3LCVB 2BSXA 2IWRA 1JECA 4HNAB 1P3JA 2BM8A 3VKFA 3QXHA 1RQXA 3I0ZA 3Q9NC 1GG9A 3GJXC 4JAVC 3AM4A 3WV5A 5F7JA 3EUAA 2HIAA 3DBLB 3H5VA 1V47A 4MRMB 4CTJA 3QUCA 1N8NA 2IEDA 1MC5A 1XTQA 4NYJQ 1QM5A 3L7MA 1VPWA 4Y2HA 2UDPA 3KKKA 3AYZB 3CR3C 5EIEA 2DTDA 2J5KA 2WQ6A 3D3QA 3E7FA 4YJ3B 3VU9B 2ZBFA 3UXMA 2PE5A 1FVFA 2F90A 4GKBA 4RDCA 4CTMA 2GS9A 1CB7A 3L5OA 4KN8A 2QG4A 1L7RA 1G7TA 5J23A 3HWWA 4KWHA 2C1EA 4EYOA 4CI9A 2Q46A 1QF9A 3ZU6A 1IY0A 3JQAD 2XEEA 3HZHA 2I6UA 3A9RA 1KXJA 1B74A 1DTEA 1OFHA 5LQAA 1PV1A 3I4CA 4R6WA 1DB3A 2ZYAA 3P0HA 3HSKA 1SUPA 3SQVA 4IN3B 5DN9A 3G0CA 2RGNC 1K66A 2AB0A 4MMXB 3FY4A 3PQEA 1ONSA 3VO9A 3EBLA 3OQJA 2EGUA 5DGXA 3UM3A 2PNFA 4R1NA 3KL2A 2K2WA 1M2HA 1Y9ZA 4XIYA 5CLLA 4QUHA 2XGGA 4YAUA 1HDRA 4EG3A 3DOOA 1O3YA 2O8VA 4YP0A 3VISA 4HVAA 5JAIA 1U0HC 5TQ2B 1JEJA 4O0LA 4DLKA 3R24A 1M6EX 3E5HA 4MVJD 4IZOA 3MQFA 2Q0XA 4ND2A 2B8JA 2PNNA 4GKKB 3HZRA 6YASA 1Z5ZA 2PUWA 3GA0A 4LDJA 2YV2A 1ENOA 1HDOA 1RCTE 1LY1A 3OP1A 1R10A 4LDRA 1E8YA 1P7VA 4RO0A 3H1BA 5JVDF 5ESRA 3HL4A 4ATZD 4A0SA 1JG1A 4PS7A 1L5VA 3SDZA 2I9CA 3NTVA 2PKXA 2FMTA 3USCS 1HG2A 4DC0A 1XDSA 4R8LA 1U1GA 2W2NA 3KWFA 1F8GA 2DZNA 4PXAA 3Q5DA 4OP1A 1UJ2A 2I1QA 1U7PA 5K8VA 1W6RA 3DBVO 1UBKS 5D01A 2C0QA 5DKFA 4Q4AB 4KXYA 1XMXA 3NM6B 4FYWA 4QJIA 4G9BA 3F5SA 4U0UA 4ZYYA 1N6IA 3SF8B 4IEEA 4TQUS 3G5LA 2DQSA 3I9NA 4MSUA 5FO1A 1I94B 4E2XA 4WA7A 3P2YA 1ARZA 4DLXA 4O1OA 4ZHQB 2WJ4A 1YA6A 5ETJA 1S63A 2P9JA 3BILA 3VHQA 2ZIVB 5YASA 1E1QA 4HLQB 4E5PA 5E4TA 1N8TA 4KE9A 4N0MA 5KWVA 1AUOA 1W88A 1TQ6A 1T3TA 5ENNA 1QTNA 1W73A 7REQB 4PC1A 4EKEA 3V2HA 3KQSA 4DLLA 1FFGA 1PFQA 3DWGA 3SX4A 5BYAA 1AX9A 4EO4A 2BBTA 3ZCVA 2X9GA 4QPNA 3R5HA 3KT8A 3R7LA 2C7VA 1M2OB 1E3IA 1E1LA 4X90A 3TWSA 4ZCLA 2HV9A 3DB1A 1Z5OA 2UYHA 1ZHOA 1K4MA 4BTVA 3PNLB 1OLUB 2MYUA 1XDDA 3H0CA 4S1PA 1Q6YA 4Z0HO 4NQZA 3VPCA 3DVRX 3CV3A 4PSDA 1RQNA 4XDZA 1ZIOA 3ONKA 4PGMA 4BNFA 1N5IA 2VP6A 3APDA 2PXHA 1MH1A 2R60A 5ANRA 1P5JA 2GJ8A 2PX3A 2XGSA 1K7YA 1PWZA 3KWJA 1AQNA 2QRNA 3KD2A 4GH5A 1YDHA 2RSLA 1OH6A 3IUNA 4JC4A 3DT8A 5DIFA 2CNWD 2WTEA 4M89A 4QU5A 4A8HA 4N65A 2Y67A 3WGVA 3WRVA 2BJHA 9LDBA 4HYQA 3INYA 4AROA 3AGQA 2BHRA 3L8HA 1ZSYA 1SZ9A 5CW2A 1Q91A 4YHHB 2QEQA 4NZMA 4ZJYA 4DA0A 3RTBA 5K8IA 4OKNA 6REQB 1G3QA 1E7VA 1KAGA 3SBXA 1HWYA 4P83A 3B51X 3WYCA 5KPDA 2IOFA 5JANA 1FJHA 3ZBUA 5IM5A 2L6BA 1DDGA 2PWPA 3HADA 4BTAA 3CKMA 1ZGBA 1POXA 5IHXA 1HE5A 1YUMA 1OGYA 3L8FA 4RV9A 3GFFA 3AKDA 2QLFA 4UTZA 1E1KA 5CFPA 4PE5B 2B9EA 3Q1LA 2B25A 2BFOA 5I48A 3ZIUA 1CR1A 3X2QE 2X1HA 3GDFA 2C7PA 2F8SA 3AS5A 2IY0C 3RV3A 3WXBA 4QO7A 2PUFA 1RZRD 3N58A 1YZVA 4PQEA 5KOYA 1EAYA 3CU5A 4OKSA 5B2ZA 2XX3A 4GZLA 5MFZA 2ONZA 2QK4A 4M0LA 3FRIA 3LYHA 1MDBA 5E7IA 1IOLA 2WMOB 2V7QD 3AUSA 4X95A 2IP2A 3PHJA 5KCZA 5CVDA 2ORYA 2XITA 3HFGA 3TUZC 3P2IA 1XEFA 1U0TA 4WDRA 2C07A 5T4YA 4EITA 1U2GC 3BXHA 3IAUA 3DLTA 3JAWA 5EG5A 3MV3B 4KQ2A 3THXB 3UT5A 3B89A 4KLAA 3HUUA 3QF7A 2Z9BA 1C29B 5IVKA 3NHWA 2NWQA 4UDOA 1RHQA 1ATIA 4WKNA 2IXAA 1X9HA 4CMJA 4AS1A 1YFJA 3AFMA 3JSAA 4H7KA 4DLZA 2P30A 2A78A 2VTVA 1U9CA 4ZAYA 1ZJZA 5B12A 2CXHA 2MJLA 3Q40A 1ITZA 2P0AA 3B60A 4J0UA 4XRRA 4KDFA 2PUCA 3VC7A 1EFHA 5KHOC 1FFYA 2OBMA 1UDXA 1YCGA 4BCCA 3F6CA 3W1WA 2HJ9A 1JG6A 5IJXA 4ZQHA 3DWLG 2AJCA 4FCWA 3PTLA 3UPUA 4Z53A 2Y1XA 3TGLA 4P93A 1K6IA 1SAYA 2B6NA 3H6KA 4DKJA 1NOKA 3LT0A 4I5GA 2JATA 2OC9A 5DNYB 3L79A 1MXHA 3EG5A 4MAAA 4KVZA 2A3RA 4TL8A 3PPXA 3ZQ4A 3FEXA 5CYFA 4A36A 1WB4A 2VSNA 3ZXIA 5ALMA 1ZK4A 2EU8A 2ZWIA 3DOJA 4AOFA 4B2IA 4DYHA 4R98A 5AIAA 1GUAA 1BXRA 1GRQA 3IPYA 4AJOA 1WETA 4D4KA 4YDQA 3G8BA 4F91B 2IXFA 3OZTA 4QYTA 4DDWA 4B3MB 1HFKA 1TCBA 4II3A 2ZFUA 4QULA 3C3MA 1RKUA 2L17A 5B53A 4TV9B 5FF9A 1N8KA 3NIWA 4PX2A 4TUYB 2Y4TA 1IRXA 3FXAA 5FBZA 2ETVA 1YNSA 4R0VA 1NVDA 2NGRA 2OLKA 3CCCA 5JMWA 4KBGA 1ODFA 1I4TD 2YXDA 4WJZA 4UVIA 1H1LB 4GC5A 3O1HB 4DY6A 4F6RB 4UASA 5LCWC 1AK1A 4DJ5X 1OXUA 4JI0B 3TKAA 2AFHA 4K9OA 2WWFA 1CKEA 2AMVA 5ISMA 1GW6A 1M2EA 3ELBA 3C8DA 4AB1A 2XYRA 3PE6A 2GBFA 4NBSA 5B1DA 2FFAA 1NLMA 4HSGA 1HOTA 3QK7A 1BTOA 5HIKA 5CXUA 5CT5A 4TMVA 5EHIA 2AWIA 3PD0A 1Y0BA 3HUDA 4WLVA 2F1KA 3RH0A 2BGGA 1O94A 2OFOA 4JSYA 3D4BA 1TADA 2P58C 3CUSA 3LHDA 1PK7A 1N7HA 3PGKA 2V8SE 4M9SA 1VOTA 4R1LA 4KODA 1AKMA 2YJZA 5BPPA 5IYZF 3UAGA 4HDCA 3JVVA 3H1PA 5HTKA 3PR2B 4B6SA 1JYSA 3I1FA 1U3DA 1Y7TA 3ESBA 4P2BA 3DL7A 1ISJA 4HNTA 4TSRA 4GI1A 1NW7A 1FUEA 3EWNA 3WL7A 3W2TA 2JGFA 1W4LA 3OPMA 1TKRA 5EY5B 4O4IB 3JYHA 1KPSB 1E3WA 4IXMA 5ALRA 2PGNA 3IEKA 4PONA 1M2VA 1V6SA 1Y3AA 1KPHA 2QT0A 4E14A 2EBFX 2PX6A 1GPWB 1S2OA 2QRZA 4F7DA 2A4KA 1X3SA 1PK8A 2P9SG 2JRCA 1VIAA 4QBIA 2R25B 1G2OA 4MW7A 5JNRA 4G0VA 3LBIA 3Q0TA 1ICEA 1SXJC 3FF4A 3I8SA 4LOAA 3IKTA 1U2VG 3RYIA 4I1VA 2PY6A 2AK3A 2OFWA 2JLZA 2I4TA 3C45A 2RD0A 3MKRA 2ECPA 2G28A 1TZJA 3JZIA 4BU1A 1O9HA 4RKQA 4P38A 1OZFA 4MW4A 5LP6A 2C7OA 3OQ6A 3WZ2A 4L95C 4KRYA 2XB9A 2W2PA 2EF1A 3A3OA 3WXMA 4BATA 5IVHA 2FMKA 3QMPA 1VBNA 3SM3A 2QV0A 3R6DA 4CF6A 4MIYA 4PWYA 3GYGA 4TYNA 2WG1A 1VJ5A 3ZZ1A 1RXSA 2ZYHA 1EX6A 1T1RA 4B71A 5AUPB 4NACA 2KZTB 3SNXA 1RBMA 1PEAA 2HFKA 1BLXB 1M6VA 2ZI9A 2H0QA 1WUHS 1JHOA 1SG0A 4BE7B 1T5BA 2JFFA 3ONDA 2RH9B 2WPDA 3FPKA 1VMEA 2FW9A 3TTUA 1BMTA 2DFTA 2PKRA 1N6NA 4UEWA 2AF4C 2D59A 3BA6A 3N8DA 1NTRA 4XWTA 1FP6A 5FZQA 2XUHA 4UZSA 2FEOA 4YRIA 2JEZA 4EPWA 3BSFA 2Q4BA 1JJVA 3TSAA 1WXFA 1YR1A 5J4VA 3IDQA 2ODAA 5CH3A 1R6AA 3SI7A 5SY6A 1SBQA 2ZK7A 2J07A 2KBXA 1P7PA 3PQDA 4PHGA 3BORA 5ITSA 1F51E 1UKEA 4B48A 4O2BA 3RCBA 1XN4A 5DSXA 2I4MA 1HT2E 4FYKA 3V46A 5EVCA 3IUPA 3LUDA 1J33A 2BGUA 3UUXA 4LHYA 4YV1A 1HNNA 3PFCA 2O50A 3QKTA 4UU7A 1RYBA 2QMOA 1UBGA 5C9ZA 3JWEA 2JZCA 3LWBA 1TZBA 3B7UX 2QXUA 1M54A 3GP3A 3NBUA 1ZDMA 2V03A 1WXEA 4XSHA 4UHCA 3L9WA 5JCPA 4ZO8A 1LDEA 3QYPA 2FEAA 1S3GA 3EC1A 3WAJA 5HQTA 5LP0A 3LTEA 3C5CA 1FPQA 3X2SA 5FWXA 4F86A 3NAGA 2DWOA 5IHPA 3GA7A 3NF1A 3WJAA 4JXKA 3IQDB 4UNRA 4BJ1A 4Q48A 1J2TA 5LJLA 1PL8A 1G8AA 5TVKA 1QTIA 3GMDA 3PEVA 3TKLA 2VHEA 1VYUA 3DCNA 4NHOA 1HRKA 1P91A 2YRXA 3D5TA 5EILA 5I7OA 1E4OA 3RS0A 2Z95A 2P2GA 1TYZA 1XTJA 3OBBA 1C0KA 1Q11A 4J8SA 5CBKA 5KZMB 4YWHA 2ODQA 1LPPA 2WD7B 5HFAA 3I6YA 2QD4A 5MN4A 4RZQA 1JQLB 3N2EA 2TYSB 5A4JA 3Q7RA 1AHPA 3I2GA 1PY1A 2BZSA 2UZ3A 3WXXA 3U4QB 1JFSA 3VR2D 3CLSC 3G9UA 5JATA 4MLZA 4GTTA 4OYSA 3HXEA 4EJSC 1TQDA 1W88B 5BV7A 2O0LA 1M0TA 3PDUA 3I62A 1AXGA 2CBGA 3KXKA 3ED5A 3T5DA 2FB9A 1TYBE 4X6XA 3SE7A 1V7CA 1WXDA 5JADA 5FI1B 3NBKA 1TNUA 1G5TA 5L53A 2GAOA 5KTTA 2WYHA 4NK5A 1E89A 4U7EB 1BVYF 2WU1A 4DQLA 2JAUA 4BY6A 3QVGA 2ZCJA 3C8UA 3PC4A 1SBYA 4TVKA 6LDHA 1X8KA 3WB0A 2YVKA 2Z83A 3IA2A 4ZEMA 2ANBA 1P4JA 2RONA 4ZO6A 4Y6QA 4E5UA 3IBTA 1DJLA 1I1OA 4ED9A 3LF1A 2YS7A 4Y0NA 5DM0A 5FL7A 5ANRB 3UKUG 2Z9DA 3MWKA 1DJPA 5KDDA 2PXAA 1ODSA 3FGZA 1QCDA 1UK7A 4IJWA 3H5IA 4QXRA 3MPUA 4PYRA 3KS2A 3D8TA 5DT2A 5CCLA 3PNYA 3DE5X 3F78A 4GYKA 4IRUA 2V9CA 2X3YA 3EWIA 4IHJF 4OTZA 3IJPA 4HMPA 4IQGA 1R4ZA 3F6SA 1QU3A 5T8KC 1YB6A 3DEHA 3TLJA 4ZT4A 1OBHA 1F4VA 4RKWA 4AWXA 1XAHA 2D7CA 5M29A 1E2NA 2VBFA 2Y69E 4ZC8A 1QQ7A 4RLYA 1CR4A 3QNKA 1ZPDA 5ERGB 2C8JA 4HGZA 1T8WA 1W5EA 5M2QA 4EG1A 1VL1A 4QATA 3GDWA 3BGOS 4RL6A 5FUYA 1XRMA 1G21A 2Q3CA 1ND5A 3EXIA 4KU4A 1SUBA 4MQFA 4PZ0A 1UCFA 3F8TA 1OX5A 3C0KA 3KAPA 1DEXA 5K6AA 3AFIA 1U7DA 2AN9A 1KY5A 4PG6A 1TO2E 1Z34A 3NWPA 4CETA 2LCFA 1UMDB 5LMCA 3R3UA 3KZVA 1IBSA 1LSSA 3KVYA 3LLUA 1INLA 3UATA 1KKMA 4C4XA 2AYZA 2SHKA 3TFWA 1K8ZB 4P4UA 5AW5A 2IFUA 2ZI7A 3OXFA 2NADA 3I5MA 5J4KA 2MDTA 1UOEA 1G5HA 1Q16A 4FSHA 4C7JA 1OLOA 3ZPXA 2XYPA 4PZ9A 3GJ3A 5SZHB 1K06A 1VMIA 4ABNA 2IU4A 4KRFA 1YK0A 2G17A 1R18A 4OUKX 1A2KC 2ZR0A 2H54A 2FTKE 1E6MA 3K53A 2MSLA 2QRJA 2BMEA 5FQ8A 1EVIA 2CXRA 3AC0A 3IMCA 4H0NA 5D2CA 1J0EA 3L7JA 2DGDA 1UINA 3ORYA 2OV1A 3F5DA 3IRVA 3FE2A 4EG7A 4HDMA 3PLNA 5KINB 3WLKX 2ZRFA 2W6ZA 3CX3A 4MICA 2GNAA 4B3JA 4JN6B 3OTHA 1YONA 3CRMA 2X58A 1Y1KE 4NR0A 4YREA 3V4PB 4MI9A 1NQ5A 4UREA 5KX5B 1OXTA 4XW2A 3ZIDA 4TLMB 1NLFA 3WX0A 3FFWA 2G1UA 4OH1A 1JAZA 1UM9A 1J8YF 1PJLA 3H8SA 1Y6GA 5TB5A 4QGFA 3Q41A 3T7CA 3BRQA 6CHYA 4JSTA 1OZAA 3QFFA 3EU9A 4E5VA 5JROA 5THQA 4DCSA 3IUJA 3EIQA 4IF6A 3C85A 1QF6A 2PT5A 1INZA 1A3CA 1UKBA 4HTFA 6NULA 4BLPA 1HG1A 2HRBA 5EP4A 1QO9A 1T2CA 1OE0A 3ITEA 4YYZA 1MV5A 2FWRA 2PRSA 3BHJA 1PGOA 3RVBA 3RKUA 1WMDA 1BXKA 1IDOA 4KX5A 3JRWA 3DVAA 1B3BA 4JI2B 2RC5A 4CGYA 2WKPA 4EUKA 1JG7A 3ZU7B 1L4UA 4JS0A 4AD8A 3WLLA 2V5UA 2IODA 4LN1A 3SC4A 1Z5SC 2FW6A 4FWIB 1IUPA 4R31A 3C97A 1DAKA 2WHQA 4J76A 1B7GO 2HYZA 4EGFA 4HJRA 3ETJA 4B89A 3TM4A 1E60A 4F3VA 5KTNA 3SF4A 4KIWA 1O1RA 4BQEA 1KEVA 2NSJA 4Z4EA 4FVTA 4YXWD 3LK6A 1DBWA 3LT2A 4Y0VA 2FAXA 3BXPA 4LBYA 5BWOA 1G3NB 2PD3A 2IPLA 3C5RA 5FR1A 2YHIB 2PZIA 1X2BA 1Z73A 4Y2QA 4P33A 4B7AA 3IIMA 1KT1A 2CZQA 4X6UA 2O4CA 3GUVA 1RZUA 3L1KA 2G9VA 2RK4A 4XE5A 2B1GA 1AG9A 3VKVA 3VUFA 2Q5IA 2A88A 1Q1ZA 4ZVSA 5K2MA 3IP9A 4APOA 3T95A 3D7KA 2G67A 3G8AA 5TJ9A 1KJNA 1XCPA 1RR6A 4M6WA 4QICA 2GNPA 2R17C 1NVBA 3AKCA 4LRTB 4IVPA 4DIUA 3HHEA 1IUOA 1EK6A 2DTEA 4G63A 3PNPA 3AGPA 1HE8B 3WLQA 2EZTA 1T36B 3K2EA 1L5RA 2Y3IA 3EEIA 3U9LA 4DIEA 2EOAA 4Y0AA 1U1IA 1T2NA 4MV5A 3BMCB 4HQFA 1GCUA 5AK5A 4TLDA 1Z7YA 3VPSA 1EVJA 1USUA 4OQPA 4QUEA 4ZI7F 1ZJ5A 2ECFA 1SFRA 3DNFA 5GZ1A 1JVSA 3TOSA 3ABQB 4E1VA 2BUGA 3AZOA 2Y1WA 3KM0A 4G2NA 4OYYA 4EHMA 1IG0A 2DQ4A 5EEHA 2W8BB 4I9EA 3VH3A 3QA9A 3R2JA 4KQEA 1H2HA 2V7UA 2ATCA 2FQYA 4UUCA 4KRXA 3RIGA 1CEEA 1KZ7B 3RYIB 4ZYTA 2BCGY 4DNFA 1KSGA 2OCBA 2Z6QA 3L06A 4OHOA 4QOJA 1H6BA 2J32A 5FHQA 7ADHA 2HPHA 1BX1A 4JLAA 1HZZA 1R64A 4ZEVA 3WYFA 4X65B 4XKJA 5ICMA 1NP6A 1NBWB 5LP6B 2NU8B 2B69A 4BLUA 1O6FA 3LLSA 1CUJA 3NANA 4HXFB 3QFHA 1II0A 2YINA 4IIGA 1FFWA 3TQSA 5KJCA 1E8XA 3PFIA 3FFAA 3VZSA 1KK1A 4HBGA 1V1JA 4PGHA 1LD7A 5G02A 1F9EA 2VNSA 4FOPA 1K98A 3IMFA 1FNNA 3PHIA 4DM4A 1OKKA 5FTPA 4OQEA 2PZJA 1NVUQ 1DAGA 1VZ3A 2M32A 3GFQA 2DKNA 3SZLA 1Q50A 2GJKA 3PV0A 4HRLA 4ACBA 2ZUWA 1T29A 1PGNA 4B4UA 2WT8A 2ZRLA 3OTWA 3TM5A 1V4BA 1U3GA 1T26A 1BU5A 2CFUA 1UADA 1XQ6A 4YO7A 3UJNA 2FG6C 2ODPA 2H6EA 2OFXA 3RAPR 3JWIA 4EPVA 3LAWA 1J00A 3PXEA 3HA7A 2XKBA 3NYQA 1MPTA 3BGWA 4KQ9A 4H3KB 2F64A 3QPVA 4UPEA 5KYYB 1CUGA 3PDWA 4M8LA 1PSDA 4RHFA 3I01M 2CLCX 1ZESA 1H8ED 1M7GA 5JHGB 4UCQA 4QPDA 2ZTUA 4O2BB 4A6EA 3LY5A 1UBFA 3RK4A 5EJGA 4ETIA 3OT4A 2PM7A 3BPSA 3OSUA 1KRXA 1ZC4A 1AMOA 4TKLA 1ECCA 3AB8A 3S7JA 1CY8A 4HK4A 4OBWA 2Q8NA 3CNEA 2QUHA 4K6OA 3VAYA 3TQQA 5TJHA 2IYLD 4YJ3F 2WM8A 4D3DA 5KAMA 3HR7A 3CN7A 1Z35A 2LKCA 2G76A 4GA1A 2JIRA 3IKOB 3PVLA 4BFUA 4HWRA 2ATVA 4BHTA 4XX5A 3QPWA 4H7PA 5FWXB 3CVYA 1WDMA 3Q8WA 1K1EA 3SYKA 3BXZA 4ZU6X 1O8BA 3TECE 3U3MA 3F67A 3MUNA 1MC8A 3C8MA 1KZ4A 3INGA 1NTOA 3ML1A 5IDYA 4RD0A 1OI7A 1FBNA 1UPFA 4KXVA 5CTAA 3UX4A 5A0FA 2GO1A 4OHMA 4CKBA 1BEZA 2J49A 1XCOA 3A1FA 1ZM7A 4WSOA 3QQPA 4V24A 1IAQA 2G3YA 1ONNA 5JZOA 3NJ4A 3TLAA 3DE4X 3SY2A 3JPWA 5GINE 2B1IA 3HWSA 2DWUA 3A6DA 4G0ZA 1GAJA 3BL5A 1P1KA 4MW5A 1IU9A 3PWKA 2CV0A 2PLNA 3CKLA 5AW0A 2OAQ1 5KU7A 1IB0A 3HXKA 5JLAA 1E2HA 1NG9A 3AT1A 1RW2A 3CHSA 1Y42X 4L15A 5T5QA 5AHXA 1WS6A 2ECOA 3DR5A 5FJIA 3B7WA 5CT4A 4RS3A 2AFHE 1J1ZA 1SGWA 3FOZA 5DFAA 1XK7A 4R81A 4ITVA 3ZW9A 4CKCA 4C5BA 3WGJA 3HKCA 1XXLA 3AH8A 2Q45A 1N8SA 2X4GA 3SFXA 3NJ8A 1VHDA 3V34A 2VRCA 2NAFA 5CVTA 2H1RA 3VLEA 4JP2A 2A5UA 3VKHA 3GGGA 1VP3A 1EBBA 2PFGA 5TF0A 3PNVA 1WZIA 2NPIA 2GGFA 4YJ2B 4UTOA 4E09A 4JV5B 3U40A 2B4RO 4YALA 2UYOA 2H08A 3G7NA 5HM8A 3JQ8B 1TO6A 3VLDA 4G9EA 1Z68A 1RYNA 3DKVA 3ZPJA 4KE6A 2HEIA 4GLJA 2HW8A 2R7LA 1A7JA 4ZHQF 4B87A 2DHCA 4XI9A 3WLRA 4B3HA 2VP4A 4IRUB 3RBXA 3UQYS 3AR7A 3OLXA 1GV1A 3MS4A 3MTAA 1XZCA 3QNMA 2RC6A 4D02A 1R00A 4JUFA 2Q8PA 3RVSA 1XPJA 4CV1A 2O0JA 2IBTA 2DT8A 3CLVA 1C3OB 2Z5VA 5F23A 16PKA 3B5IA 2BMDA 1VKNA 2ZTHA 5BN3B 1WPXA 1THZA 3C2QA 3IDSA 2DPYA 3ICWA 1WDYA 1TDJA 2EKQA 2BCJQ 1GPKA 4CM8A 1JHQA 3UC9A 3JQRA 4IZHA 4WCFA 3RI3A 2D2IA 3LCMA 4KWCA 1ZYUA 2H1OA 1UQTA 3KFXA 1ZGJA 2W42A 3SBEA 2QROA 1P1FA 3EVDA 3H18A 1WU8A 4BN5A 1L5NA 1Z0ZA 1K4YA 2HNBA 1S8FA 9ATCA 1G8HA 1KXZA 3ZDDA 2ZSAA 4OMDA 2OB2A 1CY6A 4R8SA 4YRFA 1X70A 1B89A 3D0OA 4IIVA 3A6JA 3R77A 2I4NA 1XQYA 3M89A 3ONVA 3LFTA 1RAAA 1AMNA 1AE1A 2H31A 5FOTA 5DB4A 4IR7A 3I2IA 4P1ZA 3SHWA 2R5NA 3EDYA 1PU2A 3QOYA 3OX4A 1VLVA 3N2LA 3DSTA 4D6YA 2HDHA 4HAZA 3R9KA 3CXRA 1NBIA 3PX7A 1P75A 4W1QA 1CQWA 2Z5GA 2P1RA 2IYYA 1MZCA 5ALZA 4HGRA 3EZNA 4HMOA 4UUQA 1XQVA 3HFSA 3GN2A 1E79A 4JFRA 3V32A 1FRNA 4FGKA 3QQ5A 4EDFA 2BE9A 2C2BA 4DIBA 4JXTA 3HGQA 4C76A 4WCVA 2ZYSA 3ESCA 4DX2A 1XU9A 4AMBA 3PQ2A 1CUZA 4J3JA 2JD2A 1N2JA 4AN1A 2MOWA 3DR3A 1GUDA 1YNOA 5BVHB 3DMGA 1P1BA 4GBGA 3H75A 4MGYR 1EWTA 4ZRNA 5EIFA 3HCRA 2EIHA 4CQLA 2C4MA 3KZ1E 1WZUA 1Y48E 3D9KA 4QELA 1RLTA 2I3GA 1ONPA 4HDMB 4RZXA 2X5TA 3SZOA 4P98A 4XGIA 4A10A 4GP9A 2REBA 3HXCA 1PZNA 3FPSA 2Z58A 1X7XB 3GOHA 2ID7A 3AUYA 3O75A 4IFTA 4G1TA 4U5XA 4C6TA 2RH5A 1JA9A 1JEYA 1JHXA 2NAPA 1NP7A 1O9GA 3FSGD 4I7EA 3HCEA 4EF4A 3BTUA 2VZ9A 3BRSA 1KETA 1KEZA 4I1MA 2W4QA 5DYGA 1QMGA 3K30A 3ZFWA 3V1KA 2FUCA 2IHZA 2O06A 5BN1A 4R40A 3AFNA 4K2HA 4HDRB 3EZ2A 4I36A 2O1SA 2UU9B 1GTJ1 4R05A 1RE0A 4X66B 2VDWA 3IVCA 1ZGHA 4O2RA 3VKUA 2WR8A 4B2LA 3DXXA 1UBJS 3T7JA 3UG7A 4J8DA 5AK4A 3ZHZA 3I4FA 3HHPA 4HFRA 2DYRE 1E1YA 3MT9A 3DL4A 3H7AA 3LOUA 3S7BA 3WB9A 4QRDA 2GBCA 4ZVUA 4Q3AA 1ABEA 5DTIA 3DVAB 3LVRE 1I3OA 2QAGA 2IYAA 5KBYA 4B4KA 1ZM3A 2RD2A 1CG6A 3ISTA 3EF1A 1CIVA 1QDUA 5HNKA 2SBTA 1KPIA 2YDXA 5FEUA 1R6DA 3I04M 4P0QB 3I5UA 2FF5A 1IOZA 2R9VA 2IW1A 3B38A 2QRVA 5JNVA 1T4MA 2IYOA 1ZMXA 1T8TA 2ZJ4A 4L9PA 3PQ7A 3D9MA 1X7YB 3Q10A 1LPAB 2YWBA 3A0UA 1E0SA 2YZ2A 1EWYA 3L54A 4EF5A 1LI4A 2O2GA 4YMTA 2CHGA 1SG6A 2QWXA 4U8YD 4YQZA 4C3ZA 3BQOA 1BRMA 3I39X 2XPYA 3R3VA 4FJ0A 4E22A 1HNZB 3G17A 3O8DA 3VJKA 4K9DA 5IVPA 1CERA 4MJ7A 3NGLA 4TUMA 2WU8A 5CBPB 3DXKG 5AOCA 4DJFC 3OZGA 2NU6A 4EGCB 3K70D 2IYUA 3O93A 3KCNA 2ISCA 4EMBA 5DGIA 1K0UA 2FPSA 2JBHA 3TRDA 3ZIAD 2NNLD 3QLVA 3I23A 1FU8A 5AJXA 5FUQA 2C7BA 3BHMA 5EGNA 1DXQA 4C4RA 4TV9F 3GLGA 4L9SA 4TUYF 4KR9A 3I6ZA 3OF2A 2QVYX 3MFQA 5DP1A 4AIFA 1U9JA 3WWYA 3HVEA 5AQ9A 3AESB 5CFOA 5GZ6A 3K1TA 2FH5B 3KEOA 4HC4A 4PHCA 1RWXA 1V43A 4LWQA 2BMJA 1UOQA 4EY4A 2BKEA 3GCWA 1NI5A 2JI6A 1C7IA 1UJCA 2IE8A 5MGNA 4TQAA 1E9AA 2MHKA 3STHA 3AUXA 2P4UA 5FJYA 4RA6A 2YWXA 1AP7A 3BT3A 4KOAA 4EHJA 4G2VA 4LBZA 4IINA 3HVHA 2ZRGA 3H99A 3G5UA 1ZR4A 4FCTA 2B34A 3KU1A 3RNLA 5B55A 4D56A 1C7FA 1ZMBA 2EILE 1TK9A 4CHGA 3VFDA 5MN6A 3ZBPA 3HO1A 4MKTA 3VTXA 3PJEA 4B17A 4NZ9A 5I9NA 5EPUA 5DBEX 2V8BA 4I66A 4NONA 4BGDA 4M9QA 2BUCA 3TN7A 2WKRA 4YR7A 1QQ5A 4IXNA 3N1UA 1N34B 1TJPB 4MK4A 3WMRA 5ENPD 2YBEA 4HORA 4JGBA 3Q9NA 2NZJA 3IKVA 4RPCA 1G21E 2WJVA 3D9HA 1VIVA 4Q6WA 3OZBA 4ILKA 1UAAA 2L82A 2WICA 3OO0A 4GTSA 1QHFA 2JCGA 2VLBA 3UMGA 3DJYA 3M1IA 1FP2A 3HKDB 3IAM1 3B1WA 1Z83A 2YYSA 5KDOA 4HOSA 3PGMA 2HHAA 2PYDA 4O4IF 3CR3A 3LJ3A 1LPBB 3U7HB 3R7FA 4J1TC 4FOTA 1Q74A 4HLLA 3K4HA 3AEKA 2HMAA 4BY9E 5IUJC 3GH3A 3OLYA 2ZQZA 2HBRA 1VLMA 2EKDA 4Y6OA 4ZVOA 4Q00A 1NBMD 2R2LA 3RVRA 2BHSA 2FE1A 3NHRA 3OMLA 2VZEA 1YYHA 3Q72A 2OQRA 3C3DA 2BR3A 4R7TA 3QEBZ 2H7VA 4AJPA 2JI7A 1G7CA 4TV3A 3A3YA 3ROKA 2R62A 2C59A 3RG2A 2ILTA 1Y5MA 1UMBA 1YR3A 2H1LA 3RS8A 4X61A 7ABPA 4PLYA 3GY0A 4JOSA 1C9DB 2X6IA 2RGNA 3EF3A 2EIKE 4DPMA 4BMYA 3SQXA 1LS1A 4GKVA 1N5LA 1PQYA 2FKNA 2X9LA 2PS1A 5C35A 1QRTA 2ORWA 5ALNA 4NC9A 3OMWA 1A8HA 2QY7A 4G1FA 3PZDA 5DISB 4FS3A 3BT7A 1E5DA 1GFSA 3LHSA 4UFNA 3W7AA 1R8QA 1NT2A 1P1RA 3WBJA 1YQQA 2FSHA 3ZY4A 5LDGA 1D2AA 3BGIA 1YDMA 1Y4ZA 1G1AA 2JG3A 3SQMA 2RJOA 1YVUA 1DO0A 4Y9DA 4KV9A 5JS6A 1HH8A 3EVZA 2M6KA 4JUAA 4A0RA 4GPIB 1CUVA 1J22A 1KH2A 5DGTA 1CW2B 2J3KA 4YV0A 4L57A 1QAMA 2WUVA 2I91A 4Z1OA 3NBQA 3RIMA 3B2NA 5JXJA 4F8JA 3MRTA 1PTKA 4B4DA 3TR0A 5E6RA 5KEIA 1HMYA 1GL6A 5JU6A 2WJZB 1U8AA 3QGMA 3COPA 4OIMA 1SU4A 3ADCA 3KCQA 4M1WA 4ZAXA 4CW7A 2JHFA 1RI1A 3UCFA 5GVRA 1U7HA 2ZT8A 1VGRA 3FRHA 5EESA 3DDOA 1KEWA 1ZX1A 3W9YA 4MHSA 4P4LA 2ZJYA 4KZCA 2JJ2A 2FR8C 1NKSA 1U3TA 4ZRMA 1HUQA 3AOEC 2DVWA 4G36A 1MEEA 3CH5A 1L4BA 2YCBA 1T13A 1NVFA 3R9IA 3PHGA 2JGDA 2V3WA 3HCCA 2J3MA 5EKDA 3Q7QA 2YOFA 5KYNA 3FTWA 5LLTA 3HYTA 2I7VA 1U3VA 2E4VA 4UEQA 4PNPA 1PAQA 3V3LA 2FQ1A 4DQ0A 4U2KA 4P5DA 3G02A 3O3OB 3HCNA 3UIPC 2CD7A 3PCXA 4ARZB 1AQYA 1VL0A 3ROTA 1D2CA 3FF1A 3AQ4A 1X3LA 2RI6A 3WFJA 3ZHOA 4UI9J 1NVVQ 4KN5A 2PV0A 2IV2X 4CIAA 4CKCB 3AVTA 4F3TA 2HTFA 1S9DA 1XUOA 2IX3A 5GTDA 3GPLA 4I55B 1SJ9A 1UW4B 2O52A 3MWEB 2D1YA 4W5HA 3QU5A 4V1CI 2WWTA 4XUCA 1XKLA 3D7RA 1PFVA 1L7PA 4N39A 2JVKA 1E3DA 5HS0A 3DEYX 3HCBA 5J40A 2V4LA 2ZRIA 5G04C 2CL6X 2VP2A 1OXVA 2Q3BA 3UWMA 3UYLA 2KM4A 3OIYA 4GE3A 2HJSA 1SCDA 4US1R 2CJPA 2R1TA 1FFSA 1DQZA 4D3ZA 3CVQA 5LMNB 2HB6A 1ZJ6A 3AF0A 4JX9A 2WA2A 1TQHA 3IERA 1KBOA 1N3IA 5CEDB 5JJTA 4NZNA 3HDYA 2HK9A 3LY8A 2TS1A 4IJMA 1ZXXA 4Y2JA 4G07A 3OZIA 3ZX4A 3RC8A 2WF6A 3K8ZA 1CP2A 1WZEA 5A04A 4X3PA 4WNAA 2KJQA 4J0KA 1IHBA 3FU3A 3KG2A 4N40A 3I6MA 1X81A 4FGLA 3WNZA 3I2FA 1U7XA 3RSQA 1Z17A 2IOQA 4JBHA 3WFIA 4KAAA 4FHKA 4HDOB 1KFJB 1U04A 2RG1A 3FPBA 3REGA 3QE9Y 5CNMA 4FHJA 5HF6A 2O7RA 3CE9A 2E0IA 1XZGA 2X2PA 1Z28A 1FTNA 1M1UA 5ITWA 4FDTA 3CX4A 3NHBA 1T6NA 1JFLA 3R20A 2OKCA 4EP1A 1YVEI 4UFOA 1CS0B 1VDZA 5J1SB 1WMBA 5FA8A 4MWZA 2SKCA 3NWEA 4PC2A 3B7SA 5EAIA 5FWDA 2ZT5A 4WTOA 4LYEA 1N0HA 3R3HA 1P7YA 2PJDA 3Q0EA 4RYLA 1KTIA 5J47A 1U2GA 4O0MA 1THTA 1SD1A 3T41A 3ZK9A 1GAWA 5H82A 4ZMSA 3IP5A 2V96A 2J7KA 4DUYB 2ZVJA 1MQSA 1EUCB 2R5WA 1KGDA 4NLLA 3TPZA 5KTMA 4RK4A 4E2YA 3MJTA 5KNLA 5B1BE 2I2OA 4C2TA 2JFYA 1VRVA 5LBUA 1Z15A 3ZWNA 4DNXA 4KGXA 4ML3A 3TWWA 3TG4A 3OLQA 3PUVA 2JJQA 1NATA 4ETNA 1LVHA 4DM3A 4K8RB 4KPGA 1HXIA 4BVKA 2A3NA 4CQLB 1D3AA 4IMJB 4NESA 3MHPA 3NEPX 4HEA6 3N6VA 4EKDA 3U3OA 1QHSA 3UT0A 2DCUA 1LK0A 1AGYA 2JIDA 5FEMA 3BA1A 4Z6KA 2XUDA 3TDNA 4N49A 3U4GA 3FDZB 1L9XA 2X5XA 3QX8A 1DX4A 3GT0A 4C6TB 3O9VA 5JISA 4IDAA 2QL6A 1JEYB 2CD9A 2XS8A 1R88A 2FR0A 5H83A 1NXQA 1F2DA 4OM8A 3L0SA 1Z8FA 2JLCA 2CB0A 3HDTA 1D6MA 3I2YX 2B36A 2SCUA 4XLTA 1FMJA 3ON5A 2OCKA 3FHOA 2QZSA 3OE1A 3IVGA 4EVQA 2BFBA 3ZY5A 2IYFA 1SHZA 3N0TA 4MINA 5E9QA 3ORSA 1QH8A 4DJAA 3KLBA 2VDWB 5FUBA 4NTZA 4XDHA 4NCXA 3ASHA 3OPQA 4YQFA 2QG9A 3P2KA 5F4ZA 2JFXA 1M7HA 3HV0A 2QENA 5KC9A 4N54A 5KVSA 3DV0B 1R0ZA 2JJ1A 3LC7O 2XT9A 1MB3A 1VRWA 3OQIB 3BJRA 4WIAA 1MLDA 3D3NA 2Q5OA 3U4CA 4PYKA 1PG5A 2Y0BA 4NBNA 4IDFA 1E1RD 5A0TA 4MUGA 4BNJA 4AIRA 4RQUA 3BFJA 4MWCA 5A9SA 3B52X 3A4TA 3R7BA 3THOA 3A06A 5AQEA 4OEHA 5JMOA 4OG2A 5KX5F 3P26A 4KXUA 2H4JA 3KUCA 4BT8A 3KJQA 3KSMA 1N6LA 3OQ1A 4O4LA 2CVPA 1X1AA 4PHFA 4EZEA 2OUIA 2R6FA 4X62B 5DTRA 4ND8A 1YZFA 3DZJA 1RXYA 1GKKA 4I9CA 4JODA 4U2EA 1NBOA 3OM1A 3ZVLA 1RJGA 4AVXA 2ZDGA 5EXTA 5B64A 2ZIUB 4GUAA 1I4OA 1OWMA 2GRAA 1V9CA 4P4SA 4K1LA 5LR6A 3C15C 2O3JA 3FTQA 4Y6LA 5DBGA 2WXHA 2NU6B 5A4MS 3U4TA 1QIKA 1R6VA 1HZ4A 3BDIA 2IYWA 4JLDA 2X0KA 4A3SA 4YQEA 3OZWA 5EJ2A 3L0PA 3C7TA 4GX1A 5JJ6A 2XV1A 3LDUA 2EYUA 1ESEA 2ZAOA 3JAKB 3DW3X 3K5WA 5FNZA 4CM9D 4DPRA 4MB2A 3WLHA 3FH5A 4IDBA 1HX7A 1WXIA 2JASA 4K2AA 2FGJA 5F1KA 2VPWA 4YBRA 3N71A 4GTQA 3D7NA 3TZCA 1KMNA 2HZBA 2ZU0C 3FPEA 1DBRA 3PGXA 4N7JA 4YRQA 1EK2A 5EIHA 3CLTC 4Q01A 5L51A 1XNJA 4NQRA 2B0OE 3Q49B 3KHKA 1XQXA 3OPYA 4Y6GB 3TBKA 2PMKA 1OX4A 1Q1AA 4U8HA 4FC8A 5B6PA 1H6KA 2QGZA 1SU6A 1ZITA 3TL3A 1KJ9A 4HD8A 1V8BA 2QTAA 4EY3A 1ES9A 1LLDA 2MSWA 5FOUA 5I7AA 5ENVA 2JAXA 1SXJA 4V39A 5D7BA 2NIPA 3T7IA 3HHMA 1WXWA 4OAQA 4EO7A 5AVOA 4G3XA 4IDNA 5GP1A 5MDHA 4XJXA 5CITA 4NYIQ 4H1UA 2P2CA 2W6IA 3MNFA 2JLAA 1JSXA 1PTJC 2X2FA 4GXQA 4M49A 1MJHA 2PT9A 3K96A 4Q69A 3LBHA 3SFVA 1YHYA 2JI9A 4BGUA 3SHVA 5A5FA 4DEYA 3U5ZB 1MF7A 1S4MA 2R6ZA 1UFRA 2F8XK 2G70A 1P17A 4L75A 3KXPA 4R2IA 2DH6A 2EBUA 4R7GA 3A6KA 4XKBA 1A7AA 4A6PA 3U3ZA 3FTSA 5B1SA 4WBNF 1RTKA 1LLQA 2NSDA 5HJ7A 1HI9A 4G5XA 2BEVA 3T9BA 1BDMA 2IOLA 1GYQA 4TT3A 1HE3A 2ATEA 1IN7A 1UPCA 2PLWA 5DHFA 3EAFA 4C0LA 4HBZA 4F06A 2CLSA 1C9JA 1XZPA 3HB5X 4S1TA 2CFIA 3VBEA 1YJ5A 5THKA 3JQ1A 4FC6A 4CL3A 3BIWA 5DULA 2G40A 4EH1A 3MCUA 4OU5A 2PKWA 2IOFK 1IXZA 1F20A 3ZW3A 3PX2A 1I7PA 2JK1A 5B3SE 4A6XA 2WT4A 1FA9A 5B1HA 2VAPA 5HDQA 2UVPA 5EMLA 4N6GA 4E1AA 1U98A 2OBLA 3Q3IA 3UJ7A 1AK2A 1ZD3A 5B7QA 2VK1A 2JHPA 3RROA 5HKLA 3MCZA 5LP6F 2FK7A 1FDRA 1BWRA 1N77A 2QG6A 5IAOA 2O5CA 1ZINA 1AKUA 4R0NA 4I17A 4J2TA 1T1SA 5IJ0A 1Y3FE 3EEQA 4K9LA 1WW3A 2H4FA 2CDCA 5ENDA 3WMGA 3DXMG 3FZGA 3UWPA 1GADO 2P79A 1M73E 4N8EA 1JF8A 3N87A 5ALUA 3KL4A 3S2FA 3SYLA 4I5EA 1VFPA 3DEPA 2KI5A 3VHXA 2YZKA 4ASUD 1NQTA 4RBNA 4C9BA 4X1OA 1OXJA 1Q19A 5EE1A 1USKA 1TF5A 1S9HA 4KBFA 3I2JA 1AKRA 1I0IA 2QIOA 3ZKAA 5E6RB 5IF9A 2HO5A 2OCIA 1IBLB 1OOEA 3A1UA 3CIFA 1IMOA 3DHVA 4A0GA 4XSGA 3COYA 3I9V6 2V4UA 3P2OA 3AEYA 4I6EA 2H8GA 4N2QA 2AEEA 2TSYB 4IIXA 3G2IA 4A1FA 2Q0QA 4MR7A 3D3KA 1LFDB 3H9UA 4O2BF 1XGKA 3U81A 4C05A 1GPNA 2ZE8A 1ADJA 2FUKA 1PYGA 4DGQA 1VL8A 4LFBB 3WKBA 1Q1GA 4EJSA 3OFSA 2XNKA 2QL9A 1TNDA 4RY8A 3CGHA 1DVPA 3NI2A 5JS8A 4XA8A 1UEJA 3EHDA 3RQSA 1KWGA 3PENA 3DG9A 3DBOB 2PTHA 3JUEA 1JPNA 3FNIA 1RADA 5CRVA 1FXWF 3W7VA 5ALIA 3QF4A 3AX6A 4OQNA 3FTEA 1IBKB 1D0SA 3W3AH 1LB1B 1NF8A 4AF7A 2P1DA 4EHNA 5L3SA 4G8KA 3BZWA 1YL7A 4LUNU 3GLVA 1Q1BA 5JSQA 5DN6A 3R0QA 2H85A 3F3KA 5AOBA 4QQKA 5F78A 1G7RA 1PJTA 5KOHA 3HA5A 4PAMA 1KT0A 1ANKA 1RT9A 3GEHA 4L8VA 4S12A 3TTWA 2J4DA 5KNCA 2PUGA 1Q2ZA 4E33A 1YR9A 1NFQA 1A9PA 1DMSA 2F37A 1RXCA 1WB6A 1NA3A 3I1IA 3GLGE 3ZI4A 3H3XA 4LJKA 4FHGA 1YMQA 2OV8A 3L17A 1KZ1A 2C4UA 3FZEA 3UANA 5K05A 4YY3B 1BDJA 3K71B 5T8KA 3W5UA 2GBLC 4JT8A 2R5SA 1I3CA 1G8JA 5JDCC 3JQEA 4ETWA 121PA 3FUTA 4FN5A 2F8YA 4CN8A 2GZHA 4GMHA 3GLSA 3JAWB 4WNAB 4TT8A 1E2KA 3I0NA 1VLLA 5G2OA 3UT5B 4H6WA 2F3SA 2N9UA 4FLEA 2X7JA 3E70C 2DG2A 3NEAA 1ESZA 1E3MA 4BSXA 4O59O 4RPJA 3S3TA 4HVBA 2Z08A 3EH1A 1NRWA 4GDFA 1X1BA 4QUJA 1N0VC 3RADC 4FJ1A 4PLZA 4EA7A 1ZXBA 1ODTC 4YJ2F 4O63O 1PBTA 2X8BA 1DEOA 1V26A 4GOND 2FN7A 3AS4A 1B8UA 3OZCA 2EJUA 3MF4A 1KI3A 2CCJA 4QODA 4KX3A 1XZ8A 3PNBA 1CF9A 3M6LA 2HSGA 2HYIC 5DV9A 1OI3A 4C1BA 2C97A 4M46A 4QG3A 3O1LA 5JARA 2PH1A 2HCJB 1OFUA 4BKOA 1Z08A 3FTDA 1RM3A 1JHUA 3CW9A 2JIOA 3UMCA 3ASFA 3TBHA 1VLHA 1S8OA 1LF8A 3DMFA 2AQKA 1MX6A 5SY4A 4EF6A 2E4WA 1DLJA 2YZ7A 4BFSA 3RRUA 2QW8A 4WEQA 1B4DA 5HVNA 3MIIA 2ZXEA 1E64A 2AMFA 1SWVA 4W4TA 5JBQA 1BXRB 2R65A 5HZMA 3OWOA 1WXQA 3NWOA 1SC4A 3FZQA 1KGSA 4DI4A 5KYVA 1HLDA 3T9KA 4YT2A 3G7UA 1TN7A 1DUIA 4I19A 4JA2A 3COVA 4BQNA 5A9RA 1TC2A 3P0EA 3SGLA 3LKDA 4BB6A 1II8A 4JIMA 3UIOC 3CO5A 3PRHA 1MO4A 2J0EA 3HXDA 5HF9A 3IAFA 4NWIA 1ISFA 2OAP1 3OH8A 5M7EA 1VFNA 4PRZA 4UXJA 4HLEA 4WE3A 4NOKA 3LGAA 4WX2B 2QSYA 2PH5A 2LGJA 3ZGYA 4FYXA 3IHYA 1THGA 2GRJA 4KI7A 1OVGA 2PPLA 3BMXA 4G1UC 1CHNA 2P6PA 4RHEA 2IHBA 3C3RA 5ALQA 1VHWA 3M2PA 2AFHB 5BPFA 1J4AA 3GFPA 4FJZA 2E18A 2NACA 5A05A 5HI7A 2OGZA 5GQSA 1YTUA 1E6CA 4GVPA 5DHPA 2A5FA 5T57A 1VL5A 1Y80A 3VVBA 3ASDA 1CUYA 2NVBA 2WJJA 2V7TA 2PX4A 3QWAA 3STYA 4A0QA 3KLNA 3VR4D 1PNOA 1N5KA 3L43A 4HFMA 1VKRA 5JSYA 5T7BA 3TW8A 3PVSA 4JBXA 3ZWWA 3GHYA 3A36A 4OAVB 4IQ8A 4EL5A 3S27A 4Z51A 2AR7A 2IP1A 2ZKLA 2Z09A 3AVYA 4KK3A 3AHEA 1ORTA 4CIYA 4EJFA 4B6JA 1LTKA 4E70A 1L9KA 4JJ4A 4NXMB 1MRNA 3NORA 4PYLA 5A9SB 2PGIA 3G9ZA 3ZW7A 4JITA 1P19A 3MJHA 2ZGGA 1KO4A 3QWPA 1TAQA 1QFZA 4TVSA 3RRJA 4LRZA 2YOGA 1D0VA 4XB1A 4P54A 4R69A 3VNSA 3UUFA 5BOVA 1E3WB 3VRHA 3PDHA 3RIEA 1SY7A 1M2VB 2GD1O 2QGFA 3B6MA 3WGKA 1NN5A 1EFRD 4PG4A 2JCBA 1E0AA 3KT0A 3MA0A 3DKKA 2H1IA 4P7KA 1XN1A 4FTWA 2Q1YA 3DEOA 4UVGA 4UI9K 2V59A 1WM5A 2XEHA 1E8ZA 4CJXA 2I22A 2C2KA 4QBFA 2EDAA 2GEDA 4XASA 2E4ZA 3H2KA 3IMGA 4K87A 5CNKA 3JVUA 1L1QA 3TIIA 2P9GA 3UJBA 1X94A 1NW4A 2F3TA 2J30A 1FP4A 4MJLA 3HVRA 1PD0A 4M83A 4XEHA 1DEHA 2GCIA 2UVQA 5GIOE 2VNJA 1UFKA 2GWRA 3BXOA 3BL6A 4G9GA 4WOJA 2QM7A 2JBAA 4LC0A 4OLJA 4QNMA 1G9SA 3B3JA 1N4AA 3WYAA 1YZLA 3RAFC 3IHKA 4N0EA 3WTBA 3AF5A 3B7PA 4RG9A 4YDSA 4XRGA 4YLYA 1YKSA 3WO1A 2QY6A 1GIAA 4X41A 3EF0A 2XOXA 1SU7A 3TLEA 5CDSA 1M6VB 3E9NA 1KO7A 4XD7D 1WD5A 3S1LA 2R6CA 3QU9A 3FVWA 4NG4A 3FDJA 2AMJA 1R7RA 2BDEA 2LCIA 3TWXA 3QBTA 1E2IA 5DOZA 4W5OA 1TGVA 3ZHXA 5CDHA 1X13A 1R0KA 2ZBDA 3P0RA 1V54E 4PNEA 4JL5A 1HLFA 2ZZMA 2CHWA 3VR6A 3A9TA 1YS1X 4OK3A 4UQPA 4FZ5A 2JGNA 2VDVE 4PN7A 2ZUTA 4IIJA 2VJAA 3LPMA 5DO9A 3ELWA 1GTZA 2W48A 3R3XA 1Y5LA 1MO6A 4U7GA 3RRYA 1N6OA 2QYUA 1KP9A 2XUPA 4FLBA 5ECWA 5LNK1 2GRMA 3ESAA 4MRNA 1VE1A 4K5QA 5AKZA 4XPIA 3QU4A 3UINC 5JW6A 1E2MA 1BMFD 1UFOA 3UMMA 2X8WA 4YRBA 2NQTA 4RIFA 3WR5A 5K3DA 1P1CA 2PO7A 2ESRA 1BAPA 4URUR 2D4HA 2QJWA 3GBSA 5B6JA 4LXTA 2DZDA 4O3MA 1H0HA 4FM9A 4G5YA 2WYIA 3F9IA 1RRCA 1JR6A 2QRGA 1WUJS 2AVDA 4E32A 2B4AA 2PYZA 3PC3A 2P91A 4X8OA 3W04A 1NNI1 4EY8A 2PL3A 3SZ3A 3WMEA 1AGPA 3NFRA 4KPFC 3PEVB 3OKAA 3ZHRA 1JR2A 1WCIA 1D9ZA 1J8DA 2RHTA 5ALEA 4PDXA 3OPVA 1XRLA 3D6HA 3TLMA 2PWBA 2QZAA 3CBGA 1G7SA 5EZSA 3REQA 1Q92A 2NT3A 3WP0A 3T7RA 4RJ2A 4F8EA 1PZMA 3RC2A 4OYLA 1N9KA 1KY2A 2NG1A 4AJLA 5E1DA 2FPLA 5IJ0B 1L8OA 2DHDA 1PUIA 2J9FA 3B13A 1KEUA 3FUEA 2YVUA 3R8XA 1OH7A 3GXOA 1GM5A 3KDAA 1WF6A 1NJ6A 5DLDA 4UFPA 2R8OA 2WXJA 2OHJA 3O8NA 1OV6A 4MXDA 4F3YA 2GA9A 4C9BB 1YVPA 1U02A 4NDNE 5BT8A 3UK2A 3FWHA 3DPSA 3LP8A 2R4QA 1TUIA 5FTKA 2KX7A 3RBAA 2BRUC 1SCUA 4F46A 3H16A 1KVSA 3RU7A 4J0HA 3ZE1B 1G16A 2AJDA 3G9TA 2Q1XA 3ZW8A 3NAZA 5EUBA 3VCXA 4PLHA 3TAXA 2HOQA 5CCEA 3WHPA 3DXZA 3QVGB 3GFTA 3SBSA 1UMCA 4BGVA 1XPUA 1SQ5A 4HRXA 4AY4A 2XE8A 3KT3A 5KNBH 5EX3A 1JNRB 4RMNA 3QY9A 4YFVA 3ZE8A 3U61B 4NEHB 2Q0HA 1SOUA 4TRJA 1NQOA 2WV9A 1FLDA 3IPLA 1E96A 3KDSE 3AM3A 4LV8B 2JL1A 1QG0A 1KY4A 4OSOA 4J03A 4MCAA 1TIPA 5JYBA 3Q3CA 4RM3A 5GM1A 3HU3A 3QFTA 4GOOD 2QUJA 4NE7A 2PPVA 2PEZA 1GTVA 3BJMA 1V35A 1JWAB 5ARCA 4Z9FA 3FUDA 2BISA 4QLAA 4DV0B 3QF4B 2H6HA 4BVFA 1QAQA 3EEFA 2R3SA 2KPOA 1V6CA 3FYCA 4BQRA 4J9VA 3L0CA 2EQBA 4RVGA 3ILYA 4V02A 4G11A 3N76A 1G21B 4LVCA 3HKEA 5CJJA 1OIWA 2FP3A 1R6UA 1A5BB 5KOHB 3EXIB 5F12A 2JLYA 4MQMA 5TXGA 3IP8A 4MQFB 5GJBA 4FMPA 3FGNA 3VO1A 1HO3A 1KK0A 2QN3A 1O0CA 1XJQA 2X8AA 4ZQEA 4NZPA 1Z62A 3JQBC 4K9MA 1QGOA 3D1LA 2P9UG 1W0KD 1PWYE 3C5EA 5E8RA 1TCUA 3ITNA 2AN5A 3HRHA 1Y1LA 5U4QA 1TXGA 2RKBA 2YHUA 2Z4SA 3BKWA 4DARA 3VYVA 2ZRQA 3P4XA 3VLFA 1UG3A 5KQSA 3G2HA 3PUHA 3BK7A 2TMGA 2VKQA 4IH1A 3IAHA 3KU4A 2CNNA 1RYZA 4RANA 3DDWA 2QXTA 3D9LA 2BEWA 3KVOA 4LWPA 5K8TA 1LNZA 4QFBA 2Q7FA 2O5VA 4KXMA 5KO2A 3B6EA 3WOHA 3HWX1 2WAXA 1DFHA 1HF3A 3Q6MA 2AI1A 3LUPA 3X1MA 2DBAA 1SXJE 1A71A 4I55F 5GVSA 1P0IA 2VPZA 3ZD7A 1QBQA 1OW3B 4Z8XA 4E15A 3GVXA 1ZN9A 2XUZA 5C8YA 4OVVA 1FL9A 1GDTA 4CDGA 2IYVA 1GQFA 2OAEA 3OAWA 3EIHA 3THYA 2RKOA 3SJ7A 1AOXA 4BUJA 1TJFA 2LSUA 3K16A 1ZNZA 3ZQUA 3IIEA 5FBWB 3EVFA 5HF8A 1GKLA 1TM4E 1X7GA 4KR3A 1GNQA 5BP7A 1DPGA 3EHRA 1J23A 5F52A 3JZMA 1ZUD1 4LKOA 4EHBA 1LTQA 3P0IA 2KBEA 4N5NA 1XZDA 1UM9B 1U99A 4YCLA 2OEPA 3QEAZ 3M2TA 4ZOEA 3ADPA 3W5SA 2QUZA 2YHAA 1B8OA 1YR2A 1DQYA 1XTSA 3WYGA 4Z86A 4I2NA 1M1YA 4Q3LA 4LRUA 4HTFB 5K45A 1AZTA 2WXKA 2QQ0A 1BC5A 1BD4A 3C3QA 3PFBA 3OTOB 1TZMA 2ZZKA 3EUWA 1OMOA 3QWBA 3B2EA 1K08A 1VIMA 1YJXA 4G5OA 2HMSA 5AP9A 3TE6A 3D6MA 3L8CA 4FA6A 1I6LA 2O8EA 3T3MB 2QTFA 1Y4AE 2V98A 3OPXA 4YIHA 2W98A 1CRZA 4UHHA 3OJFA 4EY5A 3DTYA 1ZWLA 4TM8A 4NH4A 1TCCA 4PBRA 1OFTA 4DMCA 3BMOA 1M2JA 4MRAA 1ZL2A 1DQSA 1TI7A 2OSBA 2WJIA 4BEBA 2HA7A 1W52X 4LF6B 4O25A 1HPLA 4CF7A 5BUCA 2FHSA 2GQ0A 3CUYA 3E48A 1T1JA 2YZNA 1VHQA 1KAEA 4F1SA 3ZWYA 2FO1E 2QI9C 1AKTA 1RPJA 1MIHA 1ZKMA 4EEXA 3IQXA 5J2UA 2D1SA 3GBVA 3FB4A 2AE2A 1TOAA 3V3TA 2UZ1A 1HDYA 1Z0UA 3CONA 4CTNA 3W05A 4I5DA 3O2NA 3W5IA 4PC7A 3BMNA 2VJKA 1U8TA 2XOKA 3FOCA 1PQPA 3F1KA 4IDHA 1YA4A 3L46A 1EIWA 1U94A 1A9RA 4LKRA 1PW7A 3L1JA 3P5SA 4MJXA 4GCOA 4HQOA 4FFOA 2GKGA 1H4SA 5AAOA 4M6WB 4WBSA 4DTIA 4QHTA 5EZYA 4C5CA 1E0DA 1GZ4A 4OCZA 4YAIA 4AXHA 4JJ7A 1GKYA 3W8RA 3S2GA 1G66A 5BMOA 3L0YA 2XCOA 4MUAA 4QXOA 2IXGA 2QL7A 2CBXA 5K8CA 5EE5B 2O7SA 3VTZA 2PZEA 4JUIA 5HKAA 1ISRA 1N11A 4OHXA 1CJBA 3O74A 3DAHA 3DOHA 3TLXA 2VJBA 2QVXX 4G97A 1E6WA 3C7AA 3UK1A 2G9QA 3CUTA 3N7TA 4GMDA 1N7IA 4RQTA 3R0JA 2XSZD 2XZPA 1D7OA 4XXHA 1KU6A 3J80A 3IPAA 4RLSA 4UYKA 3B5EA 4H1VA 5GJVC 2YFHA 5JWOA 4IHQA 4XKCA 2DUMA 1EDBA 3TX6A 2HJGA 1K86A 4CL2A 3R7WA 4IGEA 4X8MA 2VJQA 3VPDA 4IWNA 4G81A 1IDN1 2AI2A 1Z5GA 3KYDA 3E2PA 2WHYA 3TWTA 1TK2A 1D4FA 1Y7PA 3JVIA 1FP4B 5DX1A 3RRMA 4RVDA 3LW7A 5H3LA 2F00A 1E3TA 5LCWJ 5HYVA 4MDHA 3FCUB 5TR9A 1RWMA 3LX4A 3M3PA 1CY0A 4EQ6A 3MGKA 3FUCA 4KR6A 5AW6A 1M76A 3HVJA 3KWLA 4F21A 3QNWA 2AW3A 5EIDA 4D9CA 1LWOA 2M6RA 2LTAA 1L3IA 5K0JA 2G4VA 2Q5FA 2P5TB 3FBWA 2V5AA 3OWHA 2E4AA 5D1NA 2GUGA 1V5GA 4QWMA 3ABKE 5DYTA 1SQ6A 2ES4A 1KP3A 4KYVA 1KAOA 2H1FA 4TGLA 4L7QA 1Q7GA 4PV7A 1KEEA 2G9NA 4ZVVA 4GRAA 4BNTA 2EHJA 1FZTA 3CKCA 4QEKA 3V2OA 3AONB 3M0EA 4ICIA 5ECGC 5LYJA 1CEXA 2B2NA 4MUFA 1XMQB 4ARSA 1SIWA 4FDAA 1YA0A 1N1DA 3L4SO 1KMCA 4DBZA 2I4IA 3D0RA 1ZAKA 421PA 5A4IS 3NZSA 5B1AE 2AQ8A 2C3UA 2C4WA 1SIOA 4QARA 4OGFA 1ORWA 4CKZA 1TLTA 5KSWB 1Q12A 1WABA 5COAA 4BKMA 3ZV6A 2Z8YM 4FMBB 4YR9A 3TTXA 3O0TA 4B6EA 3KKLA 3TCKA 1LK7A 1FBTA 4ZARA 3QVJA 4J1TA 3HK2A 3C43A 3EQ7A 3PWTA 3C4JA 2ZUVA 4BB0A 1VJ0A 2EW2A 1OUMA 1H6AA 5EZQA 4OMUA 4HTAA 2JEKA 4RF4A 2R1UA 5AW8A 1A5TA 2VA8A 4UJ3A 1GDDA 2Q7DA 3PRZA 3T7SA 1ZD2P 2C4HA 2J87A 2LO6A 2QZJA 5DCYA 1H4QA 4YVOA 4MZXA 2WNSA 1Z12A 5H9WA 5AJTA 3PQ6A 4G89A 5D3QA 3U7IA 3OX2A 3L0DA 2GLTA 1KEPA 3DW1X 1OIVA 2Y6UA 1TVEA 4KHZA 3C6MA 1BVRA 3AAAC 2C8KA 1T5OA 2RG7A 3RO3A 4C01A 5HKPA 1W8DA 1S2LA 1KQPA 4LE0A 2R48A 3IODA 3FNQA 4E6HA 4Z99A 1JEQA 4ND3A 3REQB 3WAKA 4ARBA 4CKBB 3MAJA 2XTZA 1T1IA 4O2AA 2DR2A 3TQRA 3HVIA 1IWOA 4EA9A 4Q6BA 2FWPA 3KAEA 1AV7A 3TG8A 4APFA 4IYPA 3BK2A 5J08A 2J3JA 2QZPA 4M1SA 2Q2OA 3NC4A 3QMMA 3O1IC 4ER3A 2WV7A 4WZBA 3LH5A 2C77A 4NCBA 5JD6A 4QVKA 1QMPA 4ONEA 4BLRA 2V0PA 3ONNA 3T8KA 2BEJA 3CVXA 4WY5A 3GDOA 3RODA 2QZZA 1QJCA 3L4KA 4O4JA 1X7ZA 1E94E 1ONOA 3ZHUA 3E18A 1HQKA 3FPAA 3GG9A 3L1IA 3OICA 4KQKA 1XA4A 4BO7A 1JYEA 1M7BA 3QWVA 4QUIA 3EB9A 1FDIA 5AIJA 5AKGA 1I6MA 3HKCB 3D8BA 4R9VA 4Y1RA 5LN1A 2ID4A 4RPHA 3KJNA 3QLEA 5JT1A 4C48B 3IHWA 5MGBA 3GDGA 4EO9A 5GJCA 2FEXA 2IS2A 1VKJA 3LPCA 3VR5A 4H7IA 2C83A 2EQ5A 1G6OA 3L82A 1US8A 2CVQA 1UK8A 4W82A 3NVKI 5TDHA 2FR8A 2G8NA 4ALKA 3AOEA 1O0BA 1D8AA 4N7MA 1WTCA 2GZAA 4KO1S 4D0SA 1HTTA 3ZUPA 5IY5E 3CJQA 1RXIA 4HB4A 5BNWA 4F56A 2FA9A 1NX6A 4AZVA 4DADA 3MBIA 1WOYA 1CY2A 3NKLA 1SCQA 2RAFA 3MWDA 1ZSNA 3RFCA 3FR7A 3T3NA 4WKGA 2BZGA 3JVDA 4ZVRA 1UBUS 1YQWA 2PGOA 3PRYA 4BNUA 2W2LD 2XNDD 3FNEA 1QQAA 1PEKE 2JIPA 3MTDA 1EDUA 1XRPA 2CHUA 3H0KA 2Y1LA 3CEAA 2YXBA 2RBGA 3D6VA 4NAHA 4ZQIA 4I46A 1XZHA 2GRPB 2PH7A 2GAJA 4TSFD 5FBQB 3GVHA 1DPFA 1DTSA 4BTLA 3O7WA 5J63A 4CM8B 4WH0A 3H2SA 1GA6A 2RGBA 4WCFB 1HDZA 5HMLA 4RZ3A 5L9AA 3HKEB 1CQXA 2G06A 3O2JA 1UR5A 2PM6A 5AD1A 1SBTA 1F1BA 4DMRA 5EERA 4HADA 2Q3HA 3NJRA 4DDUA 1YL6A 1EFLA 4YUAA 1GL3A 2QORA 3HBJA 2PQ0A 3CLUD 2HWYA 4FDLA 3OEED 3I9OA 2O4UX 1JHRA 5FO0A 3EVGA 2JFVA 1D4OA 2BLNA 1GGEA 4YRTA 3C6XA 3GNQA 4GBJA 4J7WA 1RMYA 2QVCA 1E2FA 4JQOA 4ACKA 4D0RA 2NVOA 3DH0A 4O29A 4YAFA 3ANNA 1F5NA 1Q1EA 2PUEA 1P9LA 2KCVA 3MYYA 1DQPA 3CF2A 2YNQA 1Z7GA 1U2QA 4OQQA 2BGLA 2BMAA 1U8ZA 2WTAA 3L7IA 3IGFA 1YUBA 4R3UC 4YMVA 3IX7A 2ZJ8A 4UDXX 4C0WA 1Z3CA 1WM1A 4MLPA 3ORQA 1XWWA 3V8PA 1YBHA 4LV5B 1XZNA 1N0WA 3GAFA 5CD9A 3ISMC 2OXIA 1WP4A 2XA1A 1VDMA 3A1VA 5B6IA 1U2SA 1LD3A 3THYB 5TIIA 2ZUDA 3ZWMA 4XB6B 4DX5D 1E7WA 2P3QA 1SEPA 1WCWA 2Q1SA 3BWXA 4U00A 1K7FB 5FD8A 2CE2X 3J81k 2V9ZA 3CM0A 4PAGA 1B41A 3G6WA 1JNXX 3EXAA 2BGTA 4LY9A 3K0CC 1U63A 4Y9UA 1RMTA 1OIXA 2ZSHA 2CYBA 2DWQA 4UUPA 4RGQA 2EX0A 3TEMA 3KQPA 1U31A 2ZRAA 5CGQB 4YK7A 1QZXA 2NXNA 3LQKA 4UM9D 5EXSA 1JIJA 1BU8A 1AXEA 4B7ZA 1XP5A 3DNPA 3PSHA 1G8SA 2FSGA 4MUIA 4UAJA 1WW2A 1E66A 1XZQA 4GWGA 1EGQA 1RM0A 4LZPA 5JAHA 4YRAA 4J94A 1FS5A 3T8MA 4WINA 3K1JA 4RLQA 1BN7A 2QTZA 4L28A 3PVZA 2YWCA 1FQOA 2A9PA 5KTRA 2REOA 3MJ4A 3NU1A 3L6RA 4NCJA 5EJIA 2O8EB 3DT6A 2QAGB 1YU9A 1E2DA 1Y7IA 3ZXPA 3GH1A 4OHYA 5CYGA 4FX5A 4URWR 1RSZA 4IX9A 2VIIA 2I03A 3KAQA 4X7MA 5DNEA 1XDGA 3BMOB 1A76A 4ILGA 5CD1A 3ZYKA 2GZ1A 2IT1A 3B82A 2PXCA 2HHJA 2ZYGA 3R8CA 2QRVB 4DLYA 3EMKA 2K87A 3WVNA 4DCUA 1LUAA 2L19A 2XQVA 3AEXA 3LNCA 3AINA 3KR1A 1GOTA 2WE7A 3MM4A 3ZE0B 2CGEA 1P1JA 1GVNB 1I1NA 1Z4OA 2ZWMA 2Y6VA 2H2GA 3I30X 5IF3A 1L3CA 1V5EA 3E7XA 2GILA 3JWPA 3OT1A 2QP9X 1P6XA 4C0EA 3ND5A 4OQYA 4QE3A 1LSUA 2C54A 1K68A 1JAXA 3HI6A 1BWQA 4J6FA 4MKRA 1DCTA 4ZV4A 3SS7X 3QB2A 2XKAA 4O6FA 4FHDA 4DCOA 4JJZA 3BXFA 3F9RA 2RGUA 3EE6A 5HKOA 3S8YA 1U4NA 3M82A 4F4JA 4R7LA 1KS9A 1I1QB 3N59A 2BT4A 1U7IA 2GPAA 3FP3A 4AUKA 3DWIA