4N3AA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (1-26)e10a
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3aA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3aA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3aA03
4LDPA 5FTPA 1P4HA 1JIUA 2GEKA 4HOSA 5GPBA 4AN4A 1Z6QA 4ME2A 1ZU2A 1NLMA 3DDSA 4L22A 2IV3A 4CGWA 2R68A 2IF4A 2AW3A 3U3WA 2F3PA 4CTNA 3DD1A 4M60A 3CK8A 2X6RA 5TMDA 1H5UA 3OTGA 3LYAA 1NA3A 3TOVA 3MKRA 5M72A 2QZSA 4YI5A 1PSWA 3HBJA 1O6CA 3L79A 1FC0A 2IV7A 3NF1A 2QN2A 3AS4A 5JJ7A 2HY7A 2GW1A 5BT1A 3MS7A 1QQEA 4J8DA 1FU4A 3BCUA 5CCMA 1XV5A 4W6QA 3UUXA 4BQFA 2XCCA 2XCIA 3E3NA 3L7AA 1RRVA 2GT1A 2AMVA 3CUVA 3IAAA 1PN3A 1WUYA 3RJVA 5KJNA 2QNBA 1ZBPA 1L6IA 3H4IA 5D01A 1L5WA 3FWVA 3G2KA 3LKUA 3OKCA 5HXAA 4I17A 3T3GA 3SYRA 4GA2A 4I9CA 3CK7A 2KCKA 4N3BA 3H4TA 2BFWA 1AHPA 4N2SA 1PNVA 3T3EA 2VGYA 1ABBA 3MT7A 2OOEA 3HBFA 3IA7A 3QWPA 2FF4A 4HLNA 2VYIA 4EL5A 4I9EA 1IXYA 4MHSA 8GPBA 3E3OA 2VG8A 1KT1A 3QWWA 5ARGA 3VTYA 2WQHA 2FEZA 2OFFA 3UPVA 3UYKA 4AMBA 3Q15A 3Q4AB 1C50A 2C0LA 1XOIA 2FETA 3OY2A 3MRTA 3RU0A 3S2UA 1HZ4A 1GFZA 4N9WA 2LSVA 6GPBA 5TMEA 2PYDA 4G23A 4MRAA 3MSCA 2KATA 2XGOA 3E3LA 3OT5A 3MV3B 4NC9A 3KAEA 2PL2A 3ULQA 1QM5A 4NEQA 2KCVA 5CCLA 4WHMA 4H7YA 1Y8ZA 4G26A 4KQ1A 1GPBA 4CTMA 3KD7A 4WACA 4N3AA 1NVKA 3Q5MA 4FZRA 2WTXA 2GPAA 1C8KA 4IN3B 4F96A 2YHCA 3DZCA 3HBNA 2SKCA 3WADA 2XMPA 3RSCA 1QKJA 3EBOA 2Q7FA 5FZQA 3ZN3A 3U4TA 3ZCPA 1IHGA 3QDNA 4J0UA 3BCSA 2KC7A 3CEHA 5FJYA 2VCHA 3QKYA 3MT8A 3L01A 4UI9C 1Z6PA 3SYMA 1LWOA 3NCHA 4N5CA 2C1XA 4JA9A 4RBNA 1JG6A 4RIGA 5DXFA 1FS4A 3BCRA 1KLXA 1JEJA 5JJ6A 1VGVA 3MBOA 1NA0A 4GZ5A 3CUWA 3RSZA 3RKVA 3DDWA 1Z62A 3CUUA 3TG4A 3AS8A 2BISA 1E1YA 4EQFA 3NAZA 3WAGA 4M7PA 1GPAA 4BQEA 3QHPA 1P29A 2X0DA 3MTBA 2GPBA 4WUYA 1Y6FA 3CKCA 2PQRA 2ECPA 4MHOA 3UYLA 1HH8A 1J39A 3ZFWA 1NZFA 5DU2A 3OKPA 2R4UA 4GPBA 4BFCA 1PC2A 4NESA 3LCAA 4JL0A 2PYIA 1SXQA 5HI7A 3ZPJA 1FTWA 1Y6GA 4X7RA 2JLBA 2IFUA 2QLLA 2QN9A 4EL0A 4B94A 1FU7A 3ZGQA 3D1JA 4NQ0A 5FZRA 1EM6A 1KTIA 3MS4A 3EBPA 2FBNA 3QWVA 2QFCA 3G2IA 3T5TA 4N39A 3VUEA 4XIFA 3MV2B 2H1FA 2QRPA 4XI9A 5IKPA 2XA1A 5LCWJ 2GPNA 4BT9A 4U07A 3RIBA 3D0RA 1A8IA 1Z8DA 2SKDA 3ZCRA 2XGMA 2ONDA 4UQZA 1RZVA 2F3QA 2XEVA 5AYWD 2IEIA 4RIIA 1WUTA 2VGXA 5BNWA 1P2DA 3S27A 4GZ3A 3IEGA 5CHEE 7GPBA 1UZUA 5D0QD 3OY7A 2G9UA 4BTBA 1P2GA 5IKOA 2PQNA 2C0MA 3TAXA 2KS6A 3ZCUA 1FU8A 3COPA 4U0ZA 1LWNA 4YNDA 4W9RA 1K06A 2PRIA 4GYOA 1JIVA 4WADA 5FT9A 1UQTA 1GPYA 4AY5A 3VDNB 4F97A 1A17A 3T7DA 3SF4A 4GYWA 2AVPA 1PYGA 3OTHA 5TMBA 3OTIA 1GG8A 2QRGA 5JTUA 3G2HA 3CKBA 4KQ2A 4JA7A 1WV0A 5EX3A 4PQGA 4CTOA 1P4GA 9GPBA 4NRHB 2UY1A 4AMGA 3CX4A 3LY7A 3LY9A 3RT1A 2FFRA 3AMVA 1OUVA 4HWGA 1NOIA 3BD6A 1XC7A 3S29A 4N3CA 3MA5A 4G2VA 2H1HA 2G9QA 2Q6VA 1M5RA 2QRHA 3CEMA 5G05J 1L5QA 1W3BA 3E4BA 3Q47B 5KJLA 2F3SA 4MI3A 4EKYA 2V5FA 4G1TA 4XI0A 4HOTA 1E4OA 4KYOB 3MS2A 1E96B 4QLBA 4FKZA 4RIHA 2UY1B 1XL1A 2BGUA 5G04J 4RIEA 3TGOA 3WC4A 1B89A 3ASDA 4WNDA 3TG5A 2LSUA 3MRXA 2XA2A 3Q3IA 5A6CA 4Y6WA 4BQIA 4HORA 3OKAA 4HOQA 3MEKA 3ZCSA 2IYFA 2R60A 3ZCTA 3CVLA 3LPZA 3HYMB 3PE4A 1C3JA 4G2TA 1HLFA 4I2ZA 2C1ZA 2GM9A 4Y6CA 1WV1A 3CV0A 3CK9A 3GW4A 1GGNA 4UQYA 4U0UA 3GPBA 5JTTA 1JG7A 3ZCVA 1WW2A 3G2NA 2XGSA 2O6LA 1UQUA 4MICA 2YQ8A 2E2EA 4GA1A 3BD7A 3NB0A 4F9FA 4RG9A 3GZ1A 3Q49B 2SKEA 3CEQA 5D0OD 3NP7A 1FCHA 4X7MA 2PRJA 2C9ZA 2BUGA 2ACVA 1IIRA 1AXRA 1L5RA 3T3HA 1YA6A 4GZ6A 4LEIA 3OXLA 3TSAA 5TVGA 4M83A 3S0JA 4BT8A 5DBKA 1RZUA 4KXKB 4N2QA 1NZDA 3G2JA 3O3CA 4YUAA 5LQDA 3PE3A 1NOKA 1HXIA 3CUYA 1P4JA 5G05C 3SZ7A 2PZIA 4WNGA 2HYZA 4F3VA 1ELRA 2XA9A 1FTQA 2UWJG 2X6QA 4GCOA 4G24A 2P58C 1YA0A 1XL0A 2LNIA 3NC4A 5G04C 1EXVA 3CV3A 5A7DB 5JJTA 4U0SA 4X7PA 2QLNA 4WNFA 4GA0A 3LY8A 4J8FA 3QKWA 2R5SA 2HR2A 2X0FA 3FFLA 5KJKA 3S7FA 1TJCA 4BTAA 2IW1A 3QOUA 3R9AB 4APOA 4UI9K 2WPVA 2AZDA 2QN1A 3RO3A 5BW8C 4HOUA 2Y4TA 2VSYA 3Q3EA 2VSNA 4YI3A 4MI9A 1XKXA 5HQ8A 4EJ2A 3BEEA 2YJNA 1BX3A 5EKQD 2R4TA 4CDRA 3RO2A 2JZCA 2C2LA 2FF5A 2QN3A 4U04A 1FTYA 3CVNA 4H7XA 3ASHA 4RIFA 4LEUA 4GYYA 4GPKA 2Y4UA 3BEOA 3FP3A 2DBAA 3ZHEA 3N71A 2MHKA 3PDNA 2PQ6A 2IYAA 3OXGA 2VGXB 4REMA 1XNFA 3VDMA 1NZNA 1Y8MA 2L6JA 2IUYA 4I1AA 5ARFA 4A1SA 2NC9A 4KQMA 4MI6A 3T3DA 2QN7A 4X6LA 4CGVA 2R66A 1F6DA 5C1DA 1L5SA 3G2LA 1QZ2A 2XCUA 4EKEA 3GZ2A 2J9QA 4UI9J 4ABNA 2BGTA 3C4VA 3MQFA 1YGPA 3S7BA 3ZHEB 1C8LA 3GYZA 2QRQA 3D0QA 3VTXA 1L5VA 3WXXA 2VCEA 4RELA 3L7DA 2ATIA 2G9VA 1P2BA 3S28A 2GEJA 5LCWC 3EDTB 1F0KA 3MTAA 4UQXA 2P6PA 2AV6A 2IEGA 4G25A 3KS2A 5FZSA 1K08A 4BWRA 3L7BA 5DLDA 3CVQA 3OXFA 2QLMA 3CVPA 1B4DA 2HO1A 3ZCQA 1V4VA 3MT9A 2XPIA 3NPAA 3UQ3A 5EX0A 1FA9A 3FROA 3O48A 3RHZA 2F9FA 3CUTA 3Q3HA 4J8EA 1WW3A 4AIFA 3JYSA 2QN8A 2VQ2A 2ASVA 2XCBA 5KJMA 3K9IA 1WAO1 3ESKA 4I2WA 2FO7A 2G9RA 3HBMA 2F3UA 1ELWA 1SXPA 1NOJA 3T3IA 3AS5A 3NP9A 2X0EA 2JJMA 3GUHA 1L7XA 3S7DA 4AY6A 3URZA 5I45A 3ASGA 1IYGA 3BD8A 3S7JA 3MTDA 4GCNA 4Z5XA 4RG6A 1GZ5A 3C4QA 4RENA 4WNEA 4AM9A 3C48A 1JIXA 2QRMA 3L7CA 4KBQA 1KT0A 1WM5A 1P5QA 2GJ4A 5ENZA 5DIZA 2ACWA 2FI7A 4O6FA 4YVOA 2C4MA 5D00A 2KCLA 2ZB2A 3ASFA 2I6HA 3BDAA 3MRVA 3CEJA 3VUFA 4JHRA 4YVQC
chains in the Genus database with same CATH superfamily
5ALZA 4F6RD 5I9IA 5AVXA 1XZGA 3IPXA 4IJVA 1K98A 4ICIA 3BWYA 4BVAA 3K0BA 1DEOA 3GPLA 3M5DA 5DB4A 5DSZA 1G4HA 2Y1XA 1T9HA 2Z8YA 2ZWOA 1GUAA 1N5KA 3EXFB 5D01A 3DM9B 3NTXA 1W0JD 1BRMA 3JPWA 2NU8A 3E7WA 4JVNA 4RM3A 4ENWA 1OJLA 4ZU1X 1LSJA 5KSPA 4YBZA 4RTKA 1C9KA 2E1PA 1USUA 4RD6A 5B64A 3RU0A 4BX2A 1M0TA 5K3FA 3UV3A 2HJ9A 5D6NA 3ZVVA 2W90A 1TU4A 2KATA 2WVJA 3BN3A 2PGOA 3QKRA 4TV9A 2Q27A 3JAMA 3UWSA 2J3KA 4N5DA 1M1ZA 3IAXA 5CB8A 1W4BA 5B3SE 2PUDA 1XHLA 3IQDB 2XD9A 1OCOE 1ONOA 4H7IA 3NM6B 4WT7A 3PFCA 3FUDA 1J0BA 1JXAA 1S3GA 2ISSD 3F73A 2V7VA 1ABFA 3TR0A 5C1OA 2C2OA 3D3MA 4K1LA 2AJDA 5DNVA 1SIUA 4PO8A 3ZK8A 2GXSA 3DOCA 2R6JA 3KPYA 3U37A 2R4UA 2C07A 2HWXA 4BFUA 1E8OB 4CZ2A 1MFPA 5F73A 4XPZA 4YRGA 1C3LA 2QRPA 1D8EA 4F5YA 3GEMA 2HA3A 3FVTA 5BQOA 1KDOA 2QAGC 1U2TA 5EMMA 1PK9A 1CJTC 3AUYA 2FG6C 1N92A 1K8XB 5JH7A 3RFTA 4OHMA 2Y1FA 3AERB 2PZJA 1B8PA 1YB1A 1I6MA 2C2HA 1LA2A 3NBUA 1FEZA 2C2XA 1NT4A 4J9UE 4MEAA 1VG0B 2O05A 1QQTA 1XA3A 4D45A 1XTSA 1ZM9A 2VTKA 1XTZA 5FYQA 1XZ8A 3P4YA 1SIBE 1TW3A 2XQGA 1FYFA 4FLFA 2Y1LE 5CTAA 2VDWB 5IDVA 1Q7EA 3WMRA 3EGXB 4A9AA 1LW7A 3TG5A 5LQMA 2XPYA 2ZI9A 4FZVA 4HOQA 3OPNA 4EJMA 4F1JA 3EZLA 3F74A 1HGXA 3GW4A 1E5TA 1AU9A 2YC4C 4MW5A 1JFVA 1EJ6A 2QZAA 3HXTA 3LDFA 4OOEA 4EY7A 5KEIA 2IEAA 3QKSA 2GHTA 3EVEA 4FYIA 4PICA 4RQTA 3V4ZA 3PE3A 2PGNA 3OEED 2CNWA 3IELA 4B31A 3G2MA 1FXUA 1SC3A 2WLTA 5IAEA 1EXMA 3RVDA 5EQJB 3RVOA 5JECA 3BM5A 1P7WA 1NPTO 1NY5A 3BMCB 2H0RA 4C6RA 4BYGA 3A6PC 2DPGA 3B8EA 1CRWG 3OG9A 2M98A 2P4HX 3CZAA 3EJ6A 4TTTS 4F1SA 3JWHA 2AFHB 2FW9A 4QFDA 3ZGVA 1ZI8A 1XMXA 4QG7A 4Q4AA 2YWGA 3QUCA 4OFBA 3BDVA 2D62A 2FMHA 1VM6A 1LLQA 3EF3A 3T5MA 2V4HC 4CDMA 3ENNA 3VYTB 1LVHA 3OCWA 4X00A 3Q3JB 2GM4A 4E85A 3WICA 1GXSB 2TS1A 3AUFA 2HA2A 3LCRA 1T2CA 1ORWA 1WUJS 4UPVA 2OORA 1X8JA 4JOBA 3RF6A 4HWKA 1QQAA 2Y1KA 2XHZA 5KNBA 4CFYA 5DK4A 4OO3A 3WV5A 1LGYA 2XQVA 3E48A 4FYPA 4WV3A 1UWVA 1ZB1A 4D6PA 4Y6QA 2CHXA 2AWOA 4DXHA 3UAGA 4I3GA 3PI6A 3EF1A 5L7WA 4H60A 3W3AH 5LQRA 4JHRA 3FNHA 4BNTA 3S70A 5KU7A 4RDIA 8ABPA 1YFLA 4HUQB 5ENRD 4BO6A 3G9TA 3ROPA 1KFCB 1S1MA 1W1UA 3TOVA 2NM0A 4KIJA 4L50A 1AF7A 2BR5A 5B1HA 1R88A 1R6BX 3K4HA 1QRRA 4QT0A 2X5OA 5DTEA 2NUTA 5SY4A 1CXZA 3W6NA 3JQ9C 1J0DA 1S3FA 1IMOA 1AHPA 2XBLA 1JMYA 2GYVA 4GGOA 5DTMA 1G3UA 3G59A 3HE3A 2VPYA 3IJPA 1JSRA 3QWWA 1E9EA 4LYYA 2JI9A 1R3UA 2LDXA 4I8DA 5EIXA 1GFZA 3Q8LA 4MVJD 1B2RA 3SFXA 2ZUVA 1B15A 3ULQA 1E9VA 5LU8A 4XAQA 3ZUGA 3HSKA 4I55A 2JLYA 3B60A 2P3OA 1CR2A 3HJAA 1P39A 5GINE 1Z8FA 2WNSA 2Z04A 3VVCA 2I4OA 2G77B 3B20A 3UICA 2R00A 4LX8A 1D1PA 1PUIA 4BMNA 3G82C 5KOYA 1C0LA 4J0DA 1HKHA 2QVCA 4MLZA 3ONVA 4ITVA 4KWEA 2OCAA 3VKUA 1SQMA 4OM7A 4RK4A 3TW8B 2XV1A 2EWWA 1SZCA 3MAJA 3IVCA 3FYUC 5LM3A 5C7LO 4UASA 2G5CA 1P29A 2MDTA 2RE8A 1JNZB 1P7PA 1QGAA 1RRMA 1X80A 2OFOA 1DC7A 2FPXA 1FXSA 1ZAKA 1JHYA 1DLIA 4QOJA 3C5CA 4ZCMA 1COWD 2V4ZA 1JIIA 3KXPA 2ZULA 1Y98A 1EHYA 4JJKA 1BH6A 4FEYA 1V2HE 1Y9EA 4ND7A 5C8DA 5EP1A 3DKPA 1GVNB 1SOUA 4HEA1 3SEFA 4Z4CA 5B4VA 5FEUA 1DZIA 3WG7E 1CWUA 1TADA 1JPJA 1PZGA 5A9SA 1X1DA 2REQB 1IZ8A 1OCCE 1R12A 4Q3LA 1VLZA 2IOFA 2D5IA 3OLVA 2ZIXB 4ZCPA 1GDDA 2ZVDA 3GLKA 5EP4A 4OGWA 1KI8A 1ZUHA 1TJ5A 3VNUA 2HO5A 3IERA 4U9IS 4P86A 3SC2B 3ZNGA 4KBYA 1ABEA 1WCYA 1Z9BA 2O6LA 3R0XA 5E4YA 3ITDA 1G66A 3GVHA 1U3UA 1CZOA 1DUIA 4ZZ1A 5K01A 5CIYA 4D4JA 5JDIA 2RKKA 1VRVA 3FUXA 2ENWA 1YS6A 3I62A 2XPCA 2LDBA 1BCRA 3I42A 3G2SA 4O2BF 4CJXA 1OX5A 5FLYA 4WNFA 4BMYA 2PH7A 5JXIA 2FHSA 2HNBA 1PQPA 2O8BA 3LDUA 3LH5A 1D09A 3TLAA 2DKNA 4FE3A 3UC9A 3FMPB 2FF5A 4E2XA 1RFLA 2QAGA 2I3GA 4ABTA 4K8OA 3L40A 1IFXA 1OLSB 2E4ZA 3PEVA 4UFPA 4XX0B 5F3WB 1MAVA 2XB8A 1RXCA 4RHTA 5IVDA 2VJOA 3P0EA 1D9ZA 4U63A 3TDKA 4UI9J 4D43A 2RHRA 2WYIA 1F20A 2AK2A 3WXBA 2P9QA 4KLZA 2BJVA 3PLNA 1NQWA 2TYSB 3UKDA 2HTFA 4YIHA 4E08A 4HBDA 4ZODA 5AN8A 4KOAA 4MDEA 5IKEA 4R05A 3MVEA 3HVUA 1D6JA 2ZDGA 5BW4A 1N1MA 1W29A 1HNXB 2IQCA 1WEKA 2G5TA 3AETA 2F3UA 3FOBA 4KPUA 2CXQA 3IH5A 4QQNA 1US8B 1T2AA 4YO8A 5DM4A 1JA1A 5C5DA 4HGNA 1LI7A 3VAYA 3DTVA 2GRRB 1ECCA 1XU4A 4M9SA 2IXAA 3ZGYA 4ME2A 3HCFA 4LGMA 5ANRA 3NBZC 4M0PA 5MDHA 1LB1B 1D1SA 1WRBA 3E5HA 1JU9A 1JFTA 2FPKA 1TJ3A 3F5QA 4JDUA 1R6UA 2V45A 1SC4A 1FLDA 5DYWA 3B1XA 5IT9A 1U7OA 5JZVA 4QHYA 5M5BA 3N2IA 1GEEA 3R40A 4Y2GA 4NBWA 4N3BA 1E5XA 1N3LA 2ZTUA 2B8JA 5TQ0A 1H66A 5IAGA 1C9JA 3AJ8A 2WXQA 3VNQA 3Q75A 4JASB 3A1EA 3TN7A 2IOYA 3ANLA 2R2GA 4JK3A 2KCVA 1GZ3A 4KP7A 1R6AA 1ZSNA 2VPPA 2D0DA 1AQYA 1ZG3A 1XIVA 2B30A 3CCCA 4ACBA 4P0TA 1TQ6A 1TJ4A 1BDJA 4AWBA 1F4VA 3U62A 1EF1C 2OZLA 2ZWAA 4DC9A 2C77A 1YBMA 3I83A 2HGSA 3R3UA 2PHZA 4QDUA 2C00A 3K0AA 3QLEA 1PL8A 1T0PA 4GX0A 5ENOD 3P9XA 1Q22A 1RXVA 1JDPA 4ZHQB 4PY2A 4UUBA 3NV9A 2WFLB 1V5FA 3MJ4A 3I01M 5FZRA 3LQQA 2JIQA 2H1FA 4M0CA 2YJ5A 5D86A 1VJ0A 5CEAA 2QPLA 3PC4A 4LHSA 4POOA 2WIFA 3DQQA 1O5TA 3PD1A 2WQ7A 1PFVA 4MYSA 1OHHA 1P2GA 2ZBPA 1JBEA 1YR2A 2ZYSA 2PLNA 1P4AA 1YZGA 1YFZA 4LVCA 2DWCA 3KE9A 3OOWA 4CM6A 3M6AA 3SIPA 1I4WA 1LS1A 3TLMA 3KQLA 1ORIA 1KI6B 4HHEA 1CRZA 1W3BA 3ROGA 2XVXA 3VGJA 3TGOA 3DULA 5PNTA 3QEJA 3OQPA 3QG5A 1ORHA 2BDEA 2Y8EA 1R50A 5FQ4A 2OHFA 1SXJE 4PXAA 3DBLB 1C9YA 1AO0A 1YNOA 2UAGA 4PIMA 5JNRA 2BYTA 1M34A 3PB3A 5JW6A 3QVJA 4HGOA 4P32A 2FUCA 1IZYA 1EEXB 4ZK6A 2YR0A 3P9RA 3TLJA 4D8XA 3OXLA 3FF1A 1OBOA 3DEOA 1OWLA 4OEHA 1EFDN 3E9CA 5L3RA 1EWKA 4XM1A 4QYTA 3H05A 1QKKA 3B9PA 1N0UA 5CVTA 5LLSA 4I1SA 4L3OA 1TA4A 2O3RA 2L19A 4RKEA 3I8SA 4O60A 3T0GA 3UMFA 1E2GA 3A9CA 4RJJA 4J6EA 5JZ9A 4KN9S 5KJKA 1ZMTA 1N6HA 1XQ1A 3RO3A 3BHIA 4PNHA 4Q4HA 4GLFA 2Y77A 2P62A 5IFKA 4OQPA 2B20A 1W4ZA 4C7KA 4XDGA 1YZFA 4R69A 4LEUA 1QVVA 1HH4A 3NU1A 1DWUA 1LSUA 2EAUA 1YR8A 2C88A 5COBA 3WO1A 3ILHA 2JEOA 3AG6A 1EHCA 3X44A 4AX8A 3CF4G 1K7EB 3I5XA 4YCNA 4ME6A 4N7BA 1JHRA 3OO1A 4HFGA 3BTSA 4KSYA 1PT9A 4H6PA 1K08A 1B23P 2HK8A 2OPHA 2DWQA 2ZETA 4YAFA 3IVXA 2JGMA 1AK9A 1II8B 4J7UA 4G1FA 2Q3FA 3TOXA 4BE9A 2X7HA 2QUKA 3FPGA 3PWSA 2Q5IA 3EMKA 4KWHA 1M2WA 5IX8A 2GROB 4LUNU 5IYZA 2BN4A 5JCZA 1YBHA 3TAHA 1VJDA 4LCEA 4Q1EA 1M7HA 2JIOA 4AAYA 4BC1A 1U3WA 3IOYA 4NXMB 4D9JA 2Z5LA 5A05A 3W5SA 1QHSA 4HRMB 3LRPA 1RHKA 5TJHA 1SCQA 4UQPA 3HV0A 4GOOD 4M60A 2Q2OA 2FO1E 5DHFA 2A1UA 1IG3A 5CPFA 2H06A 3RS4A 1HU3A 3A04A 1TM4E 1OV6A 1Q50A 1SAYA 2X7XA 4DBLE 1GA6A 3TBFA 5JCOC 3TOCA 4QXRA 3HP7A 2ERXA 4I17A 2BEUA 3ABIA 1ABBA 5F78A 1KSGA 3BGWA 1GSIA 5I3CA 3SBSA 1JAZA 1TD9A 2NT3A 2G4VA 1NFIE 2NUAA 3V30A 5KREA 3R3SA 1RMQA 4PIVA 4MBGA 4L51A 4A8JA 1NX9A 1QIMA 3OFND 2JCXA 3GGSA 5LXTF 1GADO 1E2DA 3ZUPA 4TX1A 4Z9AA 4ZYLA 3MJCA 4ZOAA 1KYWA 2IELA 5DE3A 1MVNA 3V4VB 2RMKA 5EIOA 3TCXB 1E61A 1IEXA 3DZGA 2EXXA 2G04A 2WD7A 2Z2JA 1Q1BA 3CUUA 2FEAA 2H3EA 4BO2A 2H6EA 5BPPA 4X95A 2XZDG 1DKOA 1OROA 5C37A 4WUYA 4D42A 3OOSA 2DBRA 4Z8XA 4NCHA 1G6Q1 4US2R 5K3OA 5EIDA 2KYRA 3G2IA 3V31A 2BMJA 4LJRA 5KO2A 2ZKIA 3BIJA 3D0RA 3ZXYA 4RA9B 4U7WA 2BFBB 2XEVA 3OC6A 3NHRA 1O6FA 5TXGA 4UTRA 4MR7A 1G19A 1VTKA 4HGZA 3NAQA 2QV0A 1YVEI 4NMHA 2R17C 3E3AA 4L3VA 3SZGA 1LK5A 1WE2A 5IC6A 4FFNA 3DSXA 2GD6A 1VDYA 3RV4A 1P8AA 1I7QB 4B32A 5AFSA 4G0YA 4BMZA 3A3KA 5CT8A 2WVAA 4HN2A 4ROSA 3IUMA 4N5HX 2GA8A 2B1IA 3TFOA 4BMDA 1J20A 4PPQA 4IDOA 2J30A 1Z4LA 2WWTA 1ZGAA 4EKYA 5CVCA 3N3BC 5IJAA 3U4QA 1P0MA 3Q7PA 4DT1B 2LTAA 4LUCA 1WIWA 4EDFA 4IXTA 1DTWA 3U61B 3MLEA 4V38A 4OYYA 2G1AA 4PZ0A 1OFVA 1U1FA 2JGIA 3IB3A 2NUPA 3OFSA 1ZN8A 5IAOA 5GZ3A 5F23A 2GD2A 1QPZA 3WGQA 3HYLA 1HT1E 2A33A 4AKTA 2QM7A 3TRHA 1GL7A 1NIJA 3ADBA 4PN3A 3QVUA 4QYSA 1PD1A 5TT1A 5LCXA 4HVTA 1Z5NA 1Q7TA 4BGVA 3RVPA 1I5OA 4MLPA 3CV3A 3LPAA 4KREA 1BFUA 3GCGA 1TM3E 3PPWA 4WZAA 3FCSB 4WXPA 4L0CA 3O38A 4Q0MA 1LBQA 2VZ0A 4ANXA 3KKPA 3HN6A 1K6JA 1OLXA 5T4YA 3CW8X 2DTEA 3F8WA 2UYYA 2ZJZA 2ZRJA 4I6JA 1RWQA 1M1YA 3WLIA 1U8CB 4OU4A 3SDBA 4WOKA 1FRVA 3PXGA 4WCFC 2CVQA 4B4VA 2WPDD 4CGVA 3LWDA 1Q0SA 4FLEA 5JCPA 5BUZA 3L18A 2FEOA 4V1CB 4OK3A 4KITB 2PSEA 3S28A 3TBKA 2IU1A 4Z2YA 1D6SA 4B7CA 4CN9A 4WBNF 1TYQG 1IB6A 4CM8B 4IS3A 1DG9A 1WCXA 4QDKA 4GX2A 5A5DA 2JFYA 1NVGA 2JKYA 3EVZA 5KTOA 3SBOA 1U0GA 3HB7A 4GKBA 3OTWA 3GRUA 1NVXQ 1T5SA 4Z99A 4EB8A 1P3Y1 4ZO7A 4HN4B 1AB5A 3WLNA 2JFZA 4RUKA 4U7EB 3OJEA 1P5QA 3KOOA 4IHJB 4ZVLA 4Y0NA 3N76A 1L7NA 1HNNA 4I0WB 3E15A 1PJTA 2WUDA 3ZLVA 4TYPA 2IF4A 4K0RA 3L17A 1PG5A 5F7OA 4HQ0A 3NKVA 4DDHA 1WXDA 4L4XA 3KEQA 3HBJA 2E55A 2CHZA 3HHEA 3PEFA 5JS8A 2GAOA 1L8QA 4CE6A 2QTLA 2Q4OA 3T7IA 2NZJA 1N2GA 3U7QB 2YVLA 4LJ4A 1OQAA 3KAPA 4ATGA 4AMYA 4FHKA 2KCKA 4R9RA 4RL6A 4XM2A 4R2WA 4Q15A 3FN4A 2ZBVA 4OHXA 1KT1A 4K40A 3VTYA 4K8RB 4I14A 4WTOA 3HVEB 4IVNA 4UWGA 1C7FA 3KPJA 3OIWA 1PTKA 2C3UA 4DB4A 3BE5A 1VE9A 2EVWX 4OLHA 1P3JA 4RPJA 3L9XA 1V48A 5CLLA 3CEAA 2HHLA 2JJ1A 4FI3C 1JR3D 1V3QE 4DJAA 5LOVF 4L0DA 1GZUA 3RVQA 4N6OA 3L08A 4YV0A 3RYFB 2QGFA 3V8PA 5JQGB 1UMKA 5DHAA 4RCVA 4BNDA 1X1CA 3HV2A 2WA1A 4PFJA 4RA6B 1TAGA 5I9MA 2PXCA 3IL2A 5HKPA 1OYOA 4FFOA 2ZLBA 4B6EA 2BISA 4AY2A 1CJCA 1U4OA 2BUAA 2VP9A 2IWRA 1PTJA 1Y9AA 1FDRA 1E1RA 4MR9A 4IQ4A 1X7GA 4KPEC 1Y6GA 3NMUF 1I2DA 4RY0A 2ZI7A 1QAOA 1XRNA 1QC5A 3MV2B 5K03A 5GONB 1WB6A 1CU1A 4ETIA 1W8DA 3PNPA 4OM8A 4HDRB 1QQ6A 3LIPA 2AOVA 3I64A 3P8ZA 5IKOA 3WIEA 1KEEB 3TQOA 1M10A 1K6XA 5JCOA 2F1RA 2JIBA 3CIFA 2GUGA 2QBYA 3U5TA 2JZNA 2EJBA 4KX3A 5CH3A 1W9HA 3I09A 1Y42X 4B79A 3MWFA 1OREA 3EZNA 3ZXUB 4AC9A 3LUHA 3CVJA 4HNSA 4P81A 1KY5A 2ZJ7A 4BJ5A 3PRJA 3CVLA 3K71B 1U81A 1NN1A 2WJZB 2J4DA 2P4UA 3ONWA 3QVGB 5BNZA 1T2VA 3VSEA 1UFQA 2ZU0C 3HA3A 3KSUA 2BFOA 1P4JA 3HXKA 1DSSG 1GUFA 3RWOA 2HA5A 4LFBB 3RRYA 3WSVA 3NDBB 3UV7A 2JI7A 3GCZA 2CXXA 3WB2A 2J0VA 1IRIA 4APOA 2Y4OA 4WCDA 1ECGA 3OAWA 1N1EA 1Q17A 1Q1NA 3LC2O 2KJQA 4L5CA 3IAM6 1BVYF 1TZJA 2C4NA 2ES4A 2QN3A 4H3HB 4CEIA 3C6ZA 3FCYA 1IN1A 1UK8A 4HX2A 2N3ZA 1Z0KA 5A7GA 5IJWA 2QYSA 3RJMA 2R97A 4CLHA 1KJ9A 3ZHRA 4WJLA 2VP2A 2PX0A 4P3OA 4O8CA 2OG1A 2FWBA 2HR1A 3P9ZA 3C1UA 5KMGA 3I9KA 1KMIY 3VC2A 3AFMA 1I9CA 3DBRB 2WUGA 3G9QA 3BREA 3ETLA 4BATA 1T1EA 3M0EA 5EG5A 5J08A 4UOZA 1JR2A 3LF2A 4CQLB 1JCSA 4MP3A 1IXRC 5C31A 4EOGA 4X85A 3NBKA 2YJ4A 3ZOZA 1QZTA 4PHHA 3VU9B 3K1JA 4TROA 1ZZEA 1ZUNA 2I0FA 1NW7A 1T9GR 1SUEA 4EYGA 4ZRMA 1TF2A 2AOTA 3ZJ5A 1U9YA 4A6XA 4R71A 3AVTA 1P4HA 3KEOA 2HSJA 1SBIA 1ZH6A 3NTVA 1YI8A 2OMEA 4AICA 2LCFA 4PZAA 1U0SY 1NL3A 3ZE8A 4DB2A 3LQ1A 5EE9A 2G40A 3T5AA 2BCGY 2ZRMA 1YULA 1K0UA 1RRPA 4B33A 4EHDA 3MMSA 5H3HA 5JSKA 3IJRA 2AH5A 1HDRA 3R1IA 2A8YA 3GPIA 1KJ8A 5DLEA 4XCXA 3B7WA 3AI2A 1SZPA 4IDFA 3UGKA 3EGCA 3A70A 4UUOA 1R27A 3OM0A 1YZNA 4JW1A 4EL5A 3NASA 3NOOA 4WCFA 4YR9A 2Z8XA 2WZCA 2BE7A 4TT3A 2WTAA 3RG2A 1QK5A 3K5WA 4EUEA 4RE5A 2AFIA 4U8GA 5L3SB 5FWYA 3FSGD 5H83A 2ZJ4A 3HO8A 2Q2VA 5A5FA 2WTXA 3V7FA 3H75A 3CIOA 2D5LA 3WADA 1NBAA 4UBJA 4YJFB 3UFXB 2XXJA 2WYOA 1UOEA 1DAFA 3ZDFA 4ZP1A 2I6SA 2V55B 4YXFA 3K05A 3F3SA 4D81A 1NDQA 2IZ7A 4BO3A 4O1PA 3KZOA 3EG5A 3TPZA 3T1TA 1XVUA 1BU9A 4QSHA 4G4GA 3SZ3A 3ZD9A 3PDHA 3TZ6A 1KO5A 1E66A 4UPEA 2ETVA 1KYYA 2J6HA 4A6DA 3TSYA 4D9NA 4EEZA 5C52B 4GM1A 2WHRA 1HFWA 5BMVA 2PO5A 2V98A 2Y9PB 3E9DA 1VZ2A 5FB3A 1JG3A 2GZAA 2Z4SA 3P27A 3LP5A 4N54A 1N4QA 2F3RA 4W9NC 3FDJA 1K06A 3HABA 3FUHA 2WFAA 5BQ3A 2ZISA 1Q20A 3OZRA 1DIBA 1NLYA 4PQRA 3ITNA 3M3PA 1ID8A 2OXCA 2CLLB 3KC2A 3BXHA 3KDSE 3G7SA 3ASNE 3J5PA 2DVWA 1AA9A 2F0YA 1G3NB 4NJEB 2CMGA 5EERA 3TMYA 1VOTA 1EGQA 1L8LA 5CMWA 2HEGA 3UPUA 2QI9F 2GXUA 4UYJB 4HB2A 2ASEA 4IGIA 3B3GA 3WNQA 2PA0A 5JMPA 4DA6A 1E5VA 3DHYA 5EJIA 4EHBA 3H3XA 4IFEA 2VXOA 2FE4A 3LOUA 2XVMA 4KZ0A 4CWAA 2O2ZA 1ENOA 2TMKA 1IAQA 1Y33E 4MROA 2BFNA 3D6NB 4QEKA 1QK3A 1J1IA 3G88A 3OSZA 1T4MA 1Z5GA 4EQ6A 4CKEB 3WLLA 2PZIA 2B98A 5CNJA 4TV8A 3SNHA 2O8EB 2ZM6B 1IM5A 2ECOA 2F1JA 5K2OA 1KS2A 3VH3A 3A6ZA 4JFAA 3CSDA 1DVPA 2HLNA 2GF0A 3I2HA 1EFTA 1VKNA 3PIDA 1TFUA 2VAMA 3NAMA 5ALWA 2D5CA 1GKLA 2GRNB 1C1XA 3NM4A 4NHEA 5CW1A 1YT5A 4XWAA 3UMSA 4AJ9A 1QHYA 2OHVA 4KUHA 2DECA 1EX1A 1UOQA 3IX7A 3P32A 1XDGA 1YZKA 4INZA 3S5JA 4BECA 3WXXA 1YR1A 4YRMA 4DA8A 2I1KA 3L7BA 3MN1A 1FTSA 3EX7C 3BOSA 4ZDIA 1O1TA 1AOXA 5EP2A 2HWWA 1IMJA 1R5JA 4JENA 3MJFA 3NHYA 3CX3A 2Z6VA 1RXUA 3N0RA 4DDTA 5EJ7A 3KM0A 4CRWB 4BYMA 4HDSA 5GOTA 5JZMA 4AY6A 1NW4A 3VX3A 1JIXA 3L8DA 3E0QA 1B1AA 3C3EA 2OB1A 3FTQA 4R6WA 3NBFA 1P1JA 1G5IA 1Y9ZA 2A9QA 4YVQC 4J2OA 3IQIX 2AOUA 2B0OE 4B6JA 2IZ6A 1A4RA 4EKIA 2PGAA 4O2RA 5T4FA 5HZHA 1FJGB 1IEWA 4BNZA 2VSXE 1E1CB 3B1KA 4DQKA 1CF2O 3EVNA 4OHRA 4W1QA 4UU8A 5EQFA 1Y6IA 4RABA 3K7EA 7AT1A 3IEPA 1MJNA 4B71A 1K8YB 4OB8A 3S8EA 1G8GA 3WGUA 4ZOLB 3O8RA 5HILA 4EZBA 4F92B 3H4TA 3M6IA 1U2SA 5JG7A 3BFKA 3MWDB 5ARGA 1ZC3A 2IO2C 2PWBA 2VJCA 1PQ4A 4A8PA 2J0UB 3AGPA 1V26A 1AHNA 4KWTA 4RCYA 2PSSA 4PGGA 2C8KA 2YNQA 3KAEA 1MC5A 4MR8A 4UQLA 2QE6A 5DO9A 4IO1A 3BZUA 1KO8A 3FB4A 3P1UA 1HL7A 2DWUA 1XZLA 5AOAA 4G8JA 5FBQB 2J32A 4NARA 3HUDA 1EFVA 4N0QA 2FR1A 4MUFA 1ZH2A 2H0AA 5B1BE 2WXIA 1L7OA 1UPCA 3JQQA 1X42A 1CCWA 3G0BA 4YJ2A 4DLWA 4NS4A 4RTMA 2ATXA 1YIOA 3QRWA 4RNCA 2WWIA 5D51S 2X58A 1WTAA 2DBYA 1UP4A 4OK6A 2NXJA 3PCRB 4GMXA 1SCUA 3QX3A 5EE3A 3D59A 1XN1A 1C2TA 2JLSA 1A8IA 1RJ9A 4CM1A 2YIJA 4HFMA 5HIKA 2QL7A 5CM9C 1IPFA 1Z0UA 4CF3A 4LGYA 5KYNA 3L54A 3S1SA 2WJJA 3IIMA 4EHHA 3GC6A 3WNCA 2NO1A 3LVRE 1J2YA 2RCNA 2R6HA 2H6FA 2YWJA 1QGDA 3NDJA 2BKGA 5BN3A 1C9MA 1YASA 2AEFA 3B7RL 1XLUA 3P1JA 2GA9A 3P19A 2HRZA 1E8WA 4WKBA 4KYIB 3P9NA 4LC9A 3DEAA 3QKRB 4TV9B 1KL7A 1ZISA 4Y0VA 2R00C 4YUZA 4UUMA 5DTIA 4NFLA 3I9V1 4FA6A 4BC0A 1V8DA 5HKKD 4HWSA 4DQXA 3NB0A 3G0DA 3PRHA 4X90A 2WMOB 4PPGA 1MEJA 1W44A 4GNKA 5HM6A 1UBSB 2B8WA 1D7AA 4HH1A 1L5GB 5C0OE 1HWYA 4C0WA 4IUBS 2BGRA 3BXZA 4Q48A 4DUYB 3QMVA 2XCQA 4GPD1 1G20E 3DL2A 1RXEA 4DCGA 1RAGA 2IQIA 1N57A 4UXHA 4G4JA 1KQOA 4GOLD 3CEPB 4RIFA 5IXSA 2B78A 2GXAA 5EJMA 3N7UA 5TX7A 4W9NA 1QTQA 5H59A 2J8SD 2HCBA 4BZQA 4FHFA 3DBVO 4ZVKA 2ILVA 2V7TA 3PKZA 4YA6A 5SY6A 2A0FA 5BO5A 1DMSA 1UXGA 5JH7B 5DX8A 2KLBA 2ZUTA 2O1XA 1NLZA 5KYGA 5DXAA 1SHTX 4OHCA 5F1OA 1NVWQ 2ORED 3Q10A 3NPAA 4YLEA 4R9NA 1M2FA 3ITWA 5SZKB 2HSGA 1N6NA 2P9FA 5CMLA 1EQAA 4XX1A 3LFHA 3TZLA 4I9UA 2YIDA 2FRXA 4HB4A 2ZFUA 2X0EA 1Z88A 4M37A 3ROQA 3T7CA 5G2OA 2I3BA 3HB1A 1S7CA 4C6TA 1EUQA 1VLJA 4H7FA 3I2JA 4KBQA 3AK4A 3FUVA 1KJJA 4DJJA 2IX3A 2QG4A 3NH9A 5JDIC 2IPAB 5HDBB 3ZJ4A 5GPBA 2HCTA 4L5AA 3DDSA 5JMND 4LDAA 2BKEA 1X70A 3N70A 1RWPA 2G6TA 2GZSA 1H5UA 2ZIZA 4BZXA 4ARZB 2H1WA 4YMUA 1ZIDA 1ISIA 2HY7A 1KRXA 2IGTA 1MRNA 4JT9A 1RRVA 4I1YA 3WMWA 2BR3A 3HSYA 1KJIA 3I9MA 2E5WA 1ZOOA 1FIUA 1ZAYA 2BKLA 8AT1A 3KTOA 2FW0A 1HRDA 1Y63A 3RYIA 3LPLA 4KRYA 4M1ZA 2C95A 3FEYA 1X38A 5LYJA 3MKQA 4N65A 4JY7A 3WQBA 4Q4AB 1R0KA 4GXRA 2O8CA 4R1QA 1F51E 2AFVA 1MTOA 1VP3A 5AI0A 1P7VA 1ZICA 2P2YA 2DM6A 2GPAA 3B51X 1YKGA 2YHCA 1HBJA 5THXA 4K9NA 2RGUA 3G5MA 5C1PA 4HS2A 2YC2C 3CEHA 4K9DA 4M4SA 3FSEA 3PR2B 4OQYA 5KWSA 5DCLA 2EKBA 3OFVA 3SJAA 5KIAA 4LXUA 4CM5A 1E9FA 1YDWA 3TDNA 4UWHA 5EHZA 3CO5A 4C6HA 3RSHA 1N0VC 1RI5A 2WAYA 3E5NA 2I1JA 3K8ZA 4BWGA 4JI2B 4TYMA 4CKCA 1U8AA 1KOFA 1KO1A 2Q3MA 4GQIA 4I5DA 1E0AA 4B0ZA 3F46A 3ZCRA 1EUYA 2YVQA 1DOHA 1KZ6A 4YJKA 2AG8A 3DAPA 4TSFA 4LRTB 3BGDA 1AKTA 4KNVA 1EE2A 1U8UA 1L5FA 3PTLA 3KKMA 3OTNA 3Q2KA 5JWRA 4FFSA 2I2AA 1BCSB 4FGSA 1O8CA 3GJQA 2WJ6A 1YCHA 2CLMB 3PFWO 1UXOA 3ZHVA 2L9BA 4MRPA 2C3YA 1SIWA 3C3MA 1X6VA 3PL1A 3UTDA 3OOJA 2VL7A 4JXXA 2PUGA 2XE4A 1Z47A 3NV7A 4KK3A 2D3WA 3OBBA 4RVUA 3IDFA 4ZGWA 2J7PD 3B6IA 4E6PA 1STOA 2QU8A 2AJ8A 4RNDB 3OM1A 3IA2A 3OCVA 2QU7A 4BY9E 2RHTA 3GPBA 3LOPA 4E3ZA 3GLHA 3ADOA 2MSCB 2Z3WA 4KXMA 1LLCA 1OXXK 2H7VA 5ADHA 3R5SA 2R05A 4YO7A 4NY1A 5HS6A 2WI8A 4ERXA 4MMXB 1K5PA 1Z06A 4DA4A 3OZUA 4N8DA 3K9HA 1XNHA 2CXHA 4PSDA 5DTJA 4PAMA 1GTVA 5GGXA 2CZQA 2P5UA 1JXMA 4X7PA 3LY8A 3QKWA 3HKEA 3PUVA 1MO3A 3NWJA 4Q3CA 2FSGA 3ID6C 1FP7A 3T54A 2BBOA 4P22A 5K1ZA 1NL4A 1ODKA 5DW0A 2NW6A 1VL0A 1I4TD 4O4HB 3VV3A 3NH6A 3WRWA 1RT9A 3UJ9A 1E2EA 1E79A 1FFWA 4LCJA 2O4UX 3W7VA 3I5YA 4YNBA 3M6UA 3S4YA 1ODTC 2VDRB 4U00A 4FHJA 2PY6A 3B7GA 3TK1A 4EPZA 1NVUQ 5HMLA 3ZVKA 2CK3A 2JARA 3TLYA 2FUG1 3GD5A 2TMDA 5AK5A 4IKPA 1UBRS 2VUTA 2OD9A 4GXNA 3BL6A 5KYTA 3UJ6A 4C30A 3ABLE 1RRCA 3OUTA 3EIUA 4E31A 1FYVA 4C4RA 1N5LA 3HU3A 3GEIA 1OC2A 3E4DA 1CS0A 3LKZA 2EF1A 2VQSA 1FPPA 1ZLXA 4J6FA 3KZ1E 1ESZA 4PR0A 4QJIA 1JDTA 3CLSC 3I5MA 4R16A 5AICA 1Y48E 1W9MA 3ZZ0A 5IABA 5CLQA 3M6FA 1SQSA 2W6ZA 2RAUA 4S0ZA 4WZBE 3F1KA 1SKAA 4UCWA 3QOWA 2HB6A 5FA5A 4PAWA 3LPCA 1JWBB 1HL3A 5A7HA 4GLLA 2P27A 3C41J 4MVWA 3AYZB 4GAEA 3MJSA 2O8BB 4OHKA 1BDIA 4MKHA 3SLKA 2DEUA 1XYGA 4QUHA 2PUJA 3R9IA 2BF7A 3WDLA 3FJOA 3S99A 4Q3DA 1W7AA 2G36A 1F12A 1JIKA 2QAGB 3ECCA 1KDTA 4B40A 3GD7A 4P7GA 2PBRA 4AMBA 2EATA 2WT4A 2BSAA 4EZEA 2I6UA 3PEVB 2ZYRA 1DBQA 2BZGA 1X81A 3RPEA 1KBOA 3R74A 4L57A 4JEMA 2Q7DA 2RIRA 4CR7A 1JG1A 3GR6A 2EQBA 4GP7A 3QLUC 2P6UA 3ZNOA 2ZXEA 3TWVA 3JW8A 3SZUA 2A9PA 1IWOA 1J6UA 4QARA 2Q7FA 5FZQA 3ZY3A 2FULA 2YXEA 3WLEA 5DNEA 3BF8A 1SHUX 1W36C 4DMMA 1WZEA 3NXSA 3DW1X 4R8LA 4EATA 4KPUB 2AXVA 3QFSA 1V5GA 2J3HA 4HNGA 2BM8A 2E0IA 4HV4A 2R2LA 1Q3TA 3DTVB 3WA7A 4RTJA 3SN6A 4JQSA 1Q44A 1YONA 4UDNA 5ANRB 1VLVA 4US0R 4TTJA 3URMA 3DOJA 4EMTA 2ERCA 2PIAA 3ISJA 4C4PA 3V79K 3CJRA 3S27A 3D0KA 1Z0DA 3P9SA 5TB5A 4L1KA 3C3CA 3F78A 3UVEA 3SPXA 2X4IA 4P3YA 4JSRA 1QJ4A 3D2BA 3V8QA 4LG6A 1P2VA 1GUYA 4N4AA 1S3SA 1P0QA 2YNMA 5J4KA 2J3MA 4W5QA 2UYQA 2H00A 2XQIA 2YWCA 1Z4NA 4G2VA 5TQ0B 3LT2A 5GVRA 1I14A 3VV2A 2ZYUX 3SBDA 1NVVQ 2G4LA 4A8JC 3WK4A 3VC7A 1NATA 2JLCA 3JRNA 5AI4A 3NHZA 5IK2D 4RIHA 4HMOA 1X1BA 3A9UA 4NYJQ 1PWZA 3R23A 3ZCTA 3N2GA 3ZIUA 4UVHA 2ZGDA 2F1KA 1JEEA 3LHKA 3UB3A 3U44B 4AO6A 4B76A 4MPRA 2NZUG 4ZI2A 3GFSA 1CNMA 4HTFA 3VR3D 4GQBA 2OZLB 2X22A 4YYZA 5BVGA 4C4SA 3K0AB 2C7QA 1JLHA 2AC4A 3VZQA 4WERA 3T9KA 2A59A 2IDKA 1U3GA 4DR1B 2XDQA 2J33A 5JD3A 3GJ3A 5EAIA 4B0PA 5DHQA 1GRNA 5AVOA 1VE5A 4YS6A 2Q5HA 4B46A 3BEEA 1RXIA 3DMRA 2JGEA 2I6GA 4LY0A 1B6RA 4EZJA 1X87A 1N3IA 2W42A 4HD8A 4ZVTA 3ZH2A 4QLOA 1JU4A 2XQFA 1YRLA 3TLGB 5TEWA 5NULA 4BXOB 4KXWA 1Y8MA 5FLKA 2EL9A 3TQFA 2WZDA 1DDOA 3SJBA 3LPMA 2FZWA 2C2MA 5FV4A 3CVQA 2PZAA 3BICA 4JELA 3NHAA 1LVUA 1WMSA 4JLMA 1F9EA 3AG5A 2V7XA 1R4AA 4LOJA 4KAXA 5G02A 1NW3A 4H27A 3K9IA 3FTVA 1WY6A 1MCZA 5CA1F 4BBPA 2OPBA 3E05A 4HVCA 3KEFA 4ANWA 3WMXA 3ASGA 3AKYA 3FLAA 2CCGA 3RC9A 3I1JA 5E3JA 2OQIA 1M34B 2RSFA 3HKBB 4OY3A 2NYJA 1XCPA 2JPDA 1J23A 3P26A 4GOJA 3MT0A 2P9IG 1OT5A 1TZBA 1H1DA 3BT7A 2HFJA 2HLPA 5DISB 4NYIQ 1MC4A 3FYUB 4M98A 3NRBA 1H6PA 1NG1A 3AR4A 1QGYA 2UUCB 2ZRHA 5EXTA 2Z98A 3FNQA 5EGSA 4LJ9A 3RSFA 2QX8A 3AT1A 4LE1A 5HOQA 4BGEA 4Q4HB 4W5TA 1P1BA 1P1IA 3IR5A 1KKMA 3P5SA 5G2NA 4PNPA 5DNWA 2C3OA 3IA7A 3IPYA 1IXYA 5J47A 4FVTA 3PHCA 4ZZIA 1DC8A 4Y2SA 5KQSA 2H52A 3WWYA 5T3UA 2VIIA 1VECA 2NXPA 3QLJA 4CKYA 2ZJYA 1XRPA 4HQNA 2MYOA 1DOAA 3LXXA 2Q9BA 4BSXA 5EFOA 2ZI4A 4ZI3A 4FZRA 4P3PA 4HB3A 4YROA 3U3KA 3T99A 3GMTA 2NZWA 4PPFA 4X44A 5B3LA 2WAXA 3MG9A 5JHGB 1A69A 2OHOA 3A3NA 1SVMA 1ODLA 4DGSA 3NCHA 3H2KA 2VAWA 4LHEA 3R3VA 2XUPA 3F6SA 4ZHBA 2AE2A 1CV2A 1LTXA 1UT8A 3HP4A 2O8FB 1K4YA 4QBTA 3R6DA 1GQSA 1DCEA 4LV6A 5IYZB 3O1JC 4NCIA 3RQSA 4CZ2D 3RIMA 3IQGX 4OP3A 3QK0A 3GLRA 1LBHA 2H2DA 4G0XA 2NADA 1TPZA 3LQRA 2E21A 5I7SA 1VIVA 1JDZA 1HEYA 4CKBB 2A1UB 4KG7A 4YALA 3A1VA 4P58A 1LDYA 4JD2G 2EBHX 3C6QA 1H2VC 1FP1D 3GRYA 5AW7A 2FG5A 3M2PA 2ZJFA 1FTNA 2RI1A 4W63A 4ZQBA 1CQJA 2GEUA 4P9NA 4ALJA 1L7QA 1RI4A 3DE4X 1YJBA 1GFIA 3RODA 1OB5A 2NUAB 3IUSA 4ACAA 1MLDA 3FYHA 3PYLA 1YU6A 1ZA2A 3LX4A 3IEXA 5B1AE 2WC1A 4IQGA 2C8LA 3QLUA 1N4AA 3H1AA 1QXSA 1LPNA 1XK6A 3VMFA 1UPFA 3SDZA 3EEFA 3GFFA 1HKUA 1GQOA 4TXPA 4E5NA 3K2BA 3T5DA 2VHJA 4O5OA 2CNWD 4FBMA 1ZINA 3CLJA 5EPOA 4XARA 2RGXA 3SZ7A 3L7YA 4XDYA 1PTJC 2WD7B 4PG6A 5BSFA 3ORSA 2BFCA 3W3AA 3OAAA 2QSUA 3F9RA 5CYOA 3BK7A 1E63A 4JLVA 1R18A 2P9GA 2NU7A 5TEVA 3TKLA 4HT3B 1QIFA 4ESHA 4KVGA 8LDHA 3IO5A 1MB3A 4R8RA 1FLAA 3MUOA 5CYFA 4MR7B 4XQGA 1JSZA 4NBKA 3T9AA 1D0VA 4BKUA 1C8BA 4PLCA 2VNSA 4PVDA 4LIPD 1F2TA 2LO6A 3UT5B 6PFKA 1K86A 2FQQA 4GUAA 5AJVB 1V43A 1BA2A 2RFAA 3PXEA 3KQPA 2E4VA 1SU8A 2H63A 2W2KA 3SQVA 4IH9A 4HRYA 1HDOA 4ZMBA 2GAFA 1KWKA 3IE2A 1Q2UA 3KDPA 1ZJJA 1XTQA 5A4IS 2X86A 4F60A 5KNBD 2IS1A 1M54A 1Y8QA 3U4QB 1PR0A 5IHPA 3WL4A 2OQRA 2P1ZA 1N2CE 2MR5A 5K8TA 1DTWB 4EUHA 2IU4A 1SD1A 3REGA 1RPZA 2HM8A 4YP1A 4RZUA 3VKFA 4OXXA 2H9AA 1QMPA 4K6OA 2NUPB 2QRNA 3E5RA 5B58C 5DX1A 4H7KA 1CUIA 1ZD3A 1KFKB 2WXGA 1OCEA 5GWXA 3X0DA 4GICA 2WSMA 1E2JA 3CWCA 3C2QA 3ZKJA 4BN0A 5EOVA 5CXSA 4ZARA 2OLKA 3MPOA 3T94A 1RLTA 3GPDG 1FVHA 3OZBA 4G8LA 3RRZA 1VSBA 1UBTS 3AL3A 1KI3A 3THSA 4G36A 2O1EA 3SBTB 1B0UA 1OLXB 4IGEA 121PA 5KSWB 4BO7A 2LPMA 4C2BA 3LLCA 4GD3Q 2ZVQX 1R8XA 1ND6A 4G0UA 2V6BA 1ZN7A 2ZEJA 5A3RA 1M1YB 4PLYA 4A27A 4NZYA 1U9JA 2EZ4A 3DLBA 4OYLA 1PP4A 1TKRA 3PQ5A 1ISFA 1QM5A 4NEQA 2ID9A 3EGEA 4DCCA 5B7GA 4Q9NA 2WF6A 3D7RA 3R8FA 4G1CA 4IH4A 5EP3A 4LJSA 1KMMA 1PVVA 3EVFA 5IVPA 1XTKA 3QNWA 1ZS9A 5AXAA 4J16C 2OD7A 1TF7A 3VR1A 4IICA 2X9VA 1JFRA 3GDHA 1XQVA 1AX9A 5ILQA 2ZSHA 3UV6A 1WCWA 4FS3A 1A2QA 3WLFA 1E1YA 4MEJA 1GPAA 2JI6A 3FCOA 5F9MA 4FK8A 1H2EA 1F2VA 3I32A 4NXNB 3DLCA 3W5HA 4C7JA 1NVTA 4DSZA 5AM2A 3EAQA 4TVKA 3V1MA 1BJKA 5B1SA 1K9SA 1QHGA 2Y0BG 2AEEA 2HRDA 4DV7B 3KU1A 4BEVA 2WVGA 4GDMA 2VYVA 3TVTA 2DQKA 5BV7A 4KVAA 1NI4A 4ND6A 1NR5A 5IVKA 2DSNA 4F97A 1ZNWA 5KHLB 4KR9A 2DU8A 1LPAB 2CYBA 4D1YA 2WUFA 3GBSA 4RF2A 4BNLA 2WQ6A 2UY1A 3SSOA 4AMGA 2HBQA 1H19A 3IKMB 4RZQA 1D2MA 4F4UA 1P9NA 1FRZA 3AVYA 1U8FO 1CETA 1DAMA 5HX7A 3U81A 2NUBA 5KTMA 4ATNA 3HG0D 1IM8A 2C04A 1YRQA 1TN7A 2ZYHA 4DQUA 4K6KA 3ASDA 1U4NA 3KJQA 5HRCA 1MTZA 1MJGA 1BMFA 2R6CA 2UYHA 3M81A 4W8HA 4OI1A 4L5IA 2B6CA 5DBKA 4MCIA 2FFAA 5D7BA 4PWYA 1NW6A 5JWOA 4L8WB 5G0TA 4XIGS 3LC7O 5JS2A 1IATA 4UM9D 4M8KA 4QQFA 2RB5A 1NA5A 3TWRA 2ECQA 4DMCA 4QULA 1Q0PA 4MR9B 3GRFA 3Q7FA 1BX3A 4X1KA 3ZWDA 4Z86A 2ZW9A 1YI0A 4FYMA 1QC5B 3BL5A 1F60A 4PRKA 3MUFA 2DBAA 4HAUA 2YCLA 2A4ZA 1IBMB 2CL6X 4CMKA 2HYDA 4KUEA 4UE2A 1N2HA 4KWIA 1NBOA 3AOEC 1UKAA 3D6VA 4BLOA 1NI5A 1GAWA 1A9OA 4L16A 2R7MA 5JRJA 1UBKS 5CHYA 1XDSA 3T8YA 4S04A 2QBYB 1TVKB 2CJYA 1CR1A 1O5OA 1GPUA 4JJIA 3U40A 1K89A 5A6VA 5JS1A 1R10A 1LDNA 3KAJA 3D8HA 1ZRMA 3ENEA 4EO4A 5HUQA 4F7WA 5K0FA 1IXVA 1O6ZA 3B6EA 4X60A 4B35A 1GM5A 2O14A 4DIUA 3A2NA 1OA1A 2X2OA 5ALMA 3GNSA 3BRWA 2LE0A 4C14A 4RG6A 5DWVA 3CG0A 3DTVD 2QM3A 3E7XA 1A8SA 5IXJA 3CH7A 2W2OA 3VKVA 4ONEA 4Q34A 4LFAB 4ARAA 1T8RA 5BWBA 5JJLA 4DUZB 1XTJA 4MVJG 3ZY2A 2O5VA 2XS8A 3E58A 4HK4A 4RZIA 1ZNQO 4ILGA 5EPUA 4NE2A 1L7PA 2HNAA 2ZYGA 3E8SA 1S8FA 2QMHA 4WE3A 2Y27A 5BT1A 1KO7A 1SRRA 4BFYA 3RJVA 2OGZA 4BX0A 3IALA 1EAYA 4OMDA 3IGFA 3I0ZA 1DQPA 2IW3A 2JK1A 3WA6A 2TECE 1B0AA 5K8LA 4BFRA 3WK7A 4CEIB 1R7RA 4HMPA 3QFRA 1Z2PX 2FPLA 1NXXA 4M1WA 4OV6B 2XMQA 3DYIA 1Z82A 3FWZA 3CS3A 4F86A 1NNLA 2IKSA 3HXEA 1TA9A 2FFBA 3M6VA 1HZ4A 1YB2A 2W6PA 5KMGB 2R6FA 2R02A 4BFLA 2FP3A 4UVGA 3HHMA 4FFDA 2XZTA 1CSEE 3OWHA 4XQ9A 1K75A 4CG1A 1PBTA 1PGNA 4EG3A 4ENVA 4ZI5A 3MT8A 3N2ZB 1VLLA 4PRLA 1LX7A 3EUFA 4UXIA 3RC3A 1PW5A 2WXNA 2GZMA 1LI5A 3ROMA 1AHHA 5ICEA 3OIUA 1ZUNB 5D84A 1E7WA 4RC9A 2IDMA 1C4XA 2AOTB 2CMFA 3GJXC 3QENA 1G1AA 1EK0A 1E0KA 4X7RA 4B80A 1YS1X 1IOZA 4N39A 3AINA 3GFPA 1E99A 1QH9A 3B2QA 3QTTA 3LHDA 2X6KA 3KQSA 4IG4A 2JGRA 4QDXA 1OHHD 1NFFA 4FHZA 4F4JA 1I4OA 5F7ZA 4R0VA 1MD9A 2GD1O 1FUEA 2OOSA 4TUUA 2VHQA 5KPJA 2Z57A 3U3ZA 1XFDA 3G2VA 2BZSA 3P0IA 3JD0A 4LHYA 4EBFA 5J23A 4WCFB 1W25A 4FXOA 4NZOA 3ND5A 1DJQA 1RPJA 4GL4A 4Q4CA 4BLQA 2P1RA 1ISHA 3KVVA 4Y9DA 4Z3DA 4DIKA 3A31A 4I4TB 2ZBDA 1C3EA 4U4AA 3FFXA 2WILA 2ANBA 4B85A 4Q9LA 3GZNA 1EP3B 2JS7A 1NONA 1X9IA 1WSWA 4J16A 4JT8A 4AO8A 3CLSD 1YSCA 1PLLA 3CPHA 5TVGA 4L0QA 4LZJA 4IGFA 4FU3A 4KNYA 3D4BA 1E98A 1U0EA 2CXUA 3R0VA 2UWJG 3UIOC 3U66A 1U7XA 4B3RB 4H77A 2QUIA 3UM3A 2IHUA 3KYJB 1GGKA 1KF0A 4H7PA 4XIJA 5JEEA 4P5EA 4HR7A 5E9QA 1J42A 3QY9A 1GIAA 2C0QA 5FPHA 1RLJA 4G56A 4WA8A 3FDIA 3D6JA 3VNSA 2WNIA 4OB6A 5BMVB 5BUQA 3BG0B 3BE4A 2HV9A 2R66A 4P1ZA 4U2KA 1TUIA 1K9VF 3BTUA 1GVHA 2DBZA 1BS2A 2HWUA 3WK8A 3AY7A 3T38A 3RHFA 2FSSA 3OXFA 1YCGA 5TDHA 3C1OA 3ND7A 5ALOA 1XRQA 2EIXA 3EIFA 2V7BA 4OBWA 3SQOA 3ZLUA 2GETA 3V7UA 5FV7A 3F9IA 4I1IA 4CQNA 2JGLA 4LWQA 4NURA 3SD7A 5ECDA 4CODB 4REQA 4XJTA 3D1VA 3WGMA 3TLEA 4M3OA 2FEXA 1L3BA 4OREX 1E2HA 1WP4A 1PW7A 2R4QA 4O4LF 1PHPA 4RK7A 4TWIA 5A6SB 2NYRA 4PZLA 1MH9A 3TINA 3CYFA 5D3MB 4CMJA 2X0JA 4EQ6B 5I8WA 1WABA 3PNLA 4FHCA 2IXFA 2VBFA 1KK3A 4YRAA 1E7QA 2VA8A 3ISMC 2OCPA 4TV8B 5FFFA 1DX6A 3KSRA 3JVVA 2H1SA 2X8AA 2XCIA 5DXJA 5HIMA 2GT1A 3MJRA 5IJ9A 1ZBPA 4GRIA 3EDYA 2PKYX 2BFWA 2XYVA 2B4QA 1C1XB 4E12A 4BX9A 2P8JA 5C8YF 1Z4IA 3RQIA 1WOMA 1SQ6A 3T3NA 3MZLB 3L0IB 1DKQA 3AOEA 1E6WA 4DABA 3APDA 1CIJA 4AZ0A 2F1HA 5DEOA 5BV2P 2QLJA 3NR2A 3A3YA 1VFNA 1Y8ZA 2CNNA 1GPBA 2I6FA 4HRLA 2BE9A 3E03A 2EBUA 3A6LA 2ZGGA 1Z56C 3GN2A 5KHOC 2OBBA 5DGDA 5D5HA 4AX4A 4IYJA 4MRVA 3BILA 3IEUA 3N5CA 3EDMA 2IRWA 3BCSA 3IUJA 4FCVA 2Z6AA 2G80A 3KFLA 2VCHA 2NXWA 4I3FA 2O2HA 1K8QA 3UWKA 2R85A 2QPTA 3DZFA 3LDZA 3N6RA 1R0YA 1K7YA 2XADA 4E2WA 4R8VA 2PX6A 2I7CA 3JYNA 1K63A 3MTBA 2OUKA 2GO7A 2RHOA 1KFBB 3C3AA 5CB4F 3BERA 3QEAZ 1A98A 4TKVA 2ZIGA 4A2WA 2RFLA 5L3ZA 2Q1TA 3IT2A 1XDBA 3EW9A 3CURA 1G60A 1P5RA 3SMQA 4XSGA 3GP3A 3TTTA 3COPA 4DQDA 5LIPA 1I2BA 1EPUA 3NATA 2JGAA 5L3VA 3FTDA 3EOAI 2P9YA 5FWQA 3H6KA 4U2FA 4GSLA 5LZ9A 4BKQA 1UH5A 4WEOA 1WB9A 4JP2A 3FTCA 3DGFC 1E64A 4FT2A 4PFQA 4XWOA 3ERCA 4KB5A 1MNAA 4ZT4A 3O26A 4YV2A 1HQKA 2O1WA 3WWPA 5G04J 2K6GA 4BMPB 4MR8B 2Q29A 3KYCB 3ZE1B 2JASA 4GMFA 5GJWC 1UZLA 3LL4A 2VDPB 3CNBA 3AM1A 1CQIA 5EMJA 2R25B 1FP4A 4GI1A 1NJ1A 2JFNA 3WAJA 2I7TA 3AU4A 2P8SA 4YJ2B 2VN8A 1Y8CA 5A7DB 4G84A 2XLCA 3EW7A 4URYR 2X0FA 2QQEA 2VKQA 2IZ1A 2OG2A 3L1HA 5IDWA 1V37A 2GD0A 5M29A 3A9WA 1KSJA 3RYTC 1PR6A 2AN1A 4KO2S 1SCUB 5DCYA 1NQUA 4Y3UA 4EM6A 2WBLC 2YXNA 1RJ9B 1W5BA 3GLIE 3DZBA 1U99A 3WBKA 4RZSA 4Z4EA 3MCAA 2I3DA 4DRXE 4ES6A 5C1DA 1TYDE 3OQIA 1GU0A 3RSLA 2Z9CA 3PCXA 4H4CA 1MGOA 1RI1A 1OY3D 1JEYA 2QG9A 1EZ4A 3F1LA 3D2CA 4BWRA 5DLDA 2IH4A 2FF7A 1V4VA 5BN3B 3IMGA 4LDNA 3GG2A 5HKOA 4UYKB 1KJWA 4X65B 3EXIA 3D7MA 1X14A 3RFCA 3DPYA 1DDGA 2FSIA 1AM4D 3W2IA 3I2IA 4TZTA 5IRCD 4BVBA 4K9MA 2R47A 3AUXA 5DKFA 1DQYA 2QTZA 2IUUA 4R41A 3HCPA 2HU2A 2GVZC 5DP2A 4RXMA 4FFVA 2PLFA 2MJLA 2W2NA 4U0KA 1M66A 2H1RA 4MWCA 1OE0A 1K3ZD 2V0GA 3GUYA 1GQFA 2PBZA 3TGPA 1NVDA 1U9IA 3SQDA 4TUMA 3ZWVA 2RHHA 5DH9A 4W9MC 1L4MA 2PVCA 2FX3A 1KYXA 2C2BA 3DG9A 4W1SA 3LVBA 1JWLA 2P2SA 3KWLA 1P33A 4JR1A 1N0QA 3AY0A 5FWNA 3WGJA 2WV7A 4YCMA 5A03A 3SYRA 1GV0A 5C5CA 3CK7A 5EGNA 1PFYA 3PDUA 3NHKA 4D9GA 4R83A 1Z29A 7REQA 3AP1A 2PCJA 1EUCA 1JL3A 1LV8A 3UYKA 3GDFA 3CVUA 3DOIA 1W93A 1D4AA 1M67A 2PMKA 2NU8B 5AHOA 3ZGXA 2JJ1D 1W35A 2BH2A 4G4IA 3UKUG 1N36B 2UZ0A 3KUUA 4Y2UA 2X3YA 4LV5B 5K3FB 4F3NA 4AWAA 3WNZA 4C5CA 4HCJA 1H42A 2QK4A 2JVKA 3TW6A 2V7WA 3H13A 1JG6A 4YJGA 1NUQA 4C6TB 2HSZA 1E1RD 5JYDA 2ZYIA 1NBMA 3VM6A 4RPIA 3RTGA 2QR2A 2AG0A 3I2GA 1MXFA 4C4TA 2P0EA 1C14A 3OQNA 3Q6IA 4ZVRA 4XIFA 3UJ7A 2YS7A 4H6VA 3R7RA 1THTA 2AR0A 4IKOA 4I6EA 4ID9A 3EVBA 2FLWA 2KS6A 4JBYA 4Q19A 3FYSA 1UN8A 3VDNB 1GEGA 5J3JA 1H4QA 5TMBA 2HK7A 2XUZA 4OHVA 4ZFHA 1UDXA 2FAXA 5EVJA 1CUXA 1VMEA 5IJ0A 3CX4A 4JKOA 3QBEA 2AB0A 3UJPA 4AJ2A 4V0KA 3ICOA 2WJYA 5A0FA 3RYIB 3EE6A 2EL7A 3X2QE 5IY5E 2YMQA 2UXCB 1T24A 4QXMA 4BP8A 3MKQB 1DRJA 2DF8A 1RS0A 3RUHA 4JBNA 3SCZA 5L53A 3BFPA 2IP2A 4QXOA 2X1LA 5JD4A 4V3BA 2XBUA 1HQDA 3BFXA 2ZJ6A 1SB9A 4QBHA 1DXQA 2QS9A 4UQYA 1QOZA 4JR0A 3QF4A 2CUTA 1DC3A 3GFBA 1XQ9A 1G8PA 4F38A 5F9HA 1FCHA 3G85A 1V3TA 4L02A 3RFXA 5LLDA 3TXXA 4WESA 5I4KA 2C59A 4KXKB 4CEJA 1HXIA 1TJNA 2EC5A 1U2QA 3I9FA 5DYNA 4HKTA 5A0VA 3UXEA 5FL7A 3DC7A 2VDMB 2B5OA 3QKSB 3R6TA 3QE4A 3BGIA 1RTTA 4ER6A 1GT6A 2VSNA 3ZRHA 2X0IA 2HQSA 3QYFA 3K9FC 4KQXA 4ZCTA 4L15A 5CM8B 2AG1A 4K28A 2LXNA 4XWGA 3DVSX 1DXHA 3U31A 3WYNA 1YQ9A 3B2NA 3LT0A 2K7FA 5JNLA 3VDMA 1T1JA 2HA7A 1S1CA 3WY9A 4ANFA 2AD1A 1GUBA 3FAKA 4PHGA 3P97A 1QFYA 4KDFA 2YNMC 4AI6A 1QU3A 1H2XA 2YTZA 5F1PA 2PNJA 3IP8A 2WYWA 4UVDA 2QLMA 1NXTA 3RBVA 3H8VA 1KETA 1DNPA 3TX2A 4MIKA 2ZWMA 1JQJC 4RVHA 1E3DA 3NONA 1P5ZB 3SFYA 5EEHA 4L0MA 4BFTA 2J6BA 2O23A 4EGAA 3M1YA 2OBMA 4GR5A 2YN2A 2CBXA 2WKSA 3GG9A 4UFNA 2CHVA 5AW1A 3PXXA 5HIIA 3QU7A 2ZQ5A 4H7HA 1BSVA 2JJQA 4GMRA 2R6AA 4L07A 4MYDA 3UWPA 4FIDA 3SR0A 5CEDB 2W2TA 1UJJA 3OF5A 1K4KA 3GJZA 2XY4A 3R7WA 4TM7A 4AMVA 3LYAA 3HA2A 4TUYF 4XWYA 3NYRA 4WXHA 1AKYA 3FUMA 3VO2A 3FU6A 3HKEB 4G65A 3OMLA 3V48A 4ZK2A 2VJQA 3WP0A 1RWKA 3IILA 2XCCA 4E33A 1ZFNA 3JZDA 4R3WA 2NXNA 9MHTA 4MO9A 2WJAA 3ZZNA 5H7PA 4MARA 2EIKE 4PR3A 2AN9A 3U1TA 1C7RA 2WKQA 1P31A 3W2HA 4MHSA 2FEKA 1SCDA 4D80A 2AKAB 4CMGA 2J9XB 2NUTB 4TT3D 2O2XA 1D4ZA 2W9JA 2Q8NA 3HPQA 3K15A 2PYDA 1BN7A 4RANA 1K2VN 2EGGA 1KU0A 1Z0SA 5FBRB 4KQ1A 2F55A 3E9RA 5ALVA 2BKAA 4QQRA 5F35A 1XO1A 3UGJA 3IP3A 3W9GA 4BZPA 3W8NA 4IN3B 1OAKA 4OX9Y 1DC2A 3X2SA 1CEYA 3DMNA 4I55B 4KYTA 1JDSA 3O8QA 4UI9C 3K9GA 1VHQA 4QBKA 2Z56A 1U04A 4QUBA 5JS6A 4PYNA 1YZTA 3N6XA 4XYMA 3U0BA 3DYBA 1VLHA 5DU2A 4HGYA 1ADFA 1T3SA 1DG1G 4TXMA 3FCEA 4JGGA 3ZEIA 4KXLA 4NACA 2G72A 2A5LA 2DFTA 5C9ZA 4RLYA 4Y9UA 1X80B 3LAWA 3IT3A 4HS9A 2PRIA 3ZV4A 4QEZA 2DUMA 4DEXA 3O9VA 4FZJA 1GG8A 1GR1A 4DQ0A 3SHOA 1SG6A 2BP7A 3FNFA 2H57A 4QGSA 1N2XA 2GYUA 4E7PA 1GYQA 3JZFA 3VR6H 4B6PA 1Z4MA 1BOFA 3UF0A 2QUBA 3ZXPA 1VSVA 4O08A 1W94A 2WWGA 4P38A 4Q05A 4DQLA 4LVNA 1RU3A 4MGKR 2CDCA 2XDAA 3DEYX 5A9SB 3AF2A 421PA 2EFGA 1SG0A 1UWKA 1PD0A 2Z09A 1KJYA 3T52A 1HE3A 4Z6KA 3PNOA 4J49A 4CM9A 1C3XA 4WZ6A 4HYEA 2ID4A 2D0IA 4Q3KA 5F21A 3FETA 2BMEA 3KUDA 3O1IC 4GEKA 5SZJA 3R77A 1UJ2A 1DQZA 3AJAA 2GNPA 2R5SA 4KE6A 1JMKC 1OBFO 3NTRA 2WXLA 4HVAA 2WPVA 2WAMA 2BHSA 1NV8A 4QXPA 5IG2A 1BCRB 3QX8A 4IF4A 5DLPA 1EA7A 1KI7A 2YVKA 4J8PA 2QP3A 2ZTSA 1KZ4A 1JQ3A 4UM9B 3F6PA 4QQIA 4O3FA 5ALEA 1VHTA 2WABA 2FA9A 3QYPA 4EJ0A 2H2HA 4KNWA 4ZOEA 3QEOA 2GLTA 1B76A 3ZD8A 1PVDA 3BTOA 3T9FA 3HZRA 1OH8A 1TZCA 4HB0A 4TLCA 2FRVA 1Z28A 4BMXA 2VVTA 1QIHA 1Z7BA 1YBFA 2J3EA 5ED4A 3GAAA 1WPQA 3GIWA 4G25A 2WOJA 4XASA 4PFKA 3RBZA 1N0WA 3HCDA 4FJ2A 3SS8A 3LRXA 2HD4A 1J7JA 2PZFA 5ALLA 4TOIA 4N49A 4L4UA 1LFDB 3LUKA 1QB7A 1FZQA 3JPYA 2CLIB 1SWVA 1XMSA 1H0HA 5LDDC 4WW0A 5FOWA 1E5LA 2E4WA 1UBOS 3QU2A 3AETB 3F0TA 4WY2A 4RY2A 3VR4H 3VUFA 2Y1CA 4I3HA 2DC1A 5JSYA 1ZD4A 3EZ6A 1FYDA 3V1KA 4L22A 4MGYR 1BD4A 2ZGVA 4QU9A 4HTFB 5B7PA 1E5DA 2JAHA 4CGZA 2VPXA 5FUXA 4N41A 3BSSA 3BJEA 5LPNA 3TCKA 2HN9A 2I33A 2XDQB 5EIBE 3CRNA 2WF5A 4R3UC 2O3SA 1K8KG 3FLEA 4ZCLA 4NE7A 1JT2A 1A9PA 1GLGA 3LP8A 4I9CA 5DMHA 4ZAYA 4FLBA 4RKRA 5H3CA 1SU6A 1DCKA 2NPFA 3KLBA 1RR6A 3UPVA 1YF3A 3D7NA 4HDOB 4PYQA 2GF2A 1VPEA 4INOA 5TMEA 3ZKWA 4UAUA 2WWXA 1O08A 3HZHA 3STUA 1QOQB 1NWHA 4WACA 2QPOA 3ECSA 1PG2A 1SOWA 3IJ5A 2A94A 3ZU5A 1BXKA 1WEHA 1XNGA 1Y34E 1V9LA 2CXPA 2R03A 3OD1A 4WWPA 4OFWA 4U8HA 2JFGA 4GWGA 3K2IA 3W04A 2OCBA 4RX1A 1CZLA 2ZRAA 1UKCA 3W90A 1RQPA 4BO1A 4EMUA 2IOFK 3QA9A 2XXAA 1QIEA 3HQ4O 4EQFA 4GYKA 4QXQA 5KOJA 2NZXA 2PQRA 4X61A 3L8EA 4TL7A 1QE3A 1XZFA 4OUDA 3TNFA 1OZ0A 1FU7A 1HZZC 3B6KA 4JS0A 2W6OA 4AN0A 2SKDA 4CCSA 4BJ6A 2LW7A 3CRZA 1V35A 1KXZA 5FORA 1FQOA 1JZQA 4Q9AA 2PQNA 3HBAA 3OPMA 4O3MA 4TWBA 1SVKA 4I81A 2N47A 5EY5B 1IQRA 4YVFA 2PKCA 1GGEA 3IDSA 3ZY5A 3JVEA 1E2QA 1YYHA 5IKXA 4I8IA 2V0NA 3QW4B 3U1BA 5E7MA 1PQYA 1F4PA 3L7IA 4N12A 4CL3A 4C1BA 3A06A 4GI2A 5BW5A 3LD9A 2LBPA 1B89A 1DBIA 2R7KA 1Z6YA 4GUDA 5HF6A 2B2XA 3C3JA 2C8VA 3JYPA 1RQ7A 1GG2A 3KJGA 3UHFA 3S1AA 3HJRA 4RG9A 3E9ZA 4V0QA 3EFHA 4NP6A 1AB6A 5DCUA 3IEVA 1Y1LA 4C88A 2DLCX 1G5FA 1V9SA 2OA0A 2FMKA 4B48A 1K5GA 2FZ4A 4J8FA 4BRZA 3E35A 2FPUA 2WM2A 4J2TA 2W11A 3OUZA 1LCIA 4HEJA 2VZ8A 4CIAA 1XROA 4CI9A 5AIAA 2IJGX 1N52A 4RJLA 3DMHA 2XJ9A 3TL2A 2FW6A 2YVAA 1UBJS 4M0LA 2AQIA 5LUBA 1V7CA 1ZK1A 3DSVA 1ZRSA 1F6DA 3RBXA 5DN6A 1DTSA 3A1NA 3GYZA 2IU6A 1JE0A 4WN9A 2XKJE 3DJFA 3UNXA 4UMVA 3PFBA 1Q15A 2ISQA 3ANMA 3PFNA 1CQJB 3IIJA 4F3CA 4DX2A 1NRXA 4QOFA 4Z4FA 2W0MA 4ETMA 1ZGJA 3R6LA 1B16A 1PF7E 5KJ1A 1CNEA 3NBNB 2YICA 2P9BA 2FO7A 1UJNA 2OCYC 2B0JA 2VJ8A 5I4CA 4QQKA 2QL9A 4R8KA 1PR4A 1MJFA 3BD8A 3EGVA 4YJ3F 2EEPA 4OQQA 4S0XA 2W43A 3TSWA 2KXPC 3TUIC 4QBGB 3GFRA 4C78A 1UXIA 3OCZA 1CP3A 1W36B 5JBNA 4PS1A 1G17A 1RAFA 3UHAA 1QV7A 3ZHCA 3SD5A 4C04A 3SOPA 1NNI1 4EF4A 4MAMA 4R2LA 1EWTA 2QM0A 3NIWA 4TMXA 2XUOA 3Q0TA 2B8EA 5CFNA 3D5EA 3MZ0A 1KZ9A 2FEPA 1TRKA 3AR5A 4XEUA 3WRXC 3O92A 3QEBZ 4FYWA 4E07A 2HZBA 3S2AA 1RKXA 4ZEXA 5FQNA 2P9UG 2RSLA 2OCIA 1CUZA 5JAOA 4FGLA 3RW9A 1AKVA 2EKZA 3HBFA 4LG1A 5TVKA 4M9CA 4QU0A 1N2OA 1J4AA 1IVYA 1O94A 4LXYA 4URFA 8ADHA 1PCXA 3OY2A 3PDIA 2WM9A 3K1YA 2BEUB 1KPIA 4E1AA 1PJLA 1JQEA 3TNDA 3UK2A 5FWXA 1VE7A 2WV9A 1G5HA 5DHSA 3ED1A 2X6FA 2PBFA 1MO6A 5BYBA 1TMYA 5C5IA 5HG0A 4DEYA 4MDHA 2WP8J 3U4AA 4MYTA 3TIIA 3UQYS 4A8JB 4EX6A 1VBKA 2CEAA 4MRRA 2VF2A 3HB4X 1KAHA 1XKLA 2DQYA 3FOCA 3H2HA 2LVBA 3V6LA 2A5JA 5AM4A 1Y8QB 3SXJA 2LCIA 2PZGA 1PZEA 4D0SA 1NJ5A 3C43A 2CHFA 4LZPA 5I7AA 2DCPA 4ANVA 1R74A 1RABA 4CIBA 5CCDA 3O03A 3R5TA 4DLSA 1W5EA 3OJXA 5K0TA 3OC0A 3ANTA 3TGWA 3WLTA 2F2TA 4C01A 1ETHA 4OYHA 3PRKE 2GFIA 3RIBA 4JUAA 3LXUX 4TSFD 2ONDA 5EI5A 2X8LA 1MJ0A 4UHEA 4XTRA 2Q7OE 5LJLA 2PX4A 3PQ7A 1NN0A 1DPGA 1WZ2A 4XDZA 3IC5A 4UBNA 4QPPA 3JSAA 2AVPA 3ND8A 4DXDA 4D4MA 3H6GA 2GARA 2HFKA 4XE0A 3ZD7A 1SHJA 5JFGA 3AMVA 3CHQA 2OHIA 3CW2A 3F6QA 3QPAA 5LZ8A 1ZX1A 3EVTA 1F9AA 2OZVA 3TOSA 5CVDA 2FHPA 3FM9A 1ZD8A 3TXMA 3WQHA 3LECA 2AN4A 3VYUB 1Z2NX 3BXXA 4QASA 4Y6WA 3M1IA 3FR7A 4FOLA 1LXCA 3LUAA 2NACA 4MMYB 3VYVA 4G6ZA 1M9NA 3DV0A 3GRPA 4NL4H 1KC1A 4CIYA 2CNKA 3KR1A 4WKGA 4IOKA 1Y89A 3PKIA 2X8WA 1LLFA 4P82A 2OAGA 2PFSA 4YCDA 2RI0A 1CR6A 4XDHA 4FBLA 2LUHA 2BGJA 4LSMA 1CBUA 4DW8A 2VHUA 2ZT8A 3HJCA 5DPMA 2G9NA 5K8IA 3AZQA 4IJ5A 1KBQA 2UVPA 4U0SA 2JA2A 2RB4A 4O4IF 4C76A 4KXYA 1HZZA 1H9BA 3LRTA 1ZH0A 4HQ6A 4D10C 1E79D 4GE3A 1E60A 3VVLA 3CUEF 1FNNA 4WZAB 3E61A 1RTKA 4K03A 3OM9A 3G49A 3SJCA 1ZR4A 4Q66C 3VPHA 4JCCA 4FWBA 4G9EA 4C87A 3GA0A 4C21A 1XUOA 2E85A 5J4VA 4XRRA 2VC2B 3JV7A 5FL3A 4KLAA 2CK3D 1NI4B 4RPKA 2AUTA 1U1GA 2CT8A 3WWOA 3HJUA 1LQUA 1CUCA 3QFTA 4QBIA 4ZI7A 1QF7A 4J0QA 1JB9A 3O2QB 4OI0A 1T1IA 3QF7A 1I2ZA 4X6UA 1Y3CE 1LPBB 2BJHA 4UNPA 2PLRA 3WOHA 2PM8A 4L4YA 1WDTA 2F62A 4WKNA 3PC2A 1JKMA 5B2ZA 1RACA 4AQDA 3REFA 3V7WA 1UJCA 2FTKE 5CLJA 4GCNA 2XZPA 4BNMA 2AVDA 5HYVA 3FOAA 3HLTA 4LPSA 5FADA 3KHTA 2IU3A 2QVGA 2D06A 1ORRA 4G1EB 3OQ6A 2FWAA 1IB0A 4HQRA 4QOEA 5KTNA 3EWIA 2CBGA 5BURA 1BW9A 1FSZA 1QAQA 1WUKS 3WHPA 1UFOA 4P36A 4OVVA 3MMNA 2EHJA 4PLGA 2HIHA 5KJNA 4MKFA 4JP8A 1OU4A 3I0NA 5I9TA 2O0MA 4LRZA 2X2EA 2OKCA 4X1KB 4J0EA 4LYDA 3IE0A 4DMHA 3PDJA 4HLNA 1YRHA 3NHWA 1QGOA 3LDHA 2DIWA 4L3WA 4WUTA 3BQMB 4H1HA 2X9GA 1H2WA 1SQ0A 4OMFG 3QFHA 2Z83A 3AG4E 1ZNZA 3HXLA 4MWOA 2XGOA 2WXOA 2QWXA 1O1RA 4I50F 5KS2A 4WVFA 5JNWA 4H15A 1GAXA 1X86B 3Q5MA 4ZV7A 2G1PA 3C5EA 3PWZA 4XLLA 1RDFA 5I7OA 4O4JF 1OMOA 1C0KA 2DETA 4CLOA 3NTLA 1QFJA 5AQAA 2WINI 4U7PB 2HIMA 3A6KA 4TPKA 4Y7DA 3OF3A 2PFKA 4YRKA 5DXFA 1J90A 1ZJ4A 2R8BA 3TMAA 4F6CA 3NTOA 4BNDB 3JUIA 2P1DA 2W8BA 2XOKA 5K0CA 4D0LB 4WMLA 5EKXA 2O2CA 1E1QA 1GAJA 1RPNA 3ZPJA 1SXGA 4N82A 4O0LA 3IHYA 2A88A 3NTUA 5DF1A 4X8QA 2FX2A 4BT9A 2JDIA 4Y6OA 3SP1A 3WGKA 1QIDA 1KK2A 2GYYA 2PZLA 2VGXA 4ZMSA 3WRXA 1OFIA 1FYXA 2R1UA 3CKYA 4AKSA 5MF6A 3L4JA 3R8XA 4KQGA 2YNMD 4RLQA 3H3FA 1RHUA 2FRDA 1Z0FA 4BMSA 1FZTA 4Y2TA 1TD1A 5G1OA 4QTUB 2WKWA 1NOIA 4UUQA 2EU8A