4N3AA

Crystal structure of human o-glcnac transferase bound to a peptide from hcf-1 pro-repeat 2 (1-26)e10a
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
716
structure length
697
Chain Sequence
CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HCF-1 is cleaved in the active site of O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/substrate
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 283
structure length 697
sequence length 716
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4n3aA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4n3aA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4n3aA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n3aA03
3CEJA 1PC2A 1Y6GA 4CTMA 3FFLA 1PNVA 3C48A 3MRVA 3VUEA 2WTXA 1W3BA 2FETA 2XCIA 2LSVA 3D1JA 4WHMA 4HWGA 1YA6A 2IF4A 1LWOA 1WAO1 3IAAA 3L7AA 3RSZA 3L7BA 1XL0A 2Q6VA 2HO1A 1WV1A 2QLMA 2BUGA 1JIUA 4GYYA 3TG4A 5IKPA 4U04A 1NOJA 3K9IA 3Q15A 2VGXA 2XCCA 4IN3B 2VQ2A 1WW3A 2XPIA 1QZ2A 2XGOA 2H1HA 2QLLA 3ESKA 1NA0A 4GA0A 2DBAA 4WNDA 5D00A 4GZ3A 3H4IA 1YA0A 3URZA 1Z6QA 2KS6A 4EKEA 3WXXA 5DXFA 2FF5A 4GYWA 5LCWJ 3EBOA 3PE4A 4MI9A 4HOSA 1UQUA 2IW1A 3T3GA 4BWRA 3KD7A 1E96B 3LY9A 3MKRA 1H5UA 1XNFA 1NZDA 3MA5A 3PDNA 5JJ7A 1EXVA 4G25A 3NCHA 4WUYA 2BGTA 3KAEA 3O3CA 4RENA 4N2SA 4KXKB 1WUYA 3OTGA 1NOKA 2C4MA 5ENZA 4AN4A 5JJTA 1P4GA 3NC4A 2R5SA 1BX3A 3ZFWA 2C1ZA 1PN3A 3RIBA 3WADA 3QKYA 3TSAA 5C1DA 2QN2A 4WNEA 3TOVA 5D0QD 1XC7A 5BT1A 2QRPA 3CK9A 1TJCA 3PE3A 2VGYA 3CEQA 4REMA 3ZCRA 3CKCA 5G05C 5KJKA 3L01A 4N2QA 4YVQC 2HR2A 3UQ3A 2FF4A 1C3JA 1P5QA 4H7XA 4JA7A 3FROA 3MT8A 3MS4A 2LSUA 2GPNA 1FU4A 4BT8A 1IYGA 4WADA 1P4JA 1E1YA 4N9WA 3SF4A 3RHZA 3ASFA 1GG8A 3NP9A 3HBNA 2ONDA 3ZCSA 2PRJA 3OY7A 3T7DA 2PL2A 4LDPA 3ASHA 1L5SA 1ELRA 4G2VA 5KJNA 2Y4UA 1F6DA 2IEIA 2ATIA 3ASDA 3AS8A 4YUAA 5LQDA 2PRIA 2NC9A 3NF1A 3EDTB 3JYSA 5EX3A 4B94A 2FO7A 5G05J 4RIIA 1WUTA 2X0EA 3FWVA 4WACA 4M7PA 1V4VA 1AHPA 3CVPA 5D0OD 4ABNA 1VGVA 2QN8A 2OFFA 3QWWA 1HLFA 1OUVA 4I2ZA 2QRQA 3S7FA 1F0KA 3E3LA 3Q3HA 4J8EA 4EJ2A 3UYKA 3S0JA 4LEUA 4A1SA 5G04C 4I9EA 2FBNA 4BT9A 1IIRA 2UY1B 1SXPA 4EKYA 1Z62A 1EM6A 5FJYA 2AV6A 3OKCA 3ULQA 1IXYA 2YQ8A 3U4TA 3BCUA 4RG6A 1E4OA 3HBFA 5KJMA 3LCAA 4N3BA 1Z8DA 1UQTA 3S7DA 1GPBA 2C1XA 2G9RA 4J8DA 3L7CA 3LYAA 2P58C 1NZFA 3S7JA 3GPBA 3GUHA 2KCLA 1FTWA 2R68A 2XEVA 4WNGA 3QKWA 3U3WA 1C50A 2PZIA 2R66A 2QN1A 3LPZA 1P4HA 1QKJA 2GPBA 2X6RA 3NB0A 4G2TA 4CTOA 4QLBA 3MT7A 3CV3A 1K06A 3SYRA 4AMBA 3RSCA 5TMDA 2QRGA 1KT0A 4G26A 4AIFA 1FU8A 1KTIA 2J9QA 3OTIA 2HY7A 3CVLA 5FZRA 2QRHA 3VTXA 1B4DA 3LY7A 1FTQA 3ZHEA 3E3OA 4UI9J 4W9RA 3D0QA 4YI3A 2IYAA 3EBPA 1ELWA 2JLBA 2F3SA 3BD6A 3MRXA 2L6JA 2G9UA 1ABBA 3TG5A 4X7PA 2G9QA 2SKCA 5GPBA 5ARFA 2X0FA 1NOIA 4GCNA 5TVGA 1C8KA 2GJ4A 1L5WA 3CUYA 4UQYA 4APOA 4BTBA 1HXIA 2GM9A 2QN3A 4RBNA 3CUWA 2C2LA 2BISA 1Y6FA 2IV3A 3LKUA 1HZ4A 1ZBPA 3CVQA 3L7DA 2VGXB 2GW1A 1FTYA 5DIZA 4BQIA 3KS2A 2UY1A 4NC9A 2G9VA 3MBOA 5FZQA 1P2BA 4MHOA 4BQEA 4YVOA 2GEJA 1Y8ZA 2WPVA 2ACVA 3DDSA 2FEZA 5EX0A 3MV2B 1JEJA 2MHKA 2R60A 1SXQA 2Q7FA 5LCWC 3CEMA 3MSCA 3UUXA 3TGOA 3ZN3A 3GZ1A 5G04J 3CUTA 1RRVA 1FU7A 3T3DA 1WV0A 2JZCA 4G1TA 3Q3IA 5FTPA 4M83A 2AVPA 3UPVA 3QHPA 3UYLA 1GGNA 3E4BA 4GA2A 5IKOA 3MV3B 5JTUA 3ZHEB 2IEGA 5M72A 3ASGA 3RU0A 3COPA 4G23A 4RG9A 4U07A 3RO2A 1GFZA 5BNWA 2AMVA 5BW8C 4X7RA 3CX4A 1Y8MA 3VUFA 3MS2A 4KQ2A 5HQ8A 4UI9K 4ME2A 4JA9A 4I1AA 2KCVA 4J0UA 4CDRA 2YHCA 4G24A 1P2DA 3SZ7A 1XOIA 1FCHA 2JJMA 3NAZA 1WW2A 5FZSA 3FP3A 1ZU2A 3GZ2A 1L5QA 4RIGA 5DBKA 4GZ6A 2LNIA 3BEEA 2YJNA 4I9CA 1IHGA 1JG6A 4F97A 3MQFA 3CK8A 1A8IA 4N39A 2H1FA 2QFCA 4HLNA 4EQFA 2KC7A 4NEQA 3ZPJA 3WAGA 5D01A 4N3AA 1WM5A 1RZUA 4Z5XA 2XA2A 4L22A 2IFUA 1Z6PA 2GEKA 2VG8A 4X7MA 3MS7A 3QOUA 2QRMA 1FC0A 2X0DA 1NA3A 2FI7A 3QWVA 5A6CA 2PYIA 2BFWA 2QN7A 3C4QA 2I6HA 2PQRA 1GPYA 5AYWD 4F96A 3T3HA 3ZGQA 1JG7A 3G2NA 4FKZA 3S7BA 2QNBA 4WNFA 3HYMB 2VSYA 2XA1A 4UQZA 4HOQA 3RKVA 4Y6CA 4RIEA 4F3VA 4U0SA 3AMVA 3NP7A 3VTYA 1PYGA 4UQXA 4GCOA 3C4VA 2IV7A 1O6CA 3MEKA 1A17A 3DD1A 2ACWA 2C9ZA 4XI9A 1JIVA 1RZVA 3OKPA 9GPBA 3CK7A 3D0RA 1KT1A 3BD8A 3CVNA 4RIHA 5FT9A 3Q5MA 3TAXA 2C0MA 4H7YA 3G2KA 2ZB2A 4XIFA 1NZNA 1GZ5A 1QQEA 2XCUA 5TMBA 3CKBA 7GPBA 3MTAA 4LEIA 1C8LA 3Q47B 1LWNA 4F9FA 5I45A 1PSWA 2OOEA 3IEGA 4MI6A 4J8FA 3IA7A 2FFRA 4AMGA 4AM9A 3OXGA 3RO3A 2SKDA 2Y4TA 1J39A 3T5TA 3MTDA 2WQHA 2XGMA 1P2GA 3CEHA 1L6IA 5HI7A 3BEOA 4KYOB 5CCLA 1JIXA 2GPAA 4BTAA 3ZCQA 4MHSA 3N71A 3MTBA 4BQFA 6GPBA 4GZ5A 3QWPA 2V5FA 4U0UA 5EKQD 4N3CA 1AXRA 1FA9A 2IUYA 3CUVA 4KQMA 4XI0A 4HOTA 4MICA 3OTHA 1L5RA 1NLMA 1UZUA 4O6FA 3ZCUA 2VYIA 2UWJG 3H4TA 3Q4AB 3L79A 5DU2A 1FS4A 5HXAA 4X6LA 8GPBA 3GYZA 4GYOA 2F3UA 3OXFA 4Y6WA 1XKXA 2VCHA 4U0ZA 3T3IA 3NPAA 3RT1A 2X6QA 2AZDA 2R4TA 4YI5A 3ZCTA 3O48A 3ZCVA 1HH8A 1L5VA 1QM5A 3R9AB 3BCRA 4KBQA 3BDAA 3S27A 4NESA 3ZCPA 4EL5A 3CV0A 4PQGA 2HYZA 4AY6A 2XCBA 2QZSA 4AY5A 3Q3EA 4NQ0A 2PQ6A 5CHEE 1NVKA 2E2EA 1M5RA 4GPBA 4HOUA 2QLNA 2F3PA 4I17A 3GW4A 5CCMA 3BD7A 2KATA 1XV5A 3OY2A 5JTTA 3OKAA 2XMPA 2AW3A 3Q49B 4GA1A 4UI9C 3VDNB 2SKEA 4I2WA 4NRHB 1L7XA 4CGWA 5ARGA 5KJLA 4HORA 2F9FA 2IYFA 2VCEA 3MT9A 3T3EA 5JJ6A 4GPKA 2XA9A 4N5CA 1B89A 1P29A 3E3NA 3S2UA 1GPAA 3SYMA 2KCKA 3HBJA 2GT1A 4RELA 4W6QA 4BFCA 3AS4A 4YNDA 3S28A 2PQNA 2VSNA 3BCSA 4MRAA 3QDNA 3G2LA 2P6PA 2R4UA 4KQ1A 3G2HA 5A7DB 3OXLA 1YGPA 2F3QA 3DDWA 3OT5A 4EL0A 4CTNA 3VDMA 4JL0A 4FZRA 1KLXA 1K08A 2C0LA 3AS5A 2XGSA 4M60A 5DLDA 2O6LA 3HBMA 5TMEA 3G2JA 3DZCA 3WC4A 3RJVA 3MRTA 2PYDA 4RIFA 1XL1A 4JHRA 2BGUA 4CGVA 2ECPA 3S29A 3G2IA 2ASVA 3CUUA 4MI3A 3LY8A 2QN9A
chains in the Genus database with same CATH superfamily
1AN9A 3SI7A 5AW4A 2P78A 2RAPA 5COBA 3RF7A 2A88A 1PNVA 1G0OA 4UTOA 4GBMA 4DC0A 1Q20A 1AK1A 2G83A 4RMGA 5L3ZA 4ABYA 2XCIA 4QBTA 3D3JA 4BJ6A 1W5SA 2J9YB 2YJ3A 1ANKA 4I4IA 3E05A 4MO9A 2XEHA 3BKWA 5TARA 1JWAB 3U4AA 3KOUA 4TTJA 5IPFA 4KL8S 1W25A 1XCBA 1TU3A 2K4NA 5FL7D 4F53A 4BMYA 4M9RA 5CNKA 3HJGA 4UYKB 1BXZA 2DKFA 3JVDA 3NWJA 1T8YA 4OCZA 4QJIA 4DZTA 3PFWO 2AN4A 5GTDA 2VPTA 4DIKA 1LI4A 1HZZC 1P77A 2WHXA 4EGCB 1PBTA 3HCFA 3V33A 2CSXA 4PGFA 2P3QA 3K0KA 3GT0A 1KFBB 1N9AA 3VR5A 5C18A 3JCZA 3T7TA 5JAHA 4MUGA 1YZGA 4WY8A 3GB9A 2VHVA 4FA6A 3ORQA 2HK7A 2IIBA 4IG9A 3CWQA 3RPEA 3UUEA 3QX3A 4CUZA 1QGED 3IIIA 1XKLA 1DAPA 2HF8A 1FVOA 3LFTA 1GTG1 1Z68A 3KBBA 5LCWJ 1JEQA 1KZPA 1QWSA 3EBOA 1OXXK 4HDCA 4PG4A 3H97A 4BV2A 4DCTA 4EH1A 3MOSA 3V1YA 4CF7A 3QUTA 4HS2A 3IPAA 1DXYA 1KYXA 2I3AA 5BSRA 3OICA 1WMBA 2ZATA 4JX9A 4MVJA 2I6QA 4D8XA 2PZ8A 4TGLA 2JFBA 1R18A 2P90A 3ZLBA 3ETNA 4O2AA 4EJSB 2W98A 3LY5A 4HWTA 1O2DA 2ZT5A 1J5XA 4J8SA 2FPPB 1QIGA 4HPWA 4JP5A 5B6JA 3GQBA 2FP4B 2HWXA 2IZZA 1E5DA 2BGTA 5AJDA 1V1MA 3CJQA 3NALA 2OCIA 3WLHA 2YC2C 4MS1B 1SD1A 2EVWX 3Q12A 5LZ8A 2JIZA 4PH4B 1NT2A 1LDGA 4TKUA 4BO3A 1XPOA 2W2LA 4KQ9A 1O97D 3DRAA 2V74B 2O3TA 3MSXA 3ODGA 2Y3AA 3ONKA 1PN3A 4UKDA 3BH0A 1AKEA 1C7RA 3IEIA 2Y67A 3TSAA 4KFRA 2B82A 1P7PA 5C1DA 3H6KA 2VZ9A 5A9SA 1CQZA 1FFWA 1IY8A 3CW9A 3GEGA 2AXPA 1YZQA 1XELA 1XHEA 1TPYA 5BT1A 3PZRA 4RLFA 3FU5A 5F5LA 2XNDD 4ZVQA 2X13A 3DKKA 4I1SA 5CD1A 1FB5A 1UBUS 3QQPA 3RUCA 3ZS8A 5I9IA 1GZUA 3C14C 3EEBA 3GV0A 3WL6A 4DX5D 3OEEA 3DT9A 1BE8A 1MZCA 4M7WA 4NR0A 2XTMA 4W5HA 4C3UA 4XYLA 4Z1OA 2Q41A 4HBDA 4WINA 3FROA 3N8NA 3KYDB 2C8KA 1M1UA 3A9VA 2C88A 1DC8A 4JT4A 4OFZA 1IYGA 4YB8A 2FF7A 3UJ9A 4C07A 5A9RA 3AHHA 4V2IA 4ZMSA 2BEWA 3FNGA 3I9JA 4Q5IA 5LFAA 1NKTA 3JPYA 4W1RA 2UXDB 1QPBA 2I1QA 2YRFA 5FR1A 3G13A 2A1UA 3AGQA 4BAZA 4ZYTA 1OFUA 3AOEA 4IX1A 2WJ4A 3Q15C 4Q9KA 3HJNA 4LDPA 1XCGB 1I01A 2D06A 4A82A 1R6AA 3ASHA 3U48A 1N2HA 3PRHA 2PM8A 2ZGVA 3R3UA 4LXGA 2OV3A 4KPEC 3LUAA 1V9SA 2B9VA 4C4RA 3JWIA 3KOWA 2ETBA 1F6DA 2PPVA 2QTBA 4L0QA 4MMXB 4OQMA 3AS8A 2P41A 3B36A 3SYKA 5AW8A 3KAJA 3LCUA 4YDHB 4DDWA 2PJRA 3ZTYA 2UZ1B 1SNYA 1XDGA 4J0EA 4WKGA 5FBVB 1ADBA 1Z5PA 4WACA 3UJ3X 1WXHA 1C4WA 3WV4A 2OBXA 2MR5A 5AQBA 2FUKA 3KVVA 4EJ6A 1OX5A 3F0TA 2ZB4A 3EN0A 2FK8A 2CL5A 4DPLA 2WR8A 3EYWA 2H5IA 3ISJA 4G4GA 3ZG6A 1YOVB 3IAFA 3J5PA 1NQTA 1S4MA 4XR4A 3SHVA 4DIBA 4J43A 2CFSA 4L57A 4WOKA 2Y9PB 3K73O 2GXQA 3WB2A 2G67A 2VHJA 3VHRA 4YUWA 5ELLA 1JHQA 4ALJA 2V8OA 5BXUA 3DAFA 4YDSA 4YPVA 3LJ3A 3PHJA 2PE5A 4JH0A 4UVEA 1Q0LA 2QORA 2HWUA 2QVYX 5IT4A 1YDGA 2OKCA 1AP7A 1PEYA 3BZUA 3FYUC 3L0OA 3AT1A 2ZBDA 1UWCA 3W5HA 1Z8FA 4GAEA 1Y6JA 3I28A 1JFLA 4J8DA 3A3KA 4X54A 2IUUA 3MMXA 4GR4A 1SR8A 3EEOA 4GQBA 4AS1A 4ID3A 4EVIA 4BRUA 2H8KA 2PBZA 3NIBA 1OLSB 4G63A 4JITA 3GJRA 5MF6A 4LZOA 1G60A 2YCLA 2B3DA 2QN1A 1UM9A 4CMEC 3BSSA 3NB0A 2ZS9A 3H2HA 2GPBA 2PL5A 4MA4A 4NNJA 1Y3BE 5KWSA 2CJYA 4IMJB 3CLTC 3IQXA 2N47A 2ZR8A 3U0BA 2RAUA 4LYGA 3E33A 3ZHRA 1Y42X 2PKWA 2HY7A 3ZXXA 4CMGA 3LRTA 4NCXA 3KHKA 4EG3A 1M34B 1W96A 3DH0A 2QTCA 5JLAA 4GLLA 3T99A 5LP6C 2RBEA 3FMGA 3FVWA 3IAEA 2GZ2A 2EHDA 3FPCA 2H3EA 4KWEA 4N0PA 3I0MA 2FN8A 3IB6A 3OZFA 3GEMA 1NGSA 1XBTA 5CNJA 1C5KA 3FUVA 3LBYA 2JAUA 2XWBF 5MFZA 2I0FA 3JZAA 2CNDA 4UWGA 1RNLA 2A94A 2J41A 3CX7A 4RFLA 1W36C 2VUTA 3BJIC 1I7QB 2WB2A 2IWHA 5CAEA 3O8OA 2R6JA 3KCNA 1GDDA 3W8FA 4MV3A 3ZDZB 1FMFA 1YKSA 3NXSA 2X0FA 3I92A 1KP9A 3OJLA 3WLQA 3MMPA 1XVTA 4RK1A 3MHTA 1W8IA 2WAOA 1L5LA 2VBFA 1RTKA 2AUTA 3LKBA 4R2KA 4D0GA 4KMMA 2AWNA 4B0PA 1R0XA 3R44A 1Q0HA 5I7WA 1KZOA 5LU9A 1T9GR 2ZDGA 4RYDA 4P7FA 4D9BA 5DIZA 2OHGA 1HYBA 1Z0KA 2OB1A 1JKMA 1P2BA 3DPSA 1MEEA 5CYGA 3WQSB 3IBGA 3HKEB 2QIOA 4H7IA 1H69A 1X77A 2OYCA 3D8TA 1HY3A 3CR8A 2ACVA 4ZO9A 1UAGA 4TS9A 4EB8A 2YASA 4EDHA 5AW9A 3SHWA 3WL7A 5KKCA 4R84A 2IHJA 2MIIA 2ZWVA 2XH8A 2ODWA 5EDSA 4AW9A 5DHPA 1BGXT 1Y89A 2VH2A 1X8JA 4K0RA 3CEMA 3N6VA 3GZSA 3MSCA 2UUCB 3ZN3A 5BWOA 2IPLA 2MDTA 2NZ2A 1B14A 1POXA 5DBFA 1E2JA 5H9WA 5I9SA 1GO2A 1OX6A 3REFA 1Z34A 3U7IA 1CQJA 3G89A 3TQCA 1YCGA 3UY4A 2GYUA 1PQUA 1N6LA 2BTQA 4RDCA 1P7CA 5DTEA 4W8GA 3UYLA 3VR5H 1BI7B 1GGNA 4M7OA 1BEEA 4EFMA 5CGZA 1FJ2A 4JEHA 4PQEA 1H65A 3ZGOA 2HCJB 3KWFA 2Q5HA 4PBRA 5DHSA 3TTTA 4WCFB 1GFZA 2QQGA 5U4QA 2OXCA 4JB8A 1BW9A 4WZBE 1QMGA 3IPXA 3N0WA 4X7RA 1INLA 1C1YA 2X3UA 1JG3A 2B1JA 3P5BA 4R2XA 4RVDA 4LV5B 1O1TA 3CY6A 3B5EA 1V96A 3BMOA 3EEIA 1LU9A 3TW0A 4PV7A 4PSKA 2I4MA 1W30A 2EIKE 4DXHA 3GNQA 4IOLA 4K6KA 4RTLA 2ANBA 4Y30A 4JBXA 1YB5A 4RE5A 3D6MA 3GZ2A 1R88A 2IKQA 1Z0SA 4IGAA 4IXTA 4NF2A 2V7PA 3S99A 3OOSA 3V4RA 5TJHA 3USZA 4I50F 1OYYA 3COSA 1GARA 1Z2PX 2I9KA 3CHPA 1M0SA 3UXYA 4UBNA 3RIEA 3STVA 5JXGA 4MR9B 4PCVA 1GKLA 2VNAA 3RVNA 5COQA 4CT0A 1HE4A 1RMYA 3ZD8A 4XKCA 3W6NA 3L84A 1P18A 3ZUGA 4M38A 3KZXA 4AG3A 1N9GA 4D79A 4X7BA 1JN0A 4GOJA 2ERCA 2J09A 1O5TA 1XNGA 5FOUA 1Z5WA 1RYBA 3ZHZA 4TWRA 5K05A 4IL5A 5GIPE 5TPZD 5GMOA 4XOUA 3RVBA 4DSAA 1GDHA 1GGHA 5B3AA 5IKEA 3WLRA 5BVGB 2HIMA 2ANCA 2W93A 3VYRB 1V0JA 3ZDYB 4Q7QA 4KJZA 5A2QA 3UKRG 3OJWA 1NTOA 4ZVMA 1VXRA 1N3IA 5U4XA 2OHXA 2PYIA 1V8BA 3LYLA 2QN7A 4DL9A 3D7MA 1PWYE 1OROA 3WWOA 4XCVA 5DHUA 3HJFA 1K6JA 1HT2E 4MAMA 1C9KA 3DBLA 5K09A 1O0BA 2IP4A 5CBNA 1CRLA 1E1QA 4IY1A 2VXYA 4AXXA 3EZFA 3ROFA 3P9QA 1H3NA 3AU5A 1LPPA 2R25B 2JFFA 2OYSA 3PUYA 4LWPA 2G9ZA 3TWXA 3ASVA 5ER6A 2K7FA 5CX4A 4J9VA 1SIWA 4DMFA 5T41A 2WWHA 3Q8MA 3AUKA 3RE1A 4U2KA 1IN6A 2LE0A 1J20A 2OHFA 2WV9A 4KH1A 1PYGA 2BLLA 4JI5B 3WGVA 2BJVA 3UG7A 3O4ZA 3D3QA 3I32A 4WE3A 4ZVKA 2G6BA 2PSJA 1UXGA 4NZNA 3IO3A 2Q6IA 4HRXA 3P4XA 1ZGCA 3L7JA 4KKXB 3IUJA 2WMNA 3QX7A 3TFQA 1MXFA 3G2OA 3K8ZA 3THWB 5AK4A 1B16A 1OWOA 2H2HA 3NDRA 2J08A 1F2TB 3O4GA 4G1UC 1II8A 3OJEA 2BDUA 4KQFA 4QDXA 4CL0A 4RIHA 3VI3B 2VUSA 5EXEA 5EE0A 1NMEA 2OCCE 5FT9A 1CUBA 2WRZA 2VN8A 4U1RA 4D57A 3RC7A 2ZB2A 3G5TA 2Q62A 2XODA 4LQDA 4YALA 2VF2A 1E6MA 1SU6A 2E48A 3L17A 1MGOA 2FWNA 3DE2X 3SZUA 3WMRA 4IMIB 5B1BE 2R8PA 2BKGA 4P3YA 1XKTA 4V0OA 5BR7A 3JTEA 2GAFA 1PSWA 1V1RA 3KSRA 2VK4A 4Y9SA 1G3IA 3AVWA 5BOSA 4DE5A 5D7NA 3PQ4A 1O8BA 1SH7A 3I23A 1TT5B 4R3UC 2PZLA 1C2YA 3L6DA 3I04M 3NTRA 4CTKA 1U5CA 3WWCA 4JJ7A 2V5UA 1HC7A 4TROA 5BNIA 5LSAA 2GB4A 2O8DA 1QHIA 3IJ5A 1FT2A 1NE7A 3NBFA 1PJ2A 3WZLA 4HTAA 4TTAA 1C7JA 1ZGAA 1KVTA 2FHSA 2I9PA 4MUKA 4NVRA 3G5UA 4RW0A 3W9UA 3NAQA 3BHIA 4CV0A 5LMZA 1NRIA 2E5LB 1AXRA 5FA6A 4GOLD 5L6MB 1FMCA 4XI0A 3LZDA 3GRYA 2IQCA 5EJ5A 2HJGA 3WVNA 1EDOA 4KDRA 4E85A 2XV1A 1W4ZA 2E3JA 5HFAA 5DU2A 4WAFA 4IV5A 1Z13A 1LDEA 3GYZA 1IZ8A 2QUJA 3IVXA 3LC0A 4OQPA 4WMLA 2BONA 2GCIA 3NI2A 1DJQA 2NXWA 1E0DA 1BX1A 5DYNA 2CJWB 3QEJA 4I4NA 2OQVA 3PJRA 2B5VA 4HAWA 3EGOA 4BXOA 4E0BA 5ESXA 1QH8A 5TLSA 1NA5A 3NW9A 2OK7A 3E5HA 4WD3A 4P08A 5EC8A 3Q98A 5LLTA 2P9IG 1A69A 1QM5A 1ZAYA 3TWSA 3WA6A 3WIDA 4ZI3A 1OTYA 1GOTA 2COKA 3SXUB 1WLYA 1QH1A 2FI1A 5DYWA 1ADGA 4AY5A 2FPUA 4TZ6A 2C04A 3EG9B 2FCRA 4CMBA 5BW6B 1A7AA 2A9QA 2BV3A 2QLTA 4YTEA 5LL6P 2G71A 5D85A 1GEEA 5FOSA 4KQXA 4QTTB 1HORA 2OLKA 1G21A 1PT6A 1R3UA 4ALKA 5C8DA 3DSSA 1WZNA 3H3FA 2HIHA 2WAAA 4GVXA 2BFFA 2V5QC 2JZOA 3UHJA 1SXIA 4B09A 5L3QA 3H2IA 5JAUA 1Y3HA 3IA2A 4QDZA 4GMKA 1CIPA 4KXYA 3TFWA 5H7XA 3M4JA 5ARGA 1ONBA 2I2BA 2UYYA 3ED5A 3OQIA 4C4AA 3AOGA 3UOGA 4FFDA 1F0PA 1PJZA 4YCSA 2IELA 5AXDA 3VKWA 1B89A 4D99A 1EBBA 3UJAA 3WHIA 1Q16A 1DFGA 5KSPA 1UJ6A 1YJXA 2P35A 3LK7A 2FA9A 3DC7A 3O9MA 1TPZA 3C3MA 3I42A 1G20B 4JVLA 4NBRA 1LNQA 4ZOLF 1IMOA 4DQLA 3ENQA 3QPCA 4RGYA 4EB3A 1DEXA 1T3HA 1KBQA 1QBKC 2R79A 4TMVA 4U8VD 4B5LA 1KH2A 1NX9A 4PGAA 4ZCTA 3ERCA 1O9HA 1NF2A 3QDNA 3GGOA 3OC0A 4PW0A 2BGMA 4Q4HA 1KY5A 4HNVA 5JSQA 4LY9A 1X7GA 2B34A 2RGCA 3M6LA 3OPYB 1ID1A 4KQ1A 3U9LA 1X70A 1Z0UA 3GRUA 3G2HA 2ZWAA 1Y98A 3FMPB 4M8KA 4TWJA 2WLTA 4B7UA 2X9GA 5FAXA 5KVAA 3DZIA 4KODA 5F64A 2ZCJA 3NWEA 3DW1X 4NH0A 5DT2A 2V65A 5JCOA 3RIXA 4A3VA 4GPMA 4HAUA 4Q21A 4MCIA 3AS5A 1UJ2A 1QGUB 5I4IA 1IXZA 2BSAA 1FTSA 2WUGA 3D7NA 3HBMA 4FJ0A 1NZJA 1FXWF 3ESLA 3HWSA 2V7WA 3VISA 1RJFA 4CWAA 5TPZA 3GPDG 3ZWOA 4D82A 3T5XA 1T10A 2CXUA 1PI3A 1CNEA 1V5FA 2WAXA 1N92A 1N1GA 3D54D 4OSOA 2NVBA 3NHZA 2WQ6A 4FPXA 3FYHA 4DC1A 2AMYA 3S4YA 5CFZA 3F5SA 2WWFA 4KV9A 4CQMA 1BDHA 2I1JA 2ZPUA 5IUKC 1PC2A 1Q12A 3G88A 5BN1A 2J49A 3UTMA 2RG1A 5JR3A 3GJ5A 1N2CB 1NIPA 4DWWA 3E5RA 2XEXA 3H65A 3CXUA 4FSDA 4XM1A 1TRKA 5DTMA 1J42A 5J4KA 5KYKA 1CR2A 3ZJYA 2O8CA 1PZNA 3KOZA 3SS7X 4ER3A 5H3CA 1XEAA 1H6OA 1YU6A 1YCSB 1YQ9A 3R1IA 4G1EB 4LJ8A 4LOAA 1E3QA 4Q9HA 3WWPA 2B6NA 1JDTA 4FT4A 1YUMA 2DAPA 1PR9A 2EGGA 2R1TA 1MAVA 1OBFO 4WH0A 3NIDB 5DX1A 5LOZA 3ICOA 2CC2A 4KIFA 4UFNA 3OT4A 1SO8A 3FD8A 3ESKA 3EDOA 2EILE 4GA0A 1IBRA 2EOAA 3A8TA 3L8CA 5FQ6A 3HNRA 3SBXA 1DXHA 3WLTA 3M6AA 2FWIA 2HIGA 4H4EA 4B4WA 2YW2A 3WP0A 2KS6A 4HYTA 1GZ7A 3O5AA 2RCNA 2VQDA 1NE2A 3ZU7B 3NWPA 5LXTF 3AU4A 3D9PA 4I1IA 2RMKA 3H2YA 1QYCA 3RRMA 3WIBA 1WUHS 4BO5A 2VOEA 5I7FA 4Q47A 1DC2A 1QH1B 4MI9A 2VUUA 4ATGA 1F2UA 3K9FC 3BXZA 4L6AA 1VL8A 5GM1A 1QV9A 5HJ2A 3ZHBA 3SGLA 5K3CA 1Z63A 4FP7A 2CXRA 2XTJA 4CEHB 3E3MA 3DHWC 2OEVA 3F8SA 3TQTA 5FWNA 5E9JA 4TLAA 1H2BA 5BXQC 3MWJA 3PDNA 1T9KA 1TF7A 3EOZA 3KAQA 4G8BA 5DN6A 5TQ2A 5JNVA 4IUYA 1JPNA 4NNOA 3M9XA 3UC5A 2CG3A 1J4AA 1M6VB 3NCHA 4CKBA 4IHJF 1PZGA 4OGGA 1QGZA 1P1CA 1WUJS 1XLTA 2MRIA 1Z39A 2PG3A 2Z83A 5CT4A 4ZV7A 4N8EA 4BRZA 4ZGBA 3K70D 3MUEA 4YUXA 2CWDA 4P5DA 4UU7A 2E6KA 3KVYA 4NZZA 5EJ7A 4AWXA 1E9SA 3DLHA 2X5KO 1O58A 1QJ4A 3DKPA 2RG7A 2BE7A 5JMPA 1FW6A 4GI1A 4HUQA 1A0OA 2QI9C 4UTVA 1X7WB 2C7OA 3ZGZA 3Q7QA 1FQOA 2QYSA 1N6KA 1MNQA 3DEHA 3UMBA 3T4XA 3L6CA 3B6ZA 5CX1B 2ROQA 2SNIE 1XTJA 2XPCA 5JVDA 1F4LA 5LD2C 4Y2UA 4AZ3B 3DNMA 1T0PA 2PJDA 5K51A 1CP2A 3GRVA 2FQ1A 1CUJA 4ZHQF 3B7SA 1F60A 3UIEA 2A9KA 4RWZA 2BFBA 1RKUA 2CW5A 1JPVA 5AKZA 2FN9A 3NLLA 4C0HA 5H8WA 3WLMA 1ZUHA 1QOQB 1JMVA 5B3SE 1RKQA 1P4JA 2V0PA 4HS4A 4MWZA 4DJEC 4PIPA 4XWKA 3O8RA 1J8DA 4DSOA 4QECA 3A9TA 4YRRA 5PNTA 2ONDA 1M6YA 3ZCSA 1W1WA 2HSJA 3QPVA 4X0EA 3RU2A 2X23A 2B37A 3I61A 1XJWA 2JLCA 3SY8A 4FWBA 4HNGA 4DUPA 3FWZA 1P3Y1 1U6JA 3SOPA 3ZH9B 5EJFA 2ZS7A 4ABTA 2FULA 2QYTA 3BJEA 1JA1A 1ZW6A 4UHKA 2PRZA 5FULA 3DTVA 4WGGA 5DTQA 1E6UA 1TMYA 2NC9A 3SQOA 1SVOA 3JV7A 2OCPA 4KI7A 5DHFA 4BV9A 2OXIA 4Q3NA 4Z51A 1LLFA 3OECA 5EEHA 2GRMA 4B3SB 2NTNA 4YMHA 4OYLA 4V3IA 1W581 1NUAA 1J0BA 1IPEA 1P91A 2HHJA 2VWGA 2O2HA 3D4IA 4E33A 3CVPA 4K88A 2EL7A 3FSJX 3ZLJA 5FOWA 4NS1A 4R8RA 3IAXA 1TAUA 2JKVA 4DM4A 1T36B 1ISPA 3B7WA 2HPAA 1ZG3A 4JS0A 3GC6A 4ID9A 1KI8A 1YK0A 2R4QA 3E3LA 4AFNA 3EVGA 3LT5A 3QU5A 2CZCA 4IOMA 4QJ4A 3PHHA 3T7SA 3TLBA 4D02A 1WB5A 3TINA 3RGGA 2QPLA 4IDGA 4DZRA 1FFXB 1YS2X 2ERXA 2Q5IA 3CJTA 2BMDA 5FPTA 4EHJA 4X93A 5AM1A 1YHYA 3ZWBA 3OKCA 3C15C 4HLUA 4C30A 2JNWA 1UN9A 4PXYA 2P6RA 4D9CA 3AG1E 1TM4E 3FUTA 4N3BA 2WHPB 4JI7B 5DRTA 3IVMA 1MHQA 4LG1A 3OZAA 3TLMA 1YZKA 1Z5UA 1PUXA 1O0CA 1JT9A 1UIMA 1IPHA 3VCXA 1Q83A 4OOEA 5LBIA 1ELOA 4MRRA 4QQRA 4RU1A 2NU7B 3F7OA 3GPBA 1C7FA 1HQDA 1SUAA 3LZCA 2Z08A 3EIHA 3QLTA 2V4HC 4M0EA 2X1MA 4UPDA 4EGAA 5B3LA 2X6RA 4O60A 2ZU6A 4MS4A 5EILA 4H7HA 3M4ZA 4XCXA 3WKBA 1Q17A 4AKGA 2J5XA 1IXVA 4H7FA 2FPPA 4OF4A 2ZKIA 1N77A 3VGJA 2O0JA 2NSHA 4K5CA 4TMZA 2W7TA 1TX4B 1GL6A 2ZR9A 3PQ3A 1R27A 1XYYA 1YHZA 3OE5A 5EP3A 2W5UA 4KPUA 1EUCB 2WD7B 3IQZA 2F6RA 3A1VA 4NPHA 1TNBA 4DCPA 2QTNA 1PFQA 3ZDCA 3TBFA 2DYKA 4FOSA 4GR5A 4WCVA 2PKEA 2XWQA 3R7DA 1M1NB 3UWPA 2FWJA 1KC3A 1H8EA 4CV3A 3NR2A 5E2BA 3DXXA 5DBHX 1U7OA 2OD2A 3T4EA 1NXWA 4Q15A 4URUR 1XZNA 4X7PA 4JLKA 1ODCA 1ZOLA 1VYTA 4R69A 3HCCA 1KXZA 4RETA 3IHLA 1H1LB 3M81A 5C1PA 1Z5GA 4ZU6X 1KYTA 1TNDA 5ICEA 1C8KA 3RS7A 3H9CA 5EAIA 3CSSA 3AC0A 3F6PA 3IQFA 4UMDA 5EYPB 2DKOA 2HBQA 1KQ3A 4A16A 1NG9A 3DYVA 1OE0A 4MVYA 4QOIA 3KPJA 1JQDA 2D4AA 4MB0A 1HZ4A 3UT6A 1GYRA 1W1IA 4UUAA 4BLWA 3CVQA 4Y2TA 3D3EA 2VWQA 4H60A 2QTWB 4GAAA 4XVHA 5JECA 2N75A 2R2AA 3SZ3A 4QREA 5BPPA 1TM2A 4TLCA 3R0JA 3V6MA 4BQEA 3BG0B 1HFEL 1TI7A 2NO0A 1A9PA 1GNRA 1ZSNA 3MB5A 4NBWA 1GPUA 3G0GA 2CXSA 1KGDA 4KWTA 3VOAA 5GM2A 5B1DA 2JKYA 1XF9A 1VZ2A 1O8CA 1E18A 4TUYA 3EVZA 4C1BA 4EG4A 5LXTB 2R60A 2VK2A 4MWCA 1ISHA 4DMKA 3QC1A 1GU1A 4J0IA 3ZI0A 2OLJA 2AWOA 1CW2B 1BCRB 2IIQA 3DGEC 3EHMA 4DJAA 3G9TA 2Y92A 2WWYA 1K3ZD 4TTTS 3PPIA 4OLHA 3S2IA 5GQSA 4EPWA 1U63A 4UHHA 3IDZA 1QP4A 2ORVA 3L82B 1VIVA 3O91A 1DDIA 4NBVA 3T3DA 2NWQA 1BHO1 4WL0A 3UWOA 3A05A 4OI0A 4RLHA 3A2NA 3SE0A 1RCUA 3GMSA 3E82A 1D7AA 4XFJA 3C87A 1E98A 4UAGA 1UFKA 1JZSA 1U2DC 1K1BA 1ZLXA 2C83A 3PL1A 4RSHA 3G8AA 5KSZA 1JHYA 3LG2A 1ZINA 3PUJA 1P17A 1ZCJA 1YDWA 4XA8A 3ZOZA 3WO0A 4AQYB 1DC3A 3JQ8B 2IHYA 4AURA 2QZ4A 2QJOA 2VHWA 1QDLB 4GXNA 2QLBA 4IVNA 3FDXA 1U8ZA 2PGLA 3RAJA 3CNOA 1XK7A 3OX2A 3GJQA 1H5NA 2UZ3A 3TWTA 1LTXA 3PC8C 2QYUA 1GQ2A 2JJMA 4RFSA 1HDIA 5JNTA 5JO0A 2K6GA 1E2PA 4RESA 3ZVKA 3H8WA 3ETEA 3IHTA 3KQWA 3UMJA 4DNQA 2C8JA 2G4CA 3R0IA 2AF4C 4B75A 3D3WB 1HA3A 2AXNA 4BWFB 1FP6A 1OWLA 4AUEA 3LT4A 2PMBA 3KV1A 5KYTA 1TYZA 1M2KA 3DYIA 1UM9B 4E09A 4OXQA 3TQQA 5DH9A 1YGYA 2LKDA 4COKA 1IWBB 4BWGA 4BX2A 1BRTA 1I33A 5JPDA 4N39A 3WTCA 4HLNA 5A6SB 2BEWB 1AMOA 3C41J 4EQFA 1GG9A 4V0ME 1GUFA 3Q2KA 1I13A 1TNZA 1RLTA 2P1DA 3DB2A 3FRHA 2X8WA 4QVGA 2EZ8A 4RK0A 3L0SA 5D01A 5IEBA 1J0CA 1BYUA 3PXUA 2FQYA 3GVCA 4NX2A 4PTYA 4F3NA 5A4MS 1A76A 4LCBA 2C0CA 2L0XA 3E7DA 4HQRA 2CLLB 2DFKB 3LCCA 3GBSA 4BB6A 2EERA 4TTVA 5LOVB 1BVUA 4Q24A 2ZIWB 2TSYB 3U80A 2H5EA 3TTXA 4MYDA 4E11A 2CJXA 2NXJA 3DWEX 4QZVA 2JLYA 1GPYA 4KR6A 4QGGA 5BNTA 4KR3A 4EUFA 5F73A 2PSEA 3DV0B 3FOAA 4R7ZA 1VRVA 3OVMA 3EMBA 5B4TA 3EGXB 1T9DA 3GR6A 1FW8A 4HLQB 9MHTA 4YDRA 2J31A 1WCXA 1H9AA 4FD3A 4CEMA 2CMDA 2ZRMA 4EIWA 1W48A 2JA2A 2XOKD 2J0VA 2OHIA 1Q0RA 3MJ4A 4KO3S 4LW8A 5ICSA 5ENDA 3RNLA 4FX2A 1CQWA 3FLAA 1X9HA 4RVCA 5ED0A 3TZHA 4BWVA 1P5HA 2I5PO 4BNDB 4E31A 3J81k 1D0IA 1MO2A 1TW3A 1YS4A 3MEKA 1NTRA 4BXOB 2PH7A 3QU4A 5E0KB 4YCMA 4GTOA 2WIFA 1H1DA 4H7DA 1RBYA 2DKNA 2O06A 1KT1A 4GLFA 3RVJA 1RYZA 1JLLB 1VI5A 3R3JA 3HEMA 5TSDA 5E6UB 1MFPA 1Z75A 2PS1A 3MCZA 3TAXA 2JHCA 2P2ZA 2UKDA 3N86A 1BQ4A 3I05A 4K9RA 4MUYA 3ZZ1A 3I9KA 4E88A 4HNTA 3IIJA 4WBNA 4MKRA 1G5IA 2JCGA 3AR4A 5KWJA 1RI4A 2IS6A 2FYTA 4D97A 1A7UA 2OZEA 4EVSA 2XWPA 1T13A 3RVDA 1Y3DE 4E2FA 4U6NA 3T15A 2IOQA 3J81A 3ST7A 1XIVA 4M54A 3KG2A 2H57A 1KEPA 1Z4JA 2C5AA 3VYTB 3K2IA 4X6YA 1MC5A 3QE0A 4DMGA 3GEHA 2W37A 2N46A 3D59A 3EVTA 3LHSA 4OQ4A 3KBOA 5A05A 4DANA 3GT3A 2AR7A 3TSZA 5KSYA 3USCS 4MOWA 2JH8A 2NUPA 4L4SA 1NLYA 4QHYA 4QWWA 2GBLA 3VOBA 3IURA 4RY2A 4UBJA 3D31A 2C9BA 1ZP6A 2D5CA 2DC1A 4FONA 4V0MA 4X44A 1OCEA 2HKIA 1L1RA 5DW3A 1KH1A 2ZWOA 3L3BA 3UJHA 1NMSA 1T1EA 3C1TA 4FZVA 4BQFA 5HP4A 2AYYA 1QP7A 2D7CA 5B1AE 2HYDA 2X9LA 4L9WA 1UDRA 4ZHQB 1M5TA 3B1FA 3V9AA 5EZSA 4FMPA 1IHOA 2O5VA 4BERA 5DXAA 2VPQA 3NOOA 3CH7A 3UM2A 2VYIA 3HB1A 1EPUA 1IWOA 1R74A 4AO6A 1CJUC 2RJNA 1ADYA 3DMYA 4GM4A 4N5DA 4NOMA 3RYFA 3WDSA 2FB9A 1KP2A 5M29A 4GOKA 2XPYA 2XQFA 2Z6VA 4D5GA 1KXJA 2Q2VA 5JCJD 2EZ9A 4FMDF 1OZFA 1UXOA 4DK5A 2WMOB 3IMEA 2FLWA 3N6XA 3U0VA 2BGJA 4P4SB 4K2HA 4RDIA 2XZTA 3FNBA 5KJFA 3K20A 2BELA 2P9KG 3CF6R 3E9MA 4O2BA 3CIAA 1T8WA 1BD3A 1OFIA 5FPYA 1VZ3A 3CV0A 1G0NA 3KO8A 3VMFA 2AEFA 3IBEA 1UK6A 1NSTA 4UAVA 1CP3A 5DKFA 3TYXA 4KREA 1Y8RB 1CUAA 3UWDA 4CUKA 1IN4A 1R8XA 2P9CA 2GMWA 2R96A 4F4HA 3LJNA 1VTKA 1PLJA 5D84A 3KEQA 4HOUA 2AC2A 1TADA 4DRXE 1BA3A 4B6QA 2PGXA 4ZZ3A 2GJ8A 5KOYA 1XV5A 2C5GA 2BDTA 2ICAA 3GAAA 3OY2A 4IGFA 4LNUA 4AXHA 2JGRA 4R1UA 3RSLA 5BXOA 1OFGA 3QSYA 3Q49B 1BE6A 1AKRA 1PBNA 4ITRC 4GA1A 4IDDA 3FCUB 5EXDA 2IE0A 4K86A 1BO6A 3DLAA 2HJWA 1A96A 4HFNA 4QLAA 1O6BA 4HRMB 2VHZA 1PWHA 3THXB 1C80A 2I4OA 3FB1A 1P62B 1U4OA 2GPWA 2IYFA 1WO8A 2QGZA 2QZZA 2R00C 3GJ3A 2BGNA 1CF2O 5KCMA 4BDTA 1UOQA 1N2IA 4YJ3F 4KRFA 1LD8A 5JHAA 2I66A 1UBJS 2OP1A 1T1GA 3SC2A 5SYNA 3FPAA 1P4SA 4XJTA 4AIRA 4NY1A 1DIGA 2HFJA 3C1UA 2BEKA 5A0TA 2WV7A 2GX6A 3FRJA 4EG8A 1LRLA 2QQFA 1N36B 5AVXA 1PK9A 3QITA 2OHVA 1NU8A 3AHIA 4KMOA 1N4DA 5B6IA 3SYLA 2E1RA 4PS7A 2DR0A 2Q5EA 3BCSA 2C7BA 2HREA 3AB3A 4IS2A 1JEQB 4LVNA 1H05A 5A3VA 2I8AA 1EK6A 1L0BA 3ANTA 3HGMA 3OOEA 4UM5A 3CMMA 3C8UA 4JASB 4XM0A 2WDZA 4IUDS 3WSTA 1YVPA 4FGLA 3KUDA 5K8TA 3E1KA 1KLXA 4BIIA 1FFAA 1JDBC 1G8FA 1RKBA 1U4SA 1MVLA 1NW9B 2HUPA 3K0AB 2WXNA 3AZOA 3OIYA 1ND6A 3ID6C 4HAIA 4YUZA 2DU8A 3PXGA 3L7OA 5BV1A 2PYDA 2F9LA 2YJ5A 3H87A 4QDTA 1BLXB 3BWXA 4D0RA 4XSVA 3G8YA 3LHKA 5H0IA 4I1PA 4BZQA 4KQIA 2ASVA 5KYWA 2NUPB 3LDGA 4RF4A 2BF4A 1N9GB 3W34A 2IC5A 3FYDA 3NNDA 2QN9A 4ZT3A 4C4TA 1Y6GA 1WG8A 2IIPA 2J9ZB 3AEUA 3SX4A 3QKIA 3U62A 2QI9F 5EIDA 2AFHB 2VHUA 1PF7E 1V41E 3MRVA 3L16A 3RUFA 2E4WA 3ZWDA 4V1CA 4ZT7A 4B6JA 3EMKA 1U6IA 1YQDA 5CEFA 2GDZA 3ILVA 2R7AA 1BDJA 1UKVY 2OV6A 5JRDS 4MR8B 5KTMA 4Y1EA 4G8DA 4O2BF 3N1UA 4RA6B 2X5GA 2QY6A 3GFPA 2WYUA 3JZIA 4B93B 2VYCA 3M82A 3RABA 1NQ5A 3CE9A 1KIAA 3SR3A 3DV9A 1U0LA 1JAYA 1YZYA 4JLSA 3UFBA 3T06B 3J80A 4EI9A 5JANA 3FOEC 4C4XA 2B78A 1O1RA 3TE7A 5IX8A 1JCRA 3K5HA 2FUG6 3ZZTA 2FSSA 4CHGA 2V98A 4LRZA 3IPYA 3GCZA 1Q95A 1SA4A 4GZ3A 3A27A 2BGWA 3H4IA 2ZRBA 4PYOA 2DEUA 5AKEA 3PEUA 4F5YA 1QRTA 1VLZA 4Z6KA 3N8DA 2CFOA 2QVZX 4EKEA 5JD4A 4FC7A 2SECE 1GTRA 1F8YA 1I3NA 3K5PA 4CL8A 3T9FA 3PE4A 2YZMA 5L95A 3UK7A 3DEJA 2UV8A 5TEVA 5JWOA 2KX7A 3PEYA 1AZLA 2GKGA 1X1SA 1ONNA 2E4AA 2ZYAA 3URKA 4DCUA 4PNHA 1E96B 3LY9A 2JJ1A 1TQDA 2I67A 4PSAA 2H63A 4UTNA 2PMFA 1XP8A 3BEDA 5AT1A 4EBAA 2W6MA 4LNUB 5H7PA 2W22A 5HF9A 2VH1A 3NONA 1VHWA 1OBCA 1W59A 2JEYA 4XYBA 3VPAA 3WJ1A 4G25A 5ENTD 1MAWA 3M4XA 5IVDA 4WUYA 1MO4A 3D9HA 4WTOA 4FEYA 4J16A 1QF9A 4QOJA 4KXKB 2BCJQ 3EVAA 3JYLA 3GVXA 4H3KB 3PUZA 3OQIB 5LA6B 4IDOA 3KDPA 3WGOA 3RVKA 1CR6A 3AL3A 3P9KA 3CPEA 2JIOA 3AUUA 3QOWA 4CKEB 2GAOA 5L40A 1S02A 2VI5A 4Y2GA 3D8BA 4JBHA 4TKMA 5E8JA 1NF3A 1U28C 4HGOA 1TMKA 1OC4A 3EBLA 3GFTA 4FXPA 4KVFA 4LHZA 4B82A 1UZAA 2VGYA 2Q8QA 1QANA 2WXMA 2YIMA 4N82A 1T6ZA 3V8RA 2H9IA 4NDNE 1MC1A 3VFDA 1L5JA 5IZCA 2HR2A 3CUKA 3P9SA 5AVSA 3QX9A 2JLVA 3RNOA 4BVHA 1KBOA 1IHXA 4XQEA 2O0KA 4B4UA 2GARA 1XQYA 1P4RA 2ZTUA 5C2YA 1HTWA 3HGQA 1OTHA 2GR9A 2BL4A 3KCQA 3UJDA 4A0HA 4PFKA 1OLSA 2ZSJA 3OCYA 5HIAA 4IXNA 1FU4A 3SAJA 1OXJA 4ZO6A 3L05A 2QL9A 3KR0A 3LYUA 3UH0A 4B3IA 2J07A 4DLRA 3KKEA 4WZBA 4MLPA 3ETHA 3I2JA 5A04A 5T8IA 3ND6A 3LO5A 2L6BA 1G291 4X91A 3DWIA 1D3AA 2HCRA 2QW0X 3D7SA 1J9EA 2Q1TA 2AF3C 4OHMA 5CDGA 5HS0A 2R6ZA 3KTAB 1PJLA 1RRGA 3OLZA 3PUIA 3Q40A 5M7EA 1BDBA 1BFKA 1X1TA 2Z95A 2BEUA 4GXQA 4FWTA 3KJIA 1MW8X 2WVAA 3W6UA 1SQMA 2L19A 1BD4A 3KHSA 1KRXA 4IJVA 2VLBA 3OPVA 3FLMA 4RZUA 1Z74A 5KWIA 5AKGA 4Z8YA 1E5XA 1JL3A 3LSTA 1GPWB 2Q6OA 4TXHA 4GX1A 5IXJA 1DVPA 2FO7A 2DRIA 1P61B 4DB4A 3RVOA 5E7MA 2J0UA 4JOQA 3TCXB 1ESMA 4HGZA 2ZTVA 3A31A 3SD7A 3U3ZA 3AHDA 1VB5A 3ASOE 1LZKA 2NZXA 1ZK2A 3B70A 3DOJA 3EDQA 3GUVA 4MMYB 4RY8A 1VMEA 5EE3A 3P27A 5FTMA 3SD5A 1EFCA 3QWWA 1D5WA 1HLFA 3KB6A 2OFFA 3W5UA 4EGJA 1XLVA 1TJ4A 4NCAA 2CE7A 3R4CA 1F0KA 3D6UA 4EJSC 1RYFA 1APBA 3PGXA 3SE7A 2ECQA 5L51A 1SVMA 3BIOA 3K30A 4AJKA 4RSYA 3PC2A 4RUKA 3DEZA 4P0PB 1DV1A 3TB6A 2BC9A 3E9EA 3PJFA 4TXJA 4DBZA 5FJYA 2AV6A 2WFMA 3MYRA 4QG7A 2GUWA 1DWUA 4HH1A 4Q7LA 5C2JB 1CZHA 2HMWA 5KJMA 5JS1A 4A8PA 2MWMA 3A6LA 3E2MA 4IAOA 4Q9NA 3BPSA 3Q3GE 1LK5A 4FLMA 4X3CA 3VKVA 4M46A 2FPOA 5AK0A 1QFXA 3QKWA 1ZBQA 1ZCFA 3LFUA 4GWGA 4XYEA 5EJ2A 3SX0A 4BV8A 4C6RA 4QM7A 2VCYA 1SQSA 1WVMA 3DULA 5LBTA 5JMTA 1H2UA 1K06A 4AMBA 3TAHA 3SQWA 2REQB 2B1RA 2ZAYA 4Q00A 4P82A 3V1KA 4E5SA 4BP1A 3R74A 3KT0A 3V8EA 3RWOA 3PCXA 2X0NA 1VLQA 4HH4A 1TA9A 3N74A 5EKXA 4ZC1A 4A5SA 3BE4A 5LA6A 4CDGA 4FFLA 1OHHA 4FI3F 1WA5A 3K0SA 3TF5A 3NBNB 4UBOA 1ZY2A 3DEOA 3ZIAA 3EGEA 1RC8A 1Y9JA 2X0IA 3PEFA 2V7UA 4I9HA 1P6UA 1O6FA 4H7JA 4QT0A 4DKXA 2F3SA 3P9PA 3BD6A 3U3RA 1R37A 3AL2A 1A8HA 5BSVA 5J2TA 4ZJUA 3GGPA 3OZIA 5JRJA 1KFKB 4F6RA 2X7HA 3E9CA 2R7KA 2ET6A 4H3HB 2Z2YA 2OO3A 4RTMA 4KDEA 4AMVA 5I5GA 4RVUA 4QKQA 2FEMA 2VP9A 3H99A 1U8AA 1X3SA 3ESYA 3IB3A 4F2GA 2BKKB 4BTBA 4OAVB 2O9JA 2I29A 3HNOA 4QFDA 4TXPA 1LPMA 2AR9A 5F52A 4G81A 3M3DA 3RJ5A 2MTBA 4LNGA 2NUBA 1GYQA 4RS4A 5IAJA 3G7NA 3WWEA 4U7DA 1A4UA 1HKHA 2NQTA 4N0EA 1LS1A 3VPHA 3OIGA 1E2IA 3UB2A 3GDOA 1TIKA 3ONLA 3R9WA 2D0OB 3O4RA 4UVIA 2O59A 2AXVA 4RK6A 4KSCA 2XT6A 1QTRA 4V39A 1E5LA 3Q78A 5TXGA 1AU9A 1GVNB 4NYJQ 5DM2A 3Q75A 2ZAMA 4R2LA 1W85A 4KWIA 1M73E 3EU9A 2H54A 2V8BA 1SUPA 2B4KA 5BVHB 1PL0A 4KVAA 4RACA 1E9AA 1FFGA 1Y1SA 1XA0A 2AXQA 4NZYA 4P0QB 1VCMA 2I7XA 1G1MA 1TTTA 5TNXA 4QDOA 3DKRA 1VP3A 4I55F 2A5YB 3C3WA 5HOEA 3IOCA 4GSYA 3DR3A 5LMCA 1NQUA 3AIMA 1NWHA 1R9MA 4AJLA 4EJSA 4KRYA 3UCEA 4NMWA 2H6GA 2GVZC 1JPJA 3OG9A 3MF4A 5ITVA 2GCNA 2PWBA 2PLRA 2ZIGA 1Z45A 3VDRA 2C31A 1AKQA 4QOGA 2OLEA 2QD4A 3UOAB 1GA6A 3OWXA 4C06A 1WHTB 3DPDA 3H5OA 4R8VA 4I4TB 1CKEA 1L5GB 5B64A 3ZHEB 4LJ4A 5LYJB 3U6BA 3VJMA 3AUFA 3QVJA 4U07A 3HMQA 1KE1A 4JOSA 3TLJA 4M1OA 2QG9A 4FQ8A 1N32B 7MHTA 3X2SA 3OPNA 3KEAA 1TK2A 4OA8A 4MYTA 4QULA 1K6XA 1L7DA 5F5XA 3NAWA 4UNQA 4IQFA 4C78A 1UCFA 4YS6A 2GF2A 5EIWA 1G20E 3SZOA 2XI4A 4Z0TA 4OFWA 5NLLA 3ZXUB 1VCNA 1VSVA 4MKTA 6NULA 1KK0A 3FIUA 1SU8A 1Z6AA 4HB2A 4MH0R 4P58A 3WIEA 1EDZA 3GRPA 5ANRA 4I5IA 3L8FA 3TRFA 3LW7A 4TKVA 2FSUA 2XUFA 3AWIA 2YQZA 1P19A 2LNIA 3GMTA 1JLHA 4ERNA 1SW6A 1E7UA 3IR7A 4N5MA 2XCTB 2C7QA 2VAPA 3N75A 4IILA 4L72A 2PK3A 3IFSA 1IHGA 2I2FA 2QNRA 3SHQA 1XD9A 1ODSA 4K05A 3CCBA 2JEOA 3GGGA 3DMGA 3LOQA 4HWKA 1R3DA 1PGJA 2ID4A 4C7JA 2P68A 4F5ZA 3PLNA 3R3XA 4X66B 3CKLA 4ZOQI 1US8B 2GUGA 1LBHA 1SCUA 1Z7YA 1MNAA 1J0XO 3H2ZA 3ESQA 3IKLA 1YRWA 3SZLA 5B1EA 1QU2A 1KO4A 2A5DA 3GXOA 1GPH1 4LNBA 4AZ0A 4EYQA 3GLHB 3TVYA 2BT4A 4HWRA 1GEGA 4JXTA 5KREA 1FC0A 1VJRA 3K9NA 5IUJC 1U7DA 3C4QA 1CJTC 1REQA 1NJ1A 5DM1A 1YA8A 4LC1A 5FOVA 2QL7A 2O1SA 3CX6A 4UMFA 3TW8A 3ZGQA 2O8FA 2QNBA 2VPXA 5B1IA 4Z4HA 3DWGA 1BU8A 1MB9A 1NW8A 4GDMA 1KSHA 3ZWCA 5ADWA 5J3JA 2RGXA 1W5TA 4DLOA 1RHQA 3C5VA 2DY0A 4FVTA 4GP7A 4HH3C 1WTCA 4N49A 3CLRC 3MINB 4Y6CA 1ACLA 2IEZA 3LX4A 1FT1A 1NF8A 1ZD8A 2CJWA 2V6FA 5FQOA 4GI7A 3R0XA 4IVPA 3ZHUA 5JNWA 3IKVA 4Q3DA 3Q1LA 5FI3A 4BVFA 4UUQA 1Q7EA 2DERA 4IF6A 3UAZA 1ISFA 3SBTB 2XQ0A 1GADO 1RHKA 3HPRA 4J2OA 2RAFA 3EIUA 5FWDA 3RSHA 4CFZA 9GPBA 1P1RA 5CRUA 4UDOA 3EQ6A 4BC0A 1KAMA 3A3PA 2R6CA 4H0CA 3DZFA 1JR2A 4QAJA 3AXSA 5CMYA 3CE6A 1DIBA 4FZ3A 5EQDA 1GQYA 5FA8A 2HNBA 3GCGA 3QARA 1EDBA 2XCUA 1NZNA 3B3AA 3CPJB 3ZWQA 4D26A 4QYTA 4RPIA 2E4XA 4LUCA 4RQIA 1LWNA 3A1EA 1U2RA 4KUGA 5KO2A 5BW8A 4MWTA 3TR5A 3U9SA 4ZI2A 2WIAA 5CLHA 2BFFB 1OBOA 4FKBA 1G6KA 1J1UA 1T6BY 2VYVD 4Q96A 1FQWA 1PAQA 1SZCA 1TA4A 3K1TA 5CJ2A 2QJTA 4G8CA 2VPWA 3L82A 3ELDA 4WQMA 3AFNA 2HWKA 5BO5A 1ZKMA 4C4PA 5T3RA 1PY1A 1XN4A 4CMCA 4PEVA 3ELBA 4NDAA 1NVVR 3TN7A 1T5HX 3SGHA 1ZK3A 1T0JB 3CLTD 3NANA 1QG2A 4BTAA 1T9ZA 4MHSA 5F3RA 1MUUA 3SYTA 4CZ2D 5ICGA 1DCEA 2DFLA 4NKRA 5IDYA 3OEHA 1GU0A 3C97A 1CC1S 4WVLA 4FC6A 4H15A 1BRMA 1XD2A 2DBQA 2P77A 3ZCUA 4HVBA 3VU9B 3PTZA 1P0QA 3P2KA 3SP1A 2YMLA 4MWSA 2EQXA 4EELA 2OO5A 3W5SA 1V6SA 3T3IA 5IK2A 1ZOSA 3C3PA 4XVUA 3LS8A 4P33A 5C8ZA 3ETGA 1YDFA 1MJFA 4JXKA 2IH4A 4IH9A 2WG0A 5FLYA 4IIJA 4N65A 1BN7A 1E1MA 4RQUA 3STTA 4M21A 5TB5A 1QMPA 2IDMA 4CTJA 4N76A 4BKUA 4QDJA 3CVUA 4RLQA 2ORED 4DG5A 3QIVA 1Y3AA 2RDMA 4YIHA 1LX7A 3ASUA 2FAXA 3EPPA 4L2LA 4AY6A 1XZAA 3CLUD 3PWTA 3HFSA 1ZQ1A 3I9V1 4O33A 4BJHB 3TUJC 4PRKA 3UEOA 3FUCA 3OUTA 1XN1A 1H66A 1EHIA 5HQJA 5C53B 3H1BA 4LZPA 5TGZA 2ZUBA 1E8YA 3GW4A 2ZIVB 4HAYA 4O2AB 1HGXA 4NCIA 2AW3A 4DF3A 2Q0XA 2LW7A 4MV6A 2JLUA 2A58A 1EE9A 3SF8B 2W6JA 4MCJA 4I1OB 4PRZA 3TJRA 3FTFA 1WZCA 1GRCA 3TWUA 4L08A 5KTNA 1DRJA 1ZGBA 3LGAA 3FUNA 1EWTA 3ZXIA 4L5YA 5EJIA 4ZYLA 5GP1A 2C59A 4YRAA 1AO3A 2ZIRA 1ITZA 2OILA 3DFFA 4JGGA 1DG3A 4JL8A 5EIBD 4ER7A 2V4ZA 4WFJA 3MINA 2ZSAA 1Y9AA 2PTHA 2VLIA 3K9HA 1FIUA 3JWPA 4OQNA 2MYNA 1UC9A 1WP4A 1FNSA 2WAYA 1RWWA 2B5OA 4E5DA 3NVAA 4C7OA 2WNHA 3K9QO 1E7WA 3V8MA 5FUXA 1E6CA 3OFNA 5FOTA 2OE2A 3G7SA 3JXIA 3ITWA 1FPMA 2PS9A 3JQ8A 3KWJA 4ARZB 3KB2A 3GAZA 3Q9NA 1WTAA 4ALIA 3RSEG 3HVEB 3JWGA 4O2RA 1QVAA 3M8KA 1J8QA 2XMSA 5CNMA 4I8DA 4AN0A 3WG7E 1ZUWA 2H2IA 4JL0A 1B8NA 1JKIA 2QP4A 2VAWA 2H4ZA 4GZMA 2WUWE 4LX0A 5FPPA 5BRJA 3AW9A 2NVWA 1TQ2A 1CX9B 2O6LA 4F1WA 3ICEA 5CCDA 2VH5R 1PNTA 2GN9A 1GL9B 3AEKB 2R7MA 3H1AA 2PD6A 4HVAA 4OKIA 5F7OA 1K0FA 1M10A 1WZUA 5EUBA 1PX2A 4OU5A 5IF3A 1ISRA 2VT6A 3WWZA 1MA3A 1RHJA 1M1NA 1EK0A 3DKIA 2VTVA 4UNIA 3ZQUA 3HYTA 1Y9DA 2E87A 3LY8A 1TEZA 1J7KA 2I4NA 4IS3A 4L2IA 3AYXB 4F4JA 4ILHB 2VF4X 5EIHA 3QBDA 2CLHB 1RR6A 3P2EA 1MXHA 3CW8X 4L4UA 4YREA 1MG5A 3RIMA 2W42A 3G1UA 4K9MA 2A9RA 3OX4A 1YAJA 1L9KA 4FYXA 5JUWA 4DTCA 3TL6A 3TGPA 3ANXA 2IF4A 4CU2A 3DL4A 2CVZA 3AU9A 4AWAA 2CFCA 2QAGA 4OGKA 1IQ0A 2B7LA 2I6UA 2CKDA 2Q0SA 1XL0A 4L1KA 2JG3A 5K01A 5K6RA 1P44A 3W0LB 5T7BA 1BGWA 1JIUA 2W2KA 1EQ2A 3TG4A 4PM4A 3BWYA 3K0BA 1NR7A 3QNUA 3W8DA 2X8JA 3F4LA 3FGNA 4U7EB 4FCVA 5BYKA 5K8IA 1HM5A 4PFJA 4BNIA 3HHEA 4EYOA 3D0OA 2B8NA 3TZBA 1YSCA 2NX2A 1YA0A 1X1CA 5LC1A 3URZA 3EZNA 1PJ8A 4LRYA 3IUBA 3L5OA 3KU4A 3NPMA 4HDSA 3G2VA 3GUUA 1R4MB 4KN8A 5E2AA 3UHPA 3E5MA 2OORC 1ZGZA 3AF6A 1ZVQA 1N2GA 1SB8A 3ELYA 2R02A 3KXKA 5HUQA 4R7LA 1W5BA 3ZDDA 4XGNA 3M6WA 4DNFA 3LUDA 5K03A 2Y76A 3CISA 1WMEA 3SSOA 3S2FA 1KIMA 3CPSA 3F67A 4EAQA 1X14A 1M2OB 3OZRA 4PTZA 1VECA 5CM2Z 3ROTA 2C00A 4D1YA 3C8DA 3O6VA 3MKRA 3N0TA 3TW4A 3FIJA 1KC1A 2RB4A 4DI3A 3L8DA 4RM3A 5I5EA 2YN0A 3Q7AA 3CFYA 3FX2A 5DBGA 1EZZA 3I0ZA 3LQFA 3R0VA 3ELUA 3R20A 2BCGY 5BWNA 3VSEA 2JFGA 4U2CA 1L3BA 1SCDA 3K2BA 5FPSA 2WK1A 2E1PA 4OAUC 2WM8A 4UCQA 1BCSA 3PVSA 4KLRA 1Q6YA 2J3LA 4FFBA 2GH1A 2HK6A 2C4MA 3OTGA 4HNAA 4TTQA 1C1XA 2OHJA 3E58A 4ILEA 4R2MA 5UKDA 1P6XA 4B3MB 1P4AA 1ESNA 5HK9A 3R9MA 2YJ4A 3DAPA 1OV4A 1X7XA 1J1ZA 3EUVA 2F7SA 2P1ZA 3MJCA 2GNOA 4A03A 2NQ2C 4R8KA 3CR3C 4QLOA 5BNFA 5CDUA 3DLBA 3B7BA 1NNLA 4DLPA 3Q5GA 1ZRSA 2IODA 4WOPA 2C9OA 2BGGA 5AOXB 1ECCA 1IB0A 1X8XA 5HE9A 1XZ8A 2KYRA 5KJKA 3Q9LA 4URYR 1X1BA 2B8TA 5ALYA 4EW2A 3KL2A 2YWGA 3PC4A 1HE3A 1NPTO 3QP9A 2YOGA 3LWBA 3NWBA 1K8ZB 1FLVA 1OBVA 4MIEA 1RM3A 1VJ5A 3D2BA 3WHPA 4GL2A 4IULA 2CNBA 1FF9A 3UCXA 4AJ2A 3KSZO 1R4NA 1MJGA 2GWRA 2OV1A 3Q9UC 1O5OA 2VJPA 4R05A 2MSCB 4YMVA 1TFUA 2HQSA 2IOFK 4A6PA 4ENSA 3MGBA 5JAOA 4UZEA 3PEWA 2IYEA 1MRZA 5JZ9A 1FYFA 3UX4A 1TUEA 2Y1GA 1DAEA 2WJ6A 3FU3A 3HKEA 3KZNA 2JBHA 5SZHB 4XGIA 1DSSG 4HVTA 1DUSA 3ZKJA 1XT6A 5LQMA 3FHLA 4RVFA 4XQ0A 3GO4A 1JTFA 1F8UA 3QVKA 3MERA 1MYOA 4B84A 2HQOA 1LBQA 3ON5A 3E9DA 1OU0A 2Y1FA 3L8HA 1NJ8A 1Y8RA 1YK1A 4FNGA 5AJZA 4WESA 1IY0A 3EDTB 3S7ZA 2X19A 3HY3A 4YR9A 4I55B 1K9SA 2RK4A 5J59A 2WIDA 4KZCA 2GBFA 1CHNA 2PBFA 4G41A 4NCNA 4TWIA 3ZZUA 1RJGA 2H4WA 4A9AA 3DT6A 4I9GA 1R10A 1Z73A 4WLOA 3V2HA 3QKSA 3U3JA 4MVJE 3HB0A 3BGDA 1A95A 4EG7A 3RANA 3DVAA 5AVQA 5K20A 1QHXA 2HXYA 3FGPA 4YR7A 1Q0ZA 3O75A 1GITA 2P2NA 1PW7A 5FL7A 5J23A 1Y6IA 3K6SA 1U6KA 2IU6A 3FWKA 5JAPA 4H7KA 4AD8A 1D7OA 3QF7A 4DG8A 4LEUA 3BT3A 4JGIA 1UBSB 1ZMTA 1OKKD 2KXPC 1DRWA 1WCIA 3O3NB 2COUA 4IUBS 4GS5A 1M83A 1SUWA 1QRAA 3GA7A 2XKAA 3HA3A 3LUKA 4UDNA 1QTNA 4X1OA 3RC9A 4CV1A 1JWGA 2JFUA 1AJEA 1Y3FE 4DSZA 5LMUB 3S7JA 4DMLA 2DH6A 3ENNA 4RANA 1WQ3A 4L8VA 3TLXA 1C50A 2B0JA 4ZFHA 5HKOA 3EUAA 3CLRD 4LRXA 3B1YA 1GGJA 4CTOA 5JAMA 3Q79A 4CEJA 1OAOC 1SVNA 3GLQA 2O1WA 4OMUA 4DAEA 2ILRA 1GVHA 5AJVB 5BPHA 5EERA 1SWVA 1OFUX 1OXMA 2BMAA 3DS8A 1OXUA 4QYSA 4Y2QA 2O2EA 2OQRA 4N5QA 4KTVE 1AD2A 1QHEA 4UUNA 4ENRA 1AV6A 1LB1B 3I12A 2L2QA 4N18A 1U2PA 2X2PA 3CMCO 3SFXA 3FHEA 4HLLA 2QRHA 1YVUA 3I64A 4WKBA 3WLJA 4ZJZA 5DW0A 2CLEB 2P9ZA 3TZLA 3GG9A 1XDSA 1ZYUA 1SZPA 2FEAA 3GUCA 3DSVA 3ABQB 4JAVC 2G04A 2UAGA 2E55A 1TF2A 2W83A 5I7RA 2JLBA 1KKUA 3EQ2A 3MRXA 2AN3A 3OMXA 2O8EB 4K0KB 2BGLA 1UANA 2GTIA 4MUIA 4PFSA 5CFOA 2IPAB 2OCKA 1PJ3A 1SQ6A 1TTPB 1WPGA 3OE7D 5G4LA 1N7HA 4V1CB 4Q4JB 2ZSBA 3SY2A 3E03A 4MPRA 5KVSA 2XMDA 2XWJI 4ECEA 3FFBA 2QG4A 4DARA 1GDTA 3N07A 2R0QC 5TVGA 3EPRA 1JT2A 1KDZA 5CW2A 4M8LA 1FDVA 1ZC3A 3BUSA 2FPGB 2IY7A 5IWCA 3UMMA 3AEYA 2XBMA 1GPNA 3CUWA 5KHAA 5CFMA 3RQIA 4DG9A 5CPFA 4GI5A 1H22A 1QZZA 2H2FA 3ZI7A 3ZJVA 3V2GA 2CLCX 2IOYA 2YV3A 3HXBA 1EP9A 2B8EA 1IZ9A 2G9VA 1T6YA 4QBIA 3V1MA 3FR7A 2AJAA 3H5AA 2OP0A 5IZCC 4HAVA 3V4ZA 5AWFC 3VR2A 4QVIA 2Y0BA 2FG7C 4JK3A 4CIAA 4R01A 4B3XA 2R8OA 5KNDH 5B1YA 3WGIA 3CHOA 3SR0A 1MAHA 3K6KA 4EF5A 4HZIA 2YL2A 2ZQYA 2QVGA 4EUSA 4DRYA 2A90A 4UOZA 2ZQ5A 4UWLA 3OOHA 1B1CA 1LPSA 3UOWA 3AKZA 2VNIA 1PJ4A 2MJLA 2OAEA 1V55E 1HEYA 1Y7HA 1ATZA 1I7LA 3OFKA 3BMQB 1LFDB 3R41A 3RVSA 4ZMRA 1GV1A 4YYEA 3RG8A 4L5AA 1EEXB 3IHWA 3HBLA 5K3FB 1E8DA 3SIRA 4D8WA 3A4IA 1XRRA 2DPGA 5BW5A 4KBFA 2QMYA 4LG6A 1O95A 4ILKA 1YJ8A 2JC3A 3RS8A 2EQBA 2DTDA 2RAVA 2NUAA 1XFDA 2LXLA 3CH6A 3TKAA 1Q0TA 1HQKA 4OL9A 4DJ5X 2O52A 5JWRA 1ABFA 1YKFA 2QGFA 4GSKA 4OHBA 3CG0A 2B61A 5E38A 1KU6A 4BJ5A 3AVTA 4ITUA 4LQLA 3ZE6A 5HQ3A 3RO2A 4IDAA 2AZXA 3W04A 1BJKA 2DP4E 3KRTA 2XNDA 3AB7A 2PGOA 2G08A 2MSEB 1Q84A 2YVUA 3B51X 3CC8A 2NAPA 3EUEA 3DSXA 4NOJA 3SS9X 3FWPA 4AJEA 3BXEA 3I53A 1M1XB 2XS1A 1MF7A 1V43A 1QIDA 4M0KA 4WEQA 1OX4A 5DGIA 5P8WA 4N41A 4JNCA 2LP4Y 4ZRNA 4KT6B 3NAZA 4YJFB 3OZ7A 4I50A 1XE3A 3WGNA 2PZFA 1D8EA 3OE1A 4UM8B 3NHUA 4JLUA 2RFLA 4CDMA 1KFEB 5CIQA 3A11A 1EF1C 2CCGA 5IXYA 5DX8A 1KYYA 1VJGA 2X6KA 2K7ZA 1RXVA 4Q1FA 3ZY6A 2P2LA 2B4QA 2WP8J 4FC8A 1DJOA 1M8FA 2Q7XA 3KOXA 4Z86A 4F9EA 5J4HA 5B7QA 3SMQA 3TSCA 3BRWD 3IEUA 1ZJJA 3A6KA 3LF1A 5EIOA 3RK0A 4MDFA 2A5JA 3WAGA 1U3VA 5LP1A 3GRKA 4LOJA 2COEA 4LHEA 3GVPA 1SOAA 2D5AA 4HQKA 2GGFA 1I6WA 1T91A 4X63A 4RMHA 3QXCA 4F4CA 2IFUA 3N5KA 2AK3A 3L8EA 1JE0A 3PFIA 5B1SA 1Z4NA 3FOCA 4JR1A 4DGSA 1N5LA 2ZWPA 2CK3A 1C8VB 2YYZA 3EFEA 2I6HA 1Z36A 3NTQA 1Q15A 5D5PA 1JDPA 3ANLA 3GJYA 3LVFO 3USES 5B58C 1P0PA 3B38A 4PLPA 5DK4A 3B1VA 1A98A 3HCBA 3GH1A 1ZJ5A 4WNFA 1Q0PA 1O57A 1TTHA 2P3OA 3HKDB 2Z1MA 5ADVA 5BSUA 3EGDB 3HDJA 4BTEA 2PT9A 4HOQA 5CYOA 3V7YA 5A02A 3GJ7A 3E5NA 2DHCA 4KI0A 1XSEA 3H2GA 3STUA 4HAZA 3Q7IA 4CI9A 1DGQA 2TMYA 2Y93A 2NYJA 1XZPA 1SIBE 1Y1TA 3HN7A 4J0QA 5TT1A 3UMSA 1P1BA 3ZBUA 3PU6A 4YJDA 1F51E 1FFXA 3NBZC 4LGMA 5HMLA 4LY6A 2YC4C 4PZPA 3HJRA 2WFLA 4KYVA 1RZVA 1QOZA 1Q1BA 2V7QD 4K87A 4RNDB 1ZJ4A 3LUGA 1P7ZA 2IYLD 4PS1A 5IU6A 1DX9A 1VYVA 3SC3A 3LTEA 4AP5A 3NKVA 1C9EA 3GIDA 5LP6A 2HHCA 3ZK8A 1DKUA 4UYJB 4KQJA 2JI9A 3G2KA 4N3NA 3VLDA 4N40A 2HH9A 4XIFA 1IK6A 1F0YA 3OETA 5A0VA 3HSKA 5HZGA 3PPXA 1M72A 1PUJA 3CF0A 4B0OA 4BUCA 3F5QA 1EZ1A 2BP7A 4MKIA 4L15A 3L9WA 1U7XA 3MJVA 4Z0NA 3BD9A 4G56A 1A9ZA 1QHHB 4P98A 2WA1A 4FSXA 4JJ6A 2H6FA 5KNBH 3EAGA 2I3DA 4KAFA 3K0HA 4HNAD 2B4YA 1KL7A 4RJLA 5CM8B 5EVJA 2HJRA 2X2FA 3CX8A 5EIXA 1S01A 1N7IA 1L6IA 1SQ5A 2GF9A 4ZKEA 1TKAA 3CEPB 4N47A 4PLTA 3SX2A 3ISVA 6GPBA 4GZ5A 4E5YA 2BMFA 2P0EA 4K5BA 4WN9B 1M1YA 1L2TA 4GBED 2AFIB 5AJLA 4TRNA 4Y8VA 4BJ3A 3A14A 1P60A 3RRUA 3AJAA 4D2IA 2O8VA 3A1TA 3P71T 4U2BA 2XY4A 2HSZA 1XTKA 2J3JA 3JYHA 3PYLA 2O7QA 1TOAA 1U5BB 2YV1A 4G0NA 4RS3A 3C3KA 2JI8A 1MAUA 4CKWB 3SOZA 5TF4A 2ZIUB 4L9AA 1XKXA 2PVPA 2YNQA 5BSFA 2G1KA 4C87A 1GYPA 2EJCA 3DYBA 1KJWA 1G2OA 3HV2A 4RADA 1HE8A 3GGCA 2ZJFA 1LFAA 5JIBA 4EKDA 3M1YA 1RQRA 4B4DA 2G77B 3NOCD 4CI0B 1Z83A 4KXXA 1E7QA 3CGWA 4J2TA 2GPSA 3IV6A 3ITDA 3WKEA 2Q9BA 3L0IB 3ZCPA 2MT9A 1GNSA 2BFDB 1IY9A 1JNXX 1J49A 2SHKA 2XIQA 3APFA 1XRNA 4KO8A 1K7EB 4BP9A 3DEKA 4YJGA 2O0LA 1MB3A 5AVZA 5BQXA 1QQAA 1ZX1A 2GZMA 4F12A 1LPNA 3G0HA 4MQLA 4PE5B 1M5RA 1J90A 4EEKA 1U1DA 1ULAA 2ZB8A 3JYQA 4KGXA 4LKRA 3IH5A 4PZDA 3ZDAA 1I2DA 3WDMA 1KPGA 5D3QA 4MBGA 5TQ2B 4DLWA 3UT0A 3Q8KA 2I1KA 1RAGA 2W9JA 5LUAA 2JAWA 3NGLA 5EHNA 1G21B 1J2RA 2Z43A 1TM7E 4HB4A 1DFHA 4DCNA 4GW3A 2Y77A 3S55A 2UUAB 1T1JA 2B98A 3V7FA 5K0SA 2TECE 4Q05A 4YC7A 3RAEC 5DT9A 5AK3A 3RWMB 1VDYA 2RSLA 4ZODA 3ESXA 4MV7A 3V5NA 4CM7A 2IOFA 1YKGA 4JSYA 3REOA 3RSGA 2LVBA 4P53A 4RHYA 4L7TA 3ITNA 5CVJA 3TKYA 1U7TA 1G9TA 2B36A 1SBTA 4HUQB 4M8IA 3FEYA 2DE0X 3MC1A 3N2NA 1ZR2A 3HBJA 4BPBA 3E7PA 1BMDA 1JDUA 4MPPA 4JEUA 4YJKA 4YO8A 1UK7A 1ZL0A 4ND8B 3VC7A 3WXBA 4DSUA 4HPXB 4F71A 1XNRB 5CEJA 4RELA 3E27A 1ZONA 3FPEA 5CX1A 4YGXB 2JI7A 5HBGA 4JVSA 1PTJA 4B8WA 5CFLA 3F3MA 1XVUA 1TD9A 2Q0QA 3HKCB 2C58A 3OESA 1HOTA 2RHWA 2R59A 2NYAA 4OK6A 2WWRA 2YZGA 4LE1A 4UXIA 1AG9A 2YZNA 3TEFA 1CZNA 3C2QA 4FCTA 1HG1A 2R4UA 3NHJA 1Q1NA 2QZJA 1JTVA 1SOWA 1GT91 1NFIE 1ESEA 2GK4A 3A26A 3CLSC 4NACA 4X3OA 4YMSA 5FX2A 3OXLA 1FK8A 3WJ7A 1RP1A 4CNBA 1D2GA 2HEIA 4DLTA 1QLJA 2ZITA 3GJZA 2VP3A 2D62A 2FU5C 5ITZF 1PD1A 1QKKA 2PXAA 1K08A 2PLWA 2NT3A 2XECA 3E35A 3IXMA 3VOSA 3V6LA 4F3YA 5CDFA 5L4LA 5DLDA 1DAFA 5FORA 1ZHFA 3DBSA 3G2JA 2G4VA 4XIYA 1ZCZA 1O94D 4US1R 1HG0A 3TWQA 1XL1A 3C3OA 3ONEA 2XOEA 2X14A 2QXUA 4I14A 1KTVA 5REQB 1J24A 3SC4A 5ED4A 5JCOC 1DOAA 5CR9A 1PX0A 4EI8A 1L7RA 3U44A 1H2EA 4OATA 1JQEA 3FTEA 1VE5A 2R6GA 2VK8A 5DNVA 4KPYA 1U2SA 3D1JA 2DUNA 4CQLB 2XT9A 3PZBA 3FLEA 4O4IF 6AT1A 2XUIA 5BQPA 3RV4A 1NVTA 1XDBA 2X4DA 5G0SA 2P2SA 2H17A 1T2CA 1Y3CE 3PNQA 1HE2A 1ONSA 5FL3A 3ROZA 3E37A 1CDOA 4BLVA 3ZKWA 5FP0A 1FJGB 1Z2CA 2X4LA 4Q7MB 5IKPA 4JUBA 3MZLB 3W9BA 2OSVA 3UV3A 3RHFA 3GPLA 4BZPA 2RKKA 1TGYA 2CLFB 3TOCA 2R1TB 4WNCA 2V5VA 1JA0A 3LKZA 1NBAA 2DG2A 3MFYA 3OA0A 3W8EA 1G3UA 3HA7A 2CFTA 2D8AA 2EHJA 2GEFA 3FCOA 1QP0A 1AQYA 2ZPTX 3ZS9A 2QWXA 2Y1LE 3ICPA 9LDTA 1KYVA 3RYHB 4OY3A 2Y3IA 3DZDA 3KDSE 4DHEA 1VL6A 1UXHA 5F12A 1JLKA 2Z6QA 5A62A 1K4MA 4EWLA 4DX6D 1Q6ZA 1X7YA 2I2DA 2CXXA 1RFGE 1RPAA 3OUUA 4IIUA 4Q4DA 1L4BA 5C3UA 2ETCA 1Y7LA 1G5QA 4TV9A 3E32A 4ACLA 3IO5A 1UEXC 1CUCA 1T15A 1XX6A 3A6GA 4UATA 1GUBA 2EFYA 4AJPA 2D7DA 2PR2A 2X0JA 3HHMA 1NZDA 2I3BA 2P6UA 4RX1A 3NBYC 4A6DA 5A5FA 4JJGA 4HR7A 5CLQA 3S8YA 4OBWA 1QP8A 3KQPA 2JBAA 4K9DA 3SQLA 4ZCIA 3JW8A 5AR1A 4MV4A 4L6CA 4HP8A 4DHWA 3E2PA 1TA0A 4EGSA 1CD5A 4JKIA 3EH1A 4LOKA 2PJZA 1WHSB 3QI7A 4FHCA 1V4BA 3H19A 3D1LA 1AQ6A 1TAGA 1V6CA 5K3AA 7ADHA 2QENA 3KPWA 4DIMA 3ZHTA 2AOTA 1OPRA 2ZK7A 3S5UA 1H6BA 1N0RA 3ABME 2WF8A 4PC7A 5ITZA 3F7MA 1A2QA 5AUQA 1I7DA 4ZC8A 5TMPA 1DFIA 3C5WP 4KN6A 4WK6A 5J08A 2GBLC 1T2DA 4PS8A 1JKJA 3PQDA 2VDKB 3NATA 4HGYA 1J23A 2A92A 3AUSA 3R3WA 2CFIA 4JENA 5HF5A 5ETJA 1TYQG 1D2EA 1SKAA 2Q2WA 2VSFA 2IJGX 3FCYA 1X7HA 1M7GA 3HE3A 3VU9A 4BQPA 2AEJA 2YIVX 1R2QA 3N53A 1C2TA 5IS2A 3JAKB 5EIEA 4S1PA 1KI7A 2IUFA 1WEKA 3G82C 4UFOA 1L5KA 1LDMA 1RC1A 5EVCA 4D4JA 5DNUA 3IJEB 4KIWA 3FNQA 5CCBA 3Q85A 5KYXB 2WXRA 3KSMA 3KJHA 3DEYX 1R00A 1DWPA 2FJ0A 2WE8A 3OY7A 3PEEA 3HC7A 2NPFA 3VU0A 1PR3A 3A2KA 4AVXA 4L50A 2QM8A 4GEGA 2C7GA 1XZHA 4P4UA 5IDQA 1L5SA 2ZUDA 4BFYA 5DBIA 4TT3A 3U49A 1HDYA 2NU8A 1RHRA 3ZGXA 2NXEA 2WSBA 4OQQA 3FN4A 2Y4UA 4W5JA 5L7TA 1JHOA 1Z37A 4WJZA 1JLMA 3C6QA 3G2UA 3QG1A 4NDZA 1Z5OA 1S9DA 3EWNA 4DMMA 2I55A 1E90A 3WNBA 4AP6A 4ZN6A 3WHKA 4ARAA 3RVRA 3I6YA 4M1MA 3TI9A 1SQGA 4ARVA 5T6MA 1CY6A 4D3DA 2XUAA 1KSFX 3QEBZ 3OFSA 2J5KA 3BHMA 4EFLA 4EJ0A 3UT5A 4EYGA 4F1JA 4LNHA 1U8FO 1HT1E 1PJRA 3MOGA 1T4BA 5FQNA 3BB1A 3KQQA 3GOHA 4AJIA 4AMUA 3O1JC 4FWIB 2JAPA 3O8BA 4YQFA 2FVYA 1YL6A 3RK4A 4QSMA 1XMXA 5A1JA 2QN6A 4PWYA 3O31A 3AKEA 4BT9A 2D54A 3GNSA 4WA7A 2I7TA 4EKYA 3IT0A 1EM6A 2VWPA 3EXFA 4A8JB 3KNZA 1OH6A 1R4MA 4MPDA 4R41A 3V55A 4F6LA 1NW6A 2PMCA 4JOBA 2ZUWA 2P2YA 2G9RA 3DXFA 3DLIA 3GZ4A 5I3ZA 3WK9A 4HQDA 3LYAA 1Y1LA 1L8XA 1B93A 1TNOA 2IYRA 4GGPA 4FYVA 2VJQA 4TV9B 3ZJ5A 3DMTC 4G4IA 4C6TB 5KTSA 4LFCB 3HVEA 1IDOA 1CS0A 5DPMA 4GDFA 3UGTA 4Q69A 3SJ7A 4LHXA 1CLUA 1SUSA 2B1GA 4PYIA 3V1UA 1BJRE 2HMVA 2P5SA 1QC5A 4YNBA 4CM1A 5A5EA