4N3GA

Crystal structure of eukaryotic translation initiation factor eif5b (870-1116) from chaetomium thermophilum, domains iii and iv
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GKGVSVQASTLGSLEALLDFLKDCKIPVANVGIGPVYKRDVMQCGIMLEKAPDYAVMLCFDVKVDKEAQQYADENGIKIFTADIIYHLFDQFTKHMQEQLEKKKEESKMLAVFPCVLNPVAVFNKTNPIVVGVDVVDGQLKLNTPIAAVKMNPTTGQKEIISLGRVTGIERDHKPLQVCKKGQPAVAIKIEMGGHQPAYGRHLDEKDVLYSHISRASIDVLKQFYRDVVTTDEWQLIIKLKSVFDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title eIF5B employs a novel domain release mechanism to catalyze ribosomal subunit joining.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5B-like protein, eI
total genus 68
structure length 247
sequence length 247
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4n3gA02
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 4n3gA01
1Q86D 2YWFA 3QFRA 4PGOA 3W5UA 1VQKB 1TUIA 1VQ9B 1IJEA 1VQ6B 1JB9A 1DDIA 1CNFA 2EIXA 2DY1A 2BGJA 1YJNB 1WDTA 4ZGNB 1GJRA 2PIAA 2BGIA 1G7CA 2D74A 4M0LA 1KK3A 2VNHA 1G7SA 3AVUA 1Q7YD 1JNYA 1ZUNB 4TMWA 1VQ4B 1DDGA 1QGAA 5EMNA 3ZZ0A 2HCJB 4ACAA 1AMOA 1BX0A 1ZM9A 4P6VF 3QFTA 1EXMA 3I1FA 1Q82D 1FNDA 4B4DA 1QUEA 2YWEA 3AGPA 1DG1G 1QVFB 4KJZA 4FN5A 2C77A 3U2QA 1YITB 2VNKA 1D2EA 3OZWA 4YHBA 2GQFA 1D8TA 2EFGA 3VO2A 3CB4A 1R5BA 4AC9A 4C0SA 1M1KD 4G1BA 4R71A 2HMAA 2DCUA 3VNUA 1SKQA 3JQQA 5TR9A 5HXBA 4ZGQB 3I55B 1N8RD 2B5OA 1QGYA 4PC6A 3CCQB 4YAFA 1HA3A 1YI2B 3QE2A 4IW3B 4ZV4A 3U6KA 1XB2A 2PLFA 3WNBA 4ZCMA 3ZZTA 1ZM3A 1B23P 2QDXA 1VQMB 1KD1D 1K73D 1QH0A 3QFCA 2OTLB 2YWGA 4B44A 3ZZUA 2XEXA 4YAOA 2QN6A 3OZUA 4FK8A 3W2IA 3WBKA 4FWTA 1QFYA 1EP2B 2GPJA 1BX1A 3WYAA 4AF6A 2R6HA 3W2FA 1S72B 1H85A 4RD0A 1QG0A 1YJ9B 3I56B 1FNCA 1EFTA 2VNJA 2HDNB 1G7TA 2OK7A 3ZC3A 2BM1A 2QTZA 3VO1A 2OK8A 1EWYA 1IB0A 4TMZA 1W2BB 3OJXA 4N3GA 3W2HA 2PMDA 1E63A 3OZVA 3LVBA 1I7PA 5AN9A 5H5JA 2VZLA 4ACBA 2QTLA 1KTVA 1ELOA 4EH1A 1Q81D 3W5VA 1Z9BA 3WBJA 3MCAA 1EP3B 3CCVB 1S0UA 3WNDA 1VQ8B 1EP1B 1FRNA 4PC3A 3AVWA 4RCYA 4BPRA 2B7CA 4G5GA 1QGZA 4H9GA 4RD4A 2RC5A 4C43A 1FNBA 4ZCLA 2BF4A 3B82A 1K9MD 3CCLB 4B48A 3ES9A 4YALA 1N0VC 3CPWB 1KRHA 1KK0A 4LBZA 3OW2B 1OGIA 1QVGB 3CW2A 4PC7A 2E1RA 3G71B 3CCMB 3W5HA 4RJLA 3E20A 1W87A 4RCZA 1E64A 5DSZA 1BJKA 3CC4B 1KC8D 4DQKA 1SM4A 4QFMA 4PC1A 4ZCIA 1QX4A 4NBSA 5KSWB 4LBVA 4B3XA 3ZBUA 5GV7A 1J9ZA 2DERA 1EFCA 4J0QA 2J7KA 3LO8A 3J81k 1VQNB 1EFUA 3B8HA 4B47A 3G6EB 1VQ7B 4F7DA 1U2RA 2RC6A 2AHOA 1QFJA 3OJWA 1GR1A 2YWHA 5TV2A 1GAQA 4HE5A 2C78A 4U9UA 4DQLA 2BMWA 1QUFA 1N0UA 1JJ2B 3FJOA 1KQSB 3QSYA 4QHYA 3JQPA 2DEUA 3V76A 1JA1A 2QEXB 1XE1A 4PC2A 3MHPA 1FRQA 2BN4A 3CRZA 4B43A 4M4SA 3QFSA 4WQMA 5GV8A 3VMFA 3CXCB 3CCJB 1UMKA 4G1VA 1CNEA 2X3UA 4K1XA 3P26A 2B7BA 5H59A 3MMPA 3AVYA 3CC7B 1VQPB 1YHQB 2OTJB 1TTTA 3P27A 3B78A 5TY0A 1H42A 3AVXA 3WNCA 4MYUA 2BV3A 3FPKA 2XNJA 4LBYA 2QMUA 1F20A 3W2GA 1D1NA 1F60A 1FNMA 1KJZA 3CCSB 4Q7JB 3CCUB 4MYTA 1YJWB 4RD3A 4RD2A 4TMXA 1ZM2A 4YAUA 3CCEB 3CMEB 3E1YE 1DARA 1GO2A 2BM0A 1NDHA 2QA4B 1QFZA 4M53A 1R5OA 1W34A 2NPFA 3AGQA 1VQOB 3PENA 3U6BA 1TLLA 4AF7A 1BQEA 4UAJA 5THXA 2BVNA 1GAWA 1YIJB 4RD1A 3W2EA 4Y9RA 1OB5A 1VQLB 5JBQA 1OGJA 1TVCA 4HE6A 3CMAB 3CC2B 1M90D 4YAWA 5FA6A 2VYQA 2FX3A 1AIPA 2VNIA 4P3YA 1FDRA 3SJZA 3WY9A 1E62A 2XNCA 2CNDA 4Y9UA 2BPOA 4NCNA 1A8PA 1JA0A 3CCRB 4TMVA 1CQXA 4TMTA 1K8AD 1OB2A 1W35A 3WXMA 3CD6B 4LBWA 1KK2A 3G4SB 2CRVA 1B2RA 4N3NA 1ZM4A 2ZITA 1GVHA 4M2LA 1G7RA 1R5NA 1NJID 3AVVA 2DETA 4M1KA 3VNVA 1KK1A 4Y7CA 4TN1A 1VQ5B 1IJFA 2BSAA 4LC0A 3JQRA 3AVTA 3ZBTA 4RD6A
chains in the Genus database with same CATH superfamily
2HMWA 1NF2A 1YBMA 3H6HA 3WLLA 4HDOB 1VQ6B 1WQ3A 3NHYA 2QN3A 5FUYA 3GFRA 2QN1A 3PXAA 1JQAA 1DDIA 1TM7E 3GJTA 3UA3A 4FJ0A 4AZWA 2DY1A 1RLTA 2H7XA 4D9FA 4Q4HB 2VPQA 3I42A 4DMGA 2QR3A 5F12A 4MVJM 2OGZA 4OF4A 2ENUA 5T4FA 2X8JA 4ARZB 1SD5A 4Q18A 4CUJA 1C0LA 1P0QA 1B26A 5C1DA 5CDUA 1ZOOA 5CVTA 3UB3A 2J4DA 3DEZA 3SYTA 4FJ2A 1W8IA 1UPUA 3D7NA 3WKCA 3U7JA 4EY8A 1D1QA 4EARA 1EE2A 3A0UA 4J9VA 2HC9A 4Y6OA 2J3MA 5AVKA 3VZCA 4BGDA 4JB3A 1XL0A 4QOGA 4WZAA 3PHHA 3TVDA 5CIWA 4HNSA 1MOQA 2JAPA 3WK6A 3ZS8A 4BO7A 3N39C 1NQAO 3E58A 4M0KA 1E3IA 2KLBA 3LDUA 4LF4B 4HWPA 1C4XA 1RJEA 1VSQA 4JQZA 4R8RA 1QGAA 1HBJA 2JFWA 2W6MA 4O4JB 1LJLA 3BICA 1BCRA 4IM7A 4PTZA 3TQRA 4DA6A 3VC7A 3GQBA 2ECQA 3KSMA 2FP4A 3LX5A 1FX1A 1ULBA 1D1SA 3ZK8A 1WXGA 3W3ZB 5LDDC 4ACAA 4XJSA 3EGXB 1N05A 3HACA 3LVRE 1RQGA 4MJXA 2NT3A 1U0HC 4YAIA 3EHEA 1UBCA 3HI6A 2AQHA 2I55A 3C7CB 1F9EA 4BGIA 1OH5A 3IAHA 4EGCB 3PCRB 4FDAA 2NSJA 3EW9A 3NLLA 1ZU4A 3BWVA 2C2YA 4EJFA 3ETHA 2Z1DA 4UVHA 5ILGA 3KOOA 2JRLA 1E92A 2CF4A 4HHEA 4FYPA 5LM3A 1L5SA 4HQFA 3IMKA 1DG1G 1TIKA 2UAGA 5REQB 4CQLB 4EI7A 1TEHA 2KQUA 1DKUA 2XD9A 2R0QC 1EGHA 3CUVA 1GKYA 3ECCA 2HSWA 4GL2A 2WJ3A 2D2XA 2VAWA 1V5WA 1JN0A 3HBLA 4UTPA 3KSZO 1PR4A 1I6MA 3UFBA 4NYJR 3OZWA 2BUAA 2J9YB 1RWVA 2ZB2A 4R1QA 5E9WA 1TK3A 5D3ZA 2GBIA 4IIJA 4MX8A 3U49A 3EODA 3H3JA 4YJFA 3SI7A 5JBIA 2DF8A 1JGTA 2XBUA 4HDKB 3AX6A 3VDQA 1HKHA 3FUXA 4Z54A 5ELXA 4R41A 4LDQA 3K70D 4ARAA 2XMRA 4V2IA 1QG4A 1SR8A 4ANFA 4BAZA 3ZH9B 3HJUA 4TLEA 3WFJA 1HT3A 5K0SA 5KHAA 2WWTA 2VP2A 4HOYA 2G88A 1NOKA 2E4XA 1R0KA 1TZCA 1SIOA 1R37A 1V1RA 3VHQA 4NOLA 3BULA 2GM4A 4AICA 3WRXC 1RJ9B 3PYMA 3ZE0B 3MLAA 4FYWA 4DIMA 2ACEA 2C31A 3NHSA 4HB4A 1IZYA 4R3WA 1XB2A 4ZCMA 2VQSA 5JV5A 1F9AA 4GLJA 1LBEA 1XHFA 1LF0A 2GYYA 4JU9A 1LGYA 4KN8A 5KOHA 1YZUA 2P4HX 1KDOA 3QLEA 4JDPA 2ZI4A 3C8UA 4HAWA 1UPAA 3FFWA 3MQFA 4J8PA 2B35A 1HQYE 4PRLA 2FWBA 2ACWA 1PEYA 3EQ8A 2HA3A 3L7NA 4RVCA 5FT9A 1PZNA 1WUIS 2ORED 1YONA 2C4NA 3O75A 1IHYA 2H8GA 3KWMA 3JD3A 3Q6QA 3Q2KA 2BKLA 4PLWA 4QGSA 2IW3A 4WUTA 2POQX 1E0KA 5FBRB 4JSRA 1I8DA 1OGYA 2XAAA 3NGMA 4EI2A 2WJ6A 5AW4A 5G1PA 2BTQB 1UBFA 3A2KA 3HA5A 4FK8A 1XNGA 1X7WA 1W85B 1XN4A 2JFGA 4RK0A 4ZVOA 1KMNA 2ZVDA 3VHLB 4ZYTA 2AI2A 3BCUA 3MW8A 2REQA 1JSLA 3HJGA 3BK1A 4NFYA 2WFLB 1P9OA 3KG2A 4XL9A 3GX1A 4CF4A 2W70A 2QSJA 3RWMB 3V7AA 1PS8A 1YZGA 1YGPA 1B00A 1PT7A 2B6NA 1BX3A 3M1LA 1KVTA 4X7MA 5BOSB 1KH1A 3SVLA 2QRVA 4C0WA 4ZEOA 4RKFA 3C2QA 5EMHA 3KPJA 3RHTA 3ZWYA 2OK7A 1OXBB 2MTBA 3GZNA 3ZXUB 3E3NA 2QTZA 3QEMB 2IV7A 4EUNA 5JAPA 2O8VA 1P7CA 1E4OA 2OILA 2P65A 1T9KA 1GZUA 3AV3A 3PCTA 1DG9A 4L5YA 4PX2A 1NF9A 2F55A 3ND8A 4D25A 3HY3A 3N8GA 3W2HA 3L9WA 2VUUA 3R9KA 5CVCA 1PZEA 4ZV7A 2NV0A 5CLIA 4FNGA 3CXUA 3OZVA 2Z04A 3CLUC 5DEOA 4J0DA 4KODA 1X39A 4ESOA 5B3JC 3LVBA 3L7BA 4JWTA 1P0PA 1QR6A 4PBTA 3VVBA 4HDSA 2R1TB 3OKFA 1EWQA 2OBYA 2QTLA 2H9IA 4MPPA 1KO5A 3DHNA 5IK2A 1ELOA 1BXKA 3V00A 4BJ6A 3MC1A 4HDNA 2WYIA 1VJDA 3PNOA 1M1XB 3FPPA 2BGMA 1CUCA 4KIWA 3KO8A 1KY3A 3CCVB 1MC8A 4CU5A 5KNCD 1JA9A 1N0HA 3C3BA 1MRSA 4A0GA 1MENA 1LPNA 4OQZA 3UFXB 3C6YA 2AN9A 4JVNA 4B71A 4EUFA 4A8JA 3GAMA 1M2OB 5BXQC 1RMTA 1ZIXA 1JHXA 2AVNA 3LBHA 4ZXPA 2P8SA 4C7OB 1IQUA 1VHTA 4EZEA 2QYSA 3D4IA 2OG1A 3QHQA 3VAAA 3FNGA 1D4AA 4TS3A 1IEWA 5ICCA 1HLDA 5CXSA 2J3DA 2L0XA 2E1BA 1NN1A 2JVJA 3KFVA 1K9MD 1ZR2A 3ZIAA 3D64A 4KBYA 1FSSA 2NIPA 4KQJA 2WIDA 3PLAE 3C5VA 1ORVA 3QPCA 3RBXA 2BKUA 4H6WA 2GBCA 4JCOA 2R5NA 4U9HS 4PCUA 4DNFA 4EG3A 5CBPB 1EXNA 1RHUA 2J87A 3CLHA 5BT8A 2VDJA 2R3SA 4G24A 4JN6B 1CK4A 1UR5A 4MVJF 2C3MA 3OIUA 3IPRA 4NOMA 1DRKA 1NBIA 5DSXA 2I6QA 4BV8A 4MUEA 4HNHA 1L7NA 2IYQA 2BISA 2CK3D 2IHVA 2YYZA 2HF2A 3DUFB 2FE4A 1ZH6A 3K6JA 3PFHA 1E7YA 4RCZA 5EIBC 4E2XA 4M88A 3HB5X 2PXAA 5CT6A 4F2WA 3RADC 2HB6A 4B3HA 3T5CA 1GUAA 3RS0A 1OI3A 3E9DA 2EBHX 2VFAA 3H65A 1X1TA 5ABPA 5CMLA 5JG7A 4BFCA 2GBGA 5EI5A 2WE8A 1Z88A 3O8OA 2V3VA 4FP9A 3SSMA 5K6AA 4HWTA 3H86A 3RCBA 4BGEA 1DJOA 2JGMA 2Y93A 3PTLA 4KQHA 3RTEA 5BN3A 5HFAA 3DE3X 4NBSA 2HMYB 3R6WA 3SBDA 2V0CA 3D2AA 3HS3A 1M6NA 4N0QA 2WTEA 5AOBA 5IVIA 3E05A 2CLSA 4R2WA 4G0WA 5DNYB 1D09A 2O1SA 1DAIA 5JT1A 3MGKA 2VP6A 2AEMA 3BD8A 5FRDA 3GDHA 1UH5A 1KI4A 1ZUIA 1L1FA 5KNBA 4IZOA 3LO8A 2QQFA 4QJ3A 1MX9A 2NO5A 2IVFA 2WM2A 2HNKA 3TTSA 4C7BA 2PT9A 3L8GA 1SCQA 2XCIA 5JYEA 4JJIA 3TBFA 3U4GA 3DV0A 1QKIA 1R8JA 5HZAA 3G2PA 3VDMA 3C70A 4A0FA 3NHKA 4BBJA 4EQ6B 2GCPA 2ZJ0A 4FGJA 4YP0A 4DMRA 1MMFB 4NBUA 1N34B 2Y0BA 3U40A 1DP4A 1QKKA 2AF3C 2G9QA 3I23A 3OQVA 4BZZA 4XQGA 3MJRA 3CNLA 3E7XA 1TCVA 5AICA 3M1IA 3QMWA 2BMWA 1LLFA 4BMSA 2XMQA 3RC7A 4H0FA 4D3SA 5BVHA 4COKA 1CUFA 2JA1A 4BB6A 1B6TA 2PDAA 1GZ5A 5FBHA 3SS9X 1XEWY 4CQJA 1R0WA 2OAGA 4KRGA 1D4OA 4UPEA 1A2KC 3C3YA 3CIOA 3ZTYA 3AZPA 1RAIA 3JQPA 1CLEA 3PYLA 4UDNA 5B58C 2ODEA 4GL4A 5FNVF 1C30A 4X90A 4MGKR 1OASA 2YXLA 2OHJA 5JSZA 2H06A 4BECA 4IGAA 2DHDA 2F1IA 4OP2A 1UM9A 3CUYA 2P62A 4MVJG 1R0XA 1SWVA 1WEKA 3UQYS 3TO5A 4F12A 1PGQA 1N9ZA 3AUTA 4QULA 4E2ZA 4M4SA 1V2HE 4IXDA 4FC6A 2XDQA 3MIZA 5ALTA 2CB0A 3DTNA 1O6FA 1ULSA 2NTJA 1CZRA 4IMRA 4UXJA 5BXYA 1FQKA 4AQDA 4RF5A 4G7WA 1AS0A 1TKBA 4U2BA 1ZSNA 2AZXA 1IC6A 2IYVA 1TA0A 3A6LA 3C97A 2FUG1 3KQMA 2FN9A 4NE7A 3RIYA 2B1QA 2X6WA 4KAJA 1V3TA 2R1VA 1GRQA 2Y9PB 1ENZA 4EFNA 4QM6A 4HDSB 4L02A 5KYTA 1JZQA 1LLUA 3WADA 3WDSA 1TK2A 4CCYA 2LKCA 2QLBA 1MV5A 1EUYA 1CUAA 4CDGA 1X42A 1U7TA 4LISA 5IVDA 3W5IA 2DFKB 1J22A 3TBHA 4NZZA 4Q1EA 1AE1A 5FOVA 3O38A 1ML3A 5AW7A 3A3PA 3KL4A 3BD9A 4AG3A 4OXNA 2YBDA 3B7GA 5KOJB 4JNCA 1NRXA 1XELA 1YMUA 1L6RA 4PIVA 1HEIA 1W48A 2ETXA 5AHRA 2ZBQA 1R6UA 3FDZA 4IUDS 2PZJA 3PQ8A 5CFPA 2PH5A 1SUPA 2RHDA 4YAKA 1PLJA 1ZUHA 3Q9NA 2IXFA 3WLQA 2IF0A 4A8HA 5FTMA 3PC4A 5IW8A 3RVQA 5FPPA 1YOVB 1FFBA 3QQPA 3UTCA 3PGJA 1V11A 3L4BA 2NAPA 3I4FA 5DNCA 3T5TA 3GNSA 1IEXA 1W0CA 3VMMA 4BX2A 1N2BA 1SOUA 2FVYA 1UKEA 3EPLA 4D8YA 1FXWF 4MR7B 3PRKE 3IB3A 5HCNA 1PJ8A 1YVEI 5G0VA 4MWTA 1VHJA 4X20B 5IBCA 3W78A 1EIZA 4DK0A 1RPJA 3NAGA 3I2GA 1F8YA 1I7DA 4ZHQA 5T64A 3BZUA 4LXGA 5H02A 3F98A 4HDMA 2EP5A 4HRAA 4IIFA 4FGKA 4OHMA 1YDWA 2BEKA 1MU0A 1Y5LA 1Z6GA 2HHLA 2HLDA 1ZRMA 2FPXA 3EEBA 1BNCA 1ADYA 2NNLD 3R5FA 1XRQA 3K8ZA 4QUEA 1XVUA 4R9SA 1KSFX 2SNIE 2Z4TA 1P1IA 5F98A 3OM8A 4CNQA 1YDHA 3R09A 2PGIA 4N5IX 4XYMA 2WF6A 3WRWA 3K4PA 3I72A 1IEVA 5A3JA 5BNFA 5ILQA 4JI1B 1XA4A 2IWHA 2DC1A 3RROA 4CM4B 4QUIA 4D46A 1WOPA 4IR7A 5F4JA 1NP3A 2FLWA 3RVOA 4E5KA 1R64A 1ZS9A 2Q9CA 3U4IA 4BWFB 1I01A 2EFYA 4QYTA 3NT4A 2C9YA 2QVBA 5GAJA 3LHKA 3OEHA 4GQAA 4Q9DA 4YP7A 2ECFA 1T2AA 3OCZA 1G5PA 3SKYA 4ER7A 3LK6A 1FJHA 3LY7A 4P80A 1JFRA 3SXPA 4E70A 3DKPA 1XPOA 1TZ2A 4V03A 2J4FA 4Y1RA 1X2EA 4MIOA 3RU3A 4ND1A 4QUZA 5TGZA 4FJ1A 5HIIA 5LLSA 1IBRA 4CGZA 2FZGA 3IQHX 3PUYA 1RADA 5AVQA 2QX4A 2AG6A 3DZFA 2NUBA 3A4YA 4M83A 4QYSA 1JE1A 5CR9A 2H9AA 5JCOA 3WLKX 4B3BA 5BWCA 2OV6A 4B1FA 2WTUA 4C5BA 1SXPA 5CDTA 5A6VA 1Q1ZA 1W4RA 1XHEA 3V42A 4C9BA 5JO0A 2JZOA 2JEYA 4W7SA 4O5AA 5KWIA 2YWJA 4OLAA 1RCTE 1ZG3A 2I4NA 3KQTA 5KYYA 4DUZB 2CNOA 3SJZA 1J7KA 2EKBA 1KI6B 1H1DA 1UBHS 3HJHA 3ENQA 2C57A 1R00A 1E5XA 1RLJA 2PAAA 5KNLA 2YFYA 3NUZA 4OMCA 5BSEA 4LF7B 4OIFA 1S2OA 2FZCA 1U7HA 4HXGA 4BB5A 2BPOA 3CCRB 3COZA 3WSTA 3EZ6A 1CQXA 4XDZA 2DWUA 5F4BA 1GILA 1PV1A 1ECBA 4Y3UA 3WQBA 1ZJYA 4BFZA 1E1DA 1YA8A 1K7YA 3OTIA 2PMEA 1YQXA 4FLMA 2QX7A 1A9YA 3ZWWA 5GPBA 2FW9A 3VPBA 1R9JA 3JTMA 5AIBA 2B98A 4LNUA 3FF4A 2E5WA 4JB0A 2XE6A 3OFKA 5IP5A 1L7DA 4TZ0A 3SLGA 3F71A 4K88A 3UAVA 4BVJA 2E2WA 4REMA 1VHOA 3RVRA 3LX4A 3SZLA 1ZLXA 3OQ1A 1P4RA 5TVGA 4HB0A 2E49A 4JSYA 2QB5A 2VBIA 2H5EA 1YKSA 1DKPA 4M0PA 1J5EB 4ENUA 5D1HA 3AU8A 2HA2A 2H07A 3ESCA 3HLTA 3I4LA 4KU4A 4L78A 4N5HX 2D7DA 4IUYA 1R4AA 4E5PA 2RBKA 1HY3A 2XZTA 3A3BA 4MGEA 1BE8A 5TMEA 2ZQZA 2W6CX 3RANA 1G66A 2GCIA 4K6KA 1N0WA 4AJKA 3ZHQA 2F1MA 4EKGA 1N1MA 3IQWA 1VQ5B 3M2PA 3PC8A 4KGDA 3SQNA 3FFXA 3KS9A 3FCYA 4MIYA 4TQ9A 4AX4A 4CIXA 5IWCA 2J3EA 4FYMA 1MFZA 4WXHA 3AWDA 3ZQ6A 1G9SA 2I4MA 1CHDA 2JJ2A 4OB8A 2HPZA 1PJBA 3UATA 4JI4B 2Y4NA 3A6ZA 3P0HA 5JJ5A 1A71A 2AMJA 3QFFA 1YZQA 4K8RB 5FBQB 2QG4A 3DMDA 1RM3A 1CZOA 3UGJA 1KGSA 3EE6A 5HRCA 2BGJA 3EASA 3BYZA 1U31A 3GEGA 2M98A 5JE8A 1Z5NA 5JH7B 3NG1A 3MWKA 2JIDA 1Q0TA 2D74A 2W6ID 1KNQA 2QW0X 3BRCA 2WMYA 3Q85A 3HM9A 4PBSA 3FR7A 2NQTA 3O6VA 5KJCA 3K0SA 1EAMA 4Y2TA 2ZWVA 3QQ5A 2ZJYA 1U9YA 3PLRA 3I92A 5LQUA 1V5GA 1IM5A 4V0RA 1P1FA 1O08A 4BWVA 4CIWA 5EUBA 4DLVA 2BP7A 5JQWA 4HUQB 4JLVA 5L3VA 4FOTA 4MQFB 5ESWA 1MEOA 2YIJA 1V35A 4AG5A 1SU7A 2D1YA 1R9MA 3EZ9A 4LDRA 1V5EA 5LBIA 2GEKA 3U4DA 1Y5MA 1B8VA 4U0KA 4XJTA 3P45A 5J2TB 5LD2C 1CD5A 1FMTA 3IPLA 1QCDA 3W6PA 3UANA 4CIVA 1KBQA 5DTRA 3PXXA 3A10A 5BWNA 3ZVLA 2RB5A 3WRXA 3RVPA 5K7SA 3HNOA 3I1FA 4BQEA 3JVIA 4IHQA 3BHNA 5TXGA 1FYDA 2QLMA 5CFZA 3TMAA 3E8SA 3PQDA 3RW9A 3EXFA 1UOEA 4HDCA 4LZLA 4EW2A 3QVWA 4O8ZA 1MTZA 1U8ZA 4JT8A 3PFKA 3UK6A 4NG5A 3WMWA 1IJKA 3EWNA 1PL7A 4FD3A 2QPTA 2NZVG 1E32A 3O1HB 4GKAA 2RHJA 2X1MA 2CVFA 5F5NA 5BWBA 4FGZA 1E8DA 3EMVA 2CDNA 3EK2A 3R44A 4EKEA 4U4AA 3CT4A 3DPSA 4KAXA 4QTYA 1FYFA 3F6RA 1W19A 4HO1X 1P4GA 3AEUA 2IZZA 4WZKA 3F4KA 5DKFA 1E3JA 2KPOA 2OBSA 2ZZKA 2YOFA 3S1LA 2NUPA 3AUUA 4DN6A 1WMEA 5LBUA 4CLXA 2DKNA 2QR5A 3RV3A 2FY8A 1M0WA 1JSCA 1ZPDA 2J3HA 2TSYB 3TG8A 4W5NA 2FX2A 3EF3A 4NAVA 5KQPA 1KP9A 1UKYA 4ZGQB 1HDEA 3TUIC 5TEVA 4XYLA 2GBLC 2HA4A 2GOYA 2A58A 4IIEA 4NBRA 4PYQA 4OHZA 2CDRA 3TMYA 1PGJA 1LBQA 5ER6A 3ZHOA 5CB4B 1GQ2A 2WEKA 4WVFA 2IOYA 1E3EA 2IXBA 4RNCA 3JR7A 3BMNB 5EXDA 5C5CA 3WNBA 4AY2A 2RGUA 5G0TA 1JS1X 1JG6A 3K09C 1NXQA 1UBOS 2R4TA 2F1OA 3H84A 4MZDA 1GUYA 2UZ4A 2P79A 4I19A 4ZI7F 1FQWA 1HH4A 3R5JA 1Z4OA 4V39A 4CL8A 1X8JA 2ZK7A 3A06A 2DWQA 3WA6A 2JFQA 3CPHA 2FFAA 2QTWB 4Q3AA 1FRVA 4RHXA 4LNUB 4LKOA 4YGXB 1RR6A 3DBHA 1COWA 4BTVA 3PKZA 3VR1A 4C7KA 1V4NA 3ET4A 4BLPA 2XEXA 2XUPA 3KX2A 2RK6A 1P1RA 4TS4A 4I1VA 3DLBA 4HNAB 3OZUA 2O2ZA 3AR4A 4GEKA 3AY7A 4XKWA 1D2GA 1QIKA 3WBKA 3MVEA 3A2MA 4PSVA 2G28A 4FHCA 2WZPP 1P9NA 2GLUA 4Q16A 1X77A 3BFJA 2EX1A 4N3BA 2WLTA 4M1MA 5DRYA 1ECPA 1GGHA 2OZVA 3O93A 4AZTA 2ZZQA 2NZ2A 1U8AA 1JL3A 2I8LA 2GNPA 3RLFA 2UYOA 4DMUB 5ES4B 4RF3A 1P80A 3L4SO 1G3UA 1Y5IA 4ALKA 4IDAA 1MW8X 3RUAA 4YO8A 1B42A 4RGQA 2WA1A 3BJZA 3ADPA 1MA0A 1ZD9A 5AXAA 5TGTA 3ICCA 3V1MA 1QV6A 2P2LA 1QRUA 2X5XA 4BFUA 5AVRA 4FU0A 4PHGA 1CQIA 1AZLA 3QLVC 4S35A 3OG9A 2BH2A 3KQVA 5JEDA 2YJNA 1H8ED 2Z3ZA 2QRLA 4MCAA 4KACA 5CURA 5KTTA 1YACA 3E03A 3DS8A 4LRSB 2XB2A 4DJEC 4OH1A 1PZGA 1T13A 2YS7A 3ZYCA 3T3NA 2AI1A 1L7MA 1X7XA 2CNBA 1U3DA 1Y8CA 1Z29A 5EZ5A 3BE5A 3C5WP 2YN2A 3I0NA 4IH9A 2IYAA 5L8VA 1DINA 3MLBA 4R83A 1YSCA 5ITWA 2CV1A 1KTVA 1Q50A 3RVDA 1H3FA 4AY6A 2C3PA 4Y0VA 3UGKA 5T4HA 4DR7B 1OCEA 1KYZA 2IOQA 2JCVA 1Y4ZA 3Q1LA 1YQTA 1LDEA 4QWWA 4AXXA 2YUIA 1HDCA 1N33B 4IFIA 4LDAA 4UAUA 4UBMA 4QFDA 1NBOA 1QVRA 5EJGA 3S27A 2YHIB 3GVPA 3TJZA 3PEYA 4FSHA 5L3SA 2B4KA 2Z95A 3VR4D 1QGZA 1KYQA 3H0KA 1INLA 3L43A 2PL9A 3G13A 4L28A 1AUVA 4G56A 5E9QA 3ELYA 3ROFA 3HLYA 4DLRA 5BY2A 4LMBA 2BHTA 3ASUA 3NBQA 4C43A 4O1IA 3TTTA 4ARUA 3R0XA 3S7TA 3NHUA 2OAEA 3ZDEA 3IULA 4B4WA 1U94A 5AOCA 3LP6A 4Q3CA 6LDHA 3DQQA 4DCNA 2NU7A 3QPDA 4BATA 3AY0A 1DLJA 3JW8A 3K0HA 1ZVVA 1QM5A 2DFTA 2P3SA 2O14A 2B2NA 4G6ZA 4QYWA 4ZVPA 3AP2A 4D0NA 2ZT6A 3SIPA 3TXYA 1E79A 3AM4A 1FC0A 5SZHB 2C7GA 1YJCA 4MUAA 5AI0A 4HH1A 3D3QA 2PNFA 2BDEA 2XVXA 2A0WA 3Q7EA 4FYYA 3STVA 1HDIA 4M7WA 2JVIA 5EJ9A 5D01A 1XLWA 3QYPA 5FBWB 4NESA 3EF0A 2EQ5A 5SYMA 5F2EA 1O2DA 3OAAD 3FNIA 1T5HX 3ITKA 3K6SA 1PKVA 4UDOA 1QHSA 3C43A 4MW5A 3M4YA 2JCSA 3GOQA 3M6AA 4LXUA 4U0JA 4NXMB 1Z18A 2X0RA 2IDZA 2CE7A 1V9SA 2WY2D 3D3WA 1MNAA 5LXTF 1KAEA 1NW6A 2EWMA 1K92A 2C83A 3UIEA 5YASA 2O0KA 1LY1A 1TA9A 4PCLA 3S5UA 1ZIDA 5BMOA 5LP1A 4WA8A 1Z5UA 3SJ7A 4PHFA 3HAGA 2F59A 4QQ8A 5AI8A 2F43B 3Q2IA 3SMVA 4E4RA 4OA5A 3ROTA 3PNBA 2GKGA 3R3ZA 1CJVC 2ATXA 4IDFA 4K6GA 4XEUA 3IEUA 5EQDA 5DT2A 3K1YA 1YJ5A 4EHLA 1VP3A 1NHWA 1PWXA 1Z0AA 2HDHA 4IXWA 3FSJX 4KQMA 3H1FA 3I01M 2QL9A 2I3DA 1NL3A 2J7KA 1XCBA 5EJ4A 4C2UA 3NC4A 4Y2YA 1BWPA 2A5FA 3BXOA 4FCTA 5KNDH 4F38A 1DCTA 2XAUA 2AX4A 1VSTA 2BONA 1SULA 4G8JA 3KZXA 4YJ2A 4HVTA 1QE3A 3GZ4A 2YC4C 2GZ3A 3IP8A 4PLZA 4PQYA 4Z8YA 5E7IA 1NX9A 4RKRA 4B40A 1W75A 4FWBA 4EDHA 3UCEA 5U4XA 2I7TA 2OCXA 4IZHA 4Y6RA 3QSGA 5ER9A 3PI7A 4WKCA 3ZVMA 3D02A 2C8VA 3RDPA 2C78A 1X7HA 5E3HA 3MJHA 1RJDA 5FX2A 5HJ7A 1N0UA 1B8NA 3I76A 1XFOA 2CDBA 3LO5A 4MUNA 4UUOA 1IHMA 1FP7A 2AQ8A 3DMTA 3QF4A 4HZUA 3SX0A 3H3FA 3CN7A 5KC8A 2PUGA 5A88A 1F2VA 3O8LA 4G5OA 2O7VA 2JHPA 1U0SY 4QPPA 2ZXFA 2ZWMA 1Q92A 4KMOA 3COVA 1VZ2A 3K15A 4DLYA 3FTPA 3W5JA 1MTOA 4QU0A 4CT5A 4JJ4A 4NCAA 2XJ9A 4ZMRA 4D3DA 3HFGA 5F7XA 3TQCA 2YXDA 1ESMA 2XXBA 3QU9A 1RYZA 5P21A 4YACA 3E6AA 3DWEX 3DR5A 3RAFC 2MYNA 3O7MA 3EDRA 2FRDA 2R11A 2WIBA 4OAQA 3M8KA 4RPHA 5HQ3B 1N36B 2Q9UA 1G3QA 3PFCA 1A97A 1QVWA 5LN1A 5ALSA 2P3QA 1TJ5A 3H2HA 1EZ4A 2AV6A 3U09A 3HKDB 4YQEA 5AM4A 3QA9A 4DMFA 1YO6A 2PJRA 5LDGA 1JXAA 1Q1QA 2A0XA 3AR3A 4JT2A 5MFZA 2QTMA 2H54A 4L22A 3VH3A 1T6NA 1YJ8A 2DVMA 2WZDA 1PGOA 2QGGA 1VJRA 1SZJG 3G6WA 3PS9A 4OPMA 6NULA 3LQRA 1XD9A 1QLHA 1QHEA 4AN4A 4E11A 3OPVA 2VZ0A 3IBGA 3T7EA 2GVZC 5FLKA 3CNHA 3ENNA 5A6SA 3R7SA 3OP4A 3PHCA 2JLYA 1PJ4A 1TEZA 3OJEA 2CMKA 4X91A 1VKHA 3IIMA 4QQRA 2I6GA 3L7YA 2JZCA 2YHIA 2O1WA 2Q07A 1XQ9A 5DZSA 2VYND 3OX4A 3VR0A 5C18A 3HKBA 1F17A 4MW6A 4Q9LA 1XK6A 1ZMRA 3CR8A 3VR5D 2XUHA 2X8BA 4TRNA 3NEJA 2B78A 3DD5A 4MYUA 3BMOA 3I09A 4FGSA 4INJA 3S1AB 2WMOB 3SEQA 3JQAD 3FFTA 1XLVA 4HS4A 2CLIB 3K9FC 4FHDA 1T5IA 4G4SO 1SD2A 4PZ0A 5DWQA 5DX1A 2X15A 3TW0A 3OQMA 1CYEA 2G4CA 3N2YA 4YCCA 3VSDA 2ZR8A 4IQFA 1T3GA 3IMGA 3F49S 5AVVA 2CZCA 1JYEA 4I9UA 1GCAA 4Q3NA 5CVUA 1W0JD 3RVNA 3W2GA 1ZGBA 3NTRA 3ASYA 1IZ7A 5DBOA 3VHXB 3IE1A 3P19A 2NYVA 4FBGA 5C34B 2A1TR 2RHWA 3OICA 4RPLA 1K7SN 1P3JA 2IUUA 1HQCA 1ZH0A 1IDOA 5ESRA 5TQ0B 3PA1A 3L92A 2OEPA 4GOND 4IH1A 4NV0A 5AR1A 5ANRB 3QEKA 4N6NA 2HJWA 2I76A 4MQEB 2O8CB 2WSLA 1ZJ6A 1ZM2A 2M1ZA 3AHIA 3KTAB 4HCJA 4QRHA 3SSAA 5I9SA 1ZBDA 1HT1E 1D5CA 1XL1A 1KSGA 3SQWA 2OZKA 2XCLA 3KCQA 4HDRA 4MA0A 4PRYA 3SJAA 2EKQA 2GXAA 2XMPA 1UJNA 3K6RA 1Z15A 3GARA 1YQGA 1VIMA 1ZHOA 1TDJA 4DADA 1WV0A 1ISGA 1U2PA 2R44A 2PM8A 3PSHA 4FDTA 5T3YA 5IT5A 1E7QA 1M1NA 3K4HA 4B45A 5ELLA 4E13A 3IMFA 3SQLA 4AXBA 4B7CA 4MUHA 1KH2A 3Q40A 1LPAB 1DKOA 1F7VA 1UIMA 2X5NA 1KWGA 4QT0A 4J3NA 3ZCRA 3MT0A 3UG7A 4ZVTA 1F12A 4GR9A 1GL3A 5JSKA 4NJMB 3UQZA 1MX5A 1RS0A 2H1CA 5AHOA 3BTUA 5A62A 3EC7A 5JBQA 2D2EA 2X2OA 3W8DA 1JEAA 1Z33A 3KUKA 3OTHA 3DDUA 4LQCA 3STYA 4CF5A 1H2ZA 4GX5A 2XV1A 5ENVA 5DDIP 4YAWA 3U17A 5AW3A 2WV9A 3K73O 4JX8A 3B1ZA 2RGAA 3WB9A 4HQNA 1P6XA 2C2HA 2CUNA 2QNBA 3F6SA 5AD1A 2VNIA 4QOJA 1FXUA 3HO8A 1M1UA 2ZTNA 2Z4SA 4ZEVA 3ED1A 1LW6E 2QROA 5EMMA 2ZAOA 3WY9A 1W5FA 4GXRA 3IJPA 4EKDA 3EPHA 3CVJA 1XVAA 1M2HA 1OILA 2EJVA 1G8KA 3LIPA 3LUPA 3BWYA 3OTWA 4TTQA 5DNVA 3SDZA 3VYTB 4Y9UA 2Q99A 4BQRA 1TJYA 4WKNA 4CLRB 4EQZA 5KCZA 3HY6A 3JQFC 4XASA 1JA0A 4P31A 1L8XA 3B89A 4CTKA 1QK4A 3G2KA 4M8NE 5H9WA 1WRBA 4Z0HO 3NOXA 3O91A 1FEZA 1GFWA 3TE7A 3V34A 3UAWA 5TJHA 5K8IA 4IDCA 1EHCA 3CF0A 3KT6A 1QANA 4XQCA 4QYIA 4CM8A 3IEMA 3HBFA 3MWEB 3ZI7A 4RC9A 2C2OA 4P0TA 5G41A 4XWWA 1YR3A 4ODIA 4RULA 4DDVA 2R6FA 4RZXA 4Y1FA 2XCQA 3NT2A 5BO5A 1O89A 2IC5A 5KSPA 2ZIVB 3BD7A 3MRSA 4PAMA 5DYYA 1C50A 1ZEMA 4O2AF 3C48A 4JLSA 1QGUA 3IHTA 4DCUA 3UWMA 5ITZA 2Y1OA 5DLYA 2XT6A 2CXXA 221PA 2GM3A 3GOHA 4DW8A 5F3DA 4E5MA 3ELDA 1TA4A 5DIZA 2H8KA 4YK7A 4KR3A 2DETA 5JAMA 5KB3A 3O8RA 3PC3A 1QRSA 3HCNA 1QU2A 1RPTA 1EUCA 1FTYA 1SB8A 4O4JF 1T5EA 1GPKA 2G71A 4GZ6A 5CM2Z 3TZKA 5J4VA 3DEKA 4N5DA 5KX5B 3W4IA 1K6EA 1FE8A 2PD3A 4KFTA 3W9UA 2FZVA 1F7UA 3KYDA 1RCUA 2ZUBA 3EZ7A 3LD9A 3SHWA 5FWYA 2JD2A 1SBTA 3OJLA 4CEJA 4TVBA 2FMHA 1F3LA 1EQAA 1PW7A 3CUKA 4GS5A 5CH8A 3ZY3A 4PNZA 1AT1A 3JVVA 1J49A 2WHPA 3T99A 3ODPA 4BGUA 4UUBA 4JMLA 4Q1DA 3S28A 3GVIA 3WJ1A 4Y0AA 2ZJOA 3CF4A 3N2LA 4M87A 4TTSA 5LIRA 1XKQA 4G1EB 5FO0A 2VT3A 3VSCA 2W42A 1OFUX 4B9AA 3ZWVA 4LVUA 3IVCA 1G16A 2HNBA 2WJZB 1K1EA 4LE1A 2UXCB 4ZEXA 1HEYA 2D6FA 4PSAA 3QWAA 2C99A 3D6HA 2FHSA 4GSKA 4YP6A 4BZQA 3M49A 2QAJA 2DSNA 2R8PA 3E7FA 4IMPA 3O1IC 3VAYA 1Q7YD 2OZLB 1T9GS 5JPCA 5G40A 2PZ8A 5C7IO 5LQCA 4Q1CA 1E2BA 5ERYA 4XUGB 1JHRA 3DXXA 1ORTA 2PLNA 3KM0A 1LNSA 4OLFA 1AN9A 3BXPA 2FP4B 3IDAA 4R40A 3CX4A 1OPXA 3CN9A 4MYCA 2PGOA 2HCJB 3GH1A 4FFOA 4Y6SA 2YFKA 3QHPA 3C98A 4CLDA 1MAUA 4LC1A 4AS1A 1OXXK 1ZL2A 3AF5A 1O9HA 3QTLA 1MV8A 2JNWA 3FAKA 3PHBE 4FPXA 4CFYA 3CZRA 1ZM9A 4HDRB 6CHYA 3CTAA 1N92A 5CIYA 2V7WA 3SBEA 2D59A 1D9XA 1J8YF 3H9UA 1EXMA 2D3LA 3IAAA 4RGVA 4D9HA 3B6JA 3LWZA 3T35A 1ATZA 1NLUA 4OJTA 4CQLA 3PUZA 4X00A 4QEDA 1L5YA 1YR2A 3SZGA 3DNMA 1SQFA 1WXWA 4KJZA 4EMTA 2O2GA 1VLOA 3PPVA 4UREA 5EKDA 3DEYX 4KNWA 1GNVA 3I12A 3S8MA 1PBTA 1Y3CE 5IXYA 4DR3B 1UMDB 1AB5A 4AWXA 1D2EA 3GFVA 3WKEA 3WIDA 4CM8B 2CV0A 5AJVB 2ZZNA 4BE7B 4KUEA 2VBTA 1W36D 3VO2A 4W8OA 5K3AA 4UM8B 2P2DA 4BUJA 3GLSA 3HC7A 1J0XO 2DT8A 4H18A 4BRWA 1Z0UA 4IDGA 5KJ1A 3MELA 4M7RA 5HP4A 2Z6AA 1L5RA 3LKZA 1T3LA 4WI1A 3RVMA 3UMMA 1RWNA 4GXTA 2Z08A 4Q4LA 4QYMA 4Q0MA 5ENDA 3LOPA 1GZ6A 1LWOA 2HEIA 3JQQA 2ZJ6A 1QZ3A 2A88A 2A3RA 2G5GX 3NHJA 4JXJA 3I55B 3OESA 2OCAA 4FYJA 1P4HA 4GD3Q 5T6MA 1OLXB 2D5BA 1PVOA 2BE7A 5K8CA 4YT4A 4GYYA 5F1KA 5IANA 10MHA 1U7OA 1BD4A 4EAQA 2H0QA 3PC6A 4CM3A 2O4CA 1E77A 1NMXA 4G07A 3MRVA 2CJYA 2V8OA 3VH2A 4BZPA 4DCJA 2ZI3A 4EHAA 4Z3KA 2PVCA 2R6AA 3WSWA 4L8WB 2F7SA 2X77A 4TSFA 3E5NA 2OFFA 2VBFA 5JLJA 2LCIA 4MTCA 2XOKA 2PD4A 3KR9A 3DOJA 1GL9B 3MN1A 2WOJA 4MIKA 1NKTA 4I08A 4DXHA 1SIBE 2R6ZA 3TOCA 4MJ7A 4GPZA 4S2UA 4GM1A 3Q9SA 2ZSUA 1E3DA 1EJ6A 2FJUA 2WPDD 2X13A 4MARA 2YKGA 1T2NA 4HYQA 4D2IA 2IJGX 1KHHA 3GLUA 4FR5A 1C5KA 4DT1A 4D26A 3RF7A 4GWKA 4AF6A 3WK4A 2A5LA 3VISA 4R84A 4IQ8A 3W7BA 3NBYC 4AKHA 1P0IA 5A5VA 4DNRB 1V3QE 4YA6A 5B12A 1E2UA 4DC0A 3PQ3A 4B3FX 2W9XA 4MWZA 5HK9A 4RABA 1BQ3A 1O97D 4TUYB 1U2EA 2J8ZA 2BHRA 3VHRA 3SNHA 2H0AA 5BUSA 3ABIA 3PXEA 3BB3A 2WYRA 4UMEA 3KDPA 3MSXA 3WLHA 5HXAA 4IFTA 4WEOA 4CEJB 2AOVA 5GWXA 3MIIA 1XTZA 2Q1SA 2PZEA 3NATA 5ALPA 4BNYA 1O6GA 1IB0A 3EVZA 3HKCA 3VR3D 1JEOA 3CEPB 1W1UA 4US2R 4XUDA 1TIBA 1LS1A 4YRDA 4QKQA 1RXWA 3G8DA 1Y33E 1JSRA 5ALFA 4J76A 3GLKA 4BLRA 5HK8A 2IH2A 4X65B 2VN8A 3PK0A 3BJRA 4ND3A 3HU5A 4KRYA 4N65A 3K05A 4N9WA 1KMCA 2P27A 4DA0A 1QYWA 1TI7A 2B5WA 4BNWA 1RHRA 1XJWA 3OY7A 4XQFA 2Z5LA 1M1YA 2ON6A 1OY1A 2MR5A 4P81A 2RGNA 4PYKA 1LQ2A 1CFZA 3DWFA 3OQBA 3WMGA 3TGLA 3G0DA 1I2AA 1DC7A 2YY5A 3TLBA 4A0HA 2B7CA 2QF7A 3EUAA 2X5KO 3P5SA 2CLCX 4OJKA 3T7JA 2G5TA 3Q8KA 2O5CA 1Q15A 1UDCA 1IYZA 3EXEB 1GU7A 1BW9B 1QB8A 1WW8A 3OQJA 4N12A 4V0LA 4XIIA 1L4GA 2GAAA 4DA9A 5BVGB 3C7KA 1FNBA 1GCGA 2FFJA 3G5UA 4YEDA 1Q11A 1WOSA 2V5AA 2V4UA 2HNAA 4AJIA 1Z08A 4UNSA 4MRRA 3O2JA 5B1IA 4DC9A 3K0FA 4MDEA 2CZQA 1TD9A 4K6OA 3MUNA 3A4LA 4PR0A 4B0OA 1CUZA 2G40A 1GU1A 2JIPA 3T4XA 1ZISA 4Z5XA 1JHOA 1QYDA 2OQRA 1EJ2A 3CGWA 1VKRA 4LBZA 4M99A 3II6X 5ADHA 5BSYA 4NU5A 1NQ5A 1T3SA 2WUDA 3A9RA 3SJCA 1MC4A 2V6JA 3D54D 5EEHA 3GUHA 5DMXA 4HLQB 2HIHA 1CY8A 4DDHA 1UPCA 2I78A 2NZUG 2HI0A 2OP0A 2Y05A 3DW3X 4DRZA 5CFOA 2E87A 1NU6A 2NXNA 4ITUA 3JQ8B 1MH1A 4M9XA 5K0CA 2P40A 2QBYB 2VK4A 2RKBA 1U98A 4GZMA 1KXJA 2P2GA 1YC2A 3EIOA 1W94A 1HDXA 3U19A 3K35A 5JDIA 2RBEA 2LW7A 3I6MA 1OAKA 2Q8NA 5KZMB 5LXTA 1R8YA 1VC2A 4TT3A 1KBOA 2HT6A 3I58A 3F6CA 2WQ6A 3SKXA 4OQYA 3ORSA 5AK6A 4DLWA 2R2AA 2O23A 2A33A 2XMZA 3RWBA 3WGLA 4BQOA 2VUSA 1FB5A 1RQNA 1XYYA 2EATA 2RK4A 3DUWA 3FWPA 3P4YA 1RAHA 1Y1SA 3GW8A 5DOZA 1JIJA 3HNPA 1FPMA 1OA0A 2C8KA 2HSDA 4WCVA 4X9XA 4F5DA 1L5ZA 3QE9Y 1SVIA 2O3QA 5TMDA 1HRDA 4KEAA 2ZB3A 4L6IA 4ISCA 4N5NA 1WKVA 3TFOA 3B6ZA 4P32A 2JIMA 4Z1MD 4TQGA 3W9YA 5HZMA 2OUKA 5B2FA 3NANA 1AKVA 3OOEA 1GNSA 4C76A 3DVRX 3TM5A 3B6KA 3JQ7B 2WSSD 4E4TA 3HFRA 4IFBA 5IDXA 1THZA 1Y9DA 3I30X 4PCAA 2HJGA 2EIHA 3H2JA 1Z8NA 1L5MA 4JY7A 3SF8B 4BMNA 4FFBB 4XJVA 5A9SA 1I4EB 1P9RA 1N7IA 3SF0A 1PUJA 3QVGA 621PA 1PYOA 1AKMA 1GG5A 4GO1A 5CJJA 5AW1A 2J9GA 5GM2A 2PSHA 4RK5A 3EC2A 3A6FA 1KO7A 2VK8A 4R1PA 2VTBB 1RIIA 2FV8A 5TE9A 1X7DA 4G01B 3IURA 3Q3AA 4F6RB 3OKXA 1CUHA 2NLOA 5EG5A 4C78A 4C07A 3DDOA 3AK4A 4DZZA 1B73A 1WXEA 2F3RA 3EVEA 2IPXA 4KQKA 4ALJA 4EELA 5JNTA 1PE0A 1HQDA 2XBLA 2MU1A 1C3VA 3QNUA 3CV3A 1GUZA 5I7WA 1BGXT 5BNIA 2V6FA 1R2QA 1ORHA 4TQUS 2WIGA 2NV4A 3PEVA 4TLLB 2AN1A 3RC1A 3A6PC 4Z4VA 3N2GB 4EEKA 2OO7A 3NRCA 1SZPA 2OCIA 5AH0A 4RTJA 3M0EA 3OO1A 5I4KA 3X1WA 2VAPA 2CKMA 3PXDA 4DA4A 2CSXA 5IK2D 2AE1A 3KSRA 3WOVA 2X7XA 4OUDB 3TOVA 3VI3B 4QELA 4BZXA 1OA1A 1V37A 4Z4EA 1P7VA 5JXJA 3SC6A 4HSGA 1FSPA 4ZAVA 4QPJC 5AKLA 3TQQA 3PVDA 1TXGA 3H04A 4O0MA 1H6AA 3F6EX 1CLUA 1S4MA 3HRIA 3RS2A 4X64B 3ZE7A 2CD9A 2J6HA 4F3YA 2LBPA 4QTUB 1HLPA 4E51A 1KFCB 2GR9A 3S2GA 4BBPA 3MS2A 4BNVA 3MWJA 2C0QA 3LV8A 2HF8A 2KX7A 5JAUA 3WLSA 2B25A 4DCPA 3F90A 2IH5A 5HKOA 4JR1A 2XUIA 1W2WB 3AQIA 2AT1A 4DIOA 1DCKA 3AIIA 1WCIA 1JR6A 1TOAA 2AFHB 2OE2A 3OE1A 5CLGA 5FD8A 4OBXA 3PFFA 3GPIA 2PUAA 5FTWA 3ZDQA 4Z0NA 1WOMA 4CN8A 4CQNA 1VSBA 2NVUB 1P81A 3FDFA 5A7GA 1WABA 4CV0A 3CLSD 1KAQA 3CHYA 5CU7A 2OXRA 1Q7CA 2Q6VA 1RPZA 3HU1A 3BY1A 1SG6A 1MB4A 3OECA 1IB6A 1M10A 1QS0A 2P1RA 1FRZA 1WB6A 3WK8A 1RKXA 4JIGA 1R4MA 1YOVA 1OHHD 2FGKA 4RFSA 7AT1A 3DTVB 3BTVA 3HSYA 5EYPA 1FYVA 1JDVA 2FSVC 2ZJBA 5JECA 1Y1PA 4XUEA 4EFKA 4DB2A 5DYIA 2R97A 1DC6A 3KUDA 1TM1E 2AOUB 4KO3S 2TRSB 4LJ7A 1E1RD 2JGJA 3TWOA 2CLEB 4WESB 4YMTA 2P8JA 1F20A 4GPBA 1KO1A 1UD3A 3HU2A 1E3XA 4GSYA 4YJ3B 1PBNA 3H4TA 2A59A 4BLQA 2NZXA 1MGPA 4JR2A 3IT1A 4QOHA 2I6XA 1JDPA 1HUQA 1WMBA 5JWRA 3R9XB 2C2MA 4ABTA 3MPUA 3JQ8A 4IIJF 2RH5A 1NGSA 3HDTA 1ORWA 4LOJA 4NHOA 1H4QA 3GY0A 4FBMA 9ABPA 4CETA 3DZGA 1KYXA 3IOYA 2D4HA 1XWIA 1SAYA 2CCGA 4NNOA 2O3RA 4F56A 3RSGA 2CMGA 1RZRA 3QPVA 5IAJA 4YPOA 1EFKA 1QFZA 2P77A 4DMHA 1GGMA 3W06A 4G1UC 1TCAA 1R0YA 3N2IA 4IJWA 1N2XA 2XQKA 4N3AA 1N2CE 1XWFA 2BM8A 2QM7A 4JLWA 4BBZA 4UAGA 1PTKA 4UMVA 4AKIA 4HAZA 2OB1A 4L27A 1E5DA 1MQSA 2X8WA 4W7HA 1KR2A 4DLTA 1G6HA 1XLUA 2JH3A 3R5SA 3MTAA 1S3GA 5C7OO 5JDCA 3ASPA 4YMLA 1W76A 1QDLB 2WHXA 3L8FA 5DGHA 1XCPA 2C3UA 5I3CA 1II9A 2PZBA 3EG9A 4EYSA 2V31A 4A0QA 4WFJA 5CFMA 1VIVA 4BMXA 4YMVA 1BHJA 1SY7A 1WS6A 3P0IA 1OB5A 4WK4B 4QRIA 4UFPA 1H0KA 1SU4A 3A6JA 4TWRA 5FKJA 5BNTA 5TPZA 3N8HA 3SF8A 4H6VA 4MS3B 3CZPA 2A0UA 2QGNA 3KTFA 3SX2A 2O19A 1VHQA 1JFLA 1GPNA 4E5YA 2NU6A 4AUNA 1CVLA 4E1AA 3AETA 4QSMA 3X0DA 3G8YA 4OHWA 3VGPA 1P77A 5B7PA 2I1LA 1DBSA 4MEAA 2FX3A 3E18A 1P1KA 1Z06A 5H1YA 1J9GA 2BZ0A 2OV4A 2XWQA 3QYAA 3V1UA 1Z68A 1AQ6A 4Z4TA 4H60A 5C2JB 1GQSA 1C0KA 3HVKA 4XCVA 3ETJA 4XGRA 1T24A 2H4WA 5CUQA 3HWRA 3ZZNA 4J0IA 1H5QA 3AR8A 3AIKA 1YRYE 1YJBA 2XRYA 3A1TA 4H7JA 5AI9A 5A5GA 3ZD7A 1U2DC 4NJEA 1EUZA 5LSAA 4ROXA 2ZREA 5C7LO 2DIEA 1OX4A 2NV6A 3V4PB 3WIEA 3EIWA 4YMIA 1KZ4A 4JAVC 4QVKA 3TRKA 5E38A 1RXEA 5SYNA 3W8FA 3PJGA 4LBWA 4UZFA 1G8AA 4GQIA 1E1QD 2QN7A 3OH8A 3B6EA 4JBNA 1FIUA 4OGFA 1NQUA 1V4BA 1O5TA 1M83A 1A76A 1XZJA 2YINC 4LJ5A 4ZI2A 2QD3A 1PFVA 4EJSB 5K3OA 2JLZA 4L5AA 1CETA 1XXHB 2PQ2A 2QIPA 1WDWB 3NHPA 4TWAA 5EY5B 1DIRA 4E1BA 3CNEA 1JLSA 1Z28A 1ZJJA 2VA8A 1F2TA 1T0BA 4S1TA 3SOPA 4Z9YA 3WYBA 4I55A 4R3UC 2CZGA 2IYTA 4KI0A 4CM6A 2QJOA 5LDHA 3FX2A 3P9ZA 4O4JA 1BCRB 3U1VA 5IHXA 1GEEA 5AOAA 2O5VA 3V9AA 1E2PA 3VM6A 5M2QA 2FA9A 2HBYA 2H65A 1JFFB 5LFAA 4FCWA 4EHJA 2XQJA 1UP6A 3PD1A 3VKGA 4QXMA 1GYPA 1QMPA 1U0GA 3HMKA 3LPLA 3KQLA 1ISRA 3GRYA 2ZXEA 521PA 1XU7A 3DF7A 2I3ZA 3A3KA 4OHVA 3RRNA 3E9QA 3UJBA 3UOWA 4J7XA 3JQBC 3NV7A 5K0BA 2QGZA 4ZOLA 3I61A 1TYBE 2YZ2A 3QX9A 1N5OX 3TD6A 1RFLA 3LW8A 3KKKA 4IRMA 3RS4A 1G7SA 4AVZA 1SQ0A 1V47A 2XMGA 1U1EA 2EFHB 5I01A 5AW6A 4KPYA 1UFQA 4Q3OA 3L82B 4X84A 4DXDA 2GAOA 5JS1A 1NY6A 2BMJA 4JLAA 2B21A 3D59A 2GEJA 4JODA 4QASA 2FPIA 1X1DA 4HGYA 4WADA 1XROA 1AG9A 3R0JA 4BP9A 4P7KA 4AG6A 3GL9A 4X66B 1SKYE 2J41A 5DW0A 1F0YA 1OOEA 3QVSA 4O4HF 3FR8A 2K87A 1E1RA 1UBRS 3IVRA 3LNCA 3Q6MA 2IEBA 1LU9A 3QOWA 3F3MA 4EAAA 4PZUA 5KTKA 4YJKA 1UKCA 3Q6RA 1WZCA 2DR0A 3HB0A 4ZKDA 3Q1KA 2CLMB 3L8YA 5FTNA 4LDPA 4YWJA 4MWDA 5TPWA 3LFUA 1OHHA 2HRCA 3L6UA 3QBJA 4QHSA 3ZZ1A 3D7LA 2YH2A 4DV1B 4QWMA 1RJFA 3UXMA 4LSMA 4H7KA 1A98A 4RVGA 4CIBA 1PL6A 1PJ7A 2AJTA 1M1YE 4O33A 3CRNA 3IR7A 5ALZA 2C0CA 3ZD8A 1RRKA 2JW5A 3FTDA 4ZOAA 3ASSA 3GPLA 1JUDA 1XIVA 1EVJA 2SICE 1GKLA 3R20A 3LCUA 3ZCVA 3INNA 1N5IA 3ZI0A 4C7JA 4RTRA 1QQTA 5DP1A 3EXHC 1ISPA 4AMGA 4EY5A 1G20B 4G2NA 4Q3EA 1RQRA 3PL1A 4KH0A 4NMLA 4I50A 5IDWA 5IKEA 1JI3A 3WK5A 2QD4A 1POWA 1QYRA 2FEXA 2QT0A 2RHMA 4HVAA 1VECA 3DNFA 4X85A 3OBBA 5E0KB 3U48A 2A8YA 4J7CA 3IA7A 5K8LA 3QNWA 4PGFA 4BCCA 1RYMA 2BMVA 4Z49A 1Q20A 1OAAA 3NALA 4OFBA 2IUYA 3KQPA 3G9TA 4PPQA 3I62A 3NDPA 1N1GA 1P2UA 4E88A 2IDKA 4JT4A 4K5QA 2WKRA 4J1TC 3LTNC 4OU4A 1WUTA 3PA8A 4IW3B 2OLJA 3EUWA 3VPSA 3EWIA 2QRKA 1XTBA 3V5NA 1OBHA 2NP7A 3OOYA 1KARA 3TR0A 1W6UA 3T4UA 4E3WA 4FWIB 1WAMA 1LK7A 2W37A 3V7FA 2W5UA 1O8BA 1HDRA 1K5HA 4MWOA 3VV3A 4DQXA 2VP9A 4F96A 4NJEB 4X24A 5IT4A 5JHGB 2CHEA 1L0BA 3LF2A 3QEMA 1KD1D 3A8IA 4ZVKA 1Z16A 4B82A 1VYTA 4UZEA 4M8IA 3LX6A 1VLYA 4KXXA 1E7RA 2FW8A 3DBHB 3GNQA 1M34E 2XUFA 3CJQA 3AF3A 4LXTA 4QAJA 3SHOA 4ZOQI 5LKRA 5F77A 2X6XA 1DQNA 4JI2B 2RI1A 3NWEA 1JDBB 3UJCA 1FMFA 5F51A 1KZGB 2NXJA 1D8AA 4IJQA 4O29A 1TKRA 1ZW1A 3M6UA 1ZHFA 2F00A 1WPQA 2FFRA 3ONVA 2IHJA 2WJJA 3IQEA 4RPGA 5DLEA 4AX8A 2R6JA 1Z82A 1GP2A 1Z45A 3N0WA 3I4CA 4X3CA 3VZSA 4A15A 5PNTA 1C80A 3C3WA 1BXGA 2ZIWB 1TJNA 5C8ZA 2YIVX 1P1CA 1HZJA 3IE0A 1UT6A 3BJMA 3STWA 2YRWA 5LU8A 4OXRA 4YUYA 4A8JB 4PPNA 3K8YA 3LQEA 2XDWA 1HT2E 2P75A 4BMDA 1EQUA 1VB3A 2DPGA 2OTCA 2YASA 1N3YA 2H4HA 2OVBA 5DTMA 2GCOA 2XX3A 4FR2A 3P9SA 1B6SA 2CUKA 4F9GA 5J47A 3N5KA 4PEVA 4TMZA 3HUEA 3I9NA 1UD5A 4R8MA 3SDBA 4R0NA 7REQB 3S99A 2HQ1A 3EAFA 3C24A 3SIWA 1BVRA 3V4VB 4DEYA 4XLLA 1FDOA 1Z0FA 2VCHA 1DBRA 3JU3A 3L7LA 3RAPR 2OV2A 1XCOA 3ZNOA 1QNFA 2CCJA 1UPXA 1Y6JA 2BGWA 4M6WA 1U8EA 3GK3A 3A7EA 3HDYA 3OCUA 4Q48A 1JR4A 1NDQA 4ZJZA 4ZOLB 1GM5A 2COEA 2VATA 1G8YA 1LWNA 1FCJA 3E2IA 4URWR 3L1KA 1NQXA 2W71A 1CZNA 2BZSA 1NBAA 2P2CA 4KYUA 4A2CA 3HV0A 1Q81D 1W4ZA 4X6LA 4CMGA 4KZPA 1DE0A 2HHAA 1TAGA 2WG0A 4PC3A 1ORDA 3AVWA 2YBEA 3LUKA 4GUDA 2AD5A 2ACVA 1YDEA 2XYQA 1EBUA 1OSNA 2WT8A 3B9PA 3RUEA 1C0IA 2BBTA 4K87A 5C7YA 1S2DA 2W4IA 5J2UA 1NUPA 4O2BB 4YECA 4X7EA 5ISMA 4BO5A 3DQZA 2FF7A 3O8OB 2OD2A 3WRYA 3TW8B 3TZ6A 1A2QA 1M6WA 5JCZA 4EA6A 3N76A 3EW7A 4HQKA 3E9MA 3CCLB 3TRDA 3JD4A 1W9XA 5ADWA 4DTCA 1G21A 4C3OB 3IEXA 4FHFA 3PL5A 2CXSA 3ZHYA 5CH3A 1TM5E 3CEMA 2D2FA 2JIQA 1AHHA 4TV9F 1VL0A 4I81A 5JNUA 1XTPA 3GFTA 1B3RA 4BFTA 1RC0A 1XDWA 1F5SA 3O4VA 4WBNA 5AM1A 1EB9A 1G17A 3PUXA 4UMFA 4D4JA 3UMSA 3T8YA 1IXKA 4PO3X 4LJSA 1RQXA 3C8ZA 3E20A 1H66A 2FSGA 2R6DA 4WCFA 1QO7A 1JFSA 4PF1A 1WSDA 3LOUA 4J94A 2N9UA 3RK4A 3OHMA 2XUGA 2ZIAA 2I4IA 3L8ZA 1XQBA 2RHCA 1PJZA 6ABPA 4HXYA 4B2IA 5FTJA 4X0CA 4P3IA 3PPYA 2VDNB 3A27A 3PWKA 3BBLA 4IQ4A 1WLYA 5CM9C 4NATA 5DHUA 3DDNA 1HR0B 2VTEA 3WV4A 1P9WA 5KTSA 4HB2A 4A91A 3OEYA 1GUFA 5AKKA 3IPAA 3JPWA 1DJNA 2CUZA 2FMUA 1QX4A 4UHJA 3WV5A 4Z9FA 4MSUA 2E4UA 4FYVA 5DYGA 4JITA 4S2EA 2HF9A 2XOXA 1P31A 1GA1A 2WM9B 2AD1A 4FNMA 5CFQA 1OZFA 3VX4A 3BMXA 1QC5A 5AFSA 1L3IA 3GLVA 1Y42X 2WLSA 4IDBA 4CIAA 3K1AB 1PLLA 4YRCA 1Q0UA 3NYRA 1WZ2A 1XRSB 3HJBA 5HZHA 2LXNA 2C4MA 5I5EA 1I7NA 3DCJA 2VWQA 2PUJA 2C95A 1ZK0A 2NZWA 3TINA 2YTZA 3BFVA 1JBQA 1US8A 2CFRA 3GF4A 2WP8J 5GONB 4JC4A 4CKCB 3IH5A 4KPUB 3AHCA 4HAVA 5CA0F 2G8LA 2YQ4A 4V0MA 5EIXA 1Q3KA 1RLIA 2YWHA 1WE2A 1OREA 2C2BA 3PWZA 1B3BA 1GAQA 5E6RB 3HFJA 4NSNA 4OLJA 1ZOPA 3WOHA 1ZQ1A 3BTOA 2A5YB 1VKNA 3KOUA 3PDHA 1CZUA 2I80A 3HYLA 2I2BA 1G8JA 1ZJZA 2DP4E 2R1ZA 2WNHA 1Z6QA 3Q88A 1U9IA 1M2EA 1W5BA 3KPVA 4UBIA 3FJOA 3V8PA 4LV6A 4CCYB 3K96A 1FNNA 1T91A 4PG8A 1ACJA 1USGA 3T3IA 3TLCA 1W36B 2YWCA 4UVEA 2H1SA 1KYVA 1GT91 1L1EA 1A9XB 5E6UA 1YUMA 1C1DA 2RAPA 2D3TA 2LDBA 2E0IA 2P3OA 2NTNA 2OSBA 3B52X 4OMDA 4BLTA 2XT9A 2OBRA 1VL2A 3UK0A 1BFDA 1LDNA 4OHKA 2QG6A 4J43A 1V6AA 3B1FA 4GECA 1DO2A 2A57A 2Q1WA 4KAFA 4L4ZA 3RI3A 4BDTA 4G65A 5FA5A 3RIMA 3GO4A 2P9HA 1H6BA 3R77A 3BAZA 3B9QA 2OZPA 5E2IA 3NIGB 1OBOA 2ID8A 4XM2A 5E7MA 4HGRA 1CJSA 2G7ZA 1O9GA 2CHUA 3LBAA 4H17A 1UXKA 3OF3A 2VO1A 3BFPA 2W2KB 5HWSA 4OYRA 4YIKA 4M89A 5FULA 1WPRA 1A96A 1KORA 2RGEA 2WKPA 5LCXA 3ZTWA 1E9EA 5BYKA 4QARA 3ASTA 5KWJA 4WH0A 2VSOA 3ZUGA 5EIEA 1UMKA 2NO4A 1CNEA 2AUTA 2RGGA 2YWBA 4X20A 1QFXA 3FTEA 3OP1A 1Q2UA 1IVYA 4HX2A 3VYSB 1ZU5A 3PJRA 4EVQA 1BMFD 1DAPA 1I3MA 1K63A 1J00A 1K9VF 1XFDA 4HDMB 4UE2A 4UU7A 2P6UA 4PNPA 3FPCA 4G85A 2IU6A 2Q3LA 3PGLA 3IHWA 4DK1A 3RB8A 1K8RA 2ZL5A 4IV8A 4P38A 5SICE 4S04A 3OTOB 2VDWB 1RWPA 4LHWA 3R7DA 2VUIB 1GNPA 2Z3VA 5IRCD 4GX2A 1JEYA 2IU0A 4G89A 3KJIA 3H16A 1P4SA 2ZXIA 3NHRA 3VKVA 1NI4A 3C6KA 3QMMA 5JVDB 3RYTC 1YZNA 4AB1A 4EKNB 1MVLA 2I99A 4LHXA 3FPKA 3N75A 4Q00A 5TJ9A 5KTYA 2WAYA 4L8VA 4YLEA 1CTQA 3N8KA 3HO6A 3HJRA 4B8WA 1Y6RA 2Y0CA 1ZDMA 2YVQA 4KB5A 1ECLA 1B0PA 5HFNA 3WL7A 4XVRA 4TYYA 2JJ1D 4PPGA 5C4MA 3ZV7A 1TT7A 2Y1LA 5DM60 1GZ3A 1FNMA 5GIOE 5IAOA 3DVAB 3TQTA 4WZBB 2FZWA 4Q7JB 3JYNA 2PL5A 4HGQA 5C8VA 2ZJ2A 3H1BA 1E2DA 2O8CA 3KVNA 4AY5A 2YZNA 4FI3F 2BL4A 3LC2O 2YJTD 2VYVA 1R6AA 2EZTA 4QGFA 3O4GA 3H5VA 5FLEX 4TMFA 3V80A 5CT5A 2OOSA 5LMZA 3SFVA 2P35A 3H5RA 1F8GA 1P2TA 2FMTA 4P4NA 3K5WA 5F9MA 3C5CA 2V4DA 3IIIA 2QZPA 3WLPA 3ZVKA 3IDZA 4GP9A 3RIXA 4L4RA 1M1NB 3OQNA 4E0FA 3OLXA 4RYLA 1H94A 2GJAA 1WSAA 2FPPB 1U9JA 1W1IA 4B81A 2H11A 5EKUA 3U3OA 3STUA 4GZLA 4CCAA 1Z4KA 3T7IA 3ZPNA 1P6UA 5DLDA 2C4HA 1RZ3A 2DE0X 2I87A 3M89A 2HA6A 3L6OO 5JZMA 1HLFA 1QDUA 2ZCUA 1FVHA 2Y6UA 4FN4A 4YJHB 3AF6A 1EVYA 1XAHA 2OHOA 5DJ5A 3C3XA 2D3NA 1AKEA 2VCEA 3W2EA 1K3FA 4J16C 5GQSA 5IX8A 1S89A 5EESA 2IGTA 2OQIA 4IL5A 4YUWA 3FRIA 5B3JA 1H6DA 1NR7A 2W8BA 5LR6A 3PB3A 1M2VA 2QI9C 1XCMA 1M8FA 2O2JA 3PR3A 3C6XA 3FRHA 4TX1A 4K6HA 1JQEA 1XP8A 3CC2B 3RU9A 2JLVA 3OZ7A 1BSVA 2R8YA 4XYGA 2YOGA 1LVHA 4JS0A 4QBFA 1PHPA 2GD6A 3NW9A 4J0KA 2AZTA 1CE8A 3R41A 4XOTA 4OYYA 3WWCA 3ROMA 2PUVA 1AIPA 5B37A 3RT1A 4E5NA 1EFDN 1EX9A 4EFDA 4G0YA 5A02A 3AG5A 4M0EA 4J4TA 3SICE 4DLSA 3J7AC 1P2FA 1DEAA 3DULA 3A4VA 4BPBA 1FUEA 1DTWA 2YVAA 1EHYA 3PXUA 3W7AA 1L7OA 2JH8A 1WY7A 3LDAA 1QIEA 1UODA 2OMEA 3F7TA 1V0JA 3FUTA 1KMHA 9LDTA 3EF1A 1UXOA 4NCNA 1NVTA 3JQEA 3RARA 1HOTA 2Q4RA 1E2NA 1JU3A 2WD9A 3OKAA 5DTJA 4F72A 1MD9A 1WF6A 5MDHA 1Q7TA 4RDLA 4NZNA 4BMVA 2O3SA 5DBEX 5BUZA 3GAAA 4Q7MB 5AKYA 3CD6B 1ZESA 2V1UA 2WSMA 5M29A 5J63A 4WBSA 3DZIA 4W5HA 4EL5A 1U3GA 2BHSA 2GFIA 2VDOB 1K97A 2PN1A 2AC4A 1QONA 1PS0A 2YC2C 4RHFA 3T0IA 1BWRA 4TLMB 1ZM4A 1H1LA 4YT2A 1ULTA 5K6AC 1OMOA 1VDZA 3QK7A 4QDUA 2VDVE 5K5EA 1WTAA 4BNLA 5IM5A 2VAXA 5GADl 3VNAA 1LJ8A 3VNBA 2PL3A 4JI6B 2ZR9A 3T4EA 3ZGVA 2YNMC 1UXGA 2JI4A 3BEOA 1VPEA 4JUAA 3FCCA 4YUVA 3QI7A 3U4HA 5IJZA 1MRZA 5K4HA 2FR0A 4KRXA 1UDXA 1HE3A 2QNRA 4V0SA 3VDRA 1H5UA 2PU5A 4UHBA 4C08A 3D6MA 1BRTA 3FJYA 3HXLA 1DBIA 3DP7A 1L6IA 5T6BA 4AJ4A 3JV7A 3MK31 2HMVA 2VNAA 4E0BA 4PS0A 1TUBA 1UZUA 2PLRA 4UQLA 2EGUA 1USUA 2P5YA 3FKSA 2Q4DA 2ATEA 2JFBA 1CC1S 4OKIA 4B3DA 1TUIA 5IUJC 2GH1A 4HGOA 4L74A 1PNTA 2IGBA 5EWJA 4JC0A 1JMKC 1ZIYA 2RMKA 3L93A 2IPNA 2XXJA 3JATA 5IC6A 3ONUA 1FFSA 3EDMA 3HWWA 4FB5A 3BRWA 4WXYB 3DFIA 4PSKA 4Q4HA 5F64A 5IAAA 4GBED 1SK8A 4KWCA 5EMLA 3U3ZA 3W6ZA 2PIAA 1IOLA 1MPTA 5M34A 1H2WA 1YB6A 3L7JA 4G5HA 4LYFA 4TXMA 1G7CA 4PLPA 1H4VB 2NTYC 4JVLA 2JCBA 4AY3A 4RDXA 1VYVA 4EG6A 4BP1A 3PNSA 4ZOLF 1NXTA 2YX1A 2ZJAA 1NUQA 3LH5A 2BD0A 2IK8A 4AP6A 2HCBA 1DRVA 1EVLA 2FTKE 1LPSA 4KE8A 3C41J 4ZALA 1FP4A 4P7FA 2F9LA 5KTOA 3R8FA 4G8DA 4TV9B 1X92A 4YRRA 3T61A 1N6IA 3DVAA 3N2KA 3FM9A 4AU1A 3U61B 1C1XA 3DB1A 4B2PA 4JL6A 2EHJA 1VYHA 1Q7RA 1NI3A 2WK1A 1S96A 2B8NA 5IBQA 4CKWA 1E18A 4XRRA 2K2WA 2PGXA 3ZZ0A 3E81A 2AZDA 3O5AA 2IV2X 3UXEA 2PSDA 3LCVB 2JI9A 4MMYB 5LWHA 3KJEA 2J0QA 4X7CA 2QT9A 2QEQA 2P3LA 4RLZA 2CDCA 4J1TA 1KI2A 2FMIA 5EWLA 1BVHA 4DJJA 5L9AA 3LLVA 3ZWXA 3KYIB 4L8FA 1BYUA 2C84A 4I1UA 4NBWA 3E9NA 4MHOA 1QUEA 2DG2A 4UASA 1G3IA 1QSGA 2BFWA 4JJ7A 1NWHA 2OMKA 2Q0XA 3IAM6 3ZI4A 1IG3A 5JCPA 2J7PA 3U2QA 1B93A 5EZQA 4JQSA 5JXGA 2PX0A 1ODTC 1K8XB 2CY0A 4Y2XA 3OIVA 3C0KA 4BNDB 3MEQA 3B60A 4PYOA 5CB8A 4ZCTA 2GQFA 3RRMA 1AGXA 1MB0A 2H2GA 1BZYA 4IF4A 2WIFA 3N2NA 3COSA 2PHZA 1ZJ4A 2DTEA 3R6GA 4YJFB 3EZNA 3HBNA 1PJAA 1O95D 2ZXHA 3LLSA 1T8PA 3D8TA 4OK5A 3WWPA 3N74A 3E22A 2P6NA 1P1BA 4NBNA 3KJFA 4DOMA 5IKXA 3CNQS 2EKPA 1X1AA 4P83A 4GPTA 1A9PA 3VNUA 5IMSA 1SKQA 3ORHA 2XXAA 2C20A 5D5HA 5HXBA 1Z3IX 2DPYA 2J0UA 2GZHA 1N8RD 5D6OA 3AM1A 1C9NA 2IHUA 5AUPB 4JYAB 1T5LA 1Z5GA 4FE7A 4CIDA 1YI2B 3ER9A 1JVBA 3ZKWA 4B79A 5GOZA 5TNXA 4F93B 1I2DA 2AEFA 2YYYA 1UDAA 1FJ2A 2R48A 1R27A 3QE4A 4O8CA 4D9KA 2HSGA 1QCCA 3E70C 1ODIA 3KWLA 3PHIA 5C53B 1B23P 1RWMA 2I7CA 2IYFA 3TLXA 1L5HA 3RYIA 5J5VA 1PFGA 4TKUA 1FX0A 4RWZA 3L3BA 1XZBA 3H7IA 3ABSB 2P7IA 2FE1A 1ZVQA 3M2TA 4M49A 3VH4A 1N6RA 3MTIA 3QV1A 2A1UB 3BHMA 4RQUA 1UDWA 3NNNA 1XDUA 1UBNA 4PSCA 1XCLA 1JAYA 4GMFA 4UVGA 1U7WA 3OOSA 2XQGA 1NG1A 2P9GA 2Q2OA 4GG1A 2I4LA 5L4LA 2I67A 3DBVO 1GPDG 3U0BA 1U4SA 1U2TA 1R0ZA 3IUSA 3FNHA 2DQYA 1NXOA 3KR2A 4Q1AA 4BCBA 3W2FA 4JYMA 3VO9A 2HLDD 4LJ4A 2D54A 3DLAA 1NVDA 5LMCA 1T8SA 3I56B 5JJCA 1PJTA 2VEOA 1NE7A 3R75A 3UJ3X 3ZLTA 1PT9A 4A2QA 3U26A 1EBBA 1J23A 4RMGA 4UD6A 4OQXA 4DIUA 1ZX1A 2OYRA 5IVHA 4NENA 5G53C 4TRMA 5CT4A 4I5FA 3WIBA 4B6RA 2DR2A 3SZUA 3GZNB 3TXAA 2ZB7A 3MJEA 2EKZA 4IINA 5GJVC 1A95A 1DUIA 2A92A 3JYHA 4MQLA 1OC2A 2O0MA 1N8SA 1XF1A 3GFBA 1U8CB 3OZCA 3DO8A 4HPWA 1V45E 3C15C 3U7QB 2WHQA 4QJIA 5DHRA 3E3LA 3JQFA 3L0ZA 1QPGA 5H5JA 1QP4A 3A4NA 1I1OA 2R1TA 4ND4A 5F1PA 4IRXA 2NQ8A 1AKWA 5K05A 4P3NA 1DT3A 2GHTA 1JLRA 3W5VA 3BS4A 4MV0A 3MCAA 3OAAA 1KZYC 2NM0A 3PLNA 4X8HA 2CXOA 1NUSA 3QM1A 3GUUA 3WK7A 4HH4A 4C30A 3WYGA 3ZWOA 2HTFA 3WAGA 2PH7A 1EGQA 2VKQA 3SD7A 2YMQA 1M0TA 5KDDA 4EEXA 2JEZA 3BG5A 1ZVMA 1M2OA 1TJ4A 1XA3A 3IUBA 5J2UF 2NW6A 1V8FA 3EIXA 3M70A 2IEIA 3N59A 4JJ8A 4B6OA 3IXLA 3I1YA 2ZDHA 1QYIA 2HMUA 2GAJA 4O2LA 3WQQA 3ZNNA 4DM7A 4Q1VA 4Y9SA 3VU9B 1IQPA 1RJGA 1YZLA 3HK2A 2EZ8A 2OKGA 3L79A 2ATVA 4FFRA 3EJWA 4FFSA 4X1KB 4EF4A 1DJLA 3GJ5A 1BHSA 1NBHA 4NI5A 5T7BA 1IJBA 4ND6A 1JSZA 1JJIA 1G38A 3NVAA 4AM8A 1J2UA 3PIIA 4X05A 4JLPA 2GGSA 2NYRA 4ZHSA 3OPXA 2XCTB 4PAGA 4KITB 4LDNA 5GOTA 3GRFA 3SX4A 1E2QA 1N2JA 2E1RA 1P5ZB 5ALVA 3P4UA 1PV4A 3TX2A 2YXEA 5HKBA 2YL2A 2GF2A 2PFKA 3V7UA 1GTMA 2ZIEA 2BGKA 2ZIXB 4FCVA 3O1LA 4YWHA 3NDBB 1G5FA 4GM0A 4DHEA 1VIAA 2GSWA 2H59A 2PMWB 5IJ0A 5DSZA 4ALLA 5ICFA 1OB0A 1B1AA 2B34A 3MF4A 4W9NA 5JOQA 3KWJA 1JJAA 5JYBA 1K7FB 5JATA 1KU6A 3LXXA 3SQMA 1SO8A 3PNKA 3PQEA 2RGXA 4ZJYA 1W49A 3CVXA 3TOZA 2DPLA 1R6DA 1KC8D 3QXGA 3LCRA 5FUBA 4UZSA 5B6IA 3RU7A 4C4YA 5JWHA 5E6TA 4P2GA 3SHQA 3UK2A 3GJSA 721PA 3JZAA 3MD0A 2OM2A 2R00C 3VV2A 3BAFA 2XXAB 4M9CA 4KYTA 2JKYA 2J0UB 3R8CA 1NBME 4RENA 4W1QA 2ZRPA 4I5DA 3G59A 3RE1A 1L1RA 3L7IA 4QIHA 4OFXA 5CDHA 2AMLA 5EJMA 3TCNA 4EJSC 3OWHA 4TTTS 1YZFA 1T5BA 5HPYB 5I7VA 1JJBA 1EFAA 3O74A 4TTPA 5BN1A 3GT4A 1OTHA 3NPMA 1A9ZA 3T9BA 1LVUA 3O03A 2VH5R 3MOSA 2Q45A 2UZ1B 4L9WA 2J67A 5T5QA 3UMYA 1NRIA 1EVEA 2IEYA 3SK0A 1QGED 1EZZA 2J3JA 1O3YA 2VPTA 2V65A 3K0KA 4OP1A 4WW0A 5F21A 4D3ZA 4R5MA 1UDRA 5LIPA 2WSYB 2IYWA 2AHOA 5LVAA 2XGOA 3O8CA 1WP6A 2ZUCA 4IIGA 3HI4A 5AO9A 1GYRA 3JRWA 3T15A 3ZHXA 3DXYA 5LZ7A 3ZS9A 4P98A 2O3JA 3F5DA 2AJDA 1RXYA 4HGNA 1JG4A 1E3WA 1PJ3A 3NVDA 4R16A 1G60A 4BL5A 2XRZA 1QP0A 2UKDA 4PAWA 1T0PA 4QECA 2ZL6A 2XMSA 1X9GA 1J5XA 3GN1A 3IDQA 2J30A 1KEZA 3OHSX 1Y34E 4WLOA 3UT6A 5ALHA 2PJDA 1Q84A 3MXTA 3MS7A 2GVNA 4PQGA 3UZUA 4EY7A 1MO2A 2V7PA 2QLJA 4PNEA 2IPOA 5E9JA 4FEYA 5GJBA 4DF3A 3CCCA 4OIMA 4TM7A 2MR6A 5FB3A 1BMFA 4II7A 4E14A 3FB4A 5J4LA 2CFTA 3QBTA 4DAEA 3LY8A 1ZN2A 3IERA 5L4NA 5I9MA 3IAM1 3T9CA 1RABA 4GOKA 5MN4A 3LUHA 5EZ6B 5KYUA 4OHFA 5IYZB 3ISVA 2B8TA 4JP2A 2JJMA 4V3BA 3ABRB 4M9SA 3L7AA 1XMVA 1LUAA 1SUSA 4XFJA 4BQQA 1E0SA 3LKBA 4UEJA 1B6RA 4FMCB 4L3WA 2ORWA 4O3FA 1XD8A 1PZXA 3LS2A 5DGXA 4WQMA 2AEEA 3GLFB 1UEJA 1JHYA 2UYYA 4RKEA 1JQ5A 3FD8A 4V1CI 1EEXB 1P29A 3CB2A 3I5XA 2I9KA 3VTFA 1KSJA 3D31A 4OFZA 3RVLA 4JP3A 3GLQA 3JAWA 4W6QA 2YOHA 1H2FA 5B1YA 1DAOA 3IFSA 2XWJI 5B4VA 2Z98A 3KCNA 5H59A 4L8YA 3SDSA 4HWOA 1A5AB 5CLFA 3NR2A 1ZMTA 1FFAA 4Q4JB 4DMLA 1L8QA 1CQPA 3NEPX 2PUBA 4XKVA 5FBLB 3EVDA 4HH0A 4EGFA 2C03A 2V0NA 1PG5A 2AXEA 2X9NA 2I0FA 1CRZA 2LUOA 4ND8A 3PQ6A 1CUWA 1AZSC 4DLBA 2ESRA 4HV4A 1SC9A 2F4VB 4O0LA 1YCGA 1I18A 1JR3E 1LV8A 5BNZA 3EY9A 5K09A 1LDMA 1K08A 4JVMA 2ZROA 2FPKA 4NU6A 3WLOA 3ZE2B 1BMQA 3WNCA 3V4LA 4DJFC 1ZN7A 2P5TB 5GINE 4R4JA 2CFIA 3IEPA 1ECFA 3ZY6A 4BO3A 1B14A 1AV7A 3HKEB 3S2SA 3GWGA 1GZ7A 4IHKA 1JF8A 2Q9BA 3DT9A 3IAEA 2RGYA 4G5YA 2Q1TA 4PGMA 4RELA 1KIFA 3FETA 5I5GA 2QUAA 4HK4A 8OHMA 1USVA 3B5JA 1DPGA 3KTDA 4WESA 4LBYA 1L5VA 3A05A 4AJ1A 4D42A 2ZQ5A 1WO8A 4CDNA 2XNHA 3KLBA 4URYR 3K5IA 2FZ4A 5ULLA 4EA9A 4YQFA 1NRKA 4MR7A 2WICA 1FSZA 4H7FA 1B76A 1F38A 1X3LA 3JYOA 4NJMA 2VF8A 3FVQA 1QG6A 2W6JD 5CYGA 3GJ8A 3U5ZB 1F14A 4I1SA 3PFBA 2HLPA 3EH2A 2G1PA 2O7RA 3DEFA 1XPJA 4EPWA 1HYGA 5DHTA 1ULAA 1M2JA 4FGWA 4B75A 5I48A 5G0WA 2BEWB 2JEOA 4KXVA 2HHJA 1QMGA 4YDHB 2GETA 4MV8A 1IN7A 2OXEA 3DCYA 3OOWA 4Z4QA 1ZJWA 1Y9JA 2I2WA 1GYQA 3A25A 3IRUA 4RJ2A 4TXHA 1RM0A 3E61A 3QPUA 3QUBA 4CCWA 4G0VA 3UT5B 2BMEA 2YCBA 4K26A 4OHOA 1OFVA 3U6BA 1YR9A 3ZJ5A 3I28A 4QC2A 4DQ0A 4JH0A 4E31A 1YS9A 3VZQA 5KHOC 3JD0A 3CKKA 3FTCA 4LY3A 3W90A 3O4HA 3OUTA 1WMSA 3S2IA 3PKIA 2L69A 1MHPA 1SU6A 3LVQE 3KE8A 5HQJA 4D4LA 3BFXA 2B1IA 3SLDA 3EG9B 2D1RA 1SXJE 3K30A 1FA9A 2YWXA 3BCFA 4WWHA 4S1WA 4QXRA 2UUBB 1EFVA 2AW3A 5SZIA 4BN0A 1TJ3A 4AJ2A 3ZCTA 5JZ9A 1HRKA 4Z4FA 2GILA 1T2UA 5FPHA 5L3RA 1CF2O 1Y37A 3P9CA 4R6XA 4MS1A 1WXFA 3V