The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
247
|
structure length |
247
|
Chain Sequence |
b'GKGVSVQASTLGSLEALLDFLKDCKIPVANVGIGPVYKRDVMQCGIMLEKAPDYAVMLCFDVKVDKEAQQYADENGIKIFTADIIYHLFDQFTKHMQEQLEKKKEESKMLAVFPCVLNPVAVFNKTNPIVVGVDVVDGQLKLNTPIAAVKMNPTTGQKEIISLGRVTGIERDHKPLQVCKKGQPAVAIKIEMGGHQPAYGRHLDEKDVLYSHISRASIDVLKQFYRDVVTTDEWQLIIKLKSVFDVQ'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
eIF5B employs a novel domain release mechanism to catalyze ribosomal subunit joining.
pubmed doi rcsb |
molecule keywords |
Eukaryotic translation initiation factor 5B-like protein, eI
|
source organism |
Chaetomium thermophilum var. thermophilum
|
molecule tags |
Translation
|
total genus |
68
|
structure length |
247
|
sequence length |
247
|
ec nomenclature |
ec
3.6.5.3: Protein-synthesizing GTPase. |
pdb deposition date | 2013-10-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain |
A | PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 |
A | PF11987 | IF-2 | Translation-initiation factor 2 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Translation factors | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Translation initiation factor IF- 2, domain 3 |