4N3GA

Crystal structure of eukaryotic translation initiation factor eif5b (870-1116) from chaetomium thermophilum, domains iii and iv
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GKGVSVQASTLGSLEALLDFLKDCKIPVANVGIGPVYKRDVMQCGIMLEKAPDYAVMLCFDVKVDKEAQQYADENGIKIFTADIIYHLFDQFTKHMQEQLEKKKEESKMLAVFPCVLNPVAVFNKTNPIVVGVDVVDGQLKLNTPIAAVKMNPTTGQKEIISLGRVTGIERDHKPLQVCKKGQPAVAIKIEMGGHQPAYGRHLDEKDVLYSHISRASIDVLKQFYRDVVTTDEWQLIIKLKSVFDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title eIF5B employs a novel domain release mechanism to catalyze ribosomal subunit joining.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5B-like protein, eI
total genus 68
structure length 247
sequence length 247
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4n3gA02
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 4n3gA01
2GQFA 3ZZUA 1GAQA 1A8PA 1N0UA 2BPOA 1OGIA 2HMAA 1EXMA 1JJ2B 1K8AD 4MYTA 2BN4A 1Q81D 1F20A 4TMTA 5EMNA 5JBQA 1KK0A 2RC5A 4HE5A 1I7PA 1EWYA 1QG0A 1JNYA 1AMOA 3QFRA 1YITB 4PC2A 4Y9UA 4N3GA 3FPKA 1VQ6B 3WYAA 3WY9A 1VQNB 1FRQA 3CC7B 3OJWA 1GAWA 1KJZA 3B8HA 1H85A 3LVBA 2DEUA 1KD1D 4LBVA 3QFSA 4B48A 3QSYA 2QTZA 3I56B 4HE6A 1VQKB 3JQQA 1IJEA 1E64A 1N0VC 1CQXA 1QX4A 3ZC3A 4YAUA 1QUFA 1EP3B 5GV7A 1YJNB 3P26A 2RC6A 2DERA 3MHPA 1VQPB 1FDRA 4RD2A 2C78A 4Y7CA 5DSZA 4ZCMA 4B43A 4FN5A 3WXMA 1QGAA 2NPFA 4UAJA 1FNMA 1S72B 4ZGNB 2B7BA 2BM1A 3AVUA 4LBWA 4H9GA 2OK7A 2ZITA 3CCUB 3W2IA 3CCRB 4FWTA 2FX3A 1NDHA 3I1FA 4N3NA 4NCNA 3E20A 1D2EA 5TR9A 3ZBUA 3AVWA 2EIXA 1W87A 4C43A 1KC8D 5GV8A 1EFTA 2PLFA 2DCUA 5AN9A 1D8TA 3VO1A 2HDNB 3ZBTA 1YJ9B 2VZLA 2VNKA 3WBJA 1ZM9A 3W2GA 1HA3A 2XNJA 3SJZA 5HXBA 1BJKA 1VQOB 4M4SA 4RCYA 1FNCA 1ZUNB 4YAFA 1Q86D 5FA6A 4TMWA 2VYQA 4EH1A 1GR1A 3VMFA 1S0UA 1OB2A 2BMWA 3ZZ0A 2BSAA 1QFJA 1B2RA 1OGJA 1VQ8B 4R71A 1VQ7B 2VNJA 3CPWB 2XEXA 3CMAB 1TVCA 4DQLA 1GJRA 3U2QA 3CCMB 1QGZA 5THXA 3W2FA 4B44A 2QDXA 3CD6B 3CCLB 1QFZA 4RD3A 2QEXB 1BQEA 1ZM4A 4RCZA 1KQSB 4B3XA 2X3UA 1UMKA 4P3YA 2OTLB 1KK3A 2EFGA 3AVTA 3B78A 5TY0A 2YWGA 3P27A 1ELOA 1GVHA 4RD0A 3AVYA 3AVVA 1JA0A 1QVFB 2BGIA 4MYUA 1W2BB 1VQLB 4RD1A 1WDTA 4ZCIA 1DG1G 1CNFA 1VQ4B 3PENA 2BV3A 2QTLA 1FRNA 2VNHA 4M1KA 1H42A 1R5OA 3E1YE 4G5GA 3W2HA 1YJWB 1XE1A 2C77A 3QE2A 1K73D 3CCSB 1Z9BA 1VQ9B 4DQKA 1IB0A 4PC1A 3CRZA 4AF7A 1IJFA 2CNDA 4K1XA 4P6VF 3OJXA 4PGOA 1EFCA 1EP1B 5TV2A 3AVXA 2GPJA 4WQMA 1W34A 2D74A 2BVNA 2PMDA 3W5VA 2OTJB 1QH0A 1ZM3A 1E63A 1SM4A 1E62A 2QA4B 3CB4A 3CC4B 1AIPA 2J7KA 3WNBA 2R6HA 1D1NA 4QHYA 4TN1A 1QGYA 3W5HA 3CMEB 4ACAA 2BF4A 4NBSA 3CC2B 4Y9RA 4RJLA 1EFUA 1N8RD 3W2EA 1G7CA 1BX1A 3ES9A 4AC9A 1K9MD 1NJID 3WNCA 2XNCA 2BM0A 1G7RA 3JQRA 1KK2A 4U9UA 4F7DA 4PC7A 4AF6A 2YWFA 1OB5A 1DDGA 3OZWA 2VNIA 3FJOA 3MCAA 4M2LA 4YHBA 2B5OA 1YI2B 1M90D 2QMUA 2OK8A 3VO2A 1TTTA 4IW3B 4Q7JB 1W35A 1CNEA 3AGPA 3U6BA 3MMPA 1B23P 3OZUA 2YWEA 4RD6A 2BGJA 2YWHA 3CCEB 4YALA 1TUIA 1KK1A 3OZVA 3WNDA 3V76A 1F60A 3QFTA 2AHOA 3G6EB 3QFCA 3G71B 4M53A 2B7CA 4LBYA 1DDIA 4BPRA 3VNVA 5H59A 4KJZA 1Q7YD 1QFYA 3AGQA 4PC6A 4ZCLA 3CCVB 3ZZTA 4ZV4A 4QFMA 1R5NA 3I55B 1G7SA 3JQPA 4B4DA 1JA1A 2HCJB 1U2RA 3OW2B 4TMXA 1EP2B 3CW2A 1TLLA 3CCJB 2PIAA 3J81k 3WBKA 1YIJB 1YHQB 1FNDA 4TMZA 1Q82D 2CRVA 3VNUA 1KTVA 4G1BA 1BX0A 5H5JA 3CXCB 1ZM2A 4G1VA 4RD4A 1XB2A 4ZGQB 3G4SB 4M0LA 4LC0A 3CCQB 1VQMB 1SKQA 4YAOA 4YAWA 4J0QA 3U6KA 4ACBA 1GO2A 1QVGB 1J9ZA 4PC3A 4B47A 1M1KD 1FNBA 2DY1A 4TMVA 2DETA 1QUEA 1G7TA 2E1RA 5KSWB 1DARA 2QN6A 1R5BA 1VQ5B 3LO8A 4LBZA 4FK8A 4C0SA 1KRHA 3B82A 3W5UA 1JB9A
chains in the Genus database with same CATH superfamily
2XUZA 1S8OA 5JECA 4KQ2A 4U2KA 2EU8A 2QJFA 2ZTUA 4EGJA 3O38A 7AT1A 4KC0A 4TV9F 2XE7A 2JAXA 3O90A 3KL2A 4JLSA 2V1XA 5KCMA 3ZWCA 1TXGA 2X9NA 2JIZD 1ZMXA 1OA1A 1ZJ4A 1W5TA 2HWKA 1IXRC 2VDWA 1AN0A 3H05A 4P2NA 3HP7A 2PQ0A 3O3MB 4E2XA 3DEJA 4N4AA 1JJ2B 5HM6A 4QULA 1WDMA 1A4RA 1KNXA 2A9OA 4HPXB 4DBVO 1NNLA 2PEYA 3ENVA 5E7MA 1PEAA 2HO4A 2IHBA 3VH4A 4HGRA 4MWEA 4BNDA 4DZRA 4DA4A 4PCVA 2E4AA 4JBWA 3TTSA 3G2LA 1V43A 3QF4B 3RIGA 4DGQA 3ODGA 3VJLA 3MGAA 2ERCA 1KVSA 1CZLA 2IU6A 1SBZA 3VZRA 2F3UA 3LQ6A 1EX1A 1I5RA 1ULSA 1E6WA 1XXLA 2C57A 3K32A 3KT0A 3QYFA 4I1RA 1Z7GA 1A9XB 4KQJA 5DE3A 4ZO9A 4Z4HA 2ZXEA 3PNBA 4KYIB 4W5RA 2I22A 1JPUA 3KU4A 1YZNA 2QV0A 5DGHA 1WPCA 2X0JA 5ARDA 2FF7A 5AVXA 1EUYA 1TGYA 4GD3Q 3KBBA 3OCVA 2JKZA 4W7HA 1YZTA 3EUFA 1A8HA 2POCA 4B2IA 1EWKA 1BMDA 1HPLA 1N7GA 2YZNA 1DLIA 2GHTA 4XSHA 4UM8B 1E2IA 2DT5A 1R4ZA 1TVEA 2G70A 1Q44A 3A10A 4FXPA 4X24A 1JG4A 1WUIS 3DAGA 3LBHA 4KWIA 4TTSA 4Y6QA 4XE5A 1VPDA 3D3EA 2G07A 1MXHA 1M67A 1FXWF 1E5LA 5EUCA 4DA8A 4ZQEA 4POOA 3MCVA 2ZAMA 3ZZNA 5J1SB 2P0AA 1GL3A 1ZCBA 4GX0A 5G3ZA 1W4BA 1GNLA 5FNVA 5F2NA 1NYRA 1JR3A 1ZH8A 3CS3A 1YBMA 3TSZA 1DWPA 3WIUA 4D4HA 2FEXA 1QXSA 1P1HA 3PEYA 4YRAA 3HVRA 4RF5A 3WGLA 1II8A 5IAJA 2QBYA 1A2KC 1R74A 1UM8A 4HDMA 3ZGLA 1NMYA 4QM7A 4MA5A 3LK6A 4M7PA 5LZ2A 4YUYA 4DPLA 1W88B 4R69A 5JG7A 3E0XA 2WWYA 2PS0A 4PZPA 2DCMA 2OZEA 4DNFA 3PC8A 1XZAA 4ZCMA 2PZAA 1YR8A 1P0CA 1VE3A 3MOGA 3OWOA 1JE1A 4MUNA 4QYWA 4QYSA 2IYOA 5F4JA 3NH9A 4AT1A 4RKFA 4URVR 1IIRA 5L3SA 2NU7B 2DBQA 3QE0A 2R8PA 2V8OA 5EOVA 5KOHB 3V00A 4L22A 1LQUA 2G5GX 4LHEA 4HLCA 4L7QA 1HLFA 4AO8A 4BQOA 1E1QD 3GGSA 3DFMA 1O57A 3O2SB 4P53A 1RBZA 2PGDA 1TYCA 1KEEB 4XM1A 1FMFA 3PHHA 1X7YB 3ZI7A 2CL0X 3CCRB 1UUFA 2Y0PA 3G68A 4GPAA 1QHHA 1ZD1A 3Q7QA 4R1LA 3ZQUA 3ICEA 1YA4A 4UQOA 1NLUA 2BBTA 2FP4B 2HKIA 4GM4A 5DOZA 2QAJA 5A4AA 3ULKA 2VOJA 5TR9A 1SU7A 1TE2A 2FUG1 2GO7A 4HI0E 4EZBA 1W87A 2G8NA 3W1WA 1X3SA 3G2KA 5DHFA 3T1OA 4ILKA 1BDJA 1POWA 3EGWA 1SK8A 3JRNA 3BXGA 4BV2A 4EEZA 5GV8A 3OCYA 3VAAA 3GMTA 2VDUE 1IY8A 3ZDEA 4LWPA 1JKMA 1ZJYA 3EZ7A 4L0QA 4HNTA 4OHYA 2CNWA 5HP4A 1UFVA 1GQ2A 1NVBA 1E9VA 1U5AA 2WYWA 4OP2A 1A2BA 2FVYA 4BB0A 5BNTA 1LBEA 5IAEA 1FUUA 1SHLA 2HK8A 2I3GA 3COYA 2XITA 3GV0A 3QG1A 3QTTA 3QU4A 4YMLA 4G7XA 2K2WA 2OOSA 1DXQA 3CO5A 3FHJA 3UJ9A 3KUCA 2IP2A 1V1MA 4WD3A 4CIXA 1BOFA 1DOZA 1FF9A 1F6WA 4JMQA 1HRKA 1SCJA 1Z6GA 2V45A 3KKLA 1PV1A 4PTLA 1PUJA 2ICAA 3PFKA 2II6A 3R5TA 1RAGA 3RRXA 4F4HA 3F0TA 3FJ1A 4N5DA 4QICA 2OBSA 2CLEB 2J9YB 2ZUVA 1FNSA 1RAFA 3IEKA 4EVSA 4AQDA 2YWXA 1R0RE 1QO9A 1HT3A 4V2UA 4CKEB 1W7AA 3B6ZA 4TV9A 3VVMA 1XZBA 2N1MA 2GKGA 3ZCXA 4BAGA 3CH6A 3K05A 2DKOA 3MPUA 3DEHA 3AV0B 1TOAA 4EX6A 2QNIA 1JG3A 3E23A 4E5NA 2HUPA 3JQFA 3AU8A 3DWIA 4XX0B 3CPWB 3NV7A 3DLCA 3OECA 5AUNB 1CUDA 2R7NA 3T56B 3ITNA 4JJIA 2C7PA 3U2QA 4CGZA 3RVQA 1NLYA 3JAWB 2X5NA 4GQBA 2IVFA 2VF8A 3P2YA 3A9TA 1TCCA 3Q8XB 5H7XA 1U1GA 3L7NA 3GMDA 3RK1A 2WWTA 4NR0A 1V4NA 5ED0A 5SZJA 3VZDA 2GHRA 1CJSA 3QKIA 4NESA 1RJWA 1MVLA 3CW9A 3UK1A 1NVEA 1U8AA 3M4ZA 1KOFA 3QF4A 3PA6A 4WTOA 5LXTF 821PA 4RD3A 1YWGO 3GZJA 4IIFA 1PD0A 2I2WA 4LRSB 1U7UA 2H2GA 4NZNA 5GONF 5FFMA 3TQTA 3GB9A 2IZOA 5BYJA 2WLSA 2FE1A 4ZAZA 5IABA 3ZV5A 4UQPA 4XUDA 4AN4A 1IM2A 1JU9A 2I1QA 3BDIA 3FXAA 3GEHA 5IYNA 4KITB 5IPFA 2H48A 1MRSA 4Q3CA 3OQ6A 3G6WA 3ZWQA 4F3YA 4KFUA 2GZAA 4LUCA 4US2R 3HCRA 5D86A 2H52A 2M6SA 3FFAA 4OHBA 3GFGA 3IVGA 3GQBB 3UC5A 3RAEC 3WB9A 4PFSA 3WYFA 4RJJA 1Q1EA 4NX2A 1EFRD 1GVHA 5KI6A 2E1PA 2EBWA 2QD5A 3K94A 1M2OB 1O96A 2WJAA 3ZDYB 5IANA 3D7KA 5B7GA 1VE1A 1N5DA 2IYAA 1R6TA 2IUEA 1MB2A 4V0SA 1TEVA 2J0VA 1D7AA 2QSUA 3F8TA 2YHUA 1DFHA 1ESEA 3QX3A 1PG2A 4YS6A 1D04A 4JR2A 4UCFA 4EATA 3EBPA 4CV3A 4WK6A 3GLQA 5LUAA 3TZQA 4MXDA 1DG1G 1JHDA 3T95A 2O5VA 3R5HA 3G1UA 5J5AA 1Y1TA 4XCXA 4CN9A 1OR8A 4QGFA 4REMA 3ZWYA 3T1QA 2ZAGA 4JLKA 1ICEA 3AP3A 3SEFA 4MYDA 5DULA 3I37X 3CURA 2IEBA 1FTWA 4YACA 3T3NA 4ZA2A 3HA3A 4YJDA 4AUEA 1SO8A 5ICFA 4FR0A 3RUPA 4K9OA 5LCXA 3EFOB 3T3EA 4ROXA 4Q6WA 4MR9A 1WW3A 3LHDA 5E2IA 2BKVA 1H0KA 3L4SO 4O2AA 3TW6A 3FMOB 5EKXA 2BRUC 1K1EA 1GZ7A 1NUQA 1EFKA 1O6CA 2EL7A 4HP8A 4HRAA 4R8LA 4RBNA 2JLQA 3B7GA 4Z4FA 1EE2A 4PC1A 2HBYA 1N1MA 5EL0A 1AHNA 3Q3EA 4GEKA 3ZE1B 4D6PA 3FCEA 4LJ7A 2UZ1A 3FM9A 5HS6A 5BPFA 4PZ0A 2C2GA 4NL4H 4JVNA 2UV8A 4AY4A 1XJWA 5CFOA 2WZQA 4ZYZA 3DR5A 4GPD1 1NV8A 1UBGA 1Y5NA 3GG2A 3HADA 4KWTA 2O0MA 1AKNA 2OBYA 4BB5A 5CP8A 4H3KB 3LDGA 3MZ0A 3SP1A 3P0JA 3PLAE 2VLIA 3W5IA 1E0KA 3KV1A 3Q0EA 4B87A 2IOQA 4UTXA 4LWOA 1NBIA 1A97A 5DXJA 2XD4A 2QD2A 4ZVSA 3BSYA 3M70A 3CGWA 5HKAA 5C52B 2O7SA 4JBIA 2GASA 3C70A 1VPTA 2HMVA 4I5IA 3SVZA 4G3XA 2BJVA 2RHGB 4L95C 1DEKA 1I8TA 4X84A 1UP4A 2COUA 3ESZA 3FB4A 1ACJA 4LHYA 4OFZA 5SY9A 1H2ZA 4TVSA 1V95A 2PKQO 5DZSA 5KOYA 2REXB 2SBTA 2IIQA 2P7HA 4BVFA 3ESCA 2AHRA 3CB4A 5TJHA 2TMDA 5A4JA 2GK7A 5C8YB 5FBRB 3WWDA 2FZVA 1VLVA 3DD5A 1NVMB 1KRXA 2GXSA 3PIIA 3WNBA 1NATA 3G9XA 2WSSD 3PKZA 3ZXUB 4DCCA 3LE8A 3KNZA 4E31A 4V1CI 3KKKA 5E4TA 4PN7A 1TX4B 5TVKA 1YZGA 2I9PA 3UOGA 2O6LA 4NFYA 5A0TA 5C1BA 1EG2A 4YP5A 2WSIA 2WFLA 1DO2A 2WWGA 2HR1A 2A0YA 4X1KA 4DXDA 1JXQA 2NUBA 2XCLA 4OXQA 5BQFA 3RKSA 1N1DA 3GH1A 2WFMA 3IR5A 1G3UA 4GU5A 3G5LA 5ALHA 5EA2A 2WJ6A 4BFTA 4D8UA 5I9NA 4KDCA 4AMYA 1JHUA 1SIOA 3L0PA 1UOPA 4G5OA 4MA0A 4GLBA 2EQBA 1ZXBA 4Q0MA 3DA8A 1EH5A 1U2SA 1AZSC 3BK2A 3MUNA 4B9EA 2BISA 4H31A 5BMOA 2EW2A 1ISIA 3P1JA 3AFIA 1O0BA 2NO5A 4TYYA 2NTNA 2JAWA 3U1TA 2OBMA 3TXAA 4MV3A 5J3JA 3IKTA 3EEOA 4ISBA 2QUIA 4FE4A 2A1IA 1HNZB 3B7PA 2IY8A 3L5KA 4YV0A 3OZWA 4DAEA 4XR6A 1A3CA 1VHQA 3F7TA 5AVYA 4BNXA 1O08A 3C3KA 2HK6A 1AT1A 4BKMA 1IBKB 2QHXA 3D59A 4M98A 4CMEA 4TTJA 3DG9A 3M6AA 3ML1A 2JGEA 2YQZA 2UUBB 3EULA 3QPWA 1FQOA 3AFGA 4CZ2A 1XCOA 3L07A 1CWUA 3IUQA 3G05A 4D82A 4QRHA 3RT7A 5BWOA 2ZRMA 4D74A 4IW3B 2P3LA 3B5EA 5LP6B 1AKMA 2LP4Y 3SOZA 4UW9A 1AUOA 2I2XB 4BMVA 1MB9A 4C3OB 4W63A 4YONB 5LD2C 1OSNA 3O4RA 5EKSA 4PO9A 2RKWA 4RD6A 1PL6A 3T7RA 3VU8A 1WPGA 4ALKA 5AW0A 1N77A 1SZJG 2BMDA 3FD8A 2C04A 3KT3A 1WMEA 2WJ4A 4E1AA 1EDDA 1GN8A 1OFIA 2PV0A 4JLMA 5NULA 4K6OA 3V48A 4DNQA 2G9UA 3KSDO 3R7WB 4EFKA 4F71A 3PPXA 3ADBA 4DS3A 1LDYA 3DKPA 4X7EA 5CCXA 4GNRA 1X19A 3C6ZA 1CPYA 3NTLA 4TTTS 5JRJA 1OZ0A 4ZYWA 1O03A 2RK4A 2C1EA 4GEGA 1GILA 2DPYA 2V58A 3KLOA 5CA0A 3ZV4A 4Y6OA 4CIYA 1A96A 3O3CA 3JZFA 1KJJA 1I3CA 3BE5A 4FN4A 4QC2A 3UB3A 5C37A 2EP5A 4TX1A 5EQJB 1Z0ZA 3MGCA 4O4HA 3JAWA 1NYQA 3EY9A 2ZWMA 1TGVA 3BGWA 1UQTA 3HA7A 3NVDA 4JJZA 3W5JA 2H0AA 1GNQA 3E8XA 4TKVA 2RHWA 2XDYA 2E85A 5LLDA 2XNSA 1U3FA 3PXDA 4JUBA 2GNOA 5JQWA 1NF3A 1IHXA 2IRWA 3ZJ5A 1UXGA 2B0CA 4QO7A 2OZLB 4WZAE 2V3WA 5BO5A 3T7TA 1VPWA 5DEIA 4FGKA 3I55B 4FKBA 4Y6PA 2H1CA 4JP1A 5DBOA 4D3YA 3AZOA 4L6AA 4OJNA 2CMHA 1K5PA 2F3QA 4B2LA 5C8XA 1FMLA 4MYRA 3FNEA 4EABA 1LDEA 2O06A 4YCCA 2YVKA 1OREA 2ZYRA 3E82A 3PCRB 1U2DA 1FVHA 2ZIZA 5HGJA 2JFQA 4MS1B 1CQZA 3GEGA 5FI5A 2HM7A 4J91A 3CUKA 4N6OA 2G0NA 2BWJA 2Z30A 4JEHA 2A86A 5BSTA 2G1UA 3FCAA 1EDBA 3HYCA 3WYDA 8AT1A 2JDIA 3V7YA 4FB4A 1VKZA 2NW6A 4MDEA 4BRSA 3DOEA 4CG1A 4YWHA 4EJ0A 4TVKA 4PRYA 5U1PA 5IDQA 1T4CB 4XJXA 2CLOB 3JQ9C 4E3WA 3U4DA 1E20A 4EB8A 2FG7C 2QR2A 3GQVA 1FDOA 1BQ3A 2TRSB 3I5AA 3VOBA 3EVNA 1OFGA 1VJ5A 4OI2A 2Y9MB 3UTCA 2OGWA 2GJ8A 3ILYA 1FE8A 2KBEA 3R5FA 4G07A 1F12A 1Q57A 1Z2PX 3BXXA 3D9QX 3IURA 1FS6A 1HDXA 4FFWA 4UFOA 4AJNA 2JBAB 4NCXA 5HPYB 4L73A 2OV4A 5JJIA 1FNBA 4XOPA 2JKYA 4O29A 1MNQA 2MR6A 3VBEA 2IPLA 4GPIB 5C7YA 1H0RA 1Z26A 3KZMA 2H08A 4WADA 4I8DA 2FRVA 2BEJA 1YMQA 2O6HA 4I55F 2ZZFA 5D01A 2V7UA 1VJ1A 2WUGA 4YJ3B 3T3GA 1BFUA 4NV3A 1IVNA 1U8XX 1UFQA 2WDZA 3MK31 3REGA 1E2DA 1CQPA 3U7GA 2FW0A 1R5BA 4OIMA 3JQ9A 4EHHA 2ZRLA 3LCJA 5ILGA 2WJVA 5AI5A 1XMJA 3WTCA 4B32A 4YBRA 1GOTA 3A6LA 1ZC3A 2DWPA 4J0GA 3DL2A 4BKOA 2XQKA 4CTJA 2XXAB 3KQMA 4YH1A 5CFMA 3D54D 4Y2TA 4JLUA 1YZLA 3IAM1 5ESDA 3RCBA 3SS7X 2A88A 2G1AA 3F1LA 3OZAA 5HBRA 4UDOA 1CU1A 4M89A 3SEJA 4AZSA 4K6KA 5L4LA 4BNHA 4E4TA 4GQIA 2X9QA 2J3KA 5AW6A 1W73A 4YJGA 3I58A 3JX9A 2F67A 4KLCA 1LTHR 1Y0YA 4L3VA 1C0IA 3WOVA 5CDFA 5F2KA 4FYHA 3ZJTA 3U9TA 1P2GA 4ZJPA 1PJCA 3MD9A 1ZXLA 1J8MF 3QENA 3SFTA 2BPOA 1NXWA 1U5BA 1Z25A 3WQBA 1DC3A 4LOHA 1EXMA 2H4YA 4ZAXA 3EZLA 1OJLA 3D26A 1YZQA 2W00A 4ZO7A 2BN4A 2ZUCA 2F48A 4MQEA 5BSRA 3GRKA 3TQQA 4YDRA 1J00A 3V1YA 2G9NA 4BVAA 2VK2A 2RC5A 3EY4A 3P2EA 1VJSA 2OYRA 1U6KA 4UVDA 5I7HA 4RHTA 4DDVA 1P1BA 1OPXA 2H18A 2LDBA 1MO4A 2P68A 5CXSA 2OSVA 3LYHA 4L07A 7REQB 5ALEA 1JFVA 1WNFA 2OFWA 3IDAA 3NDRA 3TRDA 2Q2NA 3ZE6A 1MZVA 2F4VB 1XI2A 4TWBA 1JEYB 4EJMA 3S2YA 1D0IA 1C8KA 5IKPA 2PRKA 2WG2A 3PQ7A 1KO5A 5AJWA 2LGJA 2ATIA 3FPFA 2NPOA 2FSGA 3GIDA 5KWEA 4LF9B 1FFGA 3WS7A 4ERNA 1MJFA 1IONA 3HPQA 5G0TA 1ARZA 1V3TA 5A8AA 1K7SN 4GP7A 4NOKA 4WZZA 3KQYA 3W3AH 2J07A 3GGPA 4LV6A 3E22B 4Y1RA 4ON9A 2A92A 3H9CA 4CQMA 2VWPA 1O94A 4XGNA 4DG9A 5LJLA 1XLVA 2JIPA 4IUDS 4Y6LA 2WM8A 3HRIA 5DM60 8ADHA 4HAVA 1OFHA 4Z8XA 3L0DA 1FW8A 4DDTA 1D1QA 5DSTA 2QTZA 2D1QA 3SVTA 4EUHA 1UDBA 3JQQA 2FZLA 2QX9A 3QHPA 1JSCA 1MF7A 3CUSA 2DX7A 2ZM6B 1QX4A 1SIUA 4TTVA 3NONA 2XA9A 3U3MA 5CDUA 1M1YB 1Q11A 3L6BA 1T8PA 3HB0A 4GMXA 4HD8A 3PFGA 1TEHA 2OBTA 4DLVA 2GEBA 4AJIA 3DZDA 2RGGA 2XKBA 3BMQA 3HU2A 1VQPB 1GCIA 4MVCA 1JFSA 2J9XB 4IR7A 4ZJYA 5MN5A 4WOJA 2DFDA 3BK7A 3KQOA 5E7JA 4Y7CA 2HQOA 4ZHQA 1QZXA 2HMUA 2W5UA 1XTJA 1ZMRA 1A72A 2I62A 3GJXC 1ZJWA 4WNAA 3DHYA 1HX7A 1T2EA 3I9NA 5FBVB 4IIEA 3ABIA 4ARVA 3QEBZ 1KYXA 2GSDA 2XTMA 4UAJA 5E1DA 5C32A 2ZUWA 5A06A 1E6KA 2G6BA 1XHFA 2NZWA 1J22A 1AM4D 1K7CA 3LBFA 1K66A 1MIOA 1R4AA 5BQPA 4I2VA 4ARZA 3ZCQA 4EAQA 2DWQA 4YJFB 1UD2A 4CTOA 4Q48A 5KWVA 2JH3A 3IPXA 4OVKA 1HORA 1U81A 5DHPA 3WLOA 3R5JA 3WK7A 5B37A 3A3NA 4N3NA 2HO5A 4NCNA 2P27A 3NI2A 3JWEA 1QHGA 2XMPA 2P2NA 3L1UA 2NU9B 5L4NA 3OEEA 3AVWA 3SQXA 1J9EA 1FRZA 5M2QA 4GXQA 2XWPA 4LRUA 2R6DA 3NAGA 1W0JA 2RDMA 2IP1A 4G81A 1HQCA 4QRDA 1UEJA 4JB0A 3SY8A 1LJUA 4G09A 1YRBA 3GEEA 2V6JA 2OHOA 4CNBA 1C1XA 5FNVF 4LCJA 4O08A 1UPCA 2A5GA 2H6EA 1KARA 2K7ZA 3CNOA 1QB8A 2CNWD 2DP4E 3A1DA 3H4MA 2EXXA 1CT9A 1V11B 1QP0A 1LDMA 1IZYA 1GPLA 1FXWA 3Q11A 2V6IA 2XWBF 3CYFA 5AI0A 5DCUA 1R6AA 3TRKA 1PUXA 2ORED 3DUWA 1UFOA 4LGCA 5HUJA 2QY6A 1MJNA 2FCRA 3RYIA 5ES3A 1TUEA 2DPMA 2ZVDA 1R9NA 3IVRA 3RS0A 4D4GA 3E2PA 5DWVA 4MKXA 4CKCA 4X1IA 4IEIA 3PQ6A 3KUUA 1Z0DA 3D0RA 3NOXA 5K0GA 4RZSA 3DH0A 1M83A 2HPVA 3FNHA 3R76A 4ECEA 1U1CA 1XCPA 3KO8A 3KWMA 2C94A 4M87A 4QUIA 5CPFA 4LHXA 3VC7A 2PFKA 2CNLA 2MYUA 2UZ1B 5LOVF 1C7IA 4JX8A 1JIUA 3BWMA 3DXZA 3VKVA 2GRAA 4YRZA 1WUHS 1UAAA 2IW3A 4A6PA 3D7LA 1T1EA 4QODA 5JTTA 3SXPA 2XCRB 3CPSA 3LUDA 1XN4A 4NLLA 4OAQA 1R15A 4TUYA 4UD2A 5DBEX 1ZX1A 4PXYA 3ZLTA 1V26A 2AI2A 1PGOA 4NAHA 4DLXA 4QXQA 3RWOA 2OO5C 1T3HA 2VJQA 4CL0A 1JAHA 5BN3B 2B1GA 4ZI7F 1SXJA 3ZCVA 2O57A 3MRXA 2HJWA 3KKOA 5JSKA 4DQ0A 1DCMA 4JB3A 1VSTA 3UAYA 3LUFA 1KI2A 3ZW8A 1TZCA 3E2IA 1G59A 4ND3A 1CS4C 2LKCA 2ZJ0A 3N86A 3OT1A 3OT1B 4D5EA 7ABPA 2RHTA 2FZGA 3D3JA 1Z0FA 4HGOA 2QU8A 3CD6B 4Z4VA 2Q3EA 2J3QA 1KO8A 3PXBA 5G1PA 1R16A 4IIJA 3H83A 4YRPA 3K5HA 2PFGA 2P1RA 2Y71A 2EX1A 3G9QA 3KOUA 3MINA 3RRYA 4UNQA 4BE4A 4UZSA 2W6MA 4RY8A 1OFUA 4LG1A 1NRJB 3R5SA 5FUVA 2X3UA 5P8WA 2PN1A 1HE4A 3DAHA 5AOAA 3QX8A 3E05A 1XKTA 3G5AA 3EA4A 3R09A 1U4SA 3AWIA 4GOXA 1PR3A 2V7QD 2Z5VA 3KAQA 1IUPA 1ZK2A 4DR7B 5HUQA 3I9OA 2DYKA 5DTIA 2DHRA 4EYQA 4UTZA 1LPBB 5DNYB 4OSPA 5AFSA 5FXMA 4DYDA 4URZR 4DYVA 1M2JA 3ANLA 1JNXX 3KKPA 3LFUA 2IS4A 3M6FA 4CM1A 1PQWA 4LOAA 2AEJA 2Y99A 4QTXA 1ESNA 3PVDA 4X6UA 2JFGA 4AZ0A 4RENA 4C2AA 2GXAA 4XLLA 1KYVA 1XA4A 4NBUA 5AO9A 2ZS9A 4LFCB 3H84A 2G4CA 4DLPA 1MCZA 1RLJA 1PGNA 1UPAA 1R0WA 1MG5A 4GWKA 3NYIA 5KYKA 2AC2A 4N01A 1QZ3A 5LLTA 1AXEA 1HFKA 4CBVA 3THWB 1FFYA 2WM9B 3P9QA 4LPKA 2QM7A 4P83A 1O87A 5M3BA 5A0VA 1MJ5A 3JW8A 3O7WA 5LSAA 3K09C 4BXOB 1UC5B 2NU8B 1IQPA 2MSWA 3EOZA 5EJFA 2JRLA 3QUBA 2BV3A 4G1MB 4NJMB 3TNLA 4DPKA 5JVDF 1PFGA 5K9ZA 4XIJA 1QRRA 4TMYA 4B80A 3DBLA 3KRTA 2FW8A 3E1YE 1OH7A 3AL0C 2O5EA 1XQ6A 1Y7TA 3ETJA 4Q9KA 1U2GC 2D5IA 2OR3A 1B15A 4FILA 4L27A 3STTA 1JDVA 3V1MA 2FCAA 3QLUA 1BN7A 3E4CA 3MTAA 3OZDA 3P9ZA 3ROPA 1RWXA 2J31A 3SJBA 1N3BA 4B6PA 4EECA 2W8BB 3EVEA 4I9UA 4QJ4A 1EM6A 1KYYA 4MGZR 3HC7A 3S70A 2OO5A 4DT1A 1I8DA 4A2CA 2ZZMA 4HRYA 3AJDA 2PT5A 2ZRNA 1ORTA 3WNVA 3ZOZA 3U60B 1E3ZA 1Q3KA 4DV6B 3CH7A 4D0LB 2YIDA 1JDZA 5GZ6A 1DJPA 1PW7A 3EPHA 1XRSB 5TEVA 2BDEA 2NTEA 1PFQA 1EFCA 1ISMA 4B6GA 1VBMA 1JA9A 4AP9A 2WIKA 2ZRAA 5JD3A 1AQLA 2W43A 3ZU5A 2PUDA 1K6EA 4Z86A 2Q7XA 5EP3A 2AN4A 1YACA 4NMLA 4B8YA 3AIKA 2O2IA 5LFAA 2ZE8A 1S89A 4WOBA 4R2JA 3F2VA 2C31A 3BGIA 4U7WA 3DFZA 4BMPB 3SX4A 3AJ8A 5ICGA 5AIAA 2C2OA 3KG2A 3NXKA 4OPOA 2DQYA 2JJ1A 4KO4S 5CYGA 1NVAA 2OAGA 3DB1A 1ZQ1A 2QAGA 3GAFA 3TOXA 1ZSVA 2H2IA 1L7PA 1Q7TA 4ND8B 4QGHA 5KSYA 5DPMA 1DUSA 3O75A 4JK3A 4M76B 3L8GA 3NANA 2DHDA 4DR6B 4URFA 3QLVC 4HIZA 3DM5A 3GEPA 3QIAA 4FUQA 4AO7A 2O1WA 2ZIFA 4V0RA 2ODWA 1K4MA 3DFIA 4OHVA 4B46A 4ENUA 2DKNA 3PGLA 3RIHA 2X22A 4KBGA 4L4YA 1K6XA 1Y7HA 3IELA 3SICE 4DXHA 2AT1A 3IV9A 1PWZA 4F6RB 1SBNE 1VHWA 5LBUA 4ZAGA 3CMEB 3ESAA 4U5XA 4BLRA 4ROTA 3C3DA 1N8NA 5CCBA 1GPBA 3PX7A 4BE9A 3A28A 3KE8A 2UYGA 4GO1A 4Z9BA 3QBEA 4JQOA 3HDGA 2JGNA 4M54A 4BRWA 1OH5A 2IEYA 2SKEA 4F72A 4JVOA 1NVUQ 2IXDA 5CGQB 1SEPA 1ZEMA 2FPLA 2REOA 2XJ9A 4F85A 2PXXA 1HSOA 1MG0A 2QMZA 1E4YA 1XVIA 1VIAA 2YOGA 2C3OA 1DQYA 1CR6A 5U9CA 5FBQB 3BZWA 1BKDR 1WL8A 3BRWD 4D6XA 5BSFA 3EWNA 221PA 4B6EA 3WV4A 2QZ9A 2ZREA 3MCAA 1IPEA 5JSQA 2YUIA 3QY9A 1T3LA 4DWJA 2HNAA 2E0IA 4RM2A 4XGIA 4P7BA 4YR9A 2VSNA 5HM8A 4B3RB 4B17A 5JADA 4A82A 3B5JA 3GW8A 4IIHA 1ZDMA 2PUHA 2VHTA 4KXXA 1B2LA 1VYVA 3LQ4A 4HZGA 9LDTA 2QP4A 2E4YA 3ZV7A 4W5QA 4H1HA 4F9EA 4XJSA 1QQ5A 2PUVA 5JJLA 4DIFA 4GYYA 1U9CA 1JLHA 3TOSA 4MZDA 4DK1A 4DM4A 1Q7CA 4O4HF 2XKKA 4P0QB 4G4SO 5JH7A 2FPIA 2P9BA 3MUOA 4BEWA 4HNAA 3TG2A 4MW4A 1XTPA 1HLGA 3FYDA 3ZUPA 3EPRA 1YS4A 3G0IA 4N5HX 3RRNA 4YALA 2Z9BA 4BGUA 2HYIC 3HFGA 2IODA 3SFZA 3IP7A 3WLJA 3LYLA 4JP2A 3TCKA 1KJQA 2VF5X 1JT9A 1J2JA 2BZ0A 4G6ZA 5DW3A 1QRUA 2CBGA 3L9XA 3FWHA 2V7PA 3MJHA 4FYYA 5DISB 2DXIA 1YS6A 4Q4DA 4L4SA 1C0LA 1XWIA 4IWYA 1R9JA 2NZJA 2OMEA 3FHCB 5I8ZA 2X4IA 1P61B 1DZIA 2DQZA 4JJGA 1QVWA 4QATA 5JQGA 4KGXA 5HIJA 4G01B 4KX3A 4DJ5X 4YR7A 2PE3A 4ZQHA 1QFYA 3AGQA 1EQAA 1CQIA 1X1QA 1Y3AA 1YS9A 4OHUA 1YJQA 5AI6A 1TRKA 2X2OA 3CZMA 3HBNA 3RYIB 5L9AA 1TUBB 1ZLXA 2XV1A 3GRYA 4YXWD 2XAUA 3BJMA 2R6JA 2VPPA 3HNOA 5IH7A 2PFSA 3G7SA 3Q1KA 1XRLA 2XB9A 1ZZGA 3JQPA 4N18A 1EJ0A 1G16A 3UFXA 3S2ZA 1NT2A 1JA1A 2IOFA 3MRTA 2P78A 3H5AA 4U00A 2GRJA 3RUHA 3NUGA 4FFPA 1TF7A 4KRYA 1PK9A 5AI8A 2QGFA 1QHSA 1WXGA 3I28A 1TLLA 1NTOA 4B4KA 5KDDA 1WO8A 1ZI6A 4GX1A 4XLZA 3GBPA 3NUZA 5AW3A 2V03A 3QBVA 2NZ2A 4PG6A 1YIJB 4LGYA 1QRAA 2FXVA 2Z09A 3ELDA 4Z49A 3HNPA 3BYZA 2VTDA 3LBYA 3PXCX 3BC9A 3HNRA 5EMKA 4DC9A 3HGTA 3ITKA 2KWIA 4G4GA 4NFSA 4L72A 1CDZA 2QTMA 4CI9A 4EO4A 1RJFA 2HA2A 1HWYA 3SC2A 4GHWA 3CXCB 2HFKA 4CMJA 2NTYC 3KLPX 4Y0NA 2I1LA 3MJ4A 5DTMA 4UU7A 1PZEA 1PI3A 4LISA 3SBEA 1CF9A 2Y3IA 4CDGA 1KVRA 3AR8A 5G41A 1EP9A 1N2CE 1O95A 1Y81A 4XD2A 1WXFA 4KGVA 3GZNA 4ENPA 1BH2A 1V9CA 1GO2A 3NV9A 1ECLA 1P7PA 2GA9A 4H77A 3RBVA 3ZV6A 3AINA 3T41A 3TUZC 4PIMA 4Q7KA 4RZHA 1CY7A 2NVUA 3TQFA 2A84A 5YASA 2DRIA 3OZIA 2OGSA 4DMUB 1BVYF 4OL0A 1IOZA 4FT4A 5F33A 2P9FA 5ICSA 1G4HA 1L7EA 4BNJA 1L7VC 1SCKA 2YW9A 1WDWB 2A59A 4PLHA 3ZQ4A 2GF0A 2X0KA 3Q10A 4ZOAA 4S1WA 4CHTA 5JALA 4C22A 4TXHA 4XPZA 3V1UA 3QJYA 3WRYC 2RK3A 1GPMA 2C7GA 2HCTA 2MMGA 2B8NA 4UHCA 4KQIA 3WGJA 2C5BA 1Z36A 1SVWA 1EX7A 2QB5A 3LC7O 3KALA 3P52A 2RAVA 3RNOA 4GI2A 1U98A 3OCUA 4FDAA 1CUCA 2R87A 3EXAA 4JEIA 2B82A 4L2IA 5BW6B 4BUJA 4D9HA 1N9KA 3IIMA 1QS0B 2RGEA 4ZEVA 1G98A 2AG0A 4RGYA 4MWTA 4NTZA 1IL0A 3VR0A 4PZEA 3REFA 1DFGA 1KL7A 4KIWA 1K0FA 1MO3A 1N2GA 2JIRA 1QHEA 1R4NB 2OV6A 2ZIEA 1ZS9A 4D3DA 1NPTO 1CS0A 1T0IA 2GERA 5AOCA 4UC0A 2D13A 3HCNA 1BNCA 5FWXA 4BE7B 4ZJUA 5HUHA 5J23A 3I01M 2GBLC 2IP4A 3AB8A 3DAOA 4MR8A 4AJJA 4B7ZA 4JXJA 1GITA 1AKTA 2BJHA 1CDEA 1NMSA 1NUSA 3P5BA 3R6WA 1UMCA 5KDLA 3LUGA 3EVDA 1UJNA 3L06A 2JJ2D 4DCJA 2CUNA 3AOGA 4KODA 4OFXA 4TMTA 1L5SA 3LLUA 4KAAA 3I6YA 4RSHA 2KX7A 3ZVMA 1UR5A 4U63A 3KTOA 5AKGA 2F1LA 3A31A 1C4XA 1EUDA 2IL1A 4UZFA 2PWZA 3EGXA 1DT5A 3IXMA 1A2OA 1V1JA 3VHQA 5EJ2A 1YNOA 4LVCA 4B6RA 2P9CA 1OLSB 2XYQA 4EBBA 5BW5A 2CFIA 3WQHA 1OXBB 2N42A 3PBKA 2O2ZA 1FMJA 3PPWA 4ZRNA 1J49A 5EP1A 1LNZA 3AT1A 5E1MA 3H3FA 2NO6A 4UTOA 4KXYA 2OOKA 4F2HA 4TXLA 5IZCA 4JY7A 3OJWA 3CKLA 5B3AA 3IUEA 4POAA 2QUAA 5BT9A 3N28A 4GVLA 4JZYA 3AUJB 4CM4B 3CSSA 5FL7A 4Z7OB 2Q2VA 3EMVA 4G5HA 4IFEA 3LVBA 1JMKC 1HZJA 1JQLB 2W2QA 4IGAA 3UMCA 1NNEA 5KJEA 2BFPA 1JBEA 3L8DA 5JCJA 3UMBA 1JE0A 1N5LA 1UPFA 3LHFA 1ZIOA 4XPIB 1QHFA 4GFDA 1I10A 3SD7A 4AIIA 3SYRA 4CV0A 1XZEA 3F5SA 1M5UA 1H9BA 1X7ZB 1P0QA 2EG5A 4QPCA 4FDMA 1FUYB 3UFBA 4NPCA 1EUZA 3P0EA 4IICA 1P81A 2XZPA 3N8GA 4JMLA 3AILA 2WE8A 5JQGF 3O03A 5FA5A 4S0XA 1EP3B 2R4TA 4E32A 1W6RA 1NBMA 1VE6A 5AXCA 4YWJA 3R7NA 1ZBDA 1KGSA 1ZGAA 1N1GA 3FPHA 4FD2A 3MHPA 1E3IA 4QJ5A 4DIEA 4ZCRA 3DTYA 2PSSA 4S2EA 2XWJI 4OMUA 4DFDA 1JTVA 4LRWA 4QTUB 4XIFA 1R0BA 4TT8A 4IXDA 4B43A 1YQGA 1EDZA 2B98A 3RF7A 5IKEA 3ZJVA 1O58A 2P5YA 2B2NA 3H97A 3VNAA 3IEMA 2HCBA 2VEDA 3HAGA 3ENZA 5BUQA 1J0XO 2PGJA 1M8KA 3FUWA 5ALKA 1J1IA 1SVSA 1U7TA 4Q1CA 4Q21A 4YNBA 3EF3A 4RF2A 2HA4A 3DXXA 3U39A 1L1RA 2Z57A 3QLUC 2CLIB 2G40A 4MGEA 3RVRA 4QJIA 2SNIE 2PZ8A 4DNTB 2ST1A 2H4XA 1DHRA 1CUSA 2GNAA 2QI9F 1DIOB 3L9WA 3LT1A 4JI8B 4DA7A 4HATA 3ETCA 3KUDA 4RETA 3NKLA 5BYKA 3JQFC 4KYUA 4YP6A 4M8NE 1LQ2A 2H7CA 4LK3A 5EJ6A 1XZMA 4LDQA 3HGQA 3A8JA 3ZBUA 2WG1A 2WIJA 2ATEA 5E3IA 2QM3A 3KPUA 4C43A 3PC8C 1VI5A 2PXCA 1DV2A 4KCGA 4L02A 1WUTA 3D31A 4CN8A 4EM6A 3RRJA 3KKNA 4RU1A 2ZP1A 1D09A 2EBFX 2JFUA 4PBSA 4A8PA 3I1IA 2FWBA 3BMNB 1YVRA 4A8JC 2SKCA 3H8SA 3UWPA 1XCGB 3UT5A 1NN0A 1CJVC 4E2WA 3S27A 1OF1A 1VQ1A 3DEFA 3LDAA 5T4BA 5FUBA 4UEKA 2VZLA 1S4QA 2VATA 2JI9A 3BL5A 5EHNA 1NX6A 4OLJA 4C4SA 1QKIA 2IZZA 2XDAA 4Y2HA 1NU6A 2V6BA 1S2NA 3EWAA 5TQ2A 1P7YA 4BQNA 1Z5ZA 3LL4A 3MJSA 5BRJA 3SJAA 3A32A 1L5HA 2Q3BA 3R9IA 3RR2A 1XLUA 1ZD4A 1D4FA 3PUXA 4NMWA 5GJWC 2V31A 3FMIA 4RMNA 4Q6BA 5FA6A 1RBYA 1Y5MA 3TSWA 4WERA 1P4GA 2R6AA 1JHXA 2AOUA 4FMPA 4B4WA 3DL7A 4LV8B 1W46A 4J3NA 3RUDA 5MF6A 4DWOA 1ZVVA 4RDCA 4BN0A 4ARUA 2VKTA 2ZBUA 1U7ZA 4PCUA 3HL0A 3H5VA 4Q34A 1B00A 1GGKA 4RMHA 5TRTA 1YH3A 3TTTA 2PBRA 3A05A 1LI7A 1R7RA 2YXPX 5A1TA 4S1TA 3IMGA 1U8FO 1VE7A 1VGVA 3C6MA 3MMSA 3SC2B 2WU3A 2D4HA 3VV3A 2I2CA 4DUGD 2Q1XA 5B1DA 1NXSA 3M2PA 1Z62A 2WJIA 1QYRA 2AFIE 2NXJA 4ZT4A 3O8QB 4HAUA 3EC2A 2CUKA 5JT1A 1XLTA 2CBXA 2WAXA 2D59A 2DFTA 4QO8A 3VXKA 1MVNA 2D0IA 2ZGVA 3RT1A 2JGJA 3V1LA 4B44A 1UPBA 3AB3A 1W0KA 3ZS8A 4CF6A 3I01A 1PR4A 1PV2A 1PJTA 2B21A 4X63A 4KVZA 3R41A 4JT4A 2R1UA 3OQJA 4QGGA 1BQEA 4CJXA 2IE8A 3AKEA 4RTQA 1FFBA 2PZJA 3MBKA 1F9AA 2PCLA 2REQA 3I5XA 2VCEA 3I2YX 3AFHA 1KDRA 2Q5HA 4KI0A 3KDPA 3MQFA 1QVZA 2CFTA 5KQPA 3T1YB 2F17A 4PY2A 2HREA 5GONA 3IO5A 5AJVB 2X7HA 4LJLA 5AHOA 1XFOA 5LB2A 3SK0A 2ZXUA 1YCDA 5GQSA 1BDHA 5IAGA 4OQFA 1ADYA 2QL5A 3A3KA 1M2WA 3H5IA 3IEUA 3O74A 3B78A 3C3BA 5TQ0A 2VUHB 3Q0TA 5TY0A 3UJDA 4DR1B 2YWGA 3P27A 3PFCA 5TRDA 3QVGB 1E5QA 3TLYA 5JAOA 2OFFA 4J03A 1X6VA 1BMQA 1WMSA 2VBSA 2R2AA 3A1PA 3Q15C 1ISFA 5F78A 3GCDA 5B4TA 4OLBA 3BRCA 3ILHA 1EJBA 3ZXYA 2J09A 3P9KA 3TEMA 4OB6A 4IJKA 1DINA 4L6IA 4IGIA 2HPZA 3ZIAA 5K8VA 3I53A 3B1JA 1OJ7A 4D8YA 4DMKA 5LQAA 2CCKA 3I64A 4FLEA 5DN6D 3R5KA 5KTOA 3WKAA 1L7NA 2QPTA 4TRJA 1MQAA 3Q9UA 4BNKA 5BMVA 1AUQA 4OYYA 1GRRA 3M1AA 4MUKA 5L53A 4GIBA 3QIVA 2CB9A 3UUWA 4PNPA 4EB6B 2PV7A 3QVGA 2IDJA 2QZ4A 4E0BA 5BPHA 4YCJA 1BRMA 4G0PA 5JS6A 3EIXA 5GVRA 3AOEA 5JV5A 1T0PA 3DONA 1K06A 2I71A 3F5FA 1N75A 1U0GA 4N6GA 4HV4A 4ENWA 4GAEA 1NP6A 2GJPA 2Q28A 3CCSB 4FFMA 4JBYA 4LMAA 1L4KA 1Q6YA 5D6NA 2ZSEA 3S2IA 2AJTA 1Y3BE 2Z1DA 3DLBA 1CEYA 9ABPA 5LMUB 3B52X 5ALRA 2VRCD 1XT6A 2H11A 3EAFA 4M60A 1QIJA 1W581 1ZW1A 1H2XA 3V42A 1H8ED 3DE4X 4EUEA 3VPDA 5FB3A 4BX8A 2HDHA 2I2FA 4A91A 1DHTA 2RCNA 4EJFA 1ZCJA 3RK0A 4EMSA 2FQWA 4ETMA 2PUGA 1XOIA 5JDCC 1EE9A 5D5QA 4CGYA 3ZJUA 3PYMA 1NUTA 1DAHA 4BL5A 2BFBA 2IHTA 4Q37A 4FXUA 2JFZA 4K9RA 1UJ2A 1DC8A 1TYDE 2GZ2A 5BR1A 1OXUA 2AX3A 3E3OA 4NMXB 5FUWA 3T9CA 3SS8A 3ZVLA 1LZLA 1T6YA 2NQ2C 3OG9A 4IV5A 2Y6VA 1ATIA 1LWOA 3F6BX 4ZYTA 1F7VA 1TKBA 2WJGA 1UMBA 1UD8A 4DCVA 5AW7A 4NSNA 4OHOA 4XI9A 1OI3A 4JFRA 4MW6A 5EMMA 3KSBC 4AW9A 4AJPA 5EJ5A 4LOIA 5F98A 3ORFA 4WESA 3RW9A 1RQLA 2PIDA 1MO2A 2NQTA 1YZUA 3BOSA 3FNIA 2GEFA 3T5AA 3GN1A 4Z4WA 2G72A 4DOMA 1E63A 2TSYB 1QFXA 4BO3A 1Q1ZA 3JQAA 3LTEA 4INOA 2ZIGA 3RBXA 3HY6A 1KSJA 3GJ3A 4DR5B 5LKRA 4PV7A 2GJAA 3UGTA 1ADGA 2WUVA 4DCTA 2OVFA 4J07A 4QVAA 2IK8A 4KPUA 5IBPA 1RPNA 2G9ZA 2ZBGA 1GL9B 1SWWA 1S8NA 2B37A 3DAFA 2CXSA 4CT4B 3ZQJA 2PRYA 4EL5A 1U0EA 2BTEA 1GAXA 1AOXA 2CXQA 3CP8A 1RI2A 2JAOA 5TMBA 3EA5A 3D3KA 2O52A 4FLMA 4HWOA 5IDYA 2PR7A 1MB4A 2ANCA 4NBSA 2JCBA 3TJMA 1P3JA 4YJHA 5KBYA 2Q5FA 2Q6KA 3CLSC 4DV3B 3WL5A 2QJRA 1M1YE 1TK3A 3I9FA 4CMHA 3UT5B 1ZG3A 4R05A 3DBLB 1XO1A 2EEPA 2HT1A 3Q9NA 2Z5GA 1LB1B 3H8JA 4WLNA 2ZZGA 1PDWA 1E2LA 2OQIA 3N2KA 5AXAA 3UYKA 3QTBA 3V8BA 1G7RA 1CHDA 1E1NA 5LQNA 1E5DA 3AB7A 4IS2A 2ZYDA 3FSEA 4JYAB 2R85A 3NRCA 3UWOA 1GGJA 4JL5A 1E99A 1DDGA 2EARA 4XFJA 3LS2A 2O8FB 3GELA 5CM8B 2UVQA 2HLNA 4CVNA 3BF8A 3K9LA 2XOEA 3EIEA 4DA6A 2QVYX 1E7QA 2ACEA 2JNWA 4MKFA 5ALOA 1K89A 5FI3A 4R1QA 1SQ5A 2W4MA 3DMFA 3KDSE 4IMRA 4RVCA 3VO2A 3SLGA 3SI7A 4HNHA 1V5VA 1FP4B 1LX7A 1P3DA 1VLQA 2QE6A 2IHYA 1QIIA 2F3TA 5AI4A 2ZE5A 3TNFA 4URWR 1PQ4A 4XR4A 3A2KA 2W98A 4M8IA 1YIDA 2IELA 5H16A 1SHUX 3MMPA 2ORVA 4OQPA 4QQKA 3SDBA 1XMOB 2I80A 3IBCA 3PC7A 1L5HB 5C5DA 2H1SA 3L6DA 4GBGA 1E8DA 3GUYA 4G67A 4GNKA 3M6XA 4PAMA 2XUOA 3OM1A 4WXYB 1IZ8A 3AY0A 5LOVB 1H0SA 1CJCA 3H2BA 1VLMA 3MB8A 1KK1A 3Q39A 1VCNA 3KLMX 3V76A 2JGLA 2XMQA 2AOTA 3A8TA 4HCJA 1YQEA 2AXNA 3QFTA 2R1VB 2XKJE 4CKEA 2AHOA 2HHJA 4PGFA 5AQ1A 3QH4A 4DBZA 3PXGA 1SCIA 1YGPA 3MMNA 4R2HA 2IXAA 4R01A 1XZPA 3UK7A 1OLUB 3HA5A 5CXXA 4ZVUA 4E88A 4K6GA 3LPCA 2AWOA 1YU6A 3KQQA 1X9IA 2WU4A 3F49S 1R64A 3FDZA 2C5AA 3RU9A 5CVEA 3T7SA 4DANA 5EIOA 3TE7A 3R23A 1XWFA 1SQSA 2JGFA 3OD1A 2HEGA 1G63A 1RYZA 4GX2A 3ZY5A 4CLDA 2PAAA 3QFHA 1ZJZA 3OT5A 3HYNA 2CZCA 2O7VA 3QGMA 1QZTA 1IBCA 1II0A 1ODFA 1YRAA 3BD6A 2AD5A 2O3UA 3X1WA 2IEAA 1V2HE 2QRVA 2YASA 1LJ8A 2VHWA 4HZUA 5AJHA 3FPGA 4ZAWA 5AUQA 3GT0A 4C9BA 1KAEA 2TMYA 1B16A 1INLA 3O94A 1PYOA 3GNSA 3WHIA 1TAHA 4KH1A 1YQUA 4L0DA 4P3XA 4AS1A 4UBIA 3D64A 3QXGA 3BXHA 3V7UA 3VGPA 2XZDA 1VGRA 3HUDA 3WBKA 1N6RA 1W5BA 2QW0X 2DOGA 1RM3A 1WCYA 1XR3A 3DMGA 3LQQA 5BR7A 5INTA 3PTAA 2X6RA 1GM5A 4GYJA 1DB3A 4RZQA 1JPNA 4F9FA 4NBRA 3PDUA 5KNBD 1B93A 3A9CA 4FOSA 3K6RA 4K8RB 2ONZA 2QMYA 2BLNA 1W94A 4Y3UA 4MCAA 3V4VB 8LDHA 3GSIA 1FYEA 1O7JA 6ADHA 4CMKA 3K4HA 4J1SA 3STYA 4UARA 3DTVA 2VJLA 1E5TA 4W7SA 1G21B 3JQ8A 4GRAA 4RPKA 1XB2A 4AJ1A 2H2HA 1PZFA 5AT1A 1JMYA 3JQ6A 3P96A 2GN1A 5HTOA 4RFVA 1GYQA 4E03A 3TIIA 1KI9A 1CUYA 1GZSA 1EBFA 4HYYA 4KXNA 3EJ6A 1YBAA 4P7JA 3IUJA 1R0YA 1P19A 2OAP1 4R41A 2RKBA 4NPHA 4NE7A 4GKKB 4RWEA 2CJYA 1C3VA 1HZZA 2OD9A 3IBYA 1ZU5A 4OGFA 5FBHA 2B4AA 3ECAA 2CXXA 5HHTA 1XVTA 1PFUA 2A9QA 3KKEA 4Y9SA 3A1UA 4C7BA 1ONNA 3QVWA 2QVBA 2YIMA 4LEIA 2P2CA 4DSOA 5EJ8A 2VT3A 1MT3A 3ZD9A 4I9FA 2IDMA 4Z4EA 1SEVA 1F1BA 5JYDA 3COVA 5IJXA 4AIRA 1RWMA 4UTRA 3LWNA 3C74A 2B25A 4MW5A 1NYTA 1SXJC 2QP9X 2V7WA 2H2AA 1P73A 2GEKA 1U0LA 2PKYX 4LY6A 4X3OA 2IWHA 4FSXA 4CMBA 4JQYA 4LRXA 3V4FA 1ND6A 3WLAA 5ALDA 5CLJA 2F3PA 4LSGA 4NZPA 2Q4OA 1UP7A 3NXSA 3RB8A 4B3JA 5MHTA 3A3PA 3SXUB 4Y6RA 1QOPB 3CX8A 3O2QB 4MJLA 4II7A 5LBTA 2GQFA 1E94E 5E6TA 1FSGA 4N8SA 2GNPA 4NBLA 1US8B 2GD0A 2YWRA 1JWBB 4Y2PA 3V4RA 1G8JA 3DZHA 3GFVA 3VNQA 4HXGA 4WK4B 4H17A 1SBCA 4WY8A 1OX6A 4WOCA 5FRDA 4FCTA 2OCBA 2BW0A 3OJOA 1GU1A 1YUBA 2PTHA 1XRJA 5I7FA 3ESYA 2AQKA 3BBPA 4YFYA 4HEA6 2BFNA 2ZANA 4ZU1X 4HE5A 3LLSA 3GFPA 1I7PA 3ZN2A 2Z6VA 1EWYA 1ONOA 1RVDA 4NWIA 3HRHA 4OFBA 2A0FA 2R68A 3OU7A 4M21A 2O54A 3N2KB 1UWCA 4X8MA 3BB1A 4Y9UA 5CIQA 1SB9A 1RKVA 4N3GA 1E2HA 1UK6A 1EINA 2VYCA 4WZBE 5F23A 4KHPB 2GCOA 3WLFA 3FAZA 4H59A 1MJGA 1F3LA 3LA8A 4OHCA 4QPPA 1FZTA 4F8EA 2NZUG 2I91A 1GFSA 1VJCA 1BAPA 1W96A 5U4XA 1M1YA 2PZEA 4EQ6A 2WBLC 3TZ6A 1TO1E 4OXNA 2XZOA 5I7AA 1A82A 3BFKA 1PO7A 4D25A 3QF7A 3IP5A 3JVUA 4TV9B 1LI5A 3VVBA 2QWXA 4UHFA 1H85A 5EEHA 4KO2S 3ZWAA 3ZHVA 4BFLA 3PUVA 1C8BA 5HG0A 1CB7A 5L40A 5A3JA 1GL6A 1S4MA 2BEVA 1M2HA 1N5KA 1ZESA 5IYRA 1JEQA 1SD1A 4MUAA 2P1ZA 5F7ZA 4CCSA 5IYPA 2OB2A 2QMOA 2W2TA 3AR6A 2Q8PA 4TRNA 1N0VC 3LC2O 4FNGA 5FT9A 4PLFA 3FVTA 1D2MA 4KI7A 4IDAA 1OFUX 3HFRA 2V74B 3ZK9A 1KMQA 3K9WA 4QU9A 3VMMA 3IRUA 1DKRA 3LLVA 3C87A 1C7JA 4OGLA 5KEIA 2GTIA 1T1SA 2H4ZA 4R0MA 1FUIA 3BXPA 3HCCA 1ZHFA 4YCBA 4JYCA 2D2XA 3LNCA 1VFPA 2PX4A 3LX8A 1VLZA 3NM5A 1T5TA 4HSGA 1N6LA 3H6GA 3HJRA 3HI6A 2PE5A 3AY3A 1Q95A 1Y1RA 1ICIA 2ZIWB 4NFHA 2VDQB 1FFCA 1LQTA 2XUDA 5JCPA 3U3OA 1ONPA 4DNOA 2O3RA 1Z6AA 1JWLA 5KVSA 3OY7A 3WO0A 3JYNA 3FI0A 4FC6A 4XB2A 1P44A 3P19A 1U9IA 2D1FA 3WIBA 5CBPA 1DIAA 2P2GA 4WCFC 1BS9A 3KHKA 1EGVB 4TYQA 1UEIA 1NDHA 1O9BA 1U0BB 3Q72A 3I1FA 3BM5A 4LJAA 2XE4A 2RHBA 3JPWA 3RC3A 4AO6A 2R1TA 3L7BA 4ADSG 5E0OA 3R6LA 4HGYA 3LI2A 2I6QA 3OIUA 1TIPA 4HB0A 3A8KA 4BJ5A 1R0LA 1UZLA 3HDQA 3HJNA 3QLVA 4FI3F 4JR1A 1VRCA 3FTNA 3GVPA 3TGPA 3BH4A 3CJRA 4PM4A 2UYCA 3C3YA 1VPLA 3DZIA 4L7VA 2IOYA 1M2EA 5EZYF 4MVWA 2GK4A 3QJGA 3MCZA 4FEGA 4N6NA 3OMLA 5EJEA 3ADKA 2YC4C 1WMDA 3RVDA 5J5VA 3BFXA 4BFXA 1P2DA 1YXMA 3NX4A 1SG6A 1UBJS 4G26A 2OCAA 1GRCA 4OTZA 5M29A 1BEZA 1YD7A 3JYOA 1LFDB 4UUAA 1GQQA 1U7OA 4IKEA 2LZJA 2X4GA 5LZ9A 3BHIA 2PD3A 4DR3B 1VHOA 1CZOA 3G13A 4MP8A 4EKYA 2DUMA 3Q8KA 1G8YA 1JFFA 1IDN1 2QE7D 2HF2A 4OI4A 3VC3A 4CYMA 4R83A 4F2PA 4AQ7A 2XIJA 1FVXA 3INYA 5EHGA 3Q6QA 1U3TA 5PGMA 5K3DA 1SUDA 4QOJA 1EVJA 5LB4A 2V4MA 1ONSA 1BROA 4JENA 1M0EA 1UZAA 3V2UA 5KU1A 2Q0SA 4NATA 3FTEA 4RIIA 1KI3A 2YV1A 2PX2A 2O8EB 4FIZA 4OEHA 4H7JA 4ESHA 1V48A 1ZI9A 1CRLA 1S2DA 1UOOA 3L0OA 1R6VA 4KQMA 1OTXA 2Q6OA 4A26A 3COZA 4K8OA 5DJ5A 4OA5A 3P71T 3PEFA 3H18A 3ZHSA 2RD2A 1ESDA 1B8OA 2VHJA 4CMGA 1XK7A 4UM7A 1VA4A 1UD4A 1RQPA 2ZXHA 3A11A 3ESXA 1GGEA 2R44A 3GLGB 2NMVA 3UPTA 4DLYA 2IX3A 1H4VB 3P9NA 3FBTA 2Y77A 4M1WA 4C07A 1UKVY 2HJVA 2IUUA 3JVEA 2Q8QA 3NE5B 2R60A 3DLIA 2YMMA 2BE7A 3ENNA 3OCWA 5ALNA 3AHIA 3ZX4A 1EUCA 1R9GA 4F93B 2Z6QA 1VXRA 1IYZA 1V0JA 3KPYA 1TPYA 4N03A 2PZKA 3ZE8A 4JJFA 1V8OA 4QX6A 4BZPA 3EZNA 2MHCA 2CLMB 3SMVA 1W5EA 4DLBA 1A7KA 4CQNA 4GMKA 4RZ2A 2P0EA 4FFBA 2HI0A 1K8YB 4BVJA 2FV8A 4HAIA 5B6PA 1W76A 2CDRA 3ASPA 3GFBA 4QT4A 1Q15A 2JGMA 1KZLA 1YZKA 2D6FA 2O05A 1QMGA 5LP6A 4TLAA 4IDNA 5IJ0A 3FY4A 3HZZA 2Y93A 2PAFA 4CCYA 3GIWA 5HJ7A 1E6UA 3TZCA 3K9GA 1ECJA 1QTIA 3BGVA 1FA9A 3QMVA 1UK7A 4YN3A 1BHSA 5EUBA 2BGIA 3Q38A 3VU9A 4P1ZA 3UMGA 1I51A 3W7AA 1K97A 3W4IA 1FFXB 1XMIA 2XCQA 3LOPA 4B3CA 5M34A 1PR1A 3T5CA 1A9RA 2WIAA 3LH5A 4BB9A 4OBWA 1IVSA 3HABA 4GM0A 1KXZA 2VUIB 3DDHA 4GX5A 3MTBA 2R7LA 3AFMA 2A4MA 3LIPA 3ZGYA 1PWYE 5KOIA 5JD5A 2HSEA 1NNI1 2ADOA 4P54A 4X05A 3NYWA 2DM6A 2BD0A 3A9RA 5TS3A 1A1VA 1ECPA 1UKCA 4EQZA 1XXHA 2BJWA 3KXLA 3DBIA 4YHHB 1QIKA 1F8FA 1L3BA 2GH1A 3DAPA 3P20A 2VJIA 3PGJA 2J1LA 4H18A 4WESB 3CF2A 3QVKA 4MUYA 1CVRA 2DPXA 3EXIA 4R6WA 3ST7A 5GTDA 5DLEA 5BN5B 4NPAA 4MP3A 4WXRA 2YNMD 5JOQA 1M1XB 3A4YA 4IRXA 4BKRA 3D2AA 3GI1A 4HKTA 4GOOD 4X85A 3VR3A 1DJLA 3FTCA 3NBAA 1BWSA 3E8SA 3PE4A 1B6SA 1XPRA 5IXYA 3NBMA 3F78A 4N5LA 5DCYA 3TQRA 2VYFA 3OPYB 4QQRA 5IM4A 3FRJA 2XVAA 3OW7A 5DSXA 1NM5A 1JYSA 2IV3A 4L75A 2WVGA 4HNUA 3OZEA 2X0RA 4WPGA 2PT6A 4AZWA 2OV2A 3PWSA 3O4FA 3OJCA 3QHAA 1N6IA 2H5IA 2I2DA 4C20A 4V0LA 2PLNA 4WZEA 1UDAA 3PS9A 5DCLA 3L7MA 4U7DA 1CZRA 3MUFA 3E84A 3T15A 3HXOA 5AKJA 1QKJA 4ZMBA 1AQNA 4J0EA 5F1KA 3CCBA 3RFFA 1MORA 4AJEA 1TW3A 2D5BA 3MAJA 2QF7A 1KEVA 3GJQA 3R8FA 1EX6A 3DF9A 2WMDA 2KQUA 1WB6A 4I3GA 1SM4A 1EEXB 2NAPA 2J5RA 3RYHA 3IIJA 3O8OB 4DKXA 5KTSA 4OCZA 4OPMA 3ZPXA 2FJPA 3QMMA 4LK2A 1OA0A 3A35A 5BV7A 2EKPA 4ZAFA 1EK0A 1G20B 3ZBQA 3DYIA 2V97A 3EYAA 4BP3A 1MNAA 4TL8A 1HTBA 4AJOA 2ZB7A 2HU8A 1U04A 3FYUB 4BLTA 3HM9A 3TI9A 3PQ3A 1ANKA 2VSFA 3I6ZA 5D5PA 1HR0B 4LECA 1WJGA 1RPTA 2X6XA 1YTUA 5JSHA 1QH9A 4Y2XA 1EFUA 1IHPA 4CM9A 2VXYA 5LKAA 1AF4A 1DX6A 5TS2A 3DNMA 4OH1A 1RE0A 2P11A 4TQGA 3V9PA 3WA6A 1QS0A 1I7NA 3A6DA 4A2PA 2BGUA 1JH9A 3P4XA 2PQ2A 3WNCA 2B30A 5EMHA 3ZDAA 1V41E 2V5VA 5AESA 3VU0A 4EHFA 3A1NA 1G3RA 1X3LA 3BRQA 5IM5A 2ZJAA 4INAA 5GOZA 4MWZA 3L05A 4AF6A 1EAMA 3IQFA 5DNVA 1JHZA 5EPUA 3QE3A 1J6UA 4K9NA 5LIPA 1KEZA 5KPDA 2IS2A 3HVIA 2XZLA 1FP7A 1Z5NA 4P08A 4R0VA 3GPCA 4D9GA 3GVHA 4MQFA 1H4QA 4AKSA 3WMFA 2RHOA 1SVUA 3TEJA 5H9WA 2F43A 4KXWA 1ZD8A 4EY6A 3RTBA 4IJVA 1Q6ZA 4KQWA 4P5DA 3OLXA 4B73A 2BONA 2GFHA 1OI7A 4CFYA 2Y1EA 4EA6A 1FTNA 5JPDA 1CNEA 2AW3A 1E2GA 3NG1A 1LS6A 4Q4JA 4H60A 5I7EA 3OZUA 4ZZIA 1GPKA 1A5TA 5FWDA 5CA1F 1SBHA 2MSKA 1P29A 3C3EA 2BGJA 4LXIA 3X2EA 4CKCB 3NS7A 1R66A 2ODQA 1TMKA 1WB9A 4AY2A 2R4UA 1DAIA 1Z34A 4I4LA 4YV2A 2ZYVX 4COKA 1QP8A 1C8LA 1KFKB 3NW9A 4G1CA 1T4DA 2YXNA 3WNDA 1V8BA 3IEIA 1SIWA 2BKEA 3O5AA 1IE3A 5IS2A 1GYRA 3GJ6A 3KQLA 3UWKA 3KPJA 5JAUA 2QUJA 1NJ6A 1T1GA 1K3UB 2VTEA 2EEZA 2XW6A 3DP9A 4OBXA 4CU5A 1QGOA 3BT7A 3PRKE 4RW0A 4FS3A 4LHZA 1GD1O 4PU0A 5EHQA 5HDQA 3UEOA 1G5RA 4EKDA 4F60A 1JQJC 1GTJ1 1Q2UA 1WQ3A 1KS2A 1BMTA 2PSDA 2ZRBA 3NHAA 5DYTA 3TB4A 1OIVA 4XIYA 2H9AA 3G8DA 2JZCA 2L42A 3ROMA 5DXFA 2TS1A 2G0AA 2TMGA 2Y1OA 1EVZA 4MYCA 4S1PA 5EWMB 5HWSA 1GEEA 2MSNA 3KX2A 1ZD3A 2V9ZA 4A0QA 5EIWA 3FCSB 1K7YA 3L5OA 2JF0A 2PSHA 4HDKB 4XFKA 1S2IA 3I9MA 3HCWA 4FGSA 5CFLA 1IDOA 3ISXA 1P74A 3AF3A 2QTCA 4B40A 3SLDA 1D2HA 1JVSA 4NOLA 2ZJOA 3ETNA 1DPGA 2C9ZA 3MSCA 1Z6TA 3R0JA 4MV6A 3UOAB 3V46A 1FTGA 3M1IA 6Q21A 4Z0HO 2XMRA 1PD1A 3V80A 1E9DA 5BSHA 1BS2A 2PGAA 2Y1LA 2VYNA 2ZTGA 4JIGA 3CF0A 2IXBA 4JOSA 3CF4G 4BFYA 2VCHA 4E09A 1AUXA 3WRWA 1K5DA 3K0HA 5JO9A 3ICCA 1UXHA 1MX9A 5EY5B 5C34B 2Z0MA 3FZQA 2BHSA 3ONUA 1BX0A 4KQEA 4XNFA 1XZCA 3A8IA 2NV0A 3GNQA 4IDEA 3KOWA 3PQFA 1RRFA 4X94A 3SEQA 3TMYA 5KMGB 1MN6A 1EXVA 3K0AB 2QTNA 4P58A 3OC0A 2J6IA 3G8YA 4NG5A 3W6PA 4AY3A 1A9PA 2HL6A 2RH8A 1T8UA 1XU9A 4YAOA 1EQ2A 1W85A 3BULA 3GRFA 4M9UA 3SNKA 1Z12A 2QRUA 4GL2A 3RFCA 2I66A 5CDTA 1VE5A 3BXZA 4BGVA 4L8VA 2VZEA 3REQA 3RRZA 1KZ9A 2HXSA 3AUXA 1RXUA 1MKYA 2IPOA 4J2HA 5K4AA 1J9ZA 1GPH1 2FDCA 1W52X 1M0WA 3PI6A 4LQDA 4BEVA 1N4AA 3INNA 3GRUA 4BKUA 4FNOA 4TMVA 2R7AA 1P6UA 1L4EA 1SHJA 3ADCA 3TW0A 3P2IA 1GPDG 2DHEA 3UW3A 1XCLA 3PPIA 1KI6B 2CUTA 3DNFA 4KE8A 5ALZA 4EHBA 4NEGA 1OI4A 3OURA 1SCBA 2VH5R 1MV5A 4IJ6A 2J85A 1UMCB 3H11A 4C78A 2GUGA 3PJGA 4EG0A 2FR8A 4BWFB 5BSEA 2SHKA 5DT9A 1I36A 5L7YA 4CHGA 4Q93A 2WB4A 3CVVA 3C8DA 3W5SA 1U8EA 1GDHA 3USES 3WGIA 3CR7A 4RDIA 3EVGA 1QLJA 3JCZA 4RIHA 5DNWA 5K3SA 4ES6A 1M2FA 1T9HA 2R84A 4D3SA 1XRNA 2WU1A 2R1TB 4FKZA 1H22A 2XSZD 1S2LA 1P9OA 1IVYA 2YIVX 2N47A 4W82A 2D1RA 1BJRE 4NEHB 2SCUA 4BZQA 1XMPA 2XA1A 3AI1A 2C2KA 3K20A 1WLYA 5FL3A 2OXFA 2O59A 4F84A 1M2KA 4PF1A 5EE1A 5HF8A 3W6UA 1FIUA 2C2ZA 2EZ9A 4UATA 2WJYA 4OJYA 1E2FA 5JBQA 1C1XB 3M7IA 2C2YA 3J81A 3Q4GA 4A15A 3CZ4A 4BYMA 4MMXB 1YZ3A 2BDTA 1OXVA 2Q6TA 3DWEX 2AS0A 2P3QA 1FL9A 4V0QA 4CCAA 4CLRA 1HOXA 3N5CA 1ETHA 3ANXA 1P77A 4AMZA 2CHQA 2QZSA 4V3BA 2LDXA 3G7NA 2CHFA 2P3OA 4OJQA 4X6LA 5JZSA 3Q3JB 1CIPA 1X1DA 3RYHB 5JXWA 1ZJ5A 2P9HA 1PFVA 1KAGA 3H2YA 3MEQA 2JEYA 1UPXA 3UKDA 5IHPA 1HKUA 2X41A 1BQ4A 4D8VA 3WYAA 4X5OA 1PG0A 1KBOA 4HDMB 1VQNB 3CZAA 1NKTA 3GJYA 3O2NA 3S0JA 1H5NA 3WGGA 2JJMA 1SVOA 4EFLA 2V7XA 1NT4A 1CRZA 3V1TC 4B33A 1Z8HA 2VAWA 1I01A 3KE9A 1GAWA 3KZCA 4EENA 5LA6F 1O95C 1EWVA 3EVCA 3FTFA 4IQFA 3KT8A 3BJEA 5JD6A 2FQQA 4M1QA 1VG1A 2RKOA 3C1TA 4H0FA 3RU3A 1RYHA 3A7DA 3DT9A 4RANA 4BNDB 4MV7A 3DVAB 5ESXA 1JDUA 4JIMA 3QNWA 4YRMA 3U19A 4ZODA 4S35A 3RUCA 5ALVA 1JZQA 1JLLA 2Q4EA 3MAAC 4J76A 5DYIA 1IN1A 3EQ6A 3E5HA 1VQKB 1E2PA 3VGJA 2JASA 5BV0A 5IKMA 2DT8A 2G36A 2Y0BA 4N49A 2ACKA 3SLNA 2ZUFA 4MS3B 4H27A 1P1RA 4YMHA 4EKGA 2QRQA 2VHYA 2PPVA 1KEKA 3F8WA 1AGYA 1YAHA 2ZI4A 4WKGA 3G9TA 4IWNA 1TKAA 3LXMA 4BU1A 5BNWA 5IDWA 2BFEB 2IF2A 5JTUA 2PX3A 3KEOA 5D3ZA 4AY6A 3RHTA 2YRWA 4JD5A 1AS2A 4QYIB 1KFCB 2AOWA 1LX6A 3NTQA 2EJCA 2F9MA 2O20A 1XROA 2QROA 4XEHA 3MSXA 3KQTA 2W2LD 3LX6A 1TLTA 3WWOA 3MCUA 4U5QA 1RSZA 1F06A 4HXEB 1B74A 3NPAA 4L3WA 5C1OA 2V65A 4CTNA 3J7TA 4IQGA 1VTKA 4L8FA 4PTZA 4LX0A 2W37A 1YKGA 1E5VA 3NHBA 3FI9A 5D84A 4ZN6A 2OHJA 1RJEA 3IB6A 4MUIA 2KLBA 1Y9ZA 3LC0A 4Q5IA 2SKDA 4WJZA 2JJ1D 421PA 3W2IA 1XDGA 2HA5A 2NOAA 5CBKA 1P1IA 1R27A 5EESA 3N8DA 3OI7A 3VU9B 4TOIA 2ACVA 4DQXA 2DPGA 2Y1FA 3ED1A 2HSZA 5GMOA 1WXDA 1UJBA 2FSHA 2WFAA 3TAXA 4M7RA 3WP0A 4Q02A 3OBIA 4I0WB 3FZGA 1IHUA 1AN9A 1BN6A 1L4FA 3GFOA 3M3HA 4Q12A 3STWA 4J4TA 2AKEA 1AJEA 2D4AA 3OE5A 2X13A 4G8JA 2Q4DA 4FX2A 4ZV7A 3M6LA 5TXGA 1VC2A 1Q50A 2GZSA 3HCDA 4EY8A 3DOCA 5AN9A 3NT5A 1RI1A 3C3PA 2LIVA 3VDNB 1N92A 2HWWA 3JSXA 2XGMA 2R6CA 3E7DA 1IK4A 1Y8RA 1AZLA 1HL7A 1NOKA 1VIVA 1UBKS 1X2BA 1LBQA 2C58A 2E48A 2XPCA 4RPDA 3I8SA 3CZRA 1SUEA 1FP2A 3BILA 4KUHA 5DXAA 5GGXA 3DUFB 4LI0A 1XMXA 2ONCA 4FIDA 1V4VA 2DJIA 4JHLA 3SHWA 3T4UA 2HA3A 2WSMA 3BWCA 3HM2A 2Y27A 4YECA 2YV5A 3OFJA 5CXUA 1MH1A 2QTAA 5GGYA 3KJQA 1QPBA 4YUZA 5FIUA 1SUSA 3SHFA 3IVMA 4AWXA 1RWOA 1ZUNB 1Q86D 2CW5A 5JEEA 1EGHA 5AKLA 4TMWA 2NXCA 3V97A 3DOOA 3RC8A 2YBDA 4OJTA 2VBVA 1C7QA 1D5WA 1WM1A 2QN3A 3U7QB 2RGRA 3UHOA 1TAUA 3O8NA 2JLSA 5WRFA 5KYNA 3ZZ0A 3HDYA 5FTLA 1J70A 1OBOA 2HMSA 4Z4SA 3KSZO 4G1EB 3HDJA 4BNVA 4I9NA 1VQ8B 2MSDB 1IY2A 5JARA 1IM8A 2OP0A 4ZAVA 5GWXA 4BV8A 1Z8DA 1H2HA 3G8CA 2RE8A 1PJLA 3B2EA 3P9XA 2JGDA 3PCXA 1GJRA 4Y6SA 4I50F 1UBLS 3ND6A 4NYMQ 3FDFA 4ZVTA 4B45A 2I2BA 1PEKE 3AUKA 4KIGA 4URHA 1PJ3A 4LGMA 1GARA 4BIMA 2GYYA 1U80A 2HB6A 2JLAA 4LMBA 1TYZA 5HZBA 1E7SA 3RHSA 1I7LA 3WE7A 4OI0A 1QJ4A 4N1AA 2XCOA 1C3XA 2P2ZA 4MV4A 1QQAA 4ER6A 2PD6A 2QEXB 1KSHA 4XRRA 5ALFA 4WBSA 3V2IA 4DUGA 4RCZA 2Q2OA 1V0EA 1O2DA 2KPOA 1RQXA 1GXSB 1R37A 2XH8A 1KZ4A 3EGEA 3WTBA 2PXAA 4KN9S 5F5LA 2LRHA 2JKVA 1K7FB 1LLFA 2RJOA 3KJHA 3EXEB 1KK3A 2JJ2A 1U31A 3BIFA 3QWHA 4I1UA 1SD2A 1NDUA 2FE4A 4LNUB 2FMUA 4M0KA 4G97A 3I45A 3VH1A 7MHTA 4JCCA 4YEDA 3AR9A 5K03A 3VR4D 4AG6A 1DKMA 1GIAA 1QORA 2I65A 4QEKA 4YRGA 2X0FA 2EJWA 3VPCA 4FGZA 2AJDA 3IOYA 3C8MA 5D6OA 1DMSA 4D57A 2ZUBA 5C8VA 4PYMA 1TEXA 2P41A 4LJ9A 4QE3A 2DFLA 4F5DA 4LQLA 2IHUA 1JKJA 1TA4A 1Z68A 1ZAYA 1HUQA 2XBLA 2C82A 3SG0A 2FUCA 3M4JA 3JQ8B 2J9ZB 4HEQA 4MIEA 5K6RA 4YDQA 4G63A 1D9XA 1W2BB 4Z4QA 2PUCA 3ESQA 4H7DA 3DMPA 4KL8S 4RD1A 1M7HA 1NBEA 1JZTA 2VDWB 1F14A 2H16A 4RKEA 4JXZA 2XCTB 4D4LA 1WZ2A 2Y76A 4GXNA 1I7DA 4D96A 1YHNA 3IC5A 4HX2A 1QIMA 4E5PA 5K0ZA 3TTXA 1WBBA 1J8DA 3C5CA 3UG6A 4FB5A 3IAHA 2EHDA 2VNHA 4CM8B 1OCEA 1B6TA 1DRWA 2UVDA 4MINA 5ILQA 4AP5A 3IAS6 3T1VA 3U4GA 1FDSA 2JCYA 1ZLYA 1QK4A 1E1KA 4H7IA 5CD1A 2ZS7A 1VJ0A 2FPMA 4LGVA 4PHFA 2G82A 3P9RA 3SYTA 2D8MA 3WYEA 2I76A 1Q3TA 3QKRA 5DF1A 5BV2P 5FOVA 1GG2A 1HG0A 2JZNA 1RZ3A 2G4LA 4IS3A 2CMFA 2PS3A 1RRGA 4L6CA 2VRCA 1K6JA 4HN9A 3OTQA 1B41A 2PNJA 2FDRA 5EE0A 3VRHA 4KDFA 4QBIA 1XD8A 1XDUA 5L3QB 4NOMA 3NC1C 1NMZA 3NETA 5FTNA 4X7BA 3HVJA 4K1XA 3NGLA 3A36A 1JHRA 3ENKA 3MOIA 4M7OA 2F62A 2JZOA 1PT9A 2PLRA 1NWHA 3L7LA 2QVXX 3UW1A 3JALA 3WLLA 3TGLA 2AZXA 1UXKA 2O8CA 1CF4A 1B8PA 4J6FA 4RHUA 1TKRA 3NHLA 5CURA 1E6LA 1A8SA 3MERA 4RVOA 1A4UA 2HWXA 4FBMA 2DHCA 5EPOA 2A3RA 2C2BA 2ZRGA 1HDRA 4F4JA 3OZSA 4ZP1A 2GWHA 5KREA 5EWMA 4V1CB 3NR2A 3WL7A 1V16A 3QU7A 1PL7A 2YRXA 4RAOA 2FEOA 4RMJA 3L1JA 2M1XA 2ZJ8A 3R3SA 3N87A 5IARA 1J4AA 4Z1OA 5IJWA 3Q7EA 3W5AA 1HNWB 1IY0A 1ZM3A 1JJFA 4QOSA 4M6WA 3NRJA 3FPSA 3D3NA 5KTTA 3VDMA 4KN8A 1A0OA 4YLGA 5A7GA 3VPXA 3F5QA 2WYVA 3GZNB 3OFNA 1KY3A 1K3FA 2XE6A 3E1KA 3OIFA 3QVUA 5EYPA 5HK8A 5B30A 3H9UA 5DASA 1P5RA 4A2WA 4EW2A 4BXOA 1EGAA 1MR3F 1D1NA 2NPIA 5CIYA 1JFTA 4AN0A 4QHYA 5LA6A 3CXRA 4B6OA 2Z4SA 2QLBA 2GYWA 1ZMBA 3RC2A 1CUHA 1Z07A 2VVTA 3PC2A 1PW5A 2IEIA 4X1KB 2O1SA 2C5HA 3M1YA 1GCAA 3SLKA 1ZOPA 5ALGA 2AG5A 4D9KA 2IBMA 1VMKA 4H7PA 3M1LA 2A58A 3O83A 4Q7LA 4JT9A 2NQ8A 3ICWA 2WZDA 4LCEA 4Z2YA 4BECA 4FR2A 3GN2A 3O31A 2PYDA 1K9MD 4DSAA 1KJ8A 3F3KA 5KVVA 4GYWA 2BM0A 3C45A 3PRJA 2HSJA 4JQSA 4R7ZA 1L4LA 3QBJA 4BU0A 4BLQA 5EGSA 5CU7A 3OPQA 2HTFA 1TYBE 3UM9A 2CF5A 3RYTC 2AA3A 3EG9A 2VNAA 2HSDA 4BFWA 2F90A 2QDKA 3I1JA 5EXPA 3DZCA 3H4VA 5CG1A 5JXHA 5HFNA 4TZKA 5K6AA 1XZQA 2HQSA 5AKHA 1R4MA 1WBJB 2HF9A 2HBZA 3EPPA 3KHTA 4YX9A 2WEKA 2VP6A 2AC7A 3OTOB 2IYTA 2F00A 4S0ZA 4X20B 3WGHA 5K20A 1L5KA 1Z5UA 2FPXA 4X6YA 5F51A 4C21A 1YOVA 2FXIA 4U8HA 4EMUA 1WUYA 4A36A 1TU3A 5BVGB 1UBMS 1GZUA 2Z4TA 1B23P 4EY4A 4JA0A 4EUFA 4TSFD 3H1BA 5JFOA 4W5OA 1IHMA 1YKSA 1Z4IA 3UAXA 4YV7A 3E2MA 1YCHA 4P22A 2Q62A 2WUDA 3EUWA 3RIYA 4CDRA 2DJ5A 1KKMA 4M7WA 1BU5A 1UKAA 3OZVA 2QRVB 2CJXA 4FZ3A 3VR4A 2ZL6A 3GVJA 1G9XA 3L0CA 4MPRA 5EJMA 2EZ8A 3GFRA 1F60A 1Y9EA 4I3FA 1KC1A 4OOSA 4Y2QA 1B8VA 2L17A 5FFFA 2PGNA 2DFVA 1CR4A 1Q7EA 4PZCA 3ESDA 1UJCA 2FP3A 4O4JF 4B4VA 2JCSA 1VMDA 1GT91 4A10A 1RLUA 1U94A 2G1KA 3EE6A 3LSYA 3QX9A 4JJKA 4M8KA 2FOIA 4QYXA 2A57A 1LPPA 4XYGA 4WDRA 2P1DA 1EMDA 2I78A 5FL7D 2EW1A 3NP7A 2W42A 3LY9A 2AK2A 1E6CA 1OT5A 1TAGA 1U6IA 1YOVB 2PBFA 5BSGA 2JFXA 4GBMA 4W9MC 4WXPA 3LDFA 3SMQA 5K8UA 2OHXA 4IEEA 3WJAA 4DLLA 2YN4A 4RTOA 2XVMA 2D2FA 4KLAA 1H66A 1XAJA 4JELA 1VFNA 3N75A 4C7VA 2A1UB 5J43A 3O1JC 1SK9A 2GN2A 1Z7WA 3O4GA 1E7YA 1PBTA 2CXPA 2J9RA 3LVQE 4PPGA 3UOWA 4JT2A 3DOJA 4B3FX 1WKBA 3DDZX 4HQLA 1HFEL 2NVOA 1YR7A 1KY5A 1QM5A 2CDBA 3DMRA 3IXQA 4ZT2A 3ZW9A 1EP2B 1PHRA 1EK1A 2JIDA 4U02A 4UMDA 5LQDA 1H2AS 4MQUA 2FSUA 2EF0A 1UEXC 3RGGA 1YZVA 1DAGA 3U7RA 5CCDA 2JD1A 3B