4N3GA

Crystal structure of eukaryotic translation initiation factor eif5b (870-1116) from chaetomium thermophilum, domains iii and iv
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GKGVSVQASTLGSLEALLDFLKDCKIPVANVGIGPVYKRDVMQCGIMLEKAPDYAVMLCFDVKVDKEAQQYADENGIKIFTADIIYHLFDQFTKHMQEQLEKKKEESKMLAVFPCVLNPVAVFNKTNPIVVGVDVVDGQLKLNTPIAAVKMNPTTGQKEIISLGRVTGIERDHKPLQVCKKGQPAVAIKIEMGGHQPAYGRHLDEKDVLYSHISRASIDVLKQFYRDVVTTDEWQLIIKLKSVFDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5B-like protein, eI
publication title eIF5B employs a novel domain release mechanism to catalyze ribosomal subunit joining.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum
total genus 68
structure length 247
sequence length 247
ec nomenclature ec 3.6.5.3: Protein-synthesizing GTPase.
pdb deposition date 2013-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4n3gA02
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 4n3gA01
4HE6A 5H59A 4FK8A 4M0LA 4YALA 4M53A 1Q82D 3AGPA 4B4DA 1OGIA 3B82A 3VO2A 2VNHA 1WDTA 2RC6A 5TV2A 4YAFA 3CD6B 2GQFA 3ZZ0A 4P3YA 2QA4B 1JA1A 3W2EA 1E62A 4MYUA 3CCVB 3CCQB 1CNEA 3VO1A 2FX3A 1BQEA 1K8AD 3AVTA 4P6VF 3CC7B 1JA0A 4NBSA 1IB0A 2B5OA 1TUIA 4H9GA 4PC7A 1D8TA 1YJNB 1R5OA 1YJWB 3AVVA 1Q86D 4PGOA 4TMVA 4BPRA 4YAWA 1W87A 4TMWA 4WQMA 3QFTA 1CNFA 4M4SA 2YWFA 4KJZA 4RCYA 1FNCA 3ZBTA 4PC2A 2HDNB 5GV7A 1ELOA 1BX0A 2DCUA 2BN4A 2QN6A 1AIPA 4YHBA 3QSYA 1EP3B 1FRNA 3QFCA 3MMPA 1Q81D 2GPJA 5DSZA 4PC1A 3VMFA 4ZCMA 2BGJA 3WNDA 3OZVA 1QGAA 2PIAA 5TR9A 1QFJA 2B7CA 1VQ7B 1EWYA 1QH0A 3CCMB 4ACAA 2VNJA 3LVBA 1W35A 1XE1A 3W2GA 2VYQA 1VQ6B 2EFGA 2XNCA 1OB2A 4B43A 4AF6A 2OK8A 4B44A 2B7BA 5TY0A 4G5GA 4ZGQB 1IJEA 4RD2A 4DQLA 4G1VA 1QUFA 3AVUA 1I7PA 1W34A 4Y9RA 4TMZA 1QFYA 3CMEB 3WXMA 2EIXA 3CCRB 3OW2B 2CRVA 4FN5A 4R71A 3VNVA 1XB2A 3I55B 1VQ4B 1KJZA 3WYAA 3B8HA 1QGZA 3OZWA 3W5UA 3FJOA 3ES9A 4LBYA 4RD0A 1FDRA 2BV3A 3CCSB 2OK7A 1K73D 1GR1A 2BM1A 3ZBUA 4TMTA 1VQNB 3I1FA 1Z9BA 4N3GA 2QEXB 1FNMA 5FA6A 4PC6A 4RCZA 1KQSB 1FNBA 4ZV4A 2X3UA 3E1YE 3WBJA 1QFZA 4M2LA 1D1NA 1DDIA 5EMNA 2QMUA 1Q7YD 3CCEB 3AVYA 4LBZA 1U2RA 2XNJA 1DARA 1E64A 4IW3B 2BMWA 3B78A 2VZLA 2QTLA 1D2EA 4B3XA 5GV8A 2VNKA 3J81k 1UMKA 4TN1A 3VNUA 1S0UA 4QFMA 4ZCIA 1H85A 4Q7JB 1A8PA 1OB5A 1S72B 4F7DA 4ZCLA 3U6BA 3CCUB 3W5VA 1B23P 2E1RA 1VQ5B 3W5HA 4QHYA 3W2FA 2D74A 3QE2A 4U9UA 4EH1A 1F60A 4RJLA 2BGIA 1ZUNB 4N3NA 3E20A 2HMAA 2QDXA 1YITB 2OTLB 3MHPA 2ZITA 4UAJA 3CMAB 1NJID 2DERA 4AF7A 3CCLB 1VQ8B 3LO8A 3CPWB 1G7RA 1F20A 3OJWA 2CNDA 1SM4A 3SJZA 4LC0A 4B48A 3CRZA 3JQRA 1HA3A 4MYTA 3WY9A 2PMDA 2XEXA 1QVGB 1TVCA 3CB4A 1KK2A 1BJKA 1EFTA 3AGQA 4PC3A 1OGJA 3P26A 2BPOA 1VQKB 1YI2B 4RD6A 1EFUA 1ZM9A 1ZM4A 1G7SA 3W2HA 1EP1B 2NPFA 1EFCA 1KK1A 3U6KA 1VQMB 1GVHA 4M1KA 1K9MD 2J7KA 3G71B 5H5JA 1SKQA 3MCAA 1M90D 1KC8D 2YWEA 3WNCA 1AMOA 2BM0A 5HXBA 1DG1G 1VQPB 1N8RD 1CQXA 3JQQA 4YAOA 2HCJB 4C43A 3CC2B 4B47A 1GAQA 4AC9A 4ACBA 4LBVA 1E63A 1DDGA 4FWTA 1KTVA 5KSWB 3OJXA 4ZGNB 1YIJB 2C78A 1TLLA 4NCNA 3FPKA 1YHQB 4YAUA 2VNIA 4HE5A 2YWHA 3V76A 1H42A 1G7TA 3G4SB 2QTZA 2BF4A 3I56B 2DETA 1J9ZA 2R6HA 3ZZUA 4Y9UA 4K1XA 4TMXA 1VQLB 4RD4A 1QX4A 1ZM3A 1JB9A 3AVWA 4C0SA 3CCJB 2YWGA 4RD3A 1EP2B 1G7CA 2C77A 1B2RA 1GAWA 1R5BA 3W2IA 3JQPA 3WNBA 3CXCB 1KD1D 1M1KD 3ZC3A 1N0VC 3U2QA 3G6EB 3WBKA 4DQKA 1GO2A 1KK0A 1JNYA 5THXA 2BVNA 1QVFB 1TTTA 1KRHA 3CW2A 5JBQA 1FNDA 1N0UA 1VQOB 1QUEA 2PLFA 4Y7CA 3QFRA 2BSAA 1KK3A 1NDHA 3ZZTA 1FRQA 4RD1A 2DY1A 1QG0A 3CC4B 3OZUA 1IJFA 4J0QA 3AVXA 5AN9A 1W2BB 1R5NA 1EXMA 4LBWA 4G1BA 2OTJB 2DEUA 1JJ2B 3P27A 1YJ9B 3QFSA 1GJRA 1QGYA 1BX1A 2RC5A 3PENA 1VQ9B 1ZM2A 2AHOA
chains in the Genus database with same CATH superfamily
4S05A 2ZL6A 1J39A 4G4SO 2YKGA 5EIAA 5JWHA 4L4ZA 3K1JA 5LQJA 4IHQA 3QEMB 5ERYA 3P2JA 3HG7A 1RBQA 1XHEA 2HI0A 2WAXA 1NR5A 5FOSA 3TTVA 1FX0B 1SHUX 4HDKB 4U2GA 5AJHA 2ZCUA 2AEMA 2ALJA 3H2GA 1E1LA 4YDRA 3LDAA 1JX6A 3NGXA 3E2PA 2KB0A 4JLDA 5JJKA 2ZT5A 5HBGA 1P1KA 4RZXA 1FQKA 2D0PB 1DGQA 1JA1A 2JAQA 4R2XA 4RY8A 5KTRA 1C0KA 3F3SA 4R2KA 3G0BA 1WW2A 2VAMA 3EVTA 1G9TA 3QRWA 5ALOA 1R8SA 2A78A 4UOQA 2BKXA 3L46A 4HNVA 3MSXA 4MXDA 1RYZA 1EGVB 2TMGA 4MV7A 4BKMA 2VNSA 3LUGA 4EA9A 5AH0A 2VJKA 1CLUA 2GJPA 1S3IA 4CV0A 1OPRA 4RGBA 1F38A 1X7WA 1JA0A 3CUKA 1RPTA 4H7KA 2EKQA 4ENPA 2E49A 3CX6A 1A1VA 2VG8A 5IAGA 2P35A 3KEMA 4EKEA 2GBIA 5BN3A 2N1BA 2VSYA 4X6YA 4ARCA 3GAFA 1BWQA 4HWGA 4FN4A 2YRWA 2WUWE 4PBRA 1J5PA 4L0DA 3CURA 1Q14A 4KMSA 4PPQA 1XEXA 3RYHA 3VNRA 3GVIA 1DTEA 3THWA 1V7PC 1Y8QB 1C8VB 2ZTHA 5AXBA 5KYUB 3V7WA 1O58A 1S01A 3BD8A 4Q48A 3WL3A 4TMVA 4BPRA 3A4NA 1KI7A 1Q92A 2B8WA 1H2EA 2AR9A 4V0MA 1IOLA 2X7XA 4RDCA 1G60A 2OCIA 1ST3A 3IV6A 4L9AA 5DK4A 4M6WA 3QU5A 4TWBA 1IWBB 1QYCA 4EY5A 2HMWA 1Q11A 3ROGA 4AMBA 4AICA 2PY6A 1TJYA 2X5JO 4BRSA 1AQJA 4MMXB 4H35A 3NONA 4LPKA 2M9MA 3TD2A 1DWQA 3BMCA 3VISA 3D1VA 3KWLA 2HLDA 4NENB 1F48A 1K8YB 4IH9A 2UZ0A 4D9IA 1B6TA 4L57A 2BSXA 2IBMA 1CCWA 2C9MA 3TD9A 5ARCA 4QFBA 4QT4A 1KI6A 5JH7F 4WFIA 3UICA 1PV4A 3R6TA 3AHFA 1V16B 1CZNA 4B3RB 3F3KA 2NN3C 1AGRA 3FVRA 4F96A 4KQ9A 3HKDB 1HDRA 4II3A 3F4KA 3I09A 1O4WA 2I4RA 3WLFA 5IWAB 3E9EA 4JENA 1FLVA 1JDSA 4IIVA 2HREA 2NU8B 2PNFA 4OHMA 3P71T 4I36A 3W6UA 5J4VA 1C2YA 1PJ8A 2CLOB 4N48A 2NP7A 2YXPX 3OZVA 2VOEA 3V34A 1GNTA 3RC8A 4EI2A 1V3TA 2WC1A 2O2GA 1NJSA 1QRUA 5LKAA 4NOLA 2A7QA 4CMAA 2BFCB 421PA 5TR9A 1MG0A 1N7GA 1ODKA 2OGWA 1ZY2A 2AHRA 4G0ZA 4TV9F 4ZRNA 2YJ6A 3WTBA 4D2IA 1NOJA 3VPXA 1OFUX 1Q84A 1UIRA 3M6VA 5DISB 4EEXA 1QDEA 2HO5A 2W2KB 2WU0A 1I33A 3CJQA 3OZTA 4GYYA 4D8TA 1OY1A 2JA2A 3FVTA 1M6VA 3EAQA 3IRUA 3JYPA 3JW8A 3LFTA 3N0VA 1I6LA 1RI2A 4AQ7A 1NMZA 5FWXA 1WPQA 3A0UA 1VG1A 2ZU0C 1CZLA 3ETEA 3PUHA 1L5OA 2RH8A 3OTIA 4PLFA 5IJ0A 3U5TA 5DT2A 4D4MA 2D2XA 2UZ3A 2GEUA 5AW3A 5IHPA 1CJBA 5FO0A 1DRUA 3I9MA 2PT9A 3IS3A 4QYMA 3JD4A 3Q1KA 3E9NA 5CPFA 4ZVVA 4DJ5X 4LMBA 3ASQA 4P81A 4W4TA 4CM8A 4BEWA 4I55F 4F71A 1TFRA 1MABA 4ZYUA 1U80A 1IONA 2QD3A 4PLCA 1MZPA 1NN1A 3FF4A 4KI0A 1Q7RA 1O96B 1Z39A 2O2ZA 1GGVA 1YGPA 2HLDD 4URHA 4K03A 4DRZA 2A0UA 1HDXA 2WWVD 3EZ9A 1X70A 3UK7A 2F59A 1A98A 3MEQA 3OZXA 3ZEIA 1GCOA 5LP6C 5REQB 3CV3A 3F71A 1RRGA 3T5BA 1AKRA 1RLUA 2FWBA 3PV0A 4Y9RA 1ZGAA 3T99A 1Z0UA 4CEHA 1QFYA 1JR3A 1YZVA 3LQEA 4N6GA 1IHXA 3DLIA 4YRSA 4GH5A 1DXHA 1G5TA 1MC4A 1OVGA 3V80A 2JKYA 2PN1A 4UNIA 5GVRA 3W34A 2IODA 3IPYA 1JDJA 2B8TA 1QP4A 4IL5A 4OSEA 5J1SB 1OCEA 3FBTA 1P5ZB 1JG1A 2OUIA 2VK2A 3CVUA 3K5IA 1Y3HA 1G21B 1U2GC 9ATCA 2A1TR 4PS1A 1OT3A 3DZHA 1GL3A 2QV0A 3PNPA 2BDTA 4M99A 3FOCA 2A33A 5AHKA 4BE9A 4DV5B 4LBYA 2FW9A 3TRIA 3PXCX 1FSGA 4NMWA 1XC7A 2D1FA 3W5AA 4LX8A 2HU7A 3CHYA 5K0FA 5JBIA 1NN0A 4LPSA 4EZBA 1EXWA 4EJSB 2HWWA 1KY3A 2Q3BA 3KJEA 2XXAA 3PXUA 2HLPA 3OTQA 2JLQA 3D6TB 4RACA 3Q12A 3DEKA 4QDJA 4RF5A 2BI8A 3IMKA 3HNRA 3SFTA 2AOUB 3CN9A 4PC6A 1XQ1A 4JQOA 1J09A 1XQXA 2IYLD 4BQIA 4EW2A 1MAWA 4BNMA 1QHHA 1KIMA 2X3UA 1BC5A 1OYOA 5ALKA 3QMMA 1QOZA 3IOMA 1SPXA 1VYTA 2FWRA 3GGDA 4N39A 5DASA 1M2KA 4ZAYA 1ZH4A 1MOQA 2F3SA 2RGAA 4KV7A 1TT5A 2AG0A 5E9QA 4B6GA 5ELXA 1F4LA 3CCFA 2JLWA 4OGFA 5E9JA 4RGQA 5LA6F 4FI3F 3P9KA 4PM4A 3NPMA 3WGYA 4BMSA 3AESB 4NH4A 2OXEA 4JC0A 4TKUB 3U5ZB 2CVPA 4XQGA 1P6XA 3OOJA 1F4PA 1NC3A 4FWIB 1X0VA 5GV8A 1Y5NA 2AEFA 2VNKA 3OJCA 4EHDA 4FGSA 4HGZA 2JK0A 3S81A 5LYYA 2HXSA 3T5DA 3PPXA 4HUTA 4K9PA 4ER7A 1Z2NX 1S8AA 5DDIP 1U0NA 4CIWA 3F9RA 2IYUA 2Y1DA 3C39A 4G1CA 5HJEA 1THMA 4ASUA 2CNBA 1BN6A 1H85A 1GGJA 3NAGA 4O2BB 4DCGA 3BEDA 2XUZA 1T9BA 3P32A 1HNXB 3G0HA 3NVDA 3FETA 1F0KA 4PO1A 3HUFA 3IR5A 3U26A 2FQWA 3IMEA 1MDBA 2ZJ1A 3DDWA 2AF3C 1WL8A 4LMRA 4GOLD 4HNAA 3S3TA 4C1NA 3K70C 1V95A 4AXXA 2ZP1A 5JDIC 1JJIA 1OFGA 2EJWA 2GUGA 3VU3A 2WE7A 1ZJZA 5CMLA 3RVJA 7ADHA 2Q2OA 3MIIA 5GP1A 3FE2A 2C5GA 3NBFA 4JT4A 4B4VA 1FDVA 4MV1A 3B60A 1UPBA 5FBKA 2YZGA 4BMCA 4LXGA 4RJLA 5LFAA 1ILWA 2NXNA 4D92A 1QRSA 3ELBA 1XXHB 1IOZA 1N57A 1FJHA 5BWOA 4DL9A 3C2QA 3MHPA 2QRGA 4JVSB 2R79A 5DH9A 3AR6A 2QM0A 2VT7A 1NW4A 4M0EA 5PNTA 1JFRA 1GIAA 2PFGA 3MINB 4FMPA 5LUBA 3QU7A 4ADSG 4CEIA 3RUAA 5D5QA 3OZBA 5A3RA 1V1RA 2QOEA 4DF3A 3AHJA 2B4TO 3EMKA 1ZMTA 1RAFA 4IEIA 1H66A 1OMOA 4NCKA 3BXOA 3EVBA 1F06A 2BUAA 4JMQA 3RVRA 3ABSB 2V6MA 2QMOA 3CVJA 4X97A 1XZGA 4ETNA 1T9DA 4CXMA 1IM2A 5GGYA 3ZYZA 4C4PA 4C9BA 3WGZA 5AUOB 3PWTA 3SEAA 3R0VA 1I01A 2XIQA 5CVTA 4G25A 3QTTA 3TF5A 2P2DA 4XW2A 3VUFA 2A0KA 3I58A 4KO3S 3TNYA 4M3NA 5JXHA 2I6SA 2CL5A 2R7AA 5CAEB 3QPUA 4UD2A 3G9UA 4CQJA 5DYWA 1P4RA 3HFRA 4RD6A 2WAOA 3N2GB 3CGWA 1MO3A 2E3JA 1PVVA 2FB9A 2XLCA 3PHBE 3R3HA 4KXVA 3D4OA 2RHLA 4XJXA 4B2PA 4ER6A 2GZDA 3BE5A 5JH7A 3ECSA 2GO7A 1YZ3A 1I1OA 2VNAA 1SEPA 2ZR9A 4D0SA 1RM4A 3ZJ5A 2EWVA 4BNDB 1TYZA 3F2IA 2VTVA 3LQFA 4R41A 5E0KB 1B8NA 2J33A 3AEUB 2XVXA 3CRRA 2C5SA 4O63O 1AHPA 4JBLA 4W9NC 1DFGA 1NATA 2DUNA 3SR4A 1CVIA 1D0IA 2RDMA 1GQOA 2BGTA 4HH0A 1NJ2A 4D57A 3GA7A 5I7RA 1C4KA 2QGFA 3HZZA 4YJ2F 4EYEA 4RLFA 2HV8A 2P0EA 5LBTA 4J2OA 1G20E 4IUBS 2D2EA 2PMFA 2KX7A 1I2AA 1I3LA 4Z4YA 2OEPA 1SU6A 2B8EA 2ZQ5A 4QODA 4X85A 5ALLA 4YAOA 2WUFA 5CT4A 3KZMA 3H2ZA 4KBFA 1LDEA 2QW8A 4RY9A 4TV9A 3UYLA 2M1XA 4B47A 5EKUA 3ZV7A 2XUOA 1B00A 1P1HA 3E3AA 3WK6A 1X87A 2RGCA 1XCGB 4V02A 4F3TA 2WFZA 2UVPB 2G5GX 2QTBA 3IVAA 4DCJA 3RAGA 5EWLA 4LF8B 5AM5A 1TQ4A 1XRMA 1ZH8A 3AERA 2OXTA 2LGJA 1RPJA 3M33A 1QSGA 3NP9A 1VYUA 4GMXA 2QRHA 5CB6A 4BX0A 4E33A 1TCAA 5M29A 2G09A 3OURA 4IQ4A 4INAA 4QU5A 5JBNA 4KIFA 4E4TA 1Q0PA 2G4CA 2CB0A 4PG7A 1D0SA 4HAZA 2HB6A 5AT1A 3E7XA 3PNKA 3UVEA 1G41A 3OJFA 5F64A 1JEYB 1IPFA 1TK3A 3O7WA 2YWCA 2YINC 3OCZA 1PR2A 4I55A 2C5HA 1YIJB 4OVKA 4QDXA 4Y6SA 2OUKA 4ZVQA 5IYWA 5TMEA 5C1BA 2VXYA 4DR1B 3Q3VA 2HYIC 4Y2UA 3PUIA 1NI5A 1WLSA 2DHDA 1O7JA 2PLAA 4JGGA 4V0RA 3ZHVA 4KP7A 2I7DA 2W6PA 3ROEA 2ZJZA 1MEJA 3ZCPA 3PX2A 4Q1FA 2XUPA 3ENWA 4JH0A 1C1HA 2AI3A 5FLEX 3KCNA 3DDYA 3GFGA 4QPJC 1YHQB 1WP9A 5IEBA 3JD0A 2AFHA 1ISGA 4XM2A 3L6UA 1WB5A 2DFDA 5CPBA 1AKNA 3N2KB 3VBEA 2ZG6A 4CM5A 2ID4A 3PQEA 2XWQA 2IUUA 4AKEA 1ADBA 1MG5A 2VXOA 1QLWA 3HJRA 3TXAA 5ALXA 3ZG6A 1VKOA 1U9ZA 4LE1A 4X00A 4J6FA 3W3ZB 1F0YA 2JCXA 3KEOA 2PQ0A 1J9ZA 4B7ZA 1LUAA 5LU9A 5M2QA 2BFFB 4Y9UA 2Q3HA 4RK0A 4H17A 3ZZMA 5EWMB 4P6YA 1MENA 4MQEB 4YT5A 4F3CA 4UFPA 2JLBA 2OCDA 4KTVE 1TGVA 1VMIA 5DNCA 5KOHA 1A76A 3QEBZ 3OQIB 4CG3A 3C48A 3G2JA 4WKOA 2B2CA 4Y9DA 3VO8A 1LVGA 1DIRA 1REQB 2IU3A 8OHMA 3IIEA 2XQVA 2OBYA 5CVVA 3D6JA 1PT5A 1N77A 2XDQB 3ZIDA 3KU4A 2V8OA 5GIOE 5EMJA 2X8KA 4J9VA 1CIPA 4N0MA 1ZJ5A 4ALKA 3S1AB 4BPBA 3FM9A 2BMAA 2FW6A 3TQRA 1SZJG 2BBWA 3AUUA 5K3FA 1RLOA 3RI3A 3DAYA 1CLEA 3F74A 3K9CA 3N2YA 3WKAA 1XZAA 5I9TA 2EQAA 5H02A 3VU8A 2BVNA 1ZDMA 4GKVA 2H11A 4FJ1A 1WSAA 1OAOC 3KWJA 4L6CA 3F8TA 3T1YB 1KRHA 4UHBA 5CLGA 2JHCA 2HMTA 1BCSA 2JFOA 3BQ9A 4EHLA 5K5EA 1JH8A 3B53X 5BOSA 1VQOB 1LBQA 3NVKI 2D0OB 4PAQA 4RZQA 4Y7CA 1BXRB 4I9NA 2R96A 2HW8A 2X9QA 1J5XA 1GCGA 5IEJA 1OPXA 5LA6A 5T41A 2I0FA 2JBHA 3C15C 3QKRB 6ABPA 2J59A 3DZDA 1A5SB 2JFBA 3D3WA 3K6RA 3L05A 4JYBA 5B58T 4AKIA 1IVYA 1QIFA 4P31A 4C3OB 4DIOA 5C2JB 1O2DA 1QE0A 4TTAA 4X90A 1U7TA 3PSAA 4YV7A 3KSDO 2ECKA 4GRDA 3C3YA 3X0DA 5AN9A 3QBEA 1ZGZA 2EYQA 4CLHA 2AXEA 2FN8A 3BKWA 1N2EA 4G0MA 4C4ZA 3QVJA 5D6NA 3DLAA 1L7EA 1FSSA 2B9VA 3QWIA 5EZQA 1FOEB 4WKPA 1OC2A 4X61A 5F98A 3BE6A 5JPCA 4EDFA 2YJ5A 4DWJA 1VYHA 3SFZA 4QVJA 4EX7A 4L51A 3JQBC 4XZ3A 3LOPA 2JIRA 6CHYA 4IFIA 4TS1A 2LIVA 2XF8A 4MV9A 1SR8A 2Q9UA 3ZZNA 3JR7A 1SHZA 1C1DA 1G6Q1 2C31A 1WB4A 4GPBA 5CNMA 3OKXA 2AC4A 4OXXA 2QVGA 5JSHA 2DFNA 3K0AB 4UZUA 1YT5A 1RJEA 4ZO6A 4NPAA 3VMMA 4QUBA 4DMMA 1YOVA 3OZIA 2H2IA 2WFLB 4NBKA 1XDBA 4Y67A 1I2ZA 4H6PA 4W9RA 1JNXX 1LV7A 5IDXA 1CEEA 2HMUA 5EZSA 3IP1A 2QZSA 4NYIQ 3ANMA 2UYCA 5ANRB 4CCWA 4OHFA 1EFPB 3T53B 3CD6B 4CTNA 5JY6A 1EP9A 1TA9A 4YR7A 2FQXA 1O87A 2A9QA 2ABWA 3A9UA 4IQ0A 5JMWA 2V96A 3W9BA 1M5RA 2FETA 2UZ1A 1GZUA 3DLBA 1OYWA 5FUBA 3A1NA 3RUDA 1GXSB 3FTFA 2RI0A 4PG4A 3I2HA 4G37A 4QATA 2X7HA 4NU0A 2DQKA 2VAXA 4FFVA 3MC1A 121PA 4D99A 2Q5LA 2HPAA 2WZCA 3HRIA 4WEQA 3V8VA 1GQSA 4NZOA 3LUKA 1CW2B 2EFCB 1FU4A 2F1HA 4H7FA 4WESB 3V2UA 3WRXA 1UM9A 4JP2A 4XX0A 1X7XB 5D84A 3WLPA 1W5TA 1OTHA 5E2AA 1Z63A 1UBMS 3MB5A 4WZZA 3R5FA 2PRKA 3GNLA 3AQIA 4G1FA 1AUPA 1UPXA 2J9FB 2XQGA 2BHRA 1XZEA 1FSFA 2NSYA 3PF8A 3FOWA 4JJ4A 4JODA 1FDSA 1WOPA 1GNRA 1M7GA 1KEWA 3GGPA 4WZ6A 4FUTA 1GVNB 2GCPA 1HKUA 3AR2A 4KO8A 1U1GA 1A88A 3CRQA 1ORWA 2BFNA 4L8VA 1DX4A 3P9RA 5CT6A 1YV9A 2YHUA 5LDDC 4WVLA 3AJDA 4BVGA 5A6SA 4YP6A 1JPUA 1TQ8A 3OCXA 4BFLA 3IQEA 2V6FA 4D9MA 2R1TB 1QIIA 2QTCA 3O8BA 5CJPA 4NBVA 4GNKA 4FB5A 3AP2A 4KLNA 4UTVA 4C3UA 5DWDA 2AQ8A 1J22A 5A3VA 1GGKA 3T5AA 1ZA1A 3LLCA 2WYWA 4MUYA 3MBOA 1RKXA 1T6YA 3E3MA 2DUJA 2PQ2A 1SG0A 3HHEA 1L6IA 1UD5A 2G83A 3FKSA 2HV9A 2DKOA 3NWJA 4QNRA 4RE6A 4YECA 1FEZA 4S04A 2O1XA 1L5ZA 4YJ2A 3C24A 3T0IA 3B1YA 3TFOA 2ZVPX 3UV6A 3OFNA 1PK7A 2QY9A 2GPWA 4OXYA 2FSIA 3OETA 4EI7A 1AOXA 1I4OA 3EG9A 3KKNA 4M1YA 3WGMA 1C0IA 2WT8A 1KYTA 3E1SA 3AKZA 1MQ8B 5LMCA 1K6MA 1SUIA 4PC1A 4RPHA 1TM7E 2AX3A 3D7LA 3MPUA 2D1RA 5DGHA 2XVZA 3IV9A 4LTNA 3SJUA 4UC0A 1NVDA 4O0LA 1G2QA 5EI5A 3A04A 1B8VA 4LHYA 1KSGA 1QGAA 3KZ1E 4GNRA 2BZGA 3FGPA 3GGSA 4BRZA 2PLNA 2NV6A 5EZYA 2ZTMA 3ADPA 4EL0A 3BMXA 4WXPA 2IUEA 5CVJA 1GGFA 1H9AA 2XI4A 3B52X 3STXA 4F06A 3L7OA 2ZXIA 2LCFA 3PXGA 1QB8A 5BPFA 1LTHR 2PYIA 3WL8A 1SUSA 4R8LA 5C34B 4DCMA 5I47A 2ZT7A 1N92A 3CCMB 1FQOA 1IZ9A 4D9BA 3KJIA 10MHA 4L73A 2MWMA 3F46A 4ACAA 2O6LA 3DHNA 3LDFA 2E0IA 3JATB 4ZZ1A 1BD4A 4U1RA 2CF5A 2GZSA 4QT0A 1DI0A 2J32A 3QNMA 4YMUA 3RJ5A 4I9GA 1XE1A 1DQZA 1SBCA 2I65A 2JCBA 2VYQA 1M6WA 2P9TA 3CA8A 5BQPA 1M7HA 4B8YA 3UWOA 2YY5A 2HBQA 2NXWA 1Z4QA 2XTZA 3DUWA 3L8EA 4FFOA 3Q5EA 4TVOA 1QHGA 5DHTA 2IP1A 2P9YA 2ZTLA 1IXKA 4UTOA 2O3TA 1XTKA 4KQXA 4PAOA 3GT7A 5AKGA 4Y6QA 4CIDA 2G5PA 2QN2A 2FSVC 4MVCA 4XI9A 4AF6A 3LH5A 4Y2VA 2CLHB 3EIFA 3M81A 3WS7A 5EKTA 4JR2A 3ND6A 2R7MA 3FKSD 1JTEA 4I9FA 3B6KA 5I48A 5FJIA 6AT1A 4GPD1 2GRJA 1R9GA 1YK1A 2BHLA 1S02A 4JJFA 3TAHA 1WPGA 2TYSB 3OFND 5E4FA 3T7DA 2WTMA 4X3CA 1F2UB 1JIUA 2FMTA 4X45A 1O6FA 4WXHA 5JZ9A 3NJRA 3B6ZA 4B6PA 4XJTA 3O03A 3AILA 2QTWB 4R81A 2ZK7A 3CCRB 4XJSA 4YCCA 4ECAA 3WA6A 2QLMA 1GFWA 3BSFA 4KWHA 5FXMA 1TF7A 1TMGE 1T5OA 3TW6A 2EZUA 1VQ4B 4N3CA 3K70B 4IMPA 2GZMA 1SEVA 3PX3A 4PFSA 4M1ZA 3PLAE 3SSMA 3HO8A 2PL3A 3VKVA 3IKMB 2ZI3A 2ZUDA 1UAYA 3B8HA 1CSEE 4UU7A 4GGMX 3DDSA 4L5YA 4R8KA 4EJMA 3WFZA 3LC7O 2V9ZA 3ETHA 3WKDA 1J24A 1TZJA 3L0BA 2XWSA 4F84A 1EM8A 1TZCA 4OJQA 5CDFE 2OK7A 3KLNA 3CKMA 3KL2A 2JLVA 2GSWA 2PQ6A 1T36B 3I34X 4D4IA 3MJ4A 3L82B 1RQLA 1O95C 3LD9A 1CY0A 2GEFA 3WAGA 2F3RA 3PQFA 5ALIA 4J0GA 3ZU2A 4BHTA 4E70A 2Z04A 5ENVA 1PUXA 3QVWA 1VI5A 1LLCA 3GAMA 3O9VA 5IAAA 1QPGA 3TI9A 1A9PA 2X77A 4LCJA 3IIJA 3D7NA 4TLBA 4DA6A 1VHEA 4JBXA 4BOYA 3PSHA 1IZ7A 2GJSA 3HBMA 4Z4RA 5HE8A 3T6KA 2DFTA 5JVDF 4ZV4A 1W4RA 4EGFA 1XZKA 3QYJA 2YBEA 2AJDA 3L0SA 1EZ1A 3LPLA 4YO7A 1RPAA 2X42A 4WZTA 1B8UA 1T5LA 1A9QA 1XD2A 4IJ5A 4RK1A 2EGGA 1D09A 4FMCB 4A0SA 1A4UA 1MVNA 4FGJA 2VCEA 5AK0A 2R8PA 1C9EA 1ESZA 2CCKA 2ZUBA 2WSIA 4YONB 2GKOA 2XNJA 3PIDA 4BFVA 3G7SA 1Z0AA 3ACDA 4X8HA 3SEZA 3T3HA 1ZICA 4GZ3A 1YI1A 3H9QA 4AMVA 4G65A 5D3ZA 1YVEI 1FU7A 1OFHA 4GVPA 4IQGA 4ZGWA 4W5QA 4ALIA 5CLIA 4H1VA 1PUJA 3OCVA 2DUMA 5DU2A 1A7KA 5FTKA 4JITA 4EG1A 4AKTA 4HS4A 3U0BA 1OWNA 3TG8A 1YU9A 2DIEA 1C7EA 1FSZA 2H0QA 2PA3A 4HFRA 4UE6A 4W5JA 4BVBA 1DCFA 4EG4A 4MJ7A 1LWOA 2VIIA 4WWHA 4PZ0A 2AMYA 2J9XB 4ZQCB 1YVDA 1L8QA 3ZE7A 1I24A 3KSMA 4C88A 1B3RA 1B6RA 1O1YA 2UAGA 2C97A 2YC2C 1WXHA 3LXMA 3RYCB 1WP4A 4GMFA 3KV1A 3VTAA 3FYHA 3OAAD 5B37A 4GS5A 4Y6LA 2A1TS 2R8YA 2ZJ6A 4RQBA 2JJMA 4HVLA 3AIMA 4L8FA 5EUMA 3S68A 1U5BB 4XDZA 1QWSA 3D8NA 1JYFA 4IY1A 5BWBA 4TZ6A 3FH0A 4U7DA 4N0EA 4LWZA 4O4HB 5BQFA 4GMDA 3SIXA 2X9NA 4JLMA 4Z4UA 1QGOA 4KNWA 3G8CA 4XGNA 3G2IA 2G9RA 1LK0A 3KHKA 3WIVA 1I13A 1EXDA 3EWSA 6GPBA 4FGKA 3KETA 3Q0IA 4PO8A 3PJGA 1X1QA 3K0FB 3TZBA 2OC9A 4UMEA 4NXMB 3SPXA 1ABFA 1ZOPA 2A67A 1PJBA 2JLCA 1Q1GA 2YV1A 4HGRA 2WWIA 1FUEA 1H5QA 4OQDA 1JHRA 1IDOA 4YFYA 2JIDA 1X15A 4XLFA 4JL6A 2J0VA 4PHCA 1Z36A 4ETIA 4XEHA 2DMRA 4K28A 2PWYA 1P6UA 3RVKA 1ZUNA 1WSRA 1G7RA 3MNFA 1XPUA 3SZRA 2P0AA 3KBOA 1JSCA 3TGPA 3F8WA 4A5OA 4BASA 4PLHA 4XRRA 4XARA 2YYSA 1XLUA 2A84A 4PSVA 5JMOA 2GAJA 5CNKA 3RIMA 1D1TA 1NXOA 2WZNA 4BX9A 2AJ8A 2DECA 3W5SA 1P2SA 3MCWA 5DLDA 1F7VA 2C2ZA 3KE9A 3QEAZ 5JZBA 2Q3MA 3WKEA 1FIUA 4IIEA 1KK2A 2PH3A 3PPWA 3TIIA 2YBDA 2DQZA 1M10A 1Y8RA 1B0ZA 3ESRA 4MS1B 4OOVA 1UOEA 3A8JA 1V8ZA 1ZR2A 1WS6A 5FEUA 3CKKA 3F73A 1Q7TA 1G20B 1C7FA 1LW6E 2AMFA 1FLAA 3E9MA 4HMOA 2NPFA 1RIFA 4DDWA 3TTYA 4B6EA 1Q12A 3LFHA 5A7FA 2FFJA 4MICA 5LB4A 2Q2WA 4PLZA 3F7MA 4KRGA 4AZTA 1RXCA 2EFEB 4GQAA 4J16C 4ES6A 3QOYA 2PUGA 4MINA 3GV0A 1DIGA 2VDRB 4G5QA 4WXRA 4ENVA 3U0VA 1XDUA 2YZ2A 4GL4A 1D6MA 4YQFA 9MHTA 5K6TA 2IDZA 4K8OA 4CUJA 5IULC 3C7CB 4XYLA 3B2EA 4LDNA 1W2WB 3AKEA 4UBIA 3ZWBA 3ZD8A 2D5CA 4BTVA 1KSFX 2M6RA 4D4LA 2FEMA 5HK8A 1MW8X 1PR9A 2F8MA 2Q4RA 3JQQA 5DOVA 5DCUA 1GL6A 4MWSA 2VDKB 3H13A 5CNIA 2NIPA 2X0RA 1P33A 3NKLA 4QXAA 3TMKA 4WGGA 3WLLA 4B80A 4EABA 4KXMA 3M9WA 1PJZA 3LBIA 1TQHA 3PNLA 4FOLA 3RDPA 2NNLD 2PD4A 3KQWA 2P3OA 1L1RA 3LUJA 3HA5A 3DOFA 3A2LA 4XRGA 3DV0B 2I2WA 2WIAA 5KTPA 2DYIA 5FTLA 3L77A 2HXGA 2D3LA 2XRYA 1V1MB 2C2WA 3ZK8A 4BE7B 4CT4B 3OQOA 4C3ZA 1IQUA 1ULBA 1DOHA 1TAHA 2WRZA 2QVLA 3D0OA 3FVQA 4MI6A 2AIRA 3E8MA 3IE0A 2AOTA 4OKSA 4X1YB 4P7KA 2DUWA 3M82A 4YJFA 2D4HA 5CA0B 3AM1A 4O4JB 1EINA 3H1PA 4QUIA 4D3YA 3ET4A 2XNDA 3H3FA 5JZOA 2IPMA 2OSVA 3H11B 4YVFA 1GUBA 4TWAA 3FMGA 3OJXA 3HDHA 3WL5A 1NYQA 4IOKA 3R7DA 5DNUA 5K8TA 4ZT5A 4CYMA 1V4VA 3P9PA 3IV7A 2VPQA 1IPHA 2VZ0A 2HK9A 2RKBA 3BN3A 2R751 5FFFA 2C2KA 2FR0A 2VHCA 4KACA 2VBTA 4EVSA 2CJWA 3GEPA 1CU1A 3ZWOA 4ZJPA 5ED0A 4PV7A 3I1YA 4JIGA 1MX3A 1ZOLA 3KVOA 3G68A 2HR1A 2BGGA 1KBQA 2UXDB 4FC7A 4QRDA 4RJ2A 5ESRA 4M76B 4D44A 5BORA 4FDMA 3CLRD 1Q5PA 4K81B 3PC2A 3EGEA 2NSHA 3FYTA 2EBFX 1EVKA 1TK2A 3UM9A 3VR3A 3RVNA 2Q6OA 1A8SA 4BLSA 2IYTA 4BE4A 1SU4A 1XAJA 4KXQA 4V0ME 4BP8A 1E69A 1NL3A 1F0NA 2GBPA 2YRFA 1Z17A 3ORSA 3ANXA 1XHFA 3IUYA 3O2NA 2FRDC 3RS9A 4CE6A 4KPFC 2VBGA 4X7FA 3ISJA 2OHFA 4I5GA 5F4BA 1ND6A 2FR1A 4R5HA 3T5CA 3UMSA 1I2CA 4WZEA 1B1AA 2BGKA 2P3LA 3D81A 1SC3A 2B4RO 2GWRA 2PWZA 3KKPA 4RD3A 2QQEA 3MJFA 1B1CA 3RD5A 1BVHA 4ODIA 3VSAA 1V4NA 5JE8A 1T4GA 3JPWA 1UCFA 1VPDA 1W2HA 2WVHA 4CMIB 2WJIA 4NL4H 5ES3A 3NTQA 2O4CA 1R5BA 3TTUA 4Z4WA 2V4ZA 5HDBB 4DUYB 1XMXA 4UUOA 1E6EA 2BF7A 4OBEA 4QUJA 5EJAA 2VKQA 1E2UA 3IQWA 4XD7A 3VYVA 3ESZA 3PICA 2INGX 4B3TB 3ADBA 2I1WA 2HEIA 5C3UA 3R9XA 5A5DA 5AUQA 5TX7A 5JS7A 1Z2DA 2BGUA 2QMEA 4J4TA 3G6KA 3VPGA 3R0QA 3V8QA 1MO5A 4RVUA 4F2WA 1NX9A 5FI0B 1GCIA 1CZOA 5FUQA 2R9VA 4RW0A 4EVRA 1UDBA 5EJ9A 4YCNA 2FFHA 1YS2X 2UUPA 5BSVA 4KN5A 1HDIA 3KVNA 1HQYE 3PGVA 1U7DA 3ICOA 4PX3A 2WQ6A 2V31A 2Y1GA 3C1TA 2BEVB 1QXSA 3OZUA 3G88A 2XT9A 1R18A 1MGPA 5JLJA 2KI5A 1MNQA 2PL1A 2VP4A 2HF7A 5FT9A 3VSEA 5AUPB 4RL4A 5CFMA 1AE1A 2XXBA 4OHWA 5AKJA 3LC0A 3VR3D 1QGED 1N08A 4NJMB 4D45A 2FLKA 3ICEA 1LPAB 3SY8A 5C7IO 3KNZA 1VCHA 3O26A 1ZD3A 4GKAA 1WG8A 3KOUA 2JLRA 3DKPA 2VJDA 2REQB 3K94A 4G9EA 2P77A 1E5QA 1HLPA 3CEHA 2GJKA 4R01A 3SC2A 5I9BA 2QAJA 4HFMA 1O6CA 1ZIYA 4ROTA 3UOGA 2NYRA 3PENA 2R4QA 2FW0A 4IINA 1KAOA 1NMQA 4EMUA 2RH5A 1QR2A 1R6VA 3OSZA 1VQ9B 5C5CA 3GXBA 2WMDA 3L5OA 3P4XA 4M98A 1XEWY 4MI3A 3UEOA 3VBCA 5F9FA 1Y3DE 4I6JA 1ORRA 3CPXA 2DWCA 4HE6A 3D5QA 1N05A 3PA8A 4Y2PA 1SQ0A 4OL0A 1CUGA 3RK4A 1QIKA 3ZE9A 4YMLA 2XCSB 2NZWA 1HT0A 3AXTA 4G41A 4M8SA 4ONEA 3DPIA 4E5VA 4RLQA 4XD7D 4XOTA 2ZJ7A 3L49A 1GLNA 1NQTA 4RNCA 4BNFA 4MUKA 3KJHA 1ISJA 1EVIA 3NVAA 1X8XA 3A6JA 4MRRA 2CJPA 2SHKA 4XQFA 1RBYA 2QN9A 2QMYA 3MF4A 3D6FA 4JP3A 4LVNA 1RLTA 3O93A 1DIHA 3OJLA 2WZBA 3KU1A 1AKMA 2FMKA 4P53A 1MF7A 1M72A 1E62A 3FSGA 2F17A 4OSOA 4D0RA 4AQDA 2I1QA 3RS8A 3BGSA 5E3IA 1E9EA 2PR7A 4GECA 3CPSA 3OLVA 5FI1B 2Z2ZA 2IOQA 4LA4A 4WMLA 1L7PA 3ZR4B 2H4XA 4IMIB 2IT1A 3KP1A 4Y98A 1GGHA 4MR8B 4DR4B 1FDOA 2Z1DA 2ERCA 4QPZA 4CM7A 3DKKA 1M8KA 2AYXA 4OHUA 5HKLA 1TUIA 3QUAA 4RADA 1GTZA 2G1UA 3MLAA 1OX4B 3W78A 1T15A 4UVHA 1DO0A 1X0XA 1M75A 4V39A 1XDDA 4QGSA 3KZCA 3BHJA 4I1SA 4EZIA 3TOVA 1OWLA 3HJUA 5T4FA 4C0WA 2HJ9A 1DC4A 3UWKA 4N41A 5YASA 4NK4A 4BU0A 4FGWA 3AFNA 4EFDA 4Y6OA 2HEGA 3B5IA 3LIIA 1SK8A 3L84A 3IUJA 3MCUA 4Z49A 1TEVA 2A5JA 3KZVA 2H65A 3PRJA 2BE7A 3HM9A 1E6WA 3D4IA 5GJBA 4B82A 2ZBQA 4R54A 3JASA 5AVQA 5A6VA 3T56B 1F8XA 1U7ZA 5AW0A 4CEJB 4IKEA 1H0HA 4V03A 4K05A 3V8MA 1P80A 4F04A 4AKHA 1JUDA 3ABIA 4GPIB 1VLZA 1URPA 1UEXC 1W5BA 1NLFA 4J0FA 3VC3A 4UVGA 4CMHA 1PS9A 4KOAA 4BO0A 4LZLA 3ONVA 4XN0A 4IDFA 5EJMA 3FSGD 1XLWA 1Q21A 2XCQA 2Q21A 2ZZQA 3CF4G 2H54A 5CK5A 1I51A 5TGTA 4MR7A 3GCZA 1ULTA 3EHDA 1SURA 3TLGA 2FGJA 1R4NA 1O0SA 4L22A 2OQRA 1QVRA 1TI7A 2PH1A 5J9FA 4G1MB 1G64A 1W85B 5TARA 1JI0A 2IHYA 2IU0A 1RI5A 4MR9B 4CR7A 5BWLA 2CCGA 2NX2A 2RGYA 3A1FA 2AB0A 1VLYA 5MGBA 4D9GA 4YEDA 3O6VA 1NRIA 2V55B 4QQRA 1U0LA 3UJAA 4C7JA 3MCZA 1OZAA 2P4UA 1QFJA 4DYVA 3KSUA 5H3HA 4ZOLB 1JDZA 2JKVA 2DPHA 3PUXA 4BC1A 2IYQA 4QXMA 1E2NA 4QYTA 1U0GA 2C04A 2RGNC 3FKJA 3D59A 4HL6A 4HQFA 4CGYA 3EC7A 4PO9A 1ZSYA 2JIOA 3CIOA 3RT9A 4U00A 3H1TA 2DPYA 4RPIA 5KKNB 4RDHA 1O9BA 1DXOA 2ZIAA 3DXXA 1JEEA 4GG1A 3QHQA 3WWDA 4QUDA 3KVYA 4G9GA 2QUKA 1IN8A 4O1IA 3ZCXA 5J2TB 4HQOA 4QFCA 4HMPA 4TZTA 1A0OA 4G86A 3DLTA 4F6RB 2P2YA 4GUAA 3AVQA 1CJUC 1G8YA 5LIPA 5P8WA 4YP5A 2R62A 3UAOA 4E5SA 3EW9A 5L6LB 3BD7A 1GGMA 3EIHA 2GFHA 4JHXA 4PCVA 1VE1A 2QM3A 4MO2A 4RJKA 4WCFA 5KX5A 3KALA 1CQWA 4NBUA 1U2DC 3WYFA 1QUFA 3AVUA 3WL6A 1Y9EA 1UEIA 1H2BA 3O1LA 1I7PA 1K97A 2C1ZA 2HMYB 2G3YA 3VNAA 2ID8A 1IN4A 1M8FA 4BKUA 4TVSA 4HB2A 1FQWA 1NP6A 2WJPA 1FNNA 5P21A 2QN1A 3R3XA 4JJ7A 2O06A 4EOGA 2WPDA 2PU5A 4K7JA 4WDQA 4Q4HA 1H2HA 1J0AA 1K6XA 2YUIA 3HADA 3CISA 3OPQA 4FONA 3FTEA 1JEOA 2MSLA 3KPYA 3SD7A 1JG2A 1RYFA 4LF4B 4G84A 4FE7A 3QELB 1BU8A 4IQFA 2GNAA 2X0IA 1F8UA 3BE4A 4CL8A 5ES4B 1OH7A 4B3SB 1PJ4A 4H3VA 4MI1A 5JC1A 2ZOSA 4RTSA 3L4BC 4AROA 4OMFG 1BFKA 3M34A 3NYRA 3W5UA 4R2MA 5KJEA 5IAEA 1MB0A 3D31A 5E4YA 4BUCA 4CLRA 3GVLA 3LZ6A 4D41A 5I8WA 2PLRA 4OHXA 2QG9A 2QJRA 3QVVA 1RIIA 2X3YA 4J3NA 5L4NA 1K73D 1Z38A 1E9AA 3L0DA 5G41A 4G8BA 2FCRA 4GF5A 4FOPA 4QFDA 3O2SB 1PYDA 4BVHA 4MPPA 3SYTA 2WJYA 1QZ3A 2R4TA 3BS4A 1VL5A 1BH2A 1K7YA 2X1MA 4DLVA 2ZRAA 5BV1A 3BQMB 3TAXA 2HYDA 1JHUA 5L95A 3Q9UA 4YYEA 2X0FA 1H69A 1WLYA 3IBTA 1GRNA 2IOHA 5K4HA 2Z5VA 2XB6A 3KYDA 3EVGA 1XEWX 1W1UA 3MK31 1XZLA 4GWLA 2O0HA 4RS4A 2PUAA 2ZBUA 3JQCA 4EQ6B 4Y3UA 2C4NA 2EVWX 2G40A 2GO1A 2I33A 3FTDA 3RASA 4TYYA 1UOOA 3C7AA 3L18A 4DMRA 1JPNA 1ZCZA 2AC7A 2DYKA 3AYZB 1NBAA 2A9JA 3PQ6A 3LT5A 4JI8B 2ID9A 4L4XA 4EQZA 4ER5A 5JI3E 3AIKA 2PK3A 3O75A 4J2HA 1AK1A 1XMSA 3SQLA 2PX6A 3O9ZA 2H1HA 4PZPA 4RNDB 1ST2A 2WPDD 1Y81A 3K9WA 2A8YA 3HN2A 2FPIA 3Q6RA 1A27A 1Z5ZA 2PZGA 1BWRA 3T1TA 1EUYA 1JXQA 1VHWA 3G0CA 1R10A 2QVBA 3F6CA 1VRVA 3WJ2A 1YQQA 3R4VA 4MUGA 4JLUA 4KN8A 3NETA 4BB6A 4EIWA 5CM8B 2J31A 2BLLA 1HDGO 4L5AA 2HK7A 5DYIA 3GP8A 4AECA 3L0YA 3RS7A 3QF4B 3GRAA 1KVQA 1ZO8A 3JWHA 2NVWA 2GM4A 2RGXA 4OX9B 3GLIA 5JXIA 3STTA 2BCGY 4HDMA 3RJTA 3Q41A 4GC9A 4ANFA 2CSUA 4EUKA 4F5EA 4JBIA 4Z4GA 1Z37A 3PEVA 2XZTA 4BY9E 3G0GA 1B23P 1SA0B 3TWOA 4P5PA 1I9CA 3WQQA 1ZJJA 4CMJA 1U02A 4YACA 1IVSA 3U3KA 3VZBA 2Y1FA 3BFJA 4TWIA 3W6OA 3WO0A 1VKHA 4AO8A 2VF2A 1WF6A 2QKYA 4MQUA 2A1UB 1HURA 4DLTA 4MKFA 1T4DA 4F6CA 1ZH0A 3KQMA 2EGHA 1OX5A 5IJ9A 1MXHA 1V43A 1YR7A 3UUEA 2HH9A 4E21A 5KQSA 1MOSA 4UTXA 3FAKA 2YN4A 3TSZA 2DY0A 2Z0MA 1Q57A 5HF6A 3TR6A 4CV3A 5A0FA 1VDMA 1OW3B 2SKCA 3DEAA 4PXSA 4UU0A 3P9YA 1R9JA 3DMHA 3TH5A 3FHTA 1V71A 1HXHA 1NTRA 2J6CA 1KH1A 1N7IA 4CDMA 4PLVA 5BR7A 5EXTA 4YXWA 2DCMA 4C29A 3COWA 4ZO7A 2RGDA 3A05A 1GEGA 1CWUA 4IIJA 4REQB 1IWOA 4OLHA 1H9CA 2QTVB 4IO0A 4V0QA 5AM3A 1PFQA 1NR7A 3JU4A 2H8GA 4PVDA 3DMTA 2QTGA 3NFRA 3QVGA 1GA1A 4IXNA 3TUIC 1QE3A 1ECFA 2IEYA 1Y4ZA 5BNZA 1P61B 1HOXA 1DTWA 3TNJA 1OGJA 1AX9A 1MTOA 4US2R 3RSFA 1IULA 1IHPA 2O5RA 4HVTA 1Z45A 3LM8A 4G36A 1ZM4A 1KZGB 2X1LA 4NKRA 1O6BA 1OXBB 3OY2A 1AXEA 4WY5A 5B4TA 1E2BA 1KQNA 1KK1A 1DC6A 2BFBA 1OLSA 4ID9A 4WNAB 2DJIA 2YW9A 1W4LA 2W8BB 1EI9A 1UXOA 4GX5A 5DRTA 4X7PA 3HYNA 3KZXA 3LA8A 1Z6AA 4KDEA 4OQFA 1ZIDA 3V32A 5C1DA 5IH3A 5DIFA 3ZW8A 1DJOA 5DX8A 1G6KA 5FV7A 3S7ZA 1AG9A 1GNQA 3O4VA 4KPUA 5ITVA 1O57A 1AS3A 4ITVA 3FGNA 3AUTA 2NZYA 4MYCA 4NYMQ 4P5EA 3RBZA 1RRPA 4C01A 1ZVVA 3H9EO 3HFJA 3PGJA 5K0NA 4M7OA 5KKAA 1P8JA 3ESXA 4R2JA 4WW0A 1N9ZA 1RKVA 1VZ2A 2A3RA 3I39X 4YP0A 2BDUA 3QI7A 4NC9A 3LX8A 2JG3A 3DQZA 2AUMA 2QLLA 3JRNA 4IMRA 3KYBA 4IWXA 5EIXA 1ZD2P 4WTOA 2P2NA 3HDQA 3BERA 4YXWD 3U56A 1G8SA 2V0GA 3ICCA 4WBNF 1RWOA 3ZE6A 4DTCA 1R6TA 1C14A 3GDGA 1ABEA 1ZKDA 3KR2A 3IEKA 1UZAA 4RMHA 1D4OA 1OFTA 2Q0SA 3GMSA 3HVJA 4EATA 5DHSA 4ACBA 3J7AC 4HNHA 1GNPA 1JAHA 2H00A 3H04A 1B41A 1CUEA 3LDUA 2SKEA 3GRKA 4MULA 5KQRA 3RWMB 3GLGA 4LBVA 3DM9B 5FBWB 1U8AA 8MHTA 2I34A 4MTLA 5FPHA 3GK3A 3S7TA 4P58A 3DMPA 3H42B 4M9UA 4ZGNB 1QR6A 1YAJA 2GNOA 1LPBB 2IP2A 4MUNA 2RHGB 3PE3A 4WFKA 4AJ9A 1BWSA 3IDZA 2C4HA 1PR0A 1RC8A 1HFWA 2ZR7A 4JLBA 3KYCB 4MW9A 2GF0A 4HXYA 1UDXA 3T3IA 1K28D 5HRCA 2V5UA 1U2EA 2PXXA 3ZGNA 4FR5A 3X3HA 1CZUA 3ZU3A 4YMHA 5FJJA 1LJLA 4L4SA 4JDUA 3LS2A 4GR4A 4XKJA 3USZA 5IZ4A 4PNEA 3L40A 1T6ZA 3R0ZA 4KN9S 3ORHA 1WDMA 1O9HA 4QASA 1JWBB 3AONB 1H42A 1N2ZA 3QNUA 4JLKA 4BNUA 2J6HA 3KO8A 1QZXA 2FN9A 2NTYC 3R0IA 5CB4F 3DD5A 3KXPA 4ZT4A 2X8JB 3EIXA 4GE0A 3ZHBA 5HQ3A 2H3HA 5D86A 1FUYB 4DCTA 5IS2A 2QB5A 3P4YA 4F1JA 3PQ3A 4N65A 3D8HA 2OM6A 5F77A 3H8SA 4A5SA 4GKBA 4PZUA 1AKEA 1PO7A 6YASA 2R2GA 3WAKA 1D3AA 3IMFA 2QPAA 1ECBA 1ZM3A 4YCJA 3R3SA 2H1VA 1JDUA 3A37A 3MJTA 4M7WA 2YWGA 3SVZA 1I18A 1GZ7A 2BHNA 4Y2XA 3LGSA 1EIZA 3JQAA 1ACJA 1NW7A 1T6XA 1B2RA 1ENOA 1SPBS 4KYUA 4YRTA 2C58A 3TLYA 4ZOQI 1HSZA 2BGWA 1AT1A 2G36A 1Z5NA 3AHDA 4MIYA 1MA0A 4MMYB 2CV1A 3LTNC 4OIFA 1JFVA 5C46F 3TD6A 1CFZA 1E2GA 2WVAA 4V0KA 3BPSA 1CUAA 3GJ3A 4IDGA 3WKCA 1PW7A 3QV2A 2JH3A 3MWLA 1XQWA 1E2JA 4RSHA 5C8YB 4LSZA 2Y68A 3VSDA 1GDHA 2LBPA 5CFPA 1YR3A 2VC2B 2A57A 1D5CA 2RG7A 2N42A 2CYAA 2JFZA 3BBPA 4OYRA 4RE5A 5CGZA 3TMYA 2EIHA 3THYA 1TAGA 4II7A 4HFNA 3FWZA 3HA2A 4WK2B 4AS2A 1XVAA 4DS3A 5ALTA 4LKRA 2BJHA 3ZZTA 1YCFA 2GFQA 3ELWA 4FLFA 4E31A 3VJRA 1XT6A 1LFDB 1A8UA 2DY1A 2CJXA 1CQIA 1HZZC 1X7GA 2GDZA 5ALVA 3NHFA 1PN3A 1T2UA 4BL5A 1P7CA 1ZVKA 1J56A 1XU9A 3ED5A 3KB2A 4WZAB 3TK1A 4AM8A 4BFYA 4C4OA 3AVXA 2BTQA 2D5BA 3OWHA 1FVHA 4N12A 2QUBA 3SX2A 4KQ1A 4RTNA 3M4JA 3PDHA 1EXMA 4EFKA 3ZN2A 1LVHA 4AURA 1POWA 2JH8A 4H7IA 3LYHA 5M5BA 3OOHA 4FYVA 4JJEA 4C03A 2P1DA 5EIEA 4ZI2A 1PJRA 1WE2A 5DBGA 1NPYA 1TU0A 5IP5A 1P8AA 5DOZA 3ENZA 4WKNA 2JGDA 3FHOA 5HIJA 4ZICA 2NAPA 3NGLA 4LXHA 4Q7MB 1SXGA 3F98A 4Q24A 4HSEA 4DNRB 3LECA 3WBFA 1R0KA 1M0TA 2Y4OA 3DBIA 2I4OA 4CKWB 2C5LA 3BXGA 4ZYWA 4DM7A 3K30A 3JQAD 5IMBA 1FBNA 2ERXA 3ZXYA 4QVAA 4F8YA 4DDVA 4YBRA 1O0BA 2IY8A 2NQ2C 3L8ZA 2AHOA 4Y1RA 1H22A 2CXXA 3NC0C 3PI6A 2PUWA 3U3OA 2HWKA 3AWDA 2R1VB 3V3KA 3OP1A 3U9TA 1J07A 5BVGA 3KPWA 5FPTA 4KGVA 2IITA 2O3RA 2PMWB 3R3JA 3DEHA 2LKCA 3ESAA 1X7YA 3DTYA 2OL4A 4ZI3A 1WDTA 4CM6A 3LT0A 5DP1A 3DO5A 4YAFA 2QL9A 3GJRA 4IEEA 1B3BA 3NHAA 4GVLA 3SOPA 3GWZA 2QA4B 2BEUB 3M6UA 1F2DA 4KUHA 4KSCA 3WNVA 1Y5IA 2LDXA 1YJ5A 3RVLA 2H2FA 3EUFA 4JBNA 4RK7A 5DWQA 3SKXA 4ZALA 5F4JA 4QEKA 3C6YA 2IBSA 4ZAWA 2BKUA 4CQMB 4WIAA 4R6XA 5E6SA 2RARA 4LS3A 1XDSA 3EVFA 2G67A 5IYZF 3DZKA 4IOJA 4YH1A 1QKJA 5D6OA 3ILVA 1A7JA 5A7HA 4MRVA 2RJOA 2Z5GA 3FXAA 3TL2A 4MVJH 1J2UA 4YUAA 1SIOA 3PE6A 1WQ1R 3GB9A 4TRNA 2W70A 1H6BA 4V1CA 5C8VA 4PRZA 4DM3A 1OQAA 4Z51A 2VHEA 2ZDHA 4LC1A 1GZ3A 4YDQA 1YUMA 2CVFA 2PHZA 4JJ8A 2CNOA 3W5DA 3BDIA 1KI9A 1QAMA 4Q7QA 2C2OA 3DDZX 1A9ZA 2ZTVA 4NCIA 5D7NA 2X0KA 4I50A 3PR1A 2X5KO 3LX5A 3UENA 5FBVB 4PYKA 5CJJA 2KJQA 5DHUA 3K20A 4JBWA 4ZI7B 2VAVA 1HO3A 5HGXA 1LB1B 3QEOA 5FL3A 1SXJC 1IUOA 3OZAA 1FNCA 2OGTA 1ZS9A 4BBZA 3UMBA 1NXWA 2CBZA 3P4UA 2OESA 2Q5OA 1NQWA 2L2QA 3LFUA 1JQJC 2BP7B 3RF7A 1GU0A 5HKOA 3RVQA 4CGZA 1HTWA 4TZKA 2H6EA 2J3MA 5LOVA 4I2VA 2VF8A 1B14A 3DZBA 1KFKB 4L3VA 3N2LA 5AESA 2ZIVB 3OEEA 1J2YA 1C41A 1OU0A 1U98A 1UMCB 2JFUA 3H2IA 5DI3A 1LRLA 3RS3A 3AFMA 2O0KA 4AZ0A 1QS0B 3L04A 5F9MA 1V5IA 5H0IA 2QRJA 4FCTA 2MYNA 1IBRA 2O3JA 2QRPA 3GVHA 2ZRPA 3LNTA 5CW1A 2OLKA 2GPJA 2AEEA 2C94A 4J7CA 4MLCA 2AE1A 3S2FA 2AOXA 3H6HA 1MIHA 2WK1A 3IODA 3PEUA 5K8CA 1L4BA 2WWHA 2HCFA 3GQBB 3NBYC 4QU0A 1JEDA 5KVSA 4ZCQA 1DIOB 4OQ4A 3ZGVA 1TYDE 2IHZA 2E2WA 3GY0A 3S5UA 4DDTA 1EX1A 1N2CA 3CNEA 3D64A 4KB5A 1DADA 4AYXA 3D7MA 1E77A 4ABTA 2QRNA 3A10A 1SCBA 1HEUA 5TQ0B 1COZA 1H6AA 4K46A 5K0CA 1SO8A 2AA3A 2IDMA 3VR6A 4HUQB 1DFIA 2FSHA 3MAJA 1C4XA 3T4PA 1L4UA 2QHXA 2I6UA 3GP3A 4LJAA 4MVJA 3TZ6A 3X43A 2PQMA 1X3SA 4DEYA 3ZCUA 4MS3B 5HKKA 1JKJB 3BICA 4U7GA 5BSEA 4Z4IA 1RWQA 2P75A 3PFIA 1PLJA 3DP7A 5G1OA 3T34A 3A3NA 2BL4A 2FSGA 3AQ4A 5DSXA 2JA1A 3SE7A 4F0JA 2ZSIA 3S8EA 3C1AA 4RZHA 5JSZB 1VJTA 3I2GA 4MQFB 4EO9A 4RSRA 1ODIA 4JAVC 1MKYA 1FMJA 1MX5A 1N2SA 2HWYA 1MPXA 5EYPB 5A7GA 2ZB3A 4N6OA 1Z6TA 4BNTA 2VF4X 1KWGA 3T7TA 1YR2A 2J0EA 4QG3A 1Z2AA 1PZFA 1TM1E 2ZRIA 3I4FA 1UXIA 4MWOA 4UTPA 7REQB 2F1RA 5KOJA 5JAQA 1Y5RA 2VS1A 2VSFA 1GPYA 4DMUB 3OEED 1DWOA 3VO9A 5CB4A 3LYUA 4FW9A 3FCCA 1S2NA 1X9GA 2FDCA 4CMEC 1HEIA 4JKIA 2EKLA 2GHRA 4A2CA 3PHCA 3UQZA 3K8OE 1W29A 2OFWA 3EVNA 1P1IA 3QKTA 4TMZA 1PJTA 4L7QA 1CV2A 1B6GA 1MGOA 1YMUA 1UZLA 2XDAA 1N5MA 2YYYA 3KKQA 3LPNA 1NOIA 1KYQA 4G8JA 521PA 3RFCA 3RV3A 4LZZA 3G2LA 1I80A 5JV5A 1RQ7A 1KXZA 2YTZA 3V3TA 1A5ZA 3GHHA 4BBPA 2PYDA 5DN6A 5AIBA 2QXTA 3CNNA 4RWZA 3RJMA 1X6VA 1KKMA 5DYGA 4QU8A 5KVAA 3L8GA 3E27A 1XTVA 4ZXFA 3S2EA 1PE0A 3TL6A 3VR6D 3PHJA 4B9EA 4KI7A 1O54A 1NE2A 3PQ8A 2XDWA 4QNMA 1THZA 1OU4A 2ZJ2A 4POOA 3Q5GA 1JTVA 4MVJD 5AW7A 2L19A 2PRSA 4DBLE 1N5RA 3B9PA 1J20A 1MB9A 5HKKD 1Y3CE 4EG7A 1TDJA 1XZQA 2RK3A 5JTTA 2IH4A 3H5LA 3R7WB 3V1NA 1IEQA 1HDCA 5LYJA 1OLUA 2DBVO 4TKVA 4U2KA 2EL9A 5K99A 5G4LA 1E9DA 1MJGA 1RYYA 2Q5FA 4UARA 2VT3A 3SR3A 3WDSA 3PTAA 1FNMA 1NW3A 2G9ZA 4G5OA 5H68A 3FR8A 3WICA 2DLCX 4QBTA 2CB9A 2XKAA 4S2EA 4A91A 4A15A 1WOMA 3RIHA 2PLWA 3UNXA 2ZAGA 4X7RA 5LQSA 1V7QA 4FCCA 3AEXA 3NHLA 4HRYA 1U2TA 3BULA 3HXPA 1VZ3A 1QCDA 1T2CA 4C4YA 1NQXA 2GEVA 1TFUA 5BO5A 5BQ3A 1J99A 4UTZA 3S40A 3GEDA 3KZNA 3KELA 1U90A 2FHPA 4TVBA 2QPLA 5F78A 4X7EA 3ROQA 4EGAA 4V1CI 1U28A 1H3NA 1N8NA 2FRXA 1TD9A 1N0IA 2NAFA 4BYMA 5JT1A 1EGAA 1PG5A 2ZTUA 2DT5A 3LC2O 2XOKA 1GLVA 1UWVA 4YP9A 4D9CA 7MHTA 1Q3KA 1VIAA 4TRJA 3A4YA 2JGAA 3QU9A 3AX6A 1XTUA 1CZRA 2QSZA 3QLUC 5A05A 5TPWA 3BRCA 1RP1A 4FHGA 4U6NA 3R41A 4I3HA 1QTIA 1WM1A 4IG9A 3R8XA 2QUAA 5DN6D 1F1JA 1IN7A 5IKMA 2IY9A 3GNSA 3HV0A 3LRPA 1M5TA 4RORA 3T5GA 2KW5A 2RB4A 4WZBA 1P6QA 1P29A 2RAVA 7YASA 1L4YA 3A6KA 1GUAA 2JEOA 3AC0A 1C8BA 3H9JA 3PC3A 4YROA 1D4ZA 5AK5A 1LF5A 2V9PA 1SN7A 2PT5A 1EBFA 1TRKA 1MW9X 2Q8NA 1NONA 2ZUEA 1CIVA 1G2IA 1K68A 1IXYA 4N8EA 4LCBA 2CUKA 2FPOA 2Y6VA 4DIUA 2R8OA 3NIGB 3LCVB 4Z7JA 3MS2A 3CCUB 2X4DA 1ZNXA 2C95A 1G18A 3K1AA 2LXNA 1L3CA 1ZLYA 3OT1A 4I8IA 3SZ3A 4N7JA 2VSOA 4OI0A 1G2OA 1KAHA 1NUTA 1XFDA 1RI3A 1R88A 2N1MA 3EXHB 4GLLA 4OP3A 4DCPA 3ZWWA 3I5YA 1HR0B 1JG7A 2B9EA 2HBYA 2FF5A 5JJLA 2B6NA 1GCAA 1U5AA 3D9QX 3K32A 1WUHS 1NPTO 1TT7A 4GPAA 3E20A 2RAPA 1TYCA 1E9SA 1Z7YA 5IYZA 4O8ZA 4IZHA 3PQCA 4RH3A 1U0BB 1FE8A 1QGUA 3S4YA 1J70A 3GLHA 4AF7A 1ODFA 1M6EX 4LRXA 5DM1A 1GP2A 3ZUPA 5EXPA 3VZDA 2WZPP 3U9LA 2J5RA 2WM9B 4F56A 1ENZA 2D62A 2XOKD 3FZEA 4MVJI 5E7JA 4GAEA 4A16A 1LI4A 3C5HA 3CCCA 3K72B 3AFHA 3Q2IA 2ZB8A 3KM0A 4LC0A 3K09A 1HQCA 1PQUA 1LW7A 1T5BA 4C21A 2PMDA 1M1UA 4FDVA 1H1LB 1G8KA 3W3AH 4DN6A 4ROXA 3PGKA 3QX9A 2O8BA 4ND4A 4I46A 1U0EA 3BD9A 4NOMA 3W04A 1KPIA 4NCBA 2ZT6A 5C8DA 1CR4A 1MX1A 2OAGA 1E3JA 1S3SA 1GZ5A 1T5DX 4DSAA 3D7KA 1V45E 1P1BA 3AP1A 3EGDB 4OJMX 5J3JA 4PGHA 3ZDAA 3BGVA 1ZRSA 3BIOA 3Q8WA 4K9KA 2PSFA 3ZCVA 4A0QA 1KY4A 2XWJI 1QHYA 3INNA 3AO0B 4NI5A 4TSFA 1MNAA 2RK4A 3OOSA 5CEJA 2C59A 1CDDA 1UKBA 3BEOA 5L3SA 2ZJ8A 2AVDA 4GRAA 4IF6A 5KNDH 5KYTA 2EG5A 5E6RA 1US8A 3G5LA 5BVHA 2CLLB 3ZS9A 2QX7A 3E5RA 3GEBA 2Z2KA 4MV6A 4XPIA 4DA0A 1CEQA 1KI4A 4BJ1A 3ZHCA 3LU1A 4LSMA 2JVJA 4CTJA 3IJ5A 3R9KA 4YT4A 2PJRA 4UHJA 1NHWA 3KOWA 3SS9X 3HBNA 2A4KA 2H29A 1G55A 5H4GA 1D2CA 4FXPA 2X9GA 3AUYA 1R8YA 2CDRA 3EDCA 1GQYA 3BMQA 1KQOA 3R3UA 2ACEA 3COSA 3ILXA 3K5WA 2JNWA 4DT1B 1UBUS 1DC5A 4NZ9A 4MKRA 2FPGB 4J1NA 3HP7A 3ENNA 4KMRA 2FMIA 5AXCA 1N8RD 2IU4A 2PSEA 3EXIA 3HWRA 3DOUA 1IHDA 1UZNA 1UJ4A 3IO5A 3MILA 1M2EA 2HRZA 3R1IA 4KK3A 1U0RA 5CLQA 3HJTA 1I4LD 2JZOA 2HJVA 3W77A 5AFSA 5BXYA 2VQSA 3RUPA 3ZDCA 1KP2A 3GVXA 3LUDA 3WO1A 4BMDA 4CTMA 1QKIA 4Z4CA 1IQ0A 4YJHB 2ZBPA 4Z86A 2P8SA 4D79A 1LPPA 3ZBPA 1L1EA 4IDNA 4TL8A 3WP1B 5G4KA 3ZTWA 3VPSA 5FUVA 2DBQA 1ORIA 1W59A 1PGQA 1VJRA 1DAKA 1PJ6A 3RSLA 4AC9A 1H23A 1K9SA 2C20A 2JH9A 4LQCA 5F52A 5FTNA 2R11A 2X2PA 4N4AA 1AA9A 1F5SA 1Z82A 3HUEA 3CLKA 5JSKA 2APJA 3FIUA 2EZTA 2QI9C 3AR7A 4KQJA 3W3AA 4YYZA 4PYNA 4R05A 2VHXA 3THXA 4EPYA 3KLMX 3IEUA 4WCVA 1AGNA 1P2BA 3L8DA 3TQFA 1ECCA 1C0LA 1W76A 3AJRA 3JQFC 4CIVA 5K20A 2OCAA 5I4IA 4TSFD 2GEJA 3FPGA 5AUNB 3W2TA 4CETA 3P9SA 3G2KA 5JY1A 5K45A 2FP3A 3PZBA 1D2GA 1PEKE 2VBCA 5CYFA 1I8DA 2IRWA 5KDLA 1ZESA 3ERCA 2JFVA 3G3EA 4KYVA 5EMLA 4RVNA 2ZBFA 3JAWA 2H2GA 1GAJA 3TNFA 1M5UA 2VYFA 1JHPA 2E89A 2VYNA 3GUYA 4OD0A 5IPFA 3TW8B 4DOMA 4UHEA 4ZPJA 1DQPA 4C4AA 1XKQA 3BUSA 4I4TF 3PCRB 2DLNA 4G0UA 1HK7A 3RSOA 1P60A 2CMGA 1PYGA 4H7JA 3HEMA 4IILA 4PANA 2Z5LA 3ISVA 4HDOB 4LDQA 2QL5A 4YIKA 2O0LA 4DW8A 1X86B 3DBHA 3D43A 3A1PA 2EATA 2RJ3A 1KMHA 4YGXB 5C5IA 1U3UA 2ZCVA 3RTBA 1R5JA 3Q8MA 4W6QA 3ZZUA 4X8MA 3CKYA 3R7LA 4DLSA 4DEXA 2PUEA 4B84A 5LBUA 3AB8A 3MPOA 4XL9A 2AFIA 3GFOA 3FAZA 3IL2A 1XA4A 1M2NA 5TQVA 1PHPA 2WG2A 1MIOB 1W5SA 4R9UC 4RC9A 5JFOA 3GRVA 5EJEA 3PITA 3SF8A 2GARA 1OB0A 2ZRGA 2VZ9A 3W3AD 3RVDA 4Z0NA 1DLIA 1Q0RA 5A1TA 4TLLB 4PFKA 5B6IA 5I9NA 4HIZA 2XJ9A 4I7EA 4IFTA 4PEVA 3C70A 3LY9A 1P81A 1Q0LA 1S4QA 3IUEA 4AMYA 5L8VA 4Y2TA 3PJDA 4HN4B 4PTYA 1NJ5A 4LJ7A 5HGJA 1RJ9A 2DOGA 5CJ2A 5BUQA 3WMXA 1QZTA 4KAXA 2WAAA 5JXWA 4ARUA 4RTMA 1SCUB 1P45A 2ZSUA 4ZYVA 3ORFA 2QUJA 1BMFA 1UDCA 1L7VC 1PWZA 4RZ3A 3OZ7A 2D13A 4KE6A 1I6MA 1XJ5A 3K35A 1K63A 2Y05A 5AICA 2E4YA 5DHRA 2V3CC 1E58A 1KP3A 2VYND 2D0IA 3HBJA 1QG0A 2ZRJA 1L4KA 3QPBA 3QXHA 4PBTA 2ANBA 4BO8A 4IDBA 3EGXA 2Q0QA 3OUZA 5BYJA 1XCMA 1EDOA 3H99A 5AVZA 2R6R1 5JWOA 1DBVO 1EUZA 2RGUA 1M34E 2XYHA 3ENQA 1QYIA 3HPRA 3JZAA 4UHFA 2W42A 4LBWA 5KQLA 5LMNB 2FW1A 4K1LA 3AETA 5JG7A 3SQXA 2TMKA 3ZKAA 3VHLB 4BNZA 4UVIA 1H2FA 3LKBA 1EUQA 4Q4JB 4XMYA 3U37A 4CKYA 3VPAA 4F4IA 1MO6A 2ZW9A 4MTCA 1QGYA 3KZOA 3TRDA 3RUHA 1JSZA 2QX9A 2OZLB 1O8BA 4I5FA 3FFXA 3CUYA 4B6FA 3OZDA 2J5BA 2VJYA 1BWPA 4MW7A 3DEJA 3R5JA 2QVYX 2Q6LA 1FMLA 6Q21A 3PJFA 4TM8A 2W48A 1WORA 3REFA 2VRBA 4FHZA 2HM7A 4EG3A 3IEXA 3WWZA 5TT1A 3BB3A 3NG1A 1TMOA 4LDJA 3SQOA 1RQPA 2RHHA 3I9LA 3NHPA 5KWSA 3NDPA 1P7PA 1YRBA 2POQX 2G06A 2Y67A 3DVAB 1A82A 4PPGA 5TV2A 4TYPA 3QEMA 3L4SO 3ZX4A 4PWYA 3SC3A 2AR0A 2QTMA 1FX0A 1T0PA 2G82A 3HUDA 5JNLA 4HDKA 2GN8A 2NO5A 4X07A 1GN9A 4LHXA 1JFFB 4GFDA 1WCV1 4JB0A 4EVIA 1O4VA 3VX4A 1LFAA 1T5IA 5HILA 1K3TA 1P5JA 4L8YA 2C7BA 1P9LA 2PZ8A 3G0OA 3IMGA 1NJ8A 1TQ6A 3CUVA 4ND7A 3A4LA 3ER9A 1CNEA 4YAGA 1E9VA 1YS6A 3T3NA 1DV1A 1YMQA 3EIQA 4LKOA 5ECDA 3EEQA 1X1BA 2PEZA 3EGIA 3M89A 4YDSA 1NKVA 1DKOA 2ZSAA 3F7NA 3LQ4A 5DX0A 2PUTA 2IV3A 2BKLA 4LOJA 3LWBA 1IB0A 5DV9A 3ZU6A 4IBOA 2V8BA 3R4CA 4AN0A 3LPDA 4FOTA 2VDJA 1YA6A 2J3KA 3BL6A 5HMLA 1Y9AA 3HACA 3WDLA 3AF6A 3CG4A 3IA2A 5GY7A 3SHQA 1ZW1A 3F8SA 1FZTA 4PGMA 4BO5A 3OVMA 1DV2A 3FPJA 4H6WA 1TPZA 2ZIXB 3BFXA 4IV8A 1M2WA 1E5VA 1SUAA 1A9RA 1E2KA 1ODJA 3K2BA 4S1TA 3GIWA 3IE2A 4XFDA 4XUCA 4JCOA 6LDHA 3ZD9A 3U4GA 1R9MA 4R69A 4B35A 3UKOA 4UFOA 4M4SA 4JDPA 2V45A 4NU5A 4XR6A 1F0PA 1DKUA 1JN0A 3FIJA 3QLJA 3ZI4A 2G0NA 1Y8QA 3ZBTA 5HQJA 1K5GA 2OFFA 2Z3VA 2O5EA 1Q7BA 3CEAA 4JLOA 5KYUA 1N7JA 1JG4A 3VYTB 3WMGA 2C2GA 2I6QA 1VIYA 3STHA 1BE8A 5LD2B 4MKHA 3C8MA 2PUJA 3QH4A 2H57A 1KOGA 1PR3A 2RHJA 3U7GA 2M32A 2I2CA 2IHUA 4QAQA 4TXHA 2R6JA 4CCSA 3UK6A 2O54A 5CD9A 3TVTA 1XP5A 2VOJA 3N1UA 4WA8A 1PR6A 1VHQA 4RPJA 3BNWA 4JVNA 2JAUA 3ZWKA 5AOBA 1TJ4A 3NOVA 3OQMA 4Q5IA 3IELA 4Y2YA 3ILSA 4NENA 2JVKA 4HB0A 2AW3A 1QKKA 3NATA 4N8DA 1ZMBA 4ME6A 1QZUA 4F9TA 1BA3A 3I5UA 1V16A 2PZEA 3VMFA 2HIMA 2YHAA 4TLEA 2PANA 4XB1A 4EUFA 3FCXA 3HKDA 4D1YA 5IABA 4GBGA 3PUJA 1I10A 2E9SA 3UMCA 3DBLB 3IFSA 2YMQA 2NTNA 5IARA 4CHTA 1U8CB 4EHAA 4AJ1A 2JJ8A 4LXIA 5E1BA 3OPVA 3ADDA 2NU8A 5I5EA 1U4SA 2O50A 5I7FA 4K0KB 2WTBA 2PEYA 3Q3EA 4EFLA 3OW7A 4DNTB 1QQ6A 5A4MS 4NMXB 4TQ9A 2WYUA 4AT1A 4IRXA 1RAAA 1EWYA 5KJFA 3P5BA 4BJ6A 3WGOA 1BSVA 2DKFA 3ED1A 2BZSA 4KVZA 4LGCA 5AI5A 1AD2A 4XLHA 2BEJA 1GD1O 1UBEA 2BFCA 1E6LA 2OM2A 2VZ8A 3OIVA 1XCBA 4MARA 4EHIA 4BZPA 1GM5A 3C41J 3QXXA 3LVBA 2VPIA 2XUIA 3BHMA 4K6GA 4KMMA 2FPWA 1CS0B 3HDYA 3NTXA 4AJHA 4ZTUB 2W2KA 4OCZA 4DNQA 1MP0A 2V7PA 2GB4A 3KQOA 2IUYA 4F3KA 5AI4A 2REXB 2DPGA 4HQLA 1NN5A 5DBIA 3D8UA 4NAVA 4UZEA 4D9NA 5HZMA 2BIFA 4G0VA 2NXJA 1JE0A 3MTIA 4B40A 4J7UA 3W05A 1M8JA 1T2FA 3UAXA 2G6TA 2REBA 4DPMA 2WSYB 5ARBA 2ZRHA 5FLKA 5LQMA 1ODSA 2ATXA 4R1MA 4HLNA 1LWNA 5C52B 2B7BA 2BY4A 5TY0A 4MK4A 4B6QA 1I4TD 4BLOA 5JJ5A 2CF4A 1IY0A 2VEOA 2P4EA 1TEZA 5IBCA 5E1DA 1P4HA 4ZEXA 4ZZ0A 1NVEA 3R7BA 1E3IA 5H3LA 2ZL7A 1O96A 2RCYA 2NWQA 4REOA 2WP8J 4X06A 3JRWA 1GAEO 1RFLA 3HRHA 5HR5A 3IUQA 3KUXA 2XHEA 1ZH6A 4O5AA 1KSJA 5REQA 4E2WA 2CRVA 3ONNA 5AW2A 3F5SA 3AINA 1H6CA 2E4UA 4L02A 1DCMA 2FPMA 1E4OA 5B7GA 2E4VA 3G17A 1KJYA 5ER9A 4TYQA 3ZLVA 1P75A 1P2VA 2ZUUA 3E18A 1WCYA 1LX6A 4LVUA 1FDWA 4MWDA 4UJ5A 1BEEA 2FWMX 2Y0DA 3QK7A 2EW2A 2CE7A 3BE8A 4IP0A 4JEIA 5CDGA 1EE9A 5H16A 4AD8A 3AU9A 3EA5A 3QG1A 4DCUA 4NABA 2IC5A 3H5WA 1MTZA 5ALPA 5KC8A 2H7YA 2F90A 2F3TA 1GPLA 1FDIA 5DN9A 1G21A 2V4UA 4LYEA 1XWIA 4ZEOA 1T8PA 2D1SA 3CUUA 5E7MA 5SY6A 3RRZA 3ZBUA 3LV8A 3QPVA 4G0PA 3IAM6 4UBMA 4BO6A 4BX8A 4ZDKA 4NFSA 4CLEA 1QF7A 4YO8A 4YA6A 1G3IA 1R74A 1RWXA 2EARA 1I7SB 2PFSA 1YUNA 1YZNA 2IHBA 2ZI6A 3D3JA 4EJSA 5C9ZA 3DAOA 3VH1A 3DO8A 1FPMA 3INTA 3L8CA 5DZSA 4DWVA 4CKEB 3COZA 1Z0IA 2VUIB 1L8LA 4KVGA 1QONA 2O19A 2V1UA 1KDYA 1D1NA 2AOUA 1ZGHA 3FUCA 2O6HA 1XEAA 3TINA 3H1BA 3TE6A 1GGNA 4WY8A 1TQDA 1U3GA 2G9NA 3S70A 1I3OA 1MZVA 1QP8A 5DTIA 1GUYA 2Z9DA 3G2NA 3MLBA 3O3OB 3B3FA 5FQNA 3U1BA 3IAAA 1OI2A 4TKZA 2MMGA 1N9KA 4AN4A 1ZUD1 3AU8A 3A2NA 1R0ZA 3WYNA 4CPDA 4NG4A 3GLGE 3VRHA 1ZJYA 4B3XA 4B3MB 3GH1A 3HB1A 2WIDA 3H05A 2UVQA 3AESA 3FPAA 1Z5OA 3MOSA 3ODGA 4G85A 4CM9A 3OUUA 4RF4A 3B1FA 3LLMA 2IXGA 2A35A 2OD2A 4TKUA 1JKFA 1QHSA 2ZSBA 4KTTE 2HHLA 1ZI9A 3L6EA 2FPKA 1S0UA 4Y0NA 2XNKA 4C07A 1ZZEA 2DAPA 4OATA 4W6ZA 2WIKA 1PKXA 1ISSA 3T9DA 3WK9A 2IE0A 1YIOA 1UODA 2HCTA 4R3NA 5DBOA 1AUOA 2FX5A 2CNWA 5IG2A 2VTBB 4RLSA 3A58B 1E0SA 3E2MA 4HNRA 2IX9A 2YZKA 3BCUA 5D01A 2VSXA 3LK6A 3NB0A 3Q88A 4K86A 3G9TA 1UFOA 1YKGA 2F6RA 2Q1SA 3A06A 4O2BA 3F4LA 5TSDA 4P12A 3IQFA 5TXGA 4B74A 1TZMA 2P4QA 3V4ZA 4TYMA 4CL3A 4YMGA 3V8NA 5LQCA 3IVRA 1HMYA 1LSSA 4NYJR 4A26A 3W2FA 2PX3A 2D5IA 1G5RA 2GI4A 3DE6X 4OP1A 2C99A 4Z6KA 1KXJA 3UOAB 3RODA 2CFRA 2G08A 1XZMA 4QBHA 1F60A 1RQNA 4AG6A 3GYBA 2BGIA 1QHIA 5K8IA 2P6PA 3A6FA 3HB0A 3JZFA 2JIQA 2ZJYA 4E0BA 4QICA 3ROTA 4YS6A 1Z3CA 4YPOA 1JSRA 1MLDA 3RH0A 1M6YA 2WSMA 4X44A 1ZA2A 2C7PA 2X6WA 1NKTA 1LBEA 1XXHA 2ZIEA 3AL3A 3TB6A 3OA0A 4LE2A 4ZDIA 5KTNA 2O23A 2QG6A 1E7RA 3UGTA 4AK9A 4R7TA 2QXUA 3GOHA 1W44A 3T38A 1PNOA 1ZGJA 2CNNA 2F1JA 2YYAA 3DQPA 1HA3A 2IYOA 3MINA 2YWXA 3UK2A 2JIPA 3MWJA 3NEJA 3USES 3EIEA 1GG9A 4HNUA 4KIWA 1QLHA 4CM9D 4EJ0A 4PLYA 4W1SA 2ENWA 1U1IA 3QPCA 4ZVMA 4CM4B 1ZIPA 3ZHYA 1HLGA 1U1EA 2HSEA 2IUFA 3KJGA 2C98A 4EECA 4KXXA 5CHEA 1ADFA 3PUZA 1JS1X 2B4YA 1YJAA 2NUAB 1G3RA 4LXTA 3QU4A 1E7SA 5JCZA 1ADCA 2ERYA 2JPDA 3G02A 3P97A 2C9BA 3WISA 1PFVA 2V6GA 3FCUB 1NRWA 3GDHA 3PLRA 2CNWD 4DCVA 1A72A 5A04A 2R6AA 4HJRA 3TW4A 5LZ9A 5BUZA 1NULA 2PJDA 2B82A 4HDSB 2QE6A 1EK6A 3D6VA 4PXAA 4P9NA 1XRPA 2M2IA 5CAEA 3E7PA 2C4UA 1IHYA 5FADA 3DNPA 4OLJA 3N2GA 2I03A 3NHZA 4XLTA 1CP3A 2IXDA 3GGJA 4PCAA 5KU1A 1KC3A 1QVVA 3GJ4A 4WOKA 3DNFA 1IUKA 1NVAA 2CFIA 2R6ZA 3BY2A 2GJRA 5EP2A 5EMHA 4IDHA 4BNDA 5F7OA 3CH4B 3TDMA 5L6MB 1NXQA 1UQTA 1ECGA 3AEUA 3DF9A 3JAKB 4J90A 4NQZA 2Z6BD 2XZOA 4S1WA 1S9HA 3V00A 3EA0A 3QITA 2Z57A 2PH7A 3IPCA 3DUFB 2XYVA 4LV8B 1ZGGA 2DG2A 2I22A 2FOXA 4X65B 5KYWB 3LHIA 5EP1A 3L0PA 4L5JA 2VUTA 1IXSB 4BWGA 3SICE 5A3JA 1NW5A 1H2AS 1SVUA 2BGMA 2GCIA 3DT9A 3AVPA 4JIMA 3SBDA 3KOMA 1GT6A 4NDZA 1CUFA 5F4ZA 5KSYA 3HCFA 4QO8A 5KPJA 1PAUA 3U7JA 1T3TA 4IYRA 2Q28A 4RQAA 4Q1BA 2AJCA 3CMMA 1C3LA 1G3QA 4UPDA 5HFAA 2UVPA 5L3QB 2C1EA 4YJ3A 3VR0A 4EKYA 3NCHA 1L5YA 1ZC3A 3BTVA 3FVVA 1UXKA 5KNLA 1VGRA 3MJCA 4OAPA 5DM0A 3WMFA 5I7HA 1KAQA 3AH8A 3V7FA 4GE3A 1SOMA 5KTOA 3EQ6A 3UG7A 2CLDX 3CZ4A 5CIYA 1JEYA 4RS3A 4OM8A 2HTFA 1MH9A 3K31A 3WOVA 3FWNA 1G8HA 4R8VA 1NUPA 2OZKA 1X1TA 4RDJA 1TAQA 3ABRB 1IZ8A 3UV3A 2QUHA 5GOZA 1SXPA 1VI6A 1T91A 5MHTA 4BGDA 3F6RA 3FYUC 5JXGA 2JFPA 3D26A 2HHCA 5L46A 4IDQA 2K2WA 4TV8B 3UAWA 3RKRA 3CGGA 4C7OB 1OC4A 1CZHA 1Y7TA 1VFNA 3RRMA 3FPSA 3LYAA 1KFCB 1J0CA 4RVOA 3BWBA 1Q3TA 1WD5A 3Q7TA 4I19A 3PD7A 1WMBA 3RSSA 5KNBA 2E37A 3N2KA 3N8DA 4NCAA 3RC1A 2JGMA 3M1LA 3EZ6A 4NQRA 3BXXA 1JI3A 2R47A 3R6GA 2C7QA 1CUXA 2QD5A 3PGLA 3TIXB 2JAWA 2QU8A 3PPVA 3MWYW 1PDWA 5A0TA 5ALUA 4M8IA 1DFHA 1L4FA