4N40A

Crystal structure of human epithelial cell-transforming sequence 2 protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
281
structure length
281
Chain Sequence
b'EMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ECT2
publication title Crystal structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 65
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A03
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A02
2HTFA 2INGX 3K0KA 3JVEA 1IMOA 3T7KA 3KTFA 2R1ZA 3PC7A 3FA2A 3L46A 2VXCA 3K16A 3HUEA 3U3ZA 3T1NA 4JLUA 2VXBA 3EF1A 3I0MA 3T7JA 4XQ0A 2L42A 5ECGC 2ADOA 3T7IA 1KZYC 1L7BA 3SHVA 2XNHA 2EBWA 3SHTA 1T2UA 1Y98A 2COUA 1IN1A 2AZMA 2COKA 2E2WA 2DUNA 3PXAA 4BU1A 1GZHB 3PXEA 3PC8C 2NTEA 1T15A 3PA6A 3AL3A 3HUFA 3L41A 1T2VA 3PC8A 3UENA 3PXCX 4Y2GA 4OFBA 3PD7A 2D8MA 3PXBA 2K7FA 3OLCX 1JNXX 4BU0A 4BMCA 2K6GA 3K15A 3PC6A 4XPZA 4U4AA 3SZMA 3SQDA 3QVGB 2COEA 1Z56C 4IFIA 2LE0A 2M2IA 1CDZA 3QVGA 4Y18A 2EBUA 2EP8A 3I0NA 4IGKA 1OQAA 2ETXA 2XNKA 3L40A 1WF6A 4BMDA 3UEOA 4N40A 3K05A 3EF0A 3K0HA 2WT8A 1T29A 4ID3A 3AL2A 1N5OX 2JW5A 3COJA 3PXDA 1L0BA 3II6X
chains in the Genus database with same CATH superfamily
1XAIA 1Q1QA 4A16A 1Z4IA 1K9SA 1XVVA 3IUSA 5G0SA 1COWA 2O2ZA 3ENVA 3UCXA 5ES4B 1CVRA 5L3RA 4QIHA 5TX7A 1HRDA 3TQHA 1L5GB 2QN3A 3ZOKA 3I6BA 5JQGF 2IUYA 1YV9A 5CX1B 3UMCA 1UDWA 4QU5A 4IEEA 1OXTA 2QX7A 3S5UA 4MA4A 3NDJA 3ZV5A 3NP9A 1DAEA 3A1SA 3ADKA 1T9ZA 1V7ZA 3O21A 1T24A 3OX1A 2WOOA 3IHKA 5KNBA 3KELA 1LPSA 1IBMB 2X22A 4KMOA 3RPEA 3IO5A 2OTCA 3RSQA 1XT6A 3GLTA 5HE8A 2IEGA 8LDHA 3GJ6A 1FP2A 1ZNYA 4C78A 1YE5A 2QSYA 4DNOA 5JPDA 2A33A 3MJHA 3OEYA 4F96A 3TJMA 5GGYA 3D2LA 4I1YA 4K87A 3M3DA 3SVLA 5K8IA 2B36A 4G0XA 1RQLA 4ZVUA 3MOGA 3V8RA 3I6YA 2WWXA 5DCYA 3VR5D 2R8EA 1PKEA 1WJGA 3H3JA 4ZP1A 3COSA 3E9CA 3FMFA 2X6TA 2Q4DA 1VRWA 4YA6A 1GARA 3Q7IA 3ZDXB 4B43A 5HM8A 1WX1A 5JT1A 2D8AA 3SHWA 5ELXA 2GRJA 1P9RA 3OH8A 4U7DA 1ACMA 2A9PA 4G4JA 1SVIA 1GNLA 4WA7A 2ASEA 1QYIA 2JLYA 4F2DA 1AXGA 1QRDA 2UZ4A 1YS9A 4UPEA 1SM4A 2P9CA 2FN4A 3FYSA 1MAAA 5FKJA 2RKWA 2H00A 1D2CA 4MULA 4M7RA 1TFUA 1O5TA 3E8SA 5G1OA 4NP6A 4HV4A 2OXEA 5LIRA 3RADC 2HJGA 4UREA 1DRKA 1Y1LA 3AEXA 1UZLA 3F96A 1IDN1 1HTWA 2BC9A 1E92A 5BV0A 4UQOA 4I6GA 2FA9A 5DGHA 1E2KA 2KLBA 1NBWB 4MO2A 3K1JA 4IVRA 4E1BA 3AKYA 2AVNA 4S2UA 2QR5A 4CR7A 2EKBA 2IS1A 3DW1X 1ESDA 2V7BA 2VQ6A 4M60A 3EIFA 2YUTA 4PLVA 1XEWX 4MITA 4MVJD 3WLJA 4EB3A 1QP4A 3A05A 1XMIA 4QRDA 5AJVB 1AQ6A 1B3BA 3DJYA 1SXGA 4HC4A 3G6KA 1YQWA 1E2DA 1VMKA 3C7AA 3EXHA 4HDRB 4WDQA 3Q3GE 1AA9A 4P5DA 1C5KA 3RIXA 1XCBA 3ZEAA 4YJDA 5KSOA 1X1DA 4LOKA 1MJGM 2VRNA 1CETA 4IH4A 3MG9A 2BGUA 3DEZA 4XW2A 3QIVA 3CZMA 3LWZA 2RKBA 2IV2X 1UM9B 3RF7A 2OCKA 2AC7A 4A26A 2X5JO 1YVRA 4JB8A 3AJEA 1VRVA 1D0IA 3K0AA 1OTHA 2ZBEA 3QWFA 4P4TA 3WGTA 1UDRA 5FJJA 5IT9A 4F11A 1JMVA 1XZAA 2B8EA 5I3ZA 1VKNA 3ST7A 5AVZA 2VATA 2FPRA 2ZUCA 1FSZA 3KOYA 3SICE 4H7JA 1N5IA 4EDFA 1I7PA 1K7FB 3W3AA 5JXHA 4MX8A 5G53C 3PC3A 4EG3A 4N0MA 1XZKA 1IUPA 1Z25A 1GNSA 1JLLB 3DO6A 3HEAA 4HJXA 4QU9A 5F7ZA 4Q1AA 4UDXX 2PUBA 3T9FA 2R1VA 1TW2A 1T3ZA 1BE6A 2PX5A 4K9PA 3OOYA 2WMDA 2ZM6B 1RW4A 3SIWA 1TGVA 4KITB 5G0UA 4WN9A 4TV8B 2VL7A 1ARZA 2XYRA 4BL5A 2XCRB 3BUSA 4PRYA 4ENPA 5ITVA 1LFDB 1ESCA 2QV0A 3NHPA 3IL2A 1GGVA 3EPHA 4UFNA 1T43A 3QXCA 3CKKA 1QGUB 4ER6A 1VL5A 1YQ9A 1N2HA 5G4KB 3UWPA 1QB7A 4XEUA 5JSKA 3SSAA 4HRYA 4F21A 5C1BA 2VYND 1LWNA 1PR5A 2XJ4A 1WDKA 2OCYC 2FPGA 2PK3A 4PCVA 3R7BA 4WY8A 3W9BA 1V6CA 4H7FA 2KQUA 2O3QA 2VHUA 5DI9A 3I1JA 3W90A 3Q4GA 5FF9A 3KHSA 4GMKA 3P32A 5JAPA 1JKIA 1XRJA 3GJSA 4NONA 2R2AA 1IOWA 3H7AA 4RPGA 4C22A 1ECFA 3FFTA 3NHZA 6PFKA 2XRYA 2X15A 4ZVTA 3BK1A 4R2KA 4X45A 1OX5A 2W2LD 1XNJA 2VPQA 4PQYA 1OZ0A 5ESRA 3S8YA 2O8CB 5BSTA 2HUPA 4J7XA 3P71T 2AR7A 5IDYA 1SOWA 2J6CA 4RTOA 4M9QA 2PUFA 1CY2A 1ZI9A 3DKKA 1I4EB 1ADGA 3UV7A 3PC8C 3LVRE 4L27A 1SVWA 3VHRA 3NUGA 2XY4A 4DUGA 3OLQA 1GPUA 1KZ4A 2FVXA 4JP8A 4OX9Y 4MUNA 4AWXA 2R8ZA 4KAXA 1O9GA 4PYMA 2HA2A 1WHTB 3DEFA 2D2IA 5ALTA 5IKXA 4PX3A 4EFDA 1SUFA 3LXRA 3HABA 3N8DA 2IV7A 2FB9A 4QUEA 4EAAA 1FY2A 1H2WA 1OYOA 4XRGA 4FYJA 3TW8A 3O4FA 4JC0A 2GKGA 4QGHA 4US0R 5HCNA 4YUZA 1FVXA 3ETGA 3GJ7A 2XD9A 3THRA 1CC1S 3H9CA 5ALSA 4GRAA 4QREA 5L3QA 1Z4QA 5AVUA 3EGDA 4WLOA 2UV8A 1QNLA 3N2ZB 2MYPA 1JZQA 1GILA 1UH5A 2ZS9A 3EC1A 1VCOA 4QE3A 4MRMB 4UU7A 7REQB 1DXQA 3RWMB 3U49A 1NVXQ 3DO5A 3GJ5A 2H0AA 4ZHQB 4YLGA 4KDRA 1CUDA 2VCEA 2VF5X 3SSNA 2NSHA 3UMGA 2ACVA 1CYDA 3D6HA 3DDZX 3EXG1 2LXNA 3H9GA 4MUKA 3R8XA 2K7ZA 3DV9A 3HS3A 2XT9A 3MINA 2VCHA 2SCUB 3LUPA 1JHUA 4NTZA 1M34E 3H4MA 4J91A 4NK4A 1FRFS 5I7HA 1N7JA 1L5YA 1UT8A 1F2TB 2CMKA 4URYR 5CLJA 2DFVA 2FR8A 2I6GA 5JS7A 1E3EA 3DULA 3SLRA 2PPVA 1KTIA 4MYRA 3AUTA 2E4UA 3AV3A 2TECE 1Q44A 2E4YA 3MMXA 2EU8A 2X0RA 3OPQA 3QVOA 2YWDA 5C7IO 2XMZA 5JRZA 1Z63A 3GXOA 4Q1BA 1XCLA 4Q1DA 4BMDA 5HZMA 3ASYA 2QT0A 1U1EA 1RTTA 2ZTLA 5AHKA 2GAFA 3CNEA 5DW3A 2YWHA 5C7LO 1KVUA 1XTTA 3S6JA 4E88A 3HJNA 1JFSA 1M1YE 1DDOA 3MW8A 1Z0AA 3WLLA 2WB4A 5ERYA 3BXEA 1Y9DA 1NLYA 3NXKA 4B9EA 1A7UA 3FGPA 1LLDA 2XLBA 1PJLA 3E3AA 1OTYA 4UMVA 4CETA 5CG1A 3GFRA 4YDHB 3I52A 2G77B 1WWKA 5LD2C 3I2KA 3TL3A 4M6WA 4FX5A 2B34A 2PE5A 2M9MA 3CUYA 1CDOA 1I30A 1Z0UA 1PL7A 3JV7A 1R8YA 1T1IA 2VS1A 1JT2A 2FPPA 3HHEA 2ZAYA 4H59A 4X61A 1FL9A 3EIOA 3O5AA 2G06A 3K9WA 4JLOA 4OQFA 4QECA 5IBQA 1BEZA 2YIMA 3NWEA 3EXEA 4I55A 4M0UA 2G70A 1CE8A 3STWA 2UZ0A 2DBRA 3C7TA 3GGJA 1ZUWA 4KKXB 5AKGA 5E9QA 4ZCRA 1K6EA 1KOJA 1XKQA 2EV9A 2ET6A 1R66A 2WMNB 3A8TA 5LQSA 3OFJA 3SIXA 2ZREA 3N39C 4ENSA 2BEVA 1QVZA 2WU8A 1IY2A 1OLOA 2FSPA 4JYBA 5ADHA 2HFKA 3OEHD 1NBMD 1LNSA 5LJIA 5SZIA 1A8SA 1B7GO 2FPOA 1WD5A 1Z22A 3PCTA 5DNAA 4YREA 5T4HA 3VU0A 1YJQA 1VHJA 2EBWA 3NEPX 3INNA 2HJRA 2IYEA 3WNQA 1Z5WA 4C7XA 3HYSA 3IYLW 2WEKA 1YI8A 4KACA 2OFPA 3L7KA 4LECA 4UTRA 4ZALA 5IJAA 5AUQA 2C9CA 1KETA 3I39X 3L6OO 3QEOA 2ZT7A 2JGFA 1SHKA 4DDVA 1I2CA 4L57A 3QJYA 1F38A 4QHYA 3URMA 1FYVA 4EHFA 1G66A 5TNXA 4QFBA 4WNYA 1W59A 3AQIA 1WLSA 3F78A 4W8HA 2E5FA 4JA0A 4FNGA 1X19A 4P8RA 5AJHA 3GEEA 4G0NA 3HLTA 3W34A 5K4HA 1Q84A 4FEEA 4IBOA 3HKDA 3ME5A 1NDHA 5C8YA 4AC9A 4WBNA 4KWEA 4ZVSA 5KJFA 1Q0LA 3S1SA 1XHLA 2QTFA 4Z4IA 4Q4AB 1P6QA 1PQ4A 4ZI7A 1N75A 4LSMA 4NU5A 4EPVA 3RSCA 5JY6A 2BFEA 1KEVA 4IV0A 4H7EA 2G0AA 2HK8A 4UUBA 3I6QA 2IW1A 4KMSA 4UTZA 4ZFNA 5EHZA 3BAZA 2GBLA 3NDRA 2FUEA 1YK0A 2PV0A 3A31A 4JP5A 5I7VA 4N47A 3V42A 2P69A 1T8PA 3IIJA 1PFVA 5EVCA 2BSAA 2BFCA 3GH1A 4S24A 1XYYA 2R44A 3CH5A 5IF9A 1DSSG 4MW9A 5LQUA 1C1DA 2DLNA 5D5HA 1IZ7A 2YHSA 5BN5A 1M2FA 4F46A 1OFTA 4Z7JA 4UW9A 1KVSA 4ZRDA 1ZOIA 1PN3A 4V02A 2VPYA 4PANA 4PAWA 3C41J 3JQFA 4RD1A 4XPIB 5FORA 5L6MB 4B3BA 3B1KA 5CDUA 4ARAA 1ORWA 2FKAA 1XRLA 3GUYA 2VHVA 1XTSA 5L3ZA 2G07A 4Z7QB 4J3NA 2O6HA 1TK3A 2X9VA 3FCXA 3K0HA 4NBNA 1VSVA 4R31A 4D5EA 2QVXX 5FBRB 4AS1A 4L74A 4FR2A 3QKTA 4KWIA 3UW1A 2YNMD 3BSWA 4AKGA 1QFYA 3QHAA 3E7WA 4J29A 3CVVA 4IL5A 3F98A 5KYWB 2OHJA 3LVFO 3AHHA 3KEGA 1CQZA 5JD4A 5E6RA 3ZHYA 1UMKA 3UOGA 1I3CA 2O8NA 1R15A 3TIGA 1KAOA 4GL4A 3TWOA 1XDSA 2HRZA 4BQNA 3CJRA 3BJMA 2DQ4A 3BMOA 1ZJYA 1JYSA 2A4MA 3DEHA 3TPZA 2JFOA 2W8ZA 4OXXA 2GYVA 3JR7A 2VT3A 5HF5A 5C5EA 1AGRA 4MQEA 4GXNA 4QUIA 1KMCA 2MINA 5C53B 3NYRA 1D7AA 2NT4A 4L75A 3G89A 3GFOA 4KQWA 4Y2QA 4C1NA 4RTSA 2FWIA 1WZNA 821PA 1PK8A 1Z26A 4YJHA 4CNBA 3CUKA 2DCMA 4D45A 2AB0A 4BVHA 5IABA 1BRTA 3K35A 4KDEA 3P52A 4R9UC 4A1OA 2O1SA 4B3HA 5FAKA 4MIYA 1IRIA 3RAEC 2H1OA 2ORVA 2FOIA 1BDIA 4G24A 2C84A 3GT7A 1SR8A 4C0BA 2QRZA 4NARA 4L07A 4BMYA 1XMOB 1ETHA 4HFJA 4MI3A 1V0JA 1NC1A 4DRZA 4C4RA 1L7OA 3H8WA 1PZFA 1QFXA 5LQDA 2OA0A 4BMXA 5CFRA 2G25A 3GNLA 1Q2XA 3F1KA 1VZ2A 4CQNA 1FFWA 1JT9A 1KS9A 5EZ5A 3O3NB 1T4MA 4AKSA 3ZWOA 1U3DA 5CT6A 2BI4A 1LLCA 1N6IA 1GPNA 3HR8A 4Y2JA 3RTCA 3QGMA 1FFHA 3EVFA 2HHAA 4NCJA 3S0JA 2EOAA 1RFGE 2IXDA 2MIIA 4EJSB 4YJ3A 3QVKA 2OHXA 4D9MA 1HV8A 4I1UA 3SX2A 3OCVA 1BEUB 5JNUA 4GNRA 2CZQA 1C9EA 3GEPA 1FTGA 2EP5A 4D3DA 1L6RA 1TQ8A 4ZAFA 2MSNA 2B3DA 2OFXA 1XQXA 4WT7A 3JYQA 2QGZA 4U4AA 4RVOA 3HU5A 1YRYE 2IRWA 3ADCA 3GI1A 3W2HA 2WHEA 1QJCA 3PGVA 4H3HB 4DCCA 5AK4A 2W22A 3KHTA 1XAGA 3U1TA 1G64A 1NDUA 3NOXA 2P9JA 2ADMA 2C77A 3RU3A 3W2FA 4BFXA 3OCUA 5FWYB 3VZRA 4X71A 4JC8A 4RAOA 4BKRA 2IJGX 3KXKA 3NAQA 1ATZA 4RVUA 2H17A 2R66A 1QMPA 2BEUB 3KVRA 4C08A 3MJTA 4OK3A 3M5DA 2W6NA 1O95A 3VNSA 3I23A 1MXHA 2PGOA 4RD3A 1DOAA 1KAMA 1VSBA 3IOMA 4FGJA 3TNJA 1XQVA 2DBYA 3JAKA 3A7EA 4FLEA 1UT5A 4R7TA 3JQAB 3LUDA 4UBIA 1PGJA 4Q3KA 3SE0A 4TQGA 4LE2A 4AJKA 1KY4A 2FGJA 4X9XA 5COAA 1OH6A 1U0GA 2L2QA 2C5GA 1E0AA 3L0BA 3FOFC 3IERA 4KH0A 3V4OA 1UMCB 3PX7A 4B7ZA 3AINA 1XROA 1FXWF 4LRWA 5I45A 4FYIA 1U8EA 3ICVA 2BFWA 3NG1A 4IG4A 4WNAB 5DNVA 3UC5A 3F7MA 3RWOA 2H5JA 4FKZA 4Z4HA 4UVGA 4JBNA 1YKFA 4D9JA 4OMCA 1JPJA 3QUBA 2QT1A 5K3FA 1AKVA 3OCZA 3QKUA 3NNDA 9MHTA 3LY9A 4KJXA 1EWKA 1CQJB 4G5XA 4R2JA 4ZT4A 4WVLA 3WGMA 2IBSA 1DGQA 3IQIX 1OHHD 4ZZ3A 4DRYA 2C2ZA 2GJ8A 2QX9A 1EUYA 3DL0A 1UMDA 2QVZX 3G85A 4QRIA 5ALNA 5H59A 1Z16A 4O4IF 3AEZA 4QGGA 1E18A 1L5FA 3GLHB 1YRQA 2P6MA 3I9MA 1I51A 1NOJA 1SC4A 1SZCA 2VBIA 1EXWA 1D5CA 1NATA 3DZGA 3BIXA 3ETLA 3JZFA 3T1YB 1TC2A 8GPBA 1CR0A 2NVBA 4K2HA 5DXAA 3V8EA 2APJA 4B34A 3CSDA 4UQLA 1ZIDA 1TU4A 4WY5A 2GXUA 5BYKA 5B4TA 3EZXA 1UBKS 2XYPA 3GLIA 1RJEA 1Y1TA 1XC7A 1E7MA 3BE6A 3JRNA 3BERA 3QVWA 4FN5A 4M0FA 1OZGA 3FUUA 3B1FA 4AX8A 3AUSA 2V5AA 1USKA 3P4YA 2ZCJA 1MMFB 2B0CA 1R0RE 2XQGA 2NXCA 1SOVA 2FDXA 2OB2A 3C3CA 3OA0A 2V4ZA 2CNLA 2FPIA 1AN0A 4X00A 3RBXA 3TB4A 2JCSA 2HU7A 3I5XA 3BMNA 2EX1A 4E0BA 1SQ6A 3HEMA 3ZCXA 2ZTMA 3CINA 3IPCA 3RBVA 5CJ2A 5HIMA 3RC1A 5DPMA 1DEKA 2ZSFA 1PR6A 1X1QA 5LJLA 1Z2PX 1J8VA 2RHLA 4HN9A 1X7DA 5D87A 5H3LA 3W2EA 3ZEIA 4ALIA 1N6LA 4QJIA 5A7HA 1JX6A 3EDYA 2PA0A 1GKUB 4E5NA 5DM4A 4MWEA 2JAXA 2PIDA 2SKDA 4ON9A 3WICA 2FSSA 4HUQB 1SVLA 2BGIA 2XMDA 3ANYB 3OPMA 2GDZA 5EMJA 3PD7A 4G07A 1WXQA 1GTG1 2PG3A 2WIDA 4EX7A 4J4BA 5AKJA 3GLRA 5B3KA 4E12A 4PY2A 3GP5A 4TLBA 4DADA 4RVFA 3IEUA 4A7PA 2PGJA 1BFKA 3P9RA 4O4JB 3WHLA 1OBCA 1M5TA 2ZR7A 3GDGA 3H1AA 3QU9A 5CLHA 2I4TA 3MAJA 3PLRA 2C5HA 4N65A 3DBVO 3N58A 2W7TA 5DTEA 2NUAB 3ZWYA 5F9FA 6ADHA 2F1KA 4DIBA 1OI2A 1ZJJA 3M1AA 1CNFA 4G9EA 4AMBA 3LP8A 1IJEA 5AM5A 5AQEA 5FOVA 1U2TA 4P86A 4J16A 4AZ3B 1MBZA 4HDKB 4LDQA 1V5GA 4PF1A 5DWVA 1HLFA 1LBEA 3T3HA 4P93A 1XZLA 4K8RB 1FNSA 4PC3A 2R1UA 5DCUA 4G9BA 3JQCA 1NY6A 5FA8A 1ITZA 2O23A 4YBZA 1TEXA 4KXFB 2G5PA 4FFBB 5AKIA 3UKOA 4UVIA 5A4FS 2IHNA 1PJCA 3FN4A 1GPWB 4XGNA 3P8ZA 2J41A 2VJOA 4FONA 2O5VA 4XM0A 5J1TB 3GARA 2YV1A 4D74A 1C7JA 1XVTA 5LXTB 4JEHA 2Y2VA 3LLVA 1Q77A 4LK3A 3DE3X 1HEIA 4B45A 5KSZA 2ENUA 3NM4A 1Z4OA 4L85A 3ZZMA 4GUAA 1JSRA 1YR3A 4G36A 5JLJA 4F3TA 4F5DA 1DQSA 1DOHA 3SM9A 5JMTA 5JWOA 1E3MA 2GHTA 3FPCA 5CRIA 3WADA 1DB3A 2ZTHA 1R7RA 1R6BX 3HJBA 3WDLA 2HTFA 3BE8A 3FOZA 2QTAA 4BNDA 4I1SA 1FU4A 2C4NA 4LDAA 3O1JC 4TZTA 2XUAA 3ZUGA 1WDWB 2FMKA 5HUQA 5ITSA 1J8DA 4AT1A 2BFBB 3LBHA 2FWJA 5BVGA 2ZWOA 4N8DA 3WIDA 2QRGA 5LQMA 1BJKA 1NUAA 4RXMA 3VJKA 4ZQEA 3H3FA 1OVMA 2IYWA 5H83A 4J7AA 1T4BA 3IKJA 2ZI5A 4JODA 2QK4A 1U0FA 4CG2A 1EQUA 2W2KA 3LCUA 1JJBA 2Y0DA 3E22A 4OQ4A 4WKCA 4DDUA 3IR5A 2VDJA 4IMRA 3A1VA 1SK9A 1T0IA 2XNJA 4GXQA 1QCDA 4PZAA 4MLDA 4AJEA 4C89A 4DJJA 4F9EA 2NZJA 3AUJB 3Q5DA 2I71A 3K1AA 2I0FA 1TT5B 2QDXA 4GRDA 4JJEA 4ZOLF 3IEPA 5CCDA 4BAGA 4WXMA 2HA4A 4BO3A 3GGOA 2QTMA 3CXRA 3O03A 1JLLA 2GNAA 3CX4A 2C1XA 1HORA 3GPBA 1DT5A 1YZGA 2CY0A 3K72B 1L7XA 4ALLA 1O3YA 3L0CA 1CRZA 1SKBA 5EQDA 4M36A 1G20E 1SBCA 3UC9A 1J0CA 3D9QX 3NHWA 5CJJA 1N1DA 3ZNOA 3IILA 1ZNXA 4QGAA 2P6PA 1NAHA 4RK4A 5AM1A 5FR2A 1C7QA 1U9IC 1RBYA 4ZAXA 3FHLA 3U80A 3JQEA 2UYOA 1DBRA 3U3JA 1X13A 2BP7A 2VHYA 3R5XA 2YWEA 3I9V1 5CYGA 2GPYA 5JPCA 1VPWA 2N1BA 4M0PA 3WKDA 4BVJA 2B8WA 4GYJA 4G8CA 1NQXA 1E60A 4JSRA 4KQEA 1PQPA 4L6CA 3NZEA 4TQ9A 1N2SA 2FSGA 1QGAA 2YRWA 3ES9A 4AN1A 1YRWA 1Y4SA 2LUOA 4Q39A 2HK6A 1MOPA 1SCIA 1NC3A 2JI4A 2R7AA 2EJCA 3C5CA 4QQNA 5CB4F 1KY5A 1HT1E 1T0UA 2B2NA 5CFMA 2NP6A 3F97A 4L8YA 1DKUA 4NOJA 4YBRA 1PYOA 5JSHA 2GOYA 3QE3A 1YS6A 1H9BA 4HQLA 3L9WA 3QLJA 4WASA 1Y3IA 2VUIB 4NOLA 5IXYA 4YECA 1UWCA 2XOKA 1JBKA 1UMBB 3K4PA 4FNAA 2PEYA 2CBGA 2Z08A 4YRCA 2P3OA 3UWMA 4DPLA 2DPGA 2GH1A 2M2IA 2HI0A 3JS5A 3LF1A 2RK6A 4GKKB 4UUOA 4IIBA 1U28A 4HWRA 1W30A 2GPTA 4RIGA 2ETXA 3LY7A 4CFYA 4Q4DA 1ZY2A 3L7AA 3WO0A 1V35A 2O8DB 4LGCA 1FSFA 4KQ1A 5FO1A 2J46A 4EW6A 3DWIA 4LNHA 1A2KC 1H3FA 3LS2A 5K8TA 2C0PA 1SG6A 3TXAA 2ZM5A 1Z8HA 1RXSA 2GUGA 4OKNA 1H9AA 4QPJC 1E89A 1PO7A 1IBRA 1S3SA 3KV1A 2SICE 3WBJA 1EDDA 1IN8A 1C3OB 4WUVA 3VAZA 3DMDA 4AVYA 3E9YA 3HB5X 4KI0A 3TQOA 1WZEA 4LPKA 3WRYC 4LYHA 4NFLA 2AJDA 2YHIB 5BNWA 2EF0A 3P27A 3ZXXA 2OZLB 3AZPA 2X4LA 2QZZA 2HOQA 4BJ5A 4HOYA 4MRMA 2VZEA 3Q6NA 1OY1A 1H8ED 3A3NA 3AT1A 4REQA 4UCXA 4ZHQA 1YUNA 3Q0IA 1U0LA 5KJ6A 1CNEA 1ZKDA 2RHWA 5DISB 4CIAA 2HYIC 5C5CA 4PNZA 3H97A 3CLUD 1AY0A 3LKDA 2O06A 2PH3A 5SY6A 4CPDA 3RHZA 7ABPA 5LZ7A 2F8LA 2C8LA 4ND8A 3U37A 3ZCUA 1OX4A 1E94E 2VTEA 3DF9A 2FW9A 3UHPA 3VX4A 1JJAA 4G0MA 5HG0A 1BRMA 1LQUA 1POWA 4QNMA 5D7NA 3T1NA 2FQ1A 1DEOA 5IT0A 1SCQA 4DIMA 1DRJA 1ETUA 1JFTA 1EJ0A 4P7JA 1J06A 2R86A 3DBHB 1D6JA 4GKBA 4CTJA 4JI8B 1FPMA 1G7SA 4J7CA 4KBFA 3LL7A 4DLYA 2GAJA 4MW4A 1JR4A 3QLVC 4WSOA 1LGYA 3KV3O 5EP2A 4ZCIA 1U6KA 3ND8A 3O3MB 3PS9A 5CP8A 1K4KA 1PJ4A 3UOWA 2F55A 5H82A 5HQ3A 2WE7A 4R3NA 3WYBA 1S2IA 2BM9A 3C5HA 3E82A 3BAFA 3LO5A 3MJ4A 2EDCA 4CF5A 4GWGA 2IYFA 3W0LB 5JHGB 5BWLA 1L4KA 1BDBA 1GUZA 1W44A 2GN6A 3H9JA 4NV0A 3QY9A 3B1YA 2JGLA 4LNUB 4HXYA 1E1CB 1ORIA 1WPRA 3MT7A 4GYKA 5BWMA 2P0AA 4C4SA 3QVJA 5B7NA 2OV6A 1CF2O 3NBAA 1ZJ4A 2XHEA 3A1CA 1GPH1 1KYXA 3DLCA 5IKOA 4YRZA 1EG2A 3VVLA 4I08A 2JBHA 4ZVMA 1IXKA 3D2AA 4N3BA 3JQQA 3B6MA 3I64A 3IUMA 4DCSA 4FB4A 1GTJ1 4F2PA 1BHO1 3A1TA 5FH9A 3VA7A 1N5JA 2QI9F 3M9LA 4ZJZA 1LV8A 1M33A 4OHOA 3DBLB 1QUEA 4IYRA 1GGMA 1ZZEA 4KZKA 2PUDA 4OHYA 2J3EA 2CBXA 4WOPA 2XXBA 3V7UA 2GDJA 2HD4A 5SZKB 4UZEA 3HSSA 4CL0A 3DLPX 3JQ8B 2FFHA 4FKBA 1JFFA 1ADYA 1YR1A 4PYNA 5KB3A 2R84A 5JQGB 3D7KA 5CXQA 1X7WA 2ODAA 4P2GA 5SYMA 4GS5A 1NURA 2IHBA 1AO0A 1FLNA 1GFIA 1H5NA 3H2ZA 3LHSA 4Q05A 2XWBF 4WKNA 1NXWA 1F2DA 2CJWB 1DIBA 4X93A 4MROA 1YVEI 2H2AA 5JFGA 3S1AA 3H99A 3EPJA 2CVZA 2KLHA 3CWZA 3DR5A 5E7QA 2ONKA 2P9YA 3ID6C 3QX8A 3EAGA 1DMRA 3WSTA 4L7VA 1VIMA 5EIHA 1MZPA 2NADA 2QLMA 4QA9A 2E37A 4B40A 1DUSA 1P7ZA 1M5UA 5HWSA 4DUYB 1CDEA 4IEFB 1NPTO 2ZVPX 3B3AA 3DE6X 2QRHA 4GICA 1MOQA 5KAMA 4K40A 3UM9A 3HCEA 4NY1A 3TM5A 3LFHA 2E87A 2OHGA 1TJ4A 4HBZA 4MCAA 3ZI0A 2PJZA 1QDEA 4I4NA 1RXIA 1YRAA 4QOHA 5CT8A 3EH1A 1EYZA 1XZQA 2RCYA 3BTVA 2XXAB 1T5BA 4QLOA 4KRFA 1SUIA 3Q1LA 3PQ5A 2BMDA 1BSVA 2F9MA 4KR3A 1OIXA 4B8YA 2ZXEA 1NP3A 3BGVA 4ZQGA 4N3NA 1SU8A 2EBHX 3TSOA 5JANA 1YGPA 1IHUA 3E5MA 1CB7A 3KYBA 1G8HA 1O0BA 3R76A 3ZKWB 3BB4A 3H19A 3L6BA 5JS6A 2AG5A 2Q9AA 1KEZA 1MJ5A 1NT2A 1VHLA 2DTEA 3FUXA 3IUQA 3M33A 1EEXB 5T4FA 4GE3A 3UZUA 4E11A 2O7SA 3A7DA 1I6KA 2WM8A 5DWQA 1Y8ZA 3BDAA 5F77A 3FDIA 3LNCA 4ZMSA 3S40A 3EOAI 4UBKA 1RRFA 1CFJA 4JD5A 3S7TA 3N2KA 4DDHA 4YAJA 4KXYA 4RK0A 1ZA1A 1MORA 2JLQA 4QGBA 4L4ZA 4Q3LA 4KHZA 1RLOA 2IZ0A 3EVNA 3RS0A 5IEBA 3ZU6A 3OQHA 4N5DA 4CNQA 3X1KA 4GPAA 3SYMA 3FHJA 1MRNA 3ER8A 1NW8A 3N7AA 4K9LA 1JVNA 1Q91A 1XG5A 2FW6A 5I8ZA 5K0LA 3DC2A 3RC3A 2Z9CA 3I2JA 4KQHA 4FVTA 1EM6A 1G63A 2D62A 4L3VA 5ALVA 3NNNA 4MJ7A 5KOHA 4RXTA 4F2WA 3BKXA 3AR9A 4DIOA 5BMVA 1RLJA 1GRRA 4RBNA 1LBSA 1ZUNB 1IZZA 1TKRA 1G5RA 2R25B 1EGHA 1JYEA 3DH0A 5DSZA 2RJ3A 5F35A 3Q8MA 1CBUA 4A1FA 3OY7A 2DHQA 4GO1A 5C32A 3RIGA 2JVIA 2ZAIA 3C48A 3TR6A 4CT4B 4XM2A 1GFWA 7AT1A 5JEEA 4W6ZA 1PI3A 3IXLA 3PT9A 2GR9A 3WSWA 4BKUA 2G04A 4CV0A 3PXEA 2OFOA 2YQ4A 1FFXB 1SMKA 2X40A 3C7CB 3B60A 3EMVA 3ROFA 4DBLE 1T5DX 5JO0A 2VF2A 2V7UA 3W8DA 4YRGA 5DCWA 3KJIA 2XUIA 4JEMA 1EESA 1T8TA 4Y98A 5FCDA 3RD5A 3KG2A 1KMHB 2WUDA 3FPBA 5EE0A 5DZSA 3ZJUA 4TLDA 2LTAA 1M2VB 5DP1A 3CJQA 3FMIA 4BX9A 1ZA2A 1TK2A 1I7QB 1HLDA 1TXGA 4Q4HB 4MVXA 4P4SB 2Z83A 1USWA 2BKAA 2NTJA 4KAAA 3O8OA 4Y1RB 1OF1A 1OLUB 1U0OC 2I1WA 3CRZA 4UVEA 1XCMA 2VDWA 5K45A 1O9BA 1OWPA 1XTUA 1QLWA 1V1RA 3P2EA 3ACDA 2Q4OA 3H2YA 2PKWA 1BKSB 1UFVA 1CQIB 3QBJA 4JR2A 3FWHA 4C4XA 4CKCB 2FWAA 5B7QA 4X95A 1Z4PX 2QG9A 3JZIA 4YCNA 5BVHB 1X1CA 1WIWA 2B82A 3DTVD 4AIRA 1WD7A 2WIBA 4CM5A 4EFLA 4TWZA 3HM9A 2YVKA 3KRTA 4UDNA 4CUKA 1HR0B 2AJCA 5EHNA 2CVPA 1H66A 2J6BA 3DYVA 4JOCA 4TSKA 1CZHA 4Q9DA 3ICQB 4RVHA 3ZY2A 5CPBA 4GMFA 4G0WA 2P9GA 4CLXA 5DASA 5I4CA 2YIJA 2QTLA 1ORHA 3VBCA 3VR3D 3NLLA 4DBLC 3LU1A 4I3GA 3T7RA 4YAGA 3EAQA 3KQUA 1P6XA 3VPHA 4RESA 2PGDA 4EJSA 4CTKA 3DPSA 3FHOA 5JNTA 1JQJC 2D3TA 1RWBA 5C8XA 2XB4A 4RY8A 1TQ4A 2OO5A 9LDBA 4B3FX 4C7VA 3B9PA 3RJ9A 1RJFA 3CMCO 4F3KA 1PCXA 3OZBA 3DDNA 3C8DA 5ILQA 2V3CC 2H63A 1BAPA 1Q12A 2WW8A 1OH7A 2Z3ZA 2WA2A 3UT6A 3NWBA 1OPRA 3SYLA 3EY9A 2Q6LA 3TLBA 1W5AA 4PC2A 4QUBA 2QRVB 1URPA 2BJWA 4JZKA 4RK1A 3HO1A 1JHRA 1QHHA 1CUEA 1YNOA 4U7TB 2Q5HA 3E7DA 3IPXA 2D59A 4RF3A 4RTLA 1B1CA 1NXTA 1R4NA 1W94A 4M53A 1A1VA 3Q7PA 1P91A 2I80A 1KS2A 4G4IA 1BQ4A 1H8HA 4HZUB 4D4IA 2Z56A 5JI2E 4D6PA 4QBFA 2B37A 3GG2A 2J9GA 5FPKA 1K08A 5AI9A 2Q21A 3MXOA 2HCBA 3RYFB 4F12A 4FZ5A 2K5UA 4HGPA 3LGSA 3U44A 3TQCA 3P1JA 1EFHA 3T34A 2LRHA 2BV3A 1JZSA 2QD4A 1KI6A 3BQNB 3SP1A 2ZCUA 2BZGA 1HTBA 1W6UA 3N8NA 1J49A 3HKCB 3ZWKA 1XLTC 4IJUA 1GKYA 3E23A 3SS9X 2VQ3A 2D1TA 3AOEA 1T6BY 5H68A 2AJLI 2OXIA 1ZISA 3REOA 4U2GA 1B6TA 5FUYA 1EWQA 5JR3A 1RLTA 1UR5A 1Z6TA 5FI5A 1A97A 2RK4A 4HX5A 4AU1A 2XWPA 4IOJA 5G40A 3RB8A 3HCOA 4EF6A 1KR2A 4HN2A 2Z98A 2IYLD 2EP7A 2FQWA 3CZRA 3IPLA 3F47A 5JO9A 1WZUA 4D4MA 1WZIA 3A6FA 1OH8A 4X6UA 1N0VC 5HF9A 3OQMA 1HDRA 1CQJA 1H2BA 4RYLA 1DFGA 5HQ3B 4FZ3A 1GLGA 5FOTA 1J09A 1X1RA 2QRKA 1JDTA 4EL5A 1PNRA 5GPBA 1UBJS 1Y3AA 1Z12A 3PJGA 2BF7A 2CXUA 3CB2A 1LEHA 1ZINA 2X6QA 2ZRJA 1F51E 3AF2A 3NUZA 3UN1A 4U8GA 1A7JA 2EQBA 3WWPA 2Z2XA 2ZT8A 3OQIB 4N3CA 6ABPA 3FKSD 5WRFA 1V4BA 3ASVA 3IURA 3OTWA 4FMPA 4NV1A 3VR4D 1JDBB 3U61B 1FSGA 4YC7A 4MPTA 4PTZA 4RWEA 3MCUA 3AVVA 2E9SA 5EJGA 4OYLA 2GTHA 1USUA 2XAUA 3DZIA 4MQ5A 3FNRA 3T54A 3U5TA 1RPJA 4RLQA 2BKXA 2AHRA 2JAWA 1GKLA 2GVDC 2QS9A 4CT5A 5EEHA 2A5FA 1J7JA 3GHHA 4A03A 2ANBA 3KPWA 1WTAA 3FDZA 3GX1A 3DBRB 5E1MA 1V95A 4N8EA 4BBZA 2F00A 2QKYA 1TD9A 2PMKA 2ZSUA 3E9ZA 3GFGA 4L08A 3RVQA 3H6KA 3AR3A 4UPDA 4CM9A 1AZLA 4LJ6A 2Y68A 5CBPB 3TK1A 3EIHA 1SULA 2QX8A 1Q3KA 3GAZA 5FA6A 3ZZUA 2VLBA 1MZVA 1F17A 2YXBA 5KNDH 2P67A 3E58A 1ZYUA 1ZH4A 1ZJ5A 4A0FA 3EGIA 1GPBA 4GSLA 3VPAA 2R7MA 3KJEA 4AO8A 4EKYA 4C5CA 5F98A 3WNZA 4ZI3A 3BCSA 5F9HA 1XLUA 4BPBA 3HKEB 4NPCA 2CWDA 3BB1A 4M0MA 2F59A 1EUQA 2NG1A 4RENA 4DLSA 4QXAA 2H1VA 2OB1A 3I1IA 3TRFA 3VTZA 3ESXA 3WMWA 2ZJBA 1I3MA 1Z0DA 4V3BA 5GOZA 1E5TA 4LSZA 2P7HA 4F2HA 4F8EA 2P6RA 1W29A 1MEEA 5DNDA 1NMZA 1YASA 4XWYA 1N34B 4JUBA 4XAQA 1TM4E 1O0SA 5IVHA 2BBSA 3GDWA 2O20A 1JHPA 2A4KA 3NFRA 2B99A 2QJOA 2WUWE 3IVAA 3PKJA 5F1OA 2G4LA 3KU4A 4FEYA 1EXDA 1K3TA 3RFFA 2BGGA 2BD0A 3CZQA 2HJSA 2X8AA 4DNPA 1RXCA 1VPEA 1Y8QB 1U11A 4MOWA 2HDNB 3WLHA 3PFKA 3OZRA 4U2KA 1K8QA 1X9HA 2R7LA 2F43A 2VF4X 4XVUA 2GPSA 4BPRA 4QFDA 2WQZA 2PUTA 5DHSA 3M7IA 1GPKA 4CN9A 4F6LA 1NBHA 1XN4A 1L4UA 4A8JC 3HWRA 3B3QA 5DM70 1SC6A 1WNTA 2F4VB 2PMEA 4RCZA 5EIWA 1GYQA 4ZYUA 3CC8A 3VI4B 4AY5A 2SKEA 1QOQB 3Q72A 2PL5A 5DX1A 3G7UA 3LSTA 4HLCA 3BWYA 3KBBA 5DX8A 2EZ9A 3G79A 2GYWA 3OU7A 4U9UA 4HEA1 1Q7TA 1ADCA 2JFGA 4J90A 4HHEA 5FV7A 2PX0A 3T5PA 4IXMA 4KQFA 4D4LA 4JAVC 2V6JA 3ZVNA 4CQLB 4FUQA 5DTMA 3D8SA 1QIEA 4R9NA 1XTQA 1IN5A 4M88A 4MRRA 3SMQA 3UFBA 3VHQA 1UM8A 3KETA 4OEHA 5AOCA 5L95A 3V1MA 2RAPA 2YRXA 4LKRA 5CU7A 4Z9YA 5I7FA 2I87A 3HA3A 4H6WA 4IIHA 5KDOA 3AJ8A 1WKCA 2NZ2A 4KYUA 3N2EA 4TN5A 3VAAA 1X1SA 3GQBA 3MT9A 3JYPA 3OPXA 3QPVA 4AJJA 1KH1A 4FN4A 5ITZB 1Z45A 1RWMA 3LUKA 2VRWA 4EUFA 2IDMA 4DDMA 4BNVA 3I8XA 2GEVA 2J5BA 3JVIA 2VQDA 2J9ZB 3EDRA 3GBSA 4DCMA 5L45A 2I1LA 5IVDA 3LZCA 4EA6A 3ECAA 4K9DA 3SXUB 3CVWA 4URWR 1GV1A 1A7AA 3HB9A 5EZ6B 5FT9A 2A86A 1YHNA 4Z9XA 4BDSA 4EFMA 2BYTA 2PX3A 1KOLA 2AFIA 2VA9A 1U8TA 4C3OB 2IOHA 2ORIA 2JI9A 2VDNB 4JCOA 3ZY4A 2OMKA 2ZUUA 3WRXC 3AIKA 5IJXA 1DKOA 3EXHC 3AB3A 3ZE8A 1R8XA 4B3IA 1XDWA 4P84A 3I9OA 4NE2A 4AK9A 2D1FA 3RYCA 2P4UA 2BBOA 2GVNA 1R4ZA 3NCTA 5K0GA 5EIAA 2I55A 1YJBA 2ALJA 3NTXA 3ADOA 3GC6A 3QFRA 1TX4B 2WV9A 1ECLA 1LCIA 5IP5A 2IS4A 3LPDA 3TVYA 4C2UA 5ALWA 5ABPA 1CY8A 2ZDGA 4LF8B 3DD1A 5HEKA 3LX8A 3DJFA 3FSGD 4UM8B 3B3JA 5EQJB 3N87A 1YQDA 2WYUA 3SKYA 4D0RA 3V4ZA 2NQTA 2JVJA 2VT7A 4R51A 1TMGE 3L1VA 4OJKA 3TBFA 4MV8A 1VL6A 4YCSA 1T26A 1UEIA 5FO0A 4QOJA 1T1JA 5HDBB 4TS1A 1A0OA 2HLNA 3NYWA 4UPVA 5DHQA 4FC6A 2NMVA 1P4AA 2JJYA 4Q3BA 2NU6A 4A27A 1Z5OA 3A6KA 4KVZA 3TLZA 4F9TA 4X92A 4FJ2A 5JG7A 4BZQA 3SJAA 5DTRA 4LQLA 3H2KA 3HU1A 5EE5B 4DABA 3VDNB 2QRQA 1Z08A 3D7NA 3OAAD 3T5MA 3RKUA 2WTEA 2PWPA 1SXIA 5BW6B 2FJUA 3SYNA 3EWSA 4IAOA 3IMEA 3LUAA 1N9GB 2CLMB 2E4AA 1YTLA 3PQCA 4MUXA 5L53A 3J80A 2PJDA 4RFVA 4G5FA 2EF1A 2RGXA 3AY6A 2GZ3A 1RAHA 4IXWA 1V1MA 2A14A 3HA7A 3RT7A 4KHPB 2B1IA 1JHDA 4N5NA 2OSVA 2A30A 2BGJA 2W4IA 3A14A 2BEKA 2GARA 4Q1CA 3NI2A 5FV4A 4DKJA 1C0EA 4PPQA 4DR7B 1NF3A 4BTEA 4FDMA 3F46A 5KU7A 4K86A 2QV7A 1C3OA 3G1WA 3QE2A 3D7RA 3MM4A 5DHUA 5E0KB 3MUEA 1TKCA 1Q0TA 2XGMA 4Z3DA 2WU0A 5MN6A 5CFNA 2P1RA 1YJ5A 1AUPA 4BASA 8AT1A 4MYSA 5H9WA 1N5KA 3MQ2A 3ENQA 4WESB 5IU6A 3GMIA 1ONSA 2OHFA 2YR0A 2PRYA 1SOAA 4Q5IA 4UHJA 1B43A 2HRRA 1HFKA 1U04A 2HBZA 1B0UA 2X5OA 3OECA 1GPYA 3I34X 4P4NA 2NO4A 3BIFA 4EI2A 4F2GA 3GA5A 2DT5A 4PPYA 2RGAA 3DGFC 1JI0A 5TJHA 1YL5A 1F5NA 4COOA 1UOEA 3JY6A 4UOQA 2DWUA 5JBIA 5DOZA 2RB5A 4YP7A 3EUEA 4DILA 1IZ8A 4O33A 4CDNA 4KAFA 5IC4A 1ZMTA 3AYZB 3O1IC 3OWOA 1E2IA 2B83A 2AGVA 2ECQA 2ZIVB 3OIVA 2Q4RA 3COPA 3T3IA 4QUAA 3IJRA 3H5VA 3DBHA 4X3CA 2DBQA 2C54A 4YAIA 1NJ8A 4DV3B 3EQ8A 1QHXA 4MV0A 3GVIA 5H8WA 1GZSA 3WWCA 1IBCA 4IHQA 5U9CA 4JT2A 4O4IB 3ZWNA 2XE6A 4DHWA 2B25A 4TSFA 3K0CA 2DM6A 1JKXA 2DFTA 3D54D 3DPIA 3U7IA 1A88A 1QDLB 3NWOA 4JP1A 3JTEA 3SJCA 1B8PA 1WM1A 3PCXA 4EECA 2GAOA 3CF0A 4B35A 1PL0A 3PICA 5IS2A 1F3OA 1TIKA 1BMQA 3Q98A 2PMFA 4URFA 3T9AA 4J0DA 1TAGA 4KQCA 4AP5A 2ZDQA 1R0SA 4Y6OA 5JSZA 3ZLJA 5IJ0A 4DCJA 1ZWKA 4EW1A 2GYYA 3P2JA 2GUWA 5J4HA 3ESAA 3Q2IA 1MGPA 1S1MA 3IAM1 4MARA 1JALA 2FFBA 1RIFA 2DWOA 3OHPA 2QIPA 1Y48E 4ALKA 4C14A 3OX4A 4KPUB 5I7EA 4MQFB 3VTKA 5KYGA 2HHJA 3N2NA 4GOLD 2C29D 2CLDX 2HO5A 2G88A 1L1RA 3HCBA 2HX1A 5AXCA 4N3AA 4LCBA 4YWHA 2O0KA 2LKCA 5HE9A 1KDVA 2WBLC 1RQ2A 1VI2A 1Q3HA 4Z1OA 3MS4A 1G21A 1QYRA 1NR5A 3DV0B 5I9IA 1W96A 3CPSA 5AVJA 5BSHA 1RWQA 2V7TA 3KXIA 3RFUA 4LF4B 2YOFA 2EGGA 3IUJA 3NTQA 4UCWA 4IJVA 2GZSA 2QU7A 1PZEA 3PIRA 1D2RA 1BH6A 2XUGA 2FEKA 3MMNA 1J9EA 1KYQA 1TO2E 1U1GA 5KIAA 1XU4A 2ZIFA 1NJ5A 1PKXA 2LDXA 4KVGA 1RC1A 1JUDA 3LQFA 1GD1O 1QH0A 5J4LA 2RDMA 4KNWA 1SCKA 4TX1A 3HJFA 4DEVA 5F3DA 4C3VA 1EGAA 4BLSA 4DLXA 4DWOA 4ECEA 4ENUA 2JI7A 1Q11A 5KC9A 3BIOA 4ZAYA 4EKGA 5U1PA 4HRVA 3H9BA 2GZ2A 4F1KA 1AMNA 4YPOA 1WUKS 1AKNA 2ESRA 2JIQA 3L79A 3HBJA 1N6HA 2IBMA 3PR3A 4MQ6A 4R4JA 5EIOA 2OFFA 3T9DA 5JE8A 2R8RA 3M6MD 4PE5B 5KVVA 2XCSB 2ADFA 4LF9B 5BUQA 3AVTA 4QT0A 2OP0A 2AQHA 3CPEA 3LGAA 1VLJA 4OI1A 3G8CA 5IKPA 5MHTA 5JMWA 4L0MA 1K2VN 1GNRA 4IDBA 4RMJA 1FNBA 3LUJA 2CL7X 1G3RA 1ZRNA 2ZATA 3AEQA 2FI1A 4JK3A 5LC1A 3RRFA 2X7HA 4WOCA 5FLYA 4BWYA 4YDQA 2YJ3A 3NIGB 5JCJD 3LP5A 4NZMA 2GM4A 1DV1A 2QY9A 1UKCA 4LYEA 5FJIA 2VHZA 3UPTA 3GFSA 4K03A 1V9SA 2WHYA 3PXXA 4GNKA 4JLVA 1ML3A 3RABA 1D5WA 2ZJFA 1O0CA 2JGDA 4UHFA 1NMQA 4X66B 2IQIA 2CMGA 1YQQA 2LZ0A 2VO1A 3GLQA 3WGYA 2WQ6A 1MOSA 2BGRA 5I9SA 1V47A 4S04A 1KMQA 3WL4A 1CERA 2YHBA 3HP4A 2X3FA 3TIFA 4Z49A 2QW1A 3ORSA 2BSQA 4JIMA 2WF5A 3ONEA 5H70A 2JAOA 1G7CA 1P5FA 3FMOB 2BR4A 4JDUA 2GN1A 2NUPB 4OIMA 4F0JA 4F4JA 1J5EB 4M54A 2YWJA 4V3CA 3NH9A 5HXAA 5GV7A 2WZQA 1IOZA 4H3SA 3V55A 4FGZA 1DG3A 5CYFA 2XZDA 3OCXA 3OBIA 3AEYA 5TQ0A 3EZ6A 1XZCA 2QXYA 1O94A 3FF1A 4L6IA 5TQ2B 4Z1MA 5K0EA 1U0BB 4IICA 1G98A 4LXUA 5AR1A 3V4PB 2EJWA 1NM5A 1GADO 3E7PA 3HVIA 4A23A 1T34A 4Q93A 2QZSA 3WMRA 1P2SA 4LYGA 5JAUA 2E4ZA 4HL6A 4Q7JB 2ORED 5LPNA 2X2OA 2ECFA 4ZOLB 1YC2A 3G7NA 3JQFC 3OJOA 1A9PA 4PX2A 1Y7IA 3OZEA 3CLRD 4AS3A 3WGUA 2J4FA 2H85A 5HQJA 2HPZA 1S2NA 1TW3A 2J9YB 3LPLA 4JFRA 1M2VA 3AFGA 4Y2UA 4C6RA 3AB7A 2XDWA 5DNUA 5THKA 4Q4HA 4YCJA 5D84A 3WHIA 3WA6A 3DZHA 3PK0A 4C3UA 4MK4A 3U0VA 3L3BA 2JFVA 3FUCA 3G5AA 1BGWA 3ISTA 5TT0A 3AJRA 5JYDA 1HWYA 1RMTA 2HLPA 4QU0A 3ZE0B 1BG6A 1L5QA 4JBLA 1ECJA 2BSXA 4LZOA 4FFPA 1QIIA 5AW9A 3C8MA 3U3DA 4CKCA 1A1SA 3IMCA 3O4JA 3O8RA 4JCCA 1VBNA 1L8LA 4I5IA 2DSNA 3KALA 5BVHA 2NAFA 2ZRAA 5JJBA 4FJ0A 4R2XA 1KJJA 2I3GA 3IIEA 5JH7F 3HXMA 2YJGA 2CE7A 1MFZA 2IL1A 3U7FB 1V11B 4TWRA 5JS1A 3PGKA 1DX6A 5CB4B 3X1WA 2LDBA 3HY4A 5BWOA 3OQ6A 4KBYA 2DF8A 1XWIA 4YCAA 2D13A 3JQ6A 1IEWA 1Q15A 1SCNE 2PA3A 2R5FA 2VP4A 1SUWA 2OAP1 2OVFA 1II8B 4LDZA 1M83A 3UT0A 4FE3A 2FRDA 2RIRA 4OP3A 1X8JA 3KKQA 4KQ6A 4DCVA 1NTRA 4L9SA 1K7CA 4WBSA 2Q1TA 2YYYA 1OXSC 1TJYA 1W1IA 3AM3A 1NRJB 4OGWA 4Q18A 3WK8A 5L7TA 1CZUA 2C57A 4ZREA 3A3KA 4BCCA 4XQ0A 3PSHA 3TKLA 3RC8A 4N0DA 4BFSA 2I29A 1GCGA 4M87A 3OCCA 1PQUA 1Z36A 1L4BA 1U5BB 1RMQA 3NHBA 4XJXA 3A4NA 2I8AA 3IE0A 3P45A 4TTAA 5FRDA 4DC1A 3OOEA 4WOKA 4GP7A 5BQ5A 4FQ5A 3VZDA 1RJDA 1LI4A 4TMYA 4HAVA 1FDSA 1PJAA 3NX4A 4JC4A 4E32A 5K0TA 2PSFA 2RAVA 3DE2X 5JY1A 1DZIA 5A0FA 4EY6A 2XZPA 4C07A 3NB0A 2QRNA 1LDNA 4UCQA 5GZ1A 1IB6A 1W25A 2JCBA 2W2MA 3HDHA 2X2FA 4K6GA 4C9BA 3SQXA 4US2R 1JI3A 2CFOA 3T4PA 3OESA 2HCRA 3WK7A 2PEZA 3I4CA 4Y9UA 3WLNA 4YUAA 4OHVA 1VM6A 3TX2A 5AW6A 3QFSA 4JELA 1PIWA 4NRDA 4OFBA 2JJ2D 1KQPA 4RGYA 5D3MB 3CUWA 4BN0A 5AUOB 4DV1B 1O6GA 2W2OA 3OIWA 2EBFX 2QMYA 4XDGA 3COWA 1L5VA 1TGYA 4H77A 1RAAA 5REQB 1Q1GA 3TTWA 1G291 1GDTA 4JGBA 3KQPA 4CCYA 2XT0A 5KVQA 1MD9A 3RG2A 4MPJA 4BFVA 2B8JA 4PYRA 4C4OA 4NHEA 4Q3CA 3SYTA 3LECA 3G9UA 1KAGA 2QMZA 3VR0A 4MS1B 4D7AA 3VPDA 1NVTA 2DULA 1WMSA 4JOBA 1ST2A 2ZR9A 4P80A 3RUCA 5LMCA 2G4VA 3IQEA 2HMVA 1CT9A 3G2JA 4F72A 3GLIE 5DLDA 1MV8A 4EA7A 2Q5CA 3VR5A 4UEJA 1XMVA 3D8HA 1PX0A 5KYYB 3K70C 3F49S 3K09C 2QTHA 4YMVA 3BJEA 3MAAC 1X38A 5DN6A 1EFUA 3TTTA 3L84A 3WHKA 4ZJYA 4FU0A 4TVKA 2XQKA 3WFJA 5EIXA 4M1MA 1J2RA 1GT91 4KE8A 1LX6A 2RHBA 3S27A 1BWRA 5GIPE 4FTWA 1Y7HA 3L4KA 4QHTA 1E7WA 3CS3A 3NJRA 2Y2UA 4BGDA 4NXMB 3BT7A 3UUGA 1E6EA 2DPXA 1KE2A 3ZTYA 4QTYA 3WXBA 1S3IA 4UUQA 3NONA 2UYHA 5HCUA 1OI3A 3JATB 3EZYA 1FQOA 2A5LA 5AVRA 2H1WA 1XMXA 1ZPDA 3AIMA 3LPAA 3GJZA 1MNAA 2V9PA 2NO9A 3C7KA 4JLNA 3OEED 3N0XA 3ZH9B 2OVBA 2F9FA 2YBEA 2C2GA 1Y5IA 2XUFA 3FVRA 3Q7QA 4FGLA 2X9GA 2AYZA 5DMXA 5FBWB 4Z0PA 1ODCA 1EH5A 3WFIA 4JLWA 4TSRA 2ES4A 3ZHVA 4CMBA 3L7BA 5AHXA 1P19A 3OIUA 5HOEA 1DJLA 1DNPA 3C2QA 3DTNA 3EW9A 4Q47A 1EG7A 1P2TA 3PTZA 1F0NA 2HWYA 3KXPA 4WXRA 2XXJA 3FNBA 5TS3A 4EI7A 2FZ4A 4NFHA 1T2FA 2ZBQA 3U62A 3DDCA 1MA0A 3QNUA 3O8DA 4C29A 4TM8A 4ZT2A 3RASA 1XDUA 4UUPA 3SX0A 4UTNA 3SR4A 1GLNA 5BYJA 3AVXA 1YZTA 3V5NA 3HGTA 3IR7A 4O0LA 4D9KA 1S8NA 2QN7A 3ESBA 1E63A 4GR9A 2OZVA 1P4HA 5DO9A 3WGQA 3LWDA 4FOTA 4P9NA 3MIIA 3BJRA 3NHAA 4OB7A 1V96A 1SG0A 4YLEA 3AESB 3BWEA 2IX3A 2A1TS 1JP7A 3GEHA 3ZV4A 1VPDA 4B75A 4Z53A 4NFYA 3NH6A 5AI0A 4DMKA 4Q3NA 5JADA 1OMOA 3KZXA 5EMMA 1VXRA 4Z51A 5L4SA 1D9ZA 5A2QA 1GRNA 3GPLA 2FK7A 5EN4A 3PHGA 3QE0A 1UZMA 4KO8A 1NBIA 1OOEA 4YEDA 5KTPA 2XLCA 1K6MA 3FNQA 2CV1A 4A10A 3THOA 1Z8NA 2C4TA 3K9NA 5EINA 1P1IA 1SPBS 3MZ0A 1NN5A 3A6GA 5FADA 4PLHA 3FTEA 1WU8A 2XX3A 4F9FA 3GD7A 1R6AA 2CHVA 1OKKA 1L5KA 3GRKA 4ZA2A 3F7TA 5EXSA 4UOZA 4KPGA 5JZVA 1X42A 3MMSA 4DJAA 4F85A 4M9XA 2IZZA 1R9NA 4BECA 1Z07A 2Q7OE 4HT3B 3A2LA 1MABA 3AG5A 3AKCA 4WW0A 2VTBA 1EBUA 4LYFA 2XUHA 2E21A 4Y7DA 2XI4A 3INRA 1HMYA 1IH8A 1LBTA 3WBFA 3DOFA 3W2GA 2R4UA 4CQLA 1ST3A 1UXIA 3RO7A 3TFOA 3PFIA 3A2MA 3NVDA 4I2NA 1DQYA 5HRUA 1UKBA 3EVDA 4WRRA 2R9VA 4OBBA 3UMYA 4DJEC 3O4IA 3QH4A 3VYVA 3W77A 5CNMA 4R6XA 2OL4A 1I2AA 4JQOA 3I4LA 2C94A 4IZOA 2D5AA 3KC2A 1UFKA 5HM6A 4UNRA 1XZJA 1L5MA 2D4HA 5LQNA 1U90A 3INTA 2QN9A 4GYYA 1J8YF 1B26A 3RCBA 5CVUA 4D8TA 5EP3A 4AI6A 2IU6A 3EPPA 3CZ5A 3VC7A 5AW8A 3MD0A 2ZWAA 3K05A 1NN0A 3M6LA 3SXUA 4ERXA 2WIKA 3R5JA 1ZCJA 1G16A 2PFSA 3IT0A 3PFGA 4O4LF 1DCMA 4YRQA 5D86A 3Q7EA 5JWRA 2FZKA 4K46A 1T5LA 1N2CB 3HNPA 3U7QA 5KYNA 4CKZA 5EIEA 3EGOA 2FQQA 5AKEA 2IV3A 2GD0A 1PTJA 2NSYA 4AJHA 621PA 1ZGAA 2VWGA 2W00A 2WMYA 3ZK7A 4ZIRA 2K2WA 4O8CA 5GJBA 1LUAA 3J7TA 2WIGA 4C30A 4E03A 2INGX 2NNWB 4QJ5A 3CW2A 4W1RA 4Q9AA 3I3OA 5SY4A 3UOAB 2WICA 3PTAA 3ORRA 1QB8A 3INYA 4XOIA 2XCQA 4WUTA 4OUDA 4XB1A 3GGGA 3C15C 3KKPA 5BYBA 2JF0A 1EPUA 4EHJA 2OK8A 3RUHA 3D2CA 4FHGA 5FHQA 3WZLA 2AXNA 3O2QB 2XUDA 1ZRSA 2QA5A 4FR5A 4G0UA 2QSJA 4ZV4A 1I4TD 1OYYA 3ICWA 5FD8A 5FULA 3PE6A 1EM8A 4D8WA 1FMTA 4EMUA 2ZIUB 2BEJA 4YI5A 5FNVA 1KDPA 4Z2AA 2GZHA 3CZ4A 3OZAA 4BQSA 4EGSA 3IEIA 4BXOA 3QXGA 1ENZA 1PYGA 4FDLA 2R8OA 4QBIA 2I6FA 2AIRA 2Y99A 2QVGA 2JCYA 1E7QA 4N18A 1OYWA 1P7PA 4WNIA 3T1OA 4JOSA 4KR2A 1YL6A 2HRQA 3QV2A 4NAVA 3OJWA 4YVFA 4DLRA 3L6CA 1JFRA 5E7IA 1ZU5A 1LNQA 2CYCA 5KEIA 4ZEOA 3LO8A 1TUEA 1JTVA 3WS7A 5BMOA 5EJ4A 4J49A 2X9NA 1Y5MA 4C7OB 3ZBUA 2FH5B 2OOSA 3V34A 2ZSKA 4K9KA 5A71A 1GPDG 2AOWA 5FNZA 1PQYA 2H29A 4QM6A 2GT1A 2OESA 4CF7A 5IC6A 4XR4A 5B37A 4R71A 4DMRA 3GOQA 1S4MA 4Y30A 4IIXA 4DLBA 5JDIC 1YB6A 4KREA 1R4MB 2F4NA 5K0JA 1VDMA 1ZJZA 2ZYRA 5KNBD 5HF6A 2G9ZA 3GAAA 2Y1KA 4E5MA 1GUBA 3I76A 4OXRA 1Y8RB 1H23A 4IGEA 4DYHA 3HFJA 4ARIA 3PI7A 2GLXA 2ANCA 3K94A 3ELBA 4QT4A 3R9XA 5EJ7A 3ZE1B 3UJNA 2HSZA 1WB9A 1SB9A 2YJ5A 2Q7DA 4WTOA 5CH8A 2W2PA 4D0LB 3ZLUA 5K9ZA 4KJZA 2C07A 2CHQA 1PR1A 3WG9A 4PGGA 3X1DA 3NIBA 4FQ7A 1I4LD 5EAIA 1U0SY 2QAIA 5EUBA 4KX5A 1XVUA 3AKDA 1F0KA 4BGVA 2H2FA 3O47A 3I58A 3VVCA 2BH9A 3MBOA 4CFSA 5EHGA 2WRZA 5E6SB 2CXTA 2OORA 1FOEB 1WCXA 1X7GA 2IYSA 5B58C 4DCNA 4GMDA 2Q3FA 4CMGA 2IZ6A 1K3UB 1SVOA 3UWKA 3PGMA 4A8HA 2PRKA 2B6NA 1KEEB 2ZBPA 1W49A 3C6YA 4OK5A 4DCTA 2E48A 4Q3AA 1V2HE 2UXBB 2AC4A 2H08A 3HJHA 4C20A 2VZ9A 4FFRA 1MDBA 4WZ6A 4YQFA 3FFBA 4C4ZA 1WOYA 4BEVA 1SY7A 3EPRA 4OCZA 4ZC8A 4B2PA 1YR7A 3GT3A 4Z4CA 1PS8A 4WK0B 4P6VF 1VE5A 2DEUA 2DBVO 2JIRA 3CKLA 3LHIA 2ZRKA 3PU6A 5F76A 3UBMA 1AQUA 2ZZNA 1JEAA 1JG1A 4QJBA 4I9GA 2Y1OA 2VPXA 2O19A 3ABZA 3BF7A 4G1BA 1W2GA 1ZNZA 3PV0A 3SZOA 2BKVA 4HEJA 1H85A 2REXB 1ISJA 5JS8A 3RBAA 2P2ZA 4EMBA 2XIQA 1LPOA 2P11A 8ATCA 1OAOA 1KO7A 2HK7A 4ZCSA 4YMUA 1A96A 4N9WA 1M2JA 4UC0A 3OQBA 4W8GA 2ZWMA 2YOHA 5H4HA 1JQEA 2K2QB 2ZPTX 3A9UA 4DWJA 1F4LA 3W3AD 1XX6A 4EEKA 4C0SA 2HQ1A 2LNDA 3REGA 4EUKA 2TS1A 1N0WA 2VXYA 3H6GA 3K0EA 1Z8FA 2HA3A 3O8QB 4PZCA 1Q50A 2GK4A 3NANA 4JENA 4R8LA 1SVMA 5C7OO 2PY6A 4FDTA 3H9UA 5T4EA 2ACEA 2BZ0A 1HLGA 3RIYA 4EY7A 1CQPA 1Q0PA 2XVZA 3H4VA 3HEBA 2QMHA 3JAWA 3LDUA 4W9NA 1YZYA 5EYPA 1AUQA 3EQZA 3JASB 5FWDA 5T5QA 3R7NA 1RKQA 3UGJA 1TMKA 3TYXA 3H1GA 4ZARA 1TZJA 3K0FB 2GS9A 3UXMA 4R1PA 2AH5A 3ZVLA 1PV4A 2NTEA 2YNMA 1VYVA 3ESDA 2UZAA 3PA6A 4KLCA 4Z8XA 1X1BA 1HE3A 2I4RA 1H2YA 3WOVA 1SKMA 4ARVA 4BNNA 4J9VA 4OB8A 1UPUA 1B6SA 2D0IA 4FSDA 3K5WA 1YDEA 3NWJA 3E2PA 5JPIA 4AM8A 4FFLA 1HMPA 3R5HA 2OLJA 3L05A 5ED0A 3LW8A 4D0GA 1SHTX 3UWSA 2FUG6 3DT6A 3JZMA 2G67A 1VLMA 4DUPA 5J5AA 1FP6A 1E66A 1PG5A 1JEQA 2L17A 3FZEA 4OXNA 4QJ4A 3W4KA 5E3HA 2DR2A 3A9WA 1N9ZA 1A72A 5HFNA 4N1AA 3OP4A 5DHAA 1R0LA 3DVAA 3AJAA 5AXDA 2A84A 2G9QA 1E3LA 2W0SA 2Y3IA 5ELLA 4XM1A 5BNFA 4LQCA 1ZAKA 1QRRA 2C5AA 2Y0BA 3K92A 3KZMA 3V2IA 3VNVA 2GFHA 2I3AA 5PNTA 3SQLA 3K73O 4G4SP 2QI9C 2YOGA 2C96A 3MYRA 4OQPA 1W4RA 3WGKA 4CEIA 2NPFA 4DUGD 4CM6A 1T9DA 2X8BA 2ZYWX 1US8B 5KHLB 3AF0A 5CA1F 3EDCA 2WKPA 1DC7A 1CEXA 2X14A 3JALB 3GPCA 4Q9LA 4YJGB 4UVHA 1KY3A 1PJ8A 1Z2AA 3MWDA 4HB0A 5IT4A 3ZHQA 3EZNA 3SNHA 3ZHBA 4V0OA 2R8XA 1C9YA 2AKAB 4TYMA 5K6AA 5EP4A 4BNJA 4BX2A 4MS3B 4ZV7A 5KYXA 3K8YA 3TJRA 1HNXB 1ZK1A 5EJ8A 4Y7CA 3JAMA 2A0YA 5FUWA 4M37A 3IXQA 4EGAA 5AVYA 3CUTA 4DMFA 4QZVA 1QGYA 4EUHA 1T3TA 4F4DA 1BE1A 2JJMA 1DT3A 3HY6A 4L8WB 2IHZA 1JU3A 2CCJA 2J32A 3BE5A 4HVAA 3LY8A 5TQ2A 3FDJA 1JWBB 2VSFA 5EMLA 2BUCA 3LSYA 2YQ5A 3IAS6 4RD2A 2YHUA 5D3KA 3SU8A 4EHHA 2PJRA 1EK5A 1CXZA 1OW3B 1P0PA 4LHXA 3UHOA 5FYDA 3D59A 5INTA 1SA0B 3SGLA 5J2TF 3WMEA 1TD1A 4HNAA 4ZOLA 3G2MA 4TYPA 1R6XA 1W76A 4X60A 4ZDWA 2XOXA 1RNLA 1F48A 4QTUB 1JXMA 1ZOLA 4QXOA 5G02A 3EXIA 1HL7A 3TLMA 3PQ7A 3P26A 4GX1A 1Z06A 5CCBA 3UAVA 3NC4A 1I5RA 4PIVA 5B5SA 3GUVA 2LBPA 3PNKA 2W98A 4O08A 1L5NA 1J0DA 4YALA 1WBJB 4G81A 5CA0F 3SC3A 3ZS8A 1TUBA 2UYQA 1E3DA 4ZXFA 3GEDA 1SBNE 4D4GA 1XZPA 2H07A 2YN0A 4EQ6B 2P8JA 4W9MC 4V1CA 4ZDIA 4YIHA 5F2NA 1FFCA 3MJRA 1ZICA 3ZYCA 3T4XA 5JECA 4TZ0A 1Y98A 2YYZA 3ETDA 4QYXA 4Z9AA 3HACA 5LCXA 4NYMR 1UIMA 5EXPA 2DT8A 5HS4A 2GA9A 2EJVA 1JJVA 4OJTA 1V11A 1ZOPA 2Z2ZA 4Z0TA 1MG0A 1DUIA 1KEUA 3LBAA 2QQGA 3IPYA 1L7EA 4UCFA 5C35A 2P4HX 1KAEA 3G8YA 1RM5A 2Z5VA 2ZUTA 4GI1A 1XDZA 3HGQA 1GAEO 4BV3A 3HXKA 4LZLA 4W1QA 3IAHA 2FFJA 2Y05A 3D7LA 2Q62A 4QWMA 4U3JB 2ZUBA 3C6QA 5H80A 1T2NA 4JI5B 1X1AA 2J0EA 2QZ9A 3H5LA 3IP9A 2JCGA 3QPDA 3EQ6A 3O95A 4XASA 2IU4A 2P2GA 5LBIA 1U5CA 4E31A 2O8VA 3WQRA 3IBGA 3HDJA 4AJPA 2OQ2A 4GBED 3TZKA 2A1UB 2I6XA 2QTVB 2PIAA 5TRTA 1SWWA 4Y2TA 3D5EA 4WACA 4YQYA 5DJ5A 3T9BA 2WVHA 5DX0A 1QF6A 4LJ8A 1OAAA 2C2HA 4A5OA 1YMQA 2J3QA 3MA0A 3OKAA 5FLEX 4BFUA 4B6JA 3NJ4A 4OPMA 5FUVA 3Q3IA 4ZV9A 4EG7A 1TJ3A 3UWDA 3ODGA 4H1VA 3ESYA 1NF8A 1RHJA 1U94A 1SZPA 3PJDA 4NMXB 3N05A 4KLRA 2YC2C 2OO5C 1NONA 2YMQA 4B71A 5EHQA 4YY3B 4O4HF 3E81A 2WYVA 2E85A 3I04A 1U4NA 4LWPA 1E2LA 2ZCVA 3MLEA 1HL3A 2GJKA 3OJLA 5A4DA 2J0UA 4PC6A 3VZQA 1E8MA 1I6WA 5HJ7A 4KBGA 4LE0A 3LC1O 1OUMA 1OFGA 4BRZA 3EOBI 1JAHA 5REQA 3AV0B 2O7RA 4KUHA 3LE8A 3Q8KA 4B3XA 1I7NA 3BFKA 2JKZA 2NTYC 1NOIA 1B3RA 2DOKA 3G02A 4QDTA 3ZPXA 5LMZA 3ZD9A 4GMHA 3KJQA 5DN9A 2CKDA 1QE5A 2C88A 2O3TA 1MFPA 4EJ2A 1OVGA 2D1RA 3DHWC 1JG6A 2V4MA 3JQGB 4MS1A 5BO5A 2EGHA 3A4LA 3DHEA 3PNSA 4D4KA 1JJ7A 1ZM9A 4IDPA 4JVMA 2FP3A 4KW7A 1AIPA 5EKTA 4EF5A 3SZGA 2REQB 4LOLA 3NORA 1N33B 1I36A 2Q8QA 4RPJA 4BQFA 5BW5A 3CU5A 4MUIA 3R8CA 4WERA 1DXHA 4LV8B 3I8OA 1U8ZA 3L7LA 1IB0A 1KWGA 5KYYA 1MJNA 3FE2A 4UE3S 5BWNA 3ABIA 1KSJA 4HZIA 1C3EA 4RZQA 1MB4A 2ZTVA 3GJ8A 2PQ2A 1F0PA 1KVRA 1RKBA 4RK6A 4CQMB 4W99A 2VF8A 4RY2A 4EO4A 5IZCC 2H4YA 4LMRA 4JYZA 4LXYA 4N4AA 5B3JC 4WEQA 3A3OA 1TZBA 5E6UB 1GOTA 1VFPA 1CX9B 4WXPA 2K4MA 4EFKA 1B8VA 4RKFA 5KCMA 3T1VA 2C7OA 1IHDA 1GFZA 3D6TB 4XH9B 3A1EA 1ESNA 1OC4A 4BVAA 2BFFA 4MQLA 2CFRA 3B78A 4RDHA 3R9WA 3RUFA 1PW7A 2GFQA 3IJEB 4DM4A 1EHIA 2IZ7A 4CKEA 1NBOA 2HC9A 2KE5A 3PF9A 5HIIA 5ALDA 4EAQA 1K27A 3H83A 2IVFA 3GVHA 3N8IA 2XECA 3BF8A 4FD3A 4PSKA 3W5UA 4ZMBA 3W5AA 4MWOA 2JLSA 2WHPB 4DEYA 3NVKI 2CFSA 2HMTA 2JS7A 1QQBA 3FR8A 2GK3A 1R1DA 2VLIA 3FKJA 3EX7C 1OLSA 4M9ZA 2NAPA 1PR3A 2BY4A 1Y1KE 4D1YA 2O3JA 5ARDA 4AUMA 1FDWA 1I0ZA 4C21A 2AOUA 3KJGA 3UTCA 1JR3A 3HWSA 1WZCA 2IDKA 3EZ9A 3WMFA 1CP2A 1GNPA 2JI6A 2KBFA 2Q3DA 2CEKA 4JY7A 3ZUPA 2ZBUA 2K7FA 2JPDA 1RKVA 3RI3A 5IEJA 2WD9A 3FMPB 1T36A 1E4OA 2VDMB 4UBLA 3CBGA 2IPAB 3RRMA 1VE3A 1VP3A 3BEOA 3V00A 4KIGA 4P7KA 1O6FA 2FUCA 4NYJQ 2FP4B 4P81A 5KQLA 2FPUA 4MCJA 3QVGB 1VL0A 2LGJA 1BFUA 1RACA 2REBA 3ZD7A 4URUR 5D3ZA 2Q5IA 4ML3A 3U4QB 4XLZA 1UEXC 1GG2A 1HURA 2CLFB 1ZWLA 3KWMA 3L0PA 4INPA 4Z9BA 2EWWA 1TM1E 3CSSA 5ADUS 3HE3A 1FU7A 2WC1A 1J1IA 1I32A 3CTMA 4IGKA 4ISBA 3CB4A 4XSGA 1N2EA 3R5TA 4TQAA 1SZJG 4RA6A 4KXVA 1PK9A 3IXMA 2HADA 3AVQA 2O52A 1JB1A 3GRUA 4IS2A 2GZMA 4KVAA 3AEKB 3ZGYA 1JQKA 2VBFA 1ENPA 4E5UA 4WY2A 1JR2A 3I9LA 4HTFB 4QEDA 1GTSA 3HKBB 2OZPA 2PXCA 5LZ2A 1ODJA 4RHTA 3PDJA 4I4TF 2N1MA 1K4YA 1T0JB 3SEZA 2X41A 4MR7B 3RJ5A 1WAMA 1PK7A 3GJ4A 4Y9SA 4BE4A 2WI8A 3QWBA 4AXBA 4NPAA 3RUPA 2P4EA 1Z28A 2GNOA 1IWPB 3K31A 3UAOA 1K6XA 2Z6UA 3QKWA 4WL0A 3ZV3A 3MEQA 5K3EA 3RG8A 3QLUC 4IGFA 1AF4A 5T6BA 5KQGA 2OHHA 3BOSA 1J24A 3D7MA 3RAJA 3KAPA 3THWB 1P0CA 2J5KA 4D98A 2J6HA 3N70A 4ZT5A 2QM8A 1O95D 2RGDA 3OE7A 2C9YA 4PV7A 4BNZA 4MUGA 4PLGA 3TD6A 4YCDA 2O0LA 1WBDA 1CV2A 1KTVA 1QK3A 4TL8A 2BTOA 3ROXA 4ZEMA 1V8ZA 1NASA 1QGOA 4H4EA 3WMXA 4PR0A 5KTOA 1C7FA 2A58A 2VDRB 2AFIE 2X7XA 3KLMX 4GPZA 4D92A 4EG5A 4FWIB 2QP9X 5CEJA 1K5HA 2C4UA 3HZRA 3K70D 3MAGA 2C42A 3A36A 3WKBA 3TX6A 1JTEA 2H4XA 2H7XA 2O1XA 1R64A 4ZZ0A 4U1RA 2HSWA 4KKVA 4S0ZA 4JLBA 1JG7A 1UKZA 2OQIA 3AIOA 4F3NA 4MIKA 1OPXA 4QSMA 1DAIA 5HZKA 2D2EA 1PT5A 2EEPA 1XA0A 4JL5A 4WNCA 1R5JA 1NNUA 1TMYA 3I2FA 1TVEA 5IAJA 2N42A 2WY2D 2I2CA 3LXUX 1ZONA 2QL7A 5L3SA 4BNKA 2YJ6A 4JBHA 5AWFC 4GOXA 3RKSA 1UZNA 4E21A 4TVSA 4W5NA 4LUCA 3ZLTA 4BWVA 4X7PA 1ZM4A 4OHUA 4US1R 5K4GA 4NBLA 3GDFA 2IDJA 4AG5A 1VXOA 2M1ZA 2VH5R 1JU9A 1IHOA 1JSCA 3R3VA 4QDJA 3ZDQA 3KFLA 4ETWA 2OBBA 5DNEA 4D96A 4AO7A 1P77A 3C24A 3C14C 4NZNA 2J0VA 3A6LA 4KXMA 2F8MA 1EIZA 1V25A 4WZBB 3I1FA 2PPLA 1S1CA 1NUHA 1DTEA 1BHSA 1J9ZA 2OENG 2XRFA 3AXSA 3BHJA 3BMQB 3D4LA 4KE9A 3DF7A 3KUDA 2XRMA 3KQKA 3W1WA 4ADSG 4TTJA 3BGSA 2BKUA 3I1YA 1CVLA 4LTDA 1VSTA 4L4YA 5JH7B 2MYTA 5TEVA 1XUOA 4X62B 1ZR2A 4MKIA 3WV4A 4FGKA 1B0PA 1IATA 4RH0A 4OKSA 3V2GA 1O97C 3IELA 3KL2A 4Y2YA 1H6CA 2G71A 4JVSB 4O2RA 2SHKA 3SFTA 4BJHB 3LKBA 2HSDA 3MMPA 3ROGA 4BLPA 4ZGGA 2UVPB 3C6MA 3T9EA 4BEBA 2GXAA 2IH5A 4WFQA 2ZBDA 3ILVA 2WU4A 2YRFA 1BS2A 5B2ZA 1Q95A 4JR1A 1DC4A 2POCA 2C3YA 2G28A 3L01A 1ULSA 4P22A 5LYJA 4CLDA 1U02A 1TTPB 4GXRA 4N82A 5CT5A 1BKYA 3BWDD 1E3QA 2I4MA 4OG2A 3N2GB 4F38A 3M70A 4RHFA 4M1EA 1A3CA 2IUSA 2PUJA 4NH0A 1Z4JA 1RXUA 16PKA 2ZRDA 2EGUA 2ZYGA 5D6NA 3GG9A 2WK1A 2IUTA 2ZIGA 1NLZA 4QYIB 4YASA 3B85A 4DNQA 5JASA 3VKFA 2CLSA 4N5HX 4NKRA 3E27A 5A5FA 3HVUA 1CZOA 3RT9A 3HYCA 3UF0A 3QF4B 1VGRA 2FJPA 2G82A 3MHPA 3VZSA 2CF6A 2XH8A 3EOZA 3KP1A 4YCLA 3BJIC 2H3EA 4CLOA 1HQYE 5JYBA 3PE3A 5AM3A 2QWXA 4RTQA 3RYIB 2XCUA 3T1HB 1M2GA 2R751 4WZAB 2MMGA 4MIOA 4HCJA 2EW2A 3B2EA 4QYWA 4EIWA 5LBUA 1ZUD1 3CKMA 2BZSA 2QLNA 1E99A 4CMJA 5I8PA 2P1ZA 2DJ5A 2NU7B 3HCDA 1USVA 4NZPA 1FU8A 1XZDA 3RYHA 4OMUA 3KJFA 1SU6A 2XVYA 5IDVA 4LE1A 2FSHA 2GN4A 4K9QA 3LPMA 1OCEA 2PXXA 3M1YA 1NVGA 4PLCA 2OGWA 2CSXA 1UP7A 2YFYA 3UV6A 4UOEA 3HI6A 3OMLA 4F71A 2WJ4A 1FP4B 4UKDA 4XI9A 1KBQA 4R84A 1JE1A 1E69A 4PCLA 4TLEA 2PWZA 4UASA 5J4YA 1BEEA 1ZHFA 5BNZA 4ENWA 1E98A 2WHXA 1IOVA 4L9WA 4QVKA 5KSYA 2W90A 1AJEA 3CKYA 5IW8A 5C5DA 2YZ2A 2Z5FA 5DXFA 2DWCA 2BTQB 5F1KA 4Y2HA 1KEEA 4IFEA 1WV1A 4PGMA 4RZSA 3WDKA 3BCUA 3S99A 3TTXA 1EUDA 3WNCA 4DR2B 1R6TA 1BD4A 2DH6A 3ZIAD 1WSBA 1G8KA 1OFUX 4WOBA 1CYEA 3Q3JB 2GQ0A 4NI5A 3JWJA 2G5CA 5B1SA 3AUXA 1DIHA 1L7BA 3D8RA 4FIDA 1EDEA 3QU4A 4LGVA 4N5MA 4UMFA 4FKMA 4DSOA 2RK3A 4KC0A 3SAJA 4BNGA 5CT9A 3WLPA 3C3KA 1SCBA 2OQRA 4MZDA 3ASZA 4ZVKA 1WUIS 3TBHA 1C4WA 4OI4A 3TH5A 5E4JA 4Z7NB 1PV1A 4QOFA 1ISFA 3NBZC 2NZYA 3OM8A 4EPYA 4ZO6A 2YN4A 3AL3A 2FLWA 3AOGA 2C92A 3DOIA 2Y1DA 4L72A 3ZDZB 4D8XA 3USZA 2QSUA 4O1MA 2ZBRA 1QP7A 3B5IA 2Q3HA 1OFVA 4MINA 1T2VA 3ZOZA 1QTIA 1NIPA 1LX7A 5FFNA 3RRYA 3S2YA 1WB6A 1I33A 1TYCA 2VNAA 4WKPA 3U4MA 1G21E 3KE9A 4UAGA 4AJ2A 4PVCA 2G83A 1WCIA 3B1VA 4R68A 1SVNA 4LJAA 4MDFA 4JLAA 4DGQA 4H3VA 4YMSA 4JKYA 3SHQA 3U26A 4NLLA 1V16A 1QG0A 2PR7A 4MR8A 3UB3A 3OD1A 4LMBA 1HTTA 4W8OA 3D6AA 3QNMA 1YI1A 3B2QA 4P5PA 2JLUA 1PBTA 1V8PA 5HGXA 3LH5A 4Q01A 4YP9A 1QZUA 3LPCA 4R41A 4B84A 2JG3A 4ZZ2A 4DRXA 4CMIB 3TMYA 1W9HA 2YINC 1ZVKA 4ACBA 1Z7BA 3LC7O 4I19A 2PH1A 3EA0A 4IIUA 4NNOA 3ZXYA 3JASA 3T99A 2OM6A 4EKNB 4ZJPA 1JH9A 1SC3A 2R6CA 2X58A 3DB1A 4TLLB 4W5JA 4E08A 1RDFA 4YV0A 2MDTA 1P18A 3LUBA 2B1JA 1XJQA 2H2GA 2QQ5A 3FNEA 3WGNA 1Z83A 4A2CA 2ZS7A 3B5EA 4I99A 3VV3A 2A0WA 5C3MA 1CHNA 1ABFA 1W0JD 1U3FA 4PBTA 1PW5A 1IM5A 4DQ0A 2ZRIA 3QK7A 3DZJA 2OAEA 1Z7EA 1QS0B 4TWBA 5DYYA 5GP1A 2HL6A 2Y66A 4KSCA 1RXEA 4BRUA 4FDUA 1S0UA 2Z2JA 3NBYC 3RSZA 4F3CA 4NL4H 2X1VA 3IKMB 5CXUA 2UXCB 1JHMA 3V8QA 1JMYA 2HFJA 3MB8A 2O3RA 3KYCA 4RMHA 4TTSA 5LZ8A 1GAQA 1KOFA 1SRQA 2NT3A 4WEOA 1SAYA 3B48A 4XIJA 3TZEA 5FTJA 4LEIA 4BIMA 1V8BA 1PZGA 1TTHA 1X80B 2DH5A 3ROTA 4BEJA 3CZPA 2WJPA 1Q6ZA 1ULHA 4OL9A 5TPWA 3B13B 3X43A 1DUVG 1UAGA 2PS3A 5A4MS 3RTAA 4OHXA 2BZ1A 1KI4A 4OI2A 1ND5A 2OD7A 5IDXA 4IF6A 1NU6A 5KX5F 2X0JA 3DWEX 1L7PA 2F9LA 2PVPA 3GCXA 3TE6A 4TTRA 3TDMA 3URKA 5KTTA 3LQ4A 3O1HB 1J2JA 1S2MA 2G17A 3CR3C 3GO4A 4NJEB 3QEKA 3VKUA 1X8KA 4ALMA 1P5JA 1QWSA 4D57A 1US8A 1NGSA 1KZ6A 1FE8A 1PT7A 1J8QA 1T0PA 3MRVA 4PLYA 3EMBA 1EFLA 1Z7GA 4MEAA 4U8HA 3SE7A 4S1WA 1AGPA 2JD0A 3L8CA 5EPEA 2AXQA 3QG5A 1G4UR 2W9XA 3WLOA 3NBXX 2P41A 2ZJAA 4QQRA 3S44A 4M3NA 2NQ2C 4ZQIA 3U0BA 1HSOA 4B7AA 1E4VA 4IUCS 5DBGA 4C01A 1HKHA 4PLZA 1SKUA 4EMSA 1E4EA 1UZUA 2R7NA 4J0QA 1MB2A 4P92A 5TF4A 1U3UA 1DG9A 2GEUA 3U7GA 3T5TA 3J7AC 1NJGA 2WUGA 1LDEA 4KFUA 2H1IA 4IDFA 1OLXB 3OUZA 2QP3A 4G5OA 4MSUA 1LBQA 4OHWA 2AD5A 2YL2A 3VGPA 4FMDF 2G3YA 5TF0A 1YCHA 3AILA 3A9CA 2QAJA 3OJFA 3OM0A 3IQFA 1Q1AA 2NV6A 2WZCA 3ZYZA 3TKYA 3ETNA 2BH2A 5K6TA 1IONA 3IFSA 4PZPA 2V7WA 2VPZA 3VYTB 3AI2A 1LVHA 3QI7A 5F4BA 4E5VA 2GRAA 3GRYA 4O4LB 4QBGB 3CF2A 1K6JA 3BA1A 1Q2UA 3CUSA