4N40A

Crystal structure of human epithelial cell-transforming sequence 2 protein
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
281
structure length
281
Chain Sequence
EMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of triple-BRCT-domain of ECT2 and insights into the binding characteristics to CYK-4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Protein ECT2
total genus 65
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A03
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 4n40A02
3I0NA 3SHVA 4BMDA 3K0HA 1JNXX 3HUFA 1KZYC 4IGKA 3EF1A 3PXBA 3K16A 2M2IA 2VXBA 4BU0A 3T7IA 3K15A 3T7JA 2D8MA 2E2WA 3UENA 3L40A 3EF0A 3K0KA 4XPZA 3OLCX 1L7BA 4Y18A 3SZMA 3II6X 3PC8A 3PA6A 3PD7A 3L46A 4BMCA 3T7KA 1OQAA 1T15A 2EP8A 2ADOA 2NTEA 3PXDA 2L42A 3K05A 3SQDA 3PXEA 3UEOA 2ETXA 2XNHA 4IFIA 4XQ0A 3KTFA 3JVEA 4ID3A 3T1NA 3L41A 2COEA 3PXCX 3PC6A 4BU1A 2K7FA 3QVGB 2INGX 3U3ZA 2JW5A 2COKA 2HTFA 3PC8C 2WT8A 4OFBA 2AZMA 2K6GA 3FA2A 1Y98A 1IN1A 3HUEA 3SHTA 1CDZA 1IMOA 4U4AA 2EBUA 2LE0A 4N40A 2VXCA 3AL3A 3COJA 2EBWA 2COUA 2XNKA 3QVGA 4Y2GA 3I0MA 1T29A 1T2UA 2DUNA 3PXAA 5ECGC 1WF6A 3PC7A 4JLUA 1GZHB 1T2VA 2R1ZA 1N5OX 3AL2A 1Z56C 1L0BA
chains in the Genus database with same CATH superfamily
4NECA 1JKJA 1KOLA 1MKYA 3ZCUA 1N77A 3C6YA 4MKFA 1UKZA 2QTVB 1PJ3A 3EUAA 2VBCA 2ODTX 2Y1WA 1KDTA 2CNBA 2LD4A 5DRYA 2JI7A 1FXWA 4KE7A 3T3IA 2L0XA 3IV9A 3X44A 2AJLI 1L4NA 2WSSD 1OMOA 3LE8A 3UJAA 3FH0A 1ZQ9A 2PMBA 3FPAA 2C58A 2M1ZA 1E9DA 1LSUA 2FETA 2QW0X 1X92A 3FXAA 3KR2A 4LRYA 3PX7A 3TLGA 2NT3A 1PJCA 2D8AA 1QGZA 2P2LA 3EUWA 3HR8A 3JALA 3Q9NA 3QG5A 4OFZA 3T7IA 3U4QB 1VIDA 5K09A 1ZWKA 3VH2A 2I6UA 3WIOA 5DGHA 2PH1A 4GLFA 5BMVA 5E1MA 5HOQA 3RYFA 3C3PA 4OFXA 2ZJ7A 3D4NA 4QUHA 4KE9A 4ZQHA 4HH0A 3DR5A 4Q5IA 2FSFA 4N8DA 2G76A 1VIMA 1EHCA 4GPAA 3WDMA 1MNAA 1NW4A 3CH5A 4K05A 1ORIA 4FNOA 4EA6A 3BA1A 1B93A 3S40A 2J59A 4HUQB 1BQEA 3A9CA 3CTMA 4BDSA 4F8EA 5HNKA 3WO1A 3IQFA 3BULA 1TCUA 2F67A 4GKAA 4NP6A 4ZCQA 4B76A 1T0HB 4D0RA 1T3GA 4EYKA 1QPGA 2J9FA 3H13A 1TYBE 3GRUA 2R0QC 4JYAB 4PHGA 3P0IA 3AVQA 3HVIA 2H9IA 3NPAA 3BEDA 5LLSA 5HHTA 1P2VA 1GTMA 4N9WA 3KQWA 4ZI3A 2WVGA 3T3NA 5DTQA 4WK6A 2GFHA 4HP8A 1VI6A 4EPRA 5AVVA 2XNHA 1H8HD 4ESEA 4Q3CA 1IM8A 2G5TA 3ISTA 4V0SA 2HBYA 2PXCA 3LA8A 3ROPA 4N7MA 5AJTA 3S68A 1WPRA 4IVQA 3ZTTA 4U5XA 4DCPA 4ILEA 4E1AA 4DR3B 1H2ZA 2J1LA 2EGGA 3OTIA 1Z6PA 5CU7A 3V4PB 1DC7A 1W4RA 2FWPA 5EHXA 1B1CA 2B6HA 1SNYA 2C4MA 4FLMA 1ZC4A 2Q1UA 1A69A 4M86A 1Z4OA 1WDWB 3N0WA 3OQBA 3G0BA 1DKOA 1MO5A 4ZYXA 3K30A 2XD9A 4EB8A 5IH7A 3DL2A 3AB7A 4AZ3B 4Y2VA 1OVMA 2O2EA 4EG7A 3AHFA 3AUXA 3GA7A 1Y4SA 3AM1A 1TF5A 4GEGA 4Y2UA 2Q2VA 3EA5A 2AKAB 5DBOA 3FMFA 2WOOA 4AT1A 4AY4A 1U7HA 1JKXA 3GAMA 3HB5X 4WT7A 4D3FA 4LKOA 1F7UA 3OU6A 3AR9A 2HJWA 2I76A 3DD5A 1CDDA 2HMTA 5EJ8A 3KV1A 3HDQA 4RAOA 4IJMA 4ARIA 3DCIA 1ZMRA 2Z6VA 1DTEA 2FFQA 3AESA 3D6VA 1I7SB 3BF8A 1OC2A 5KYTA 1DEAA 1P7VA 1PGQA 1E79D 3OUUA 2AMFA 5IJAA 3CRNA 3BD8A 3QXXA 1A8SA 3NVKI 1A4UA 4X20B 3HDJA 5G02A 4FOSA 1HI9A 1I3OA 1VJCA 4D3SA 3PKJA 3Q3CA 4Q9NA 1VI5A 1H22A 1PGOA 2MSKA 2P3QA 3PWSA 1DQRA 4CCAA 2I65A 4ARSA 4GX5A 1HY3A 3H8SA 3CPJB 5TJHA 4FS8A 2PR2A 4PCVA 4NESA 4IHJF 4OMDA 5CCBA 5IZCC 3UMJA 1YKFA 3OLWA 4CM8B 3UN1A 2P6NA 2NUAB 3PQ7A 1HORA 5ITSA 2PX0A 3VAAA 3AYZB 2NSJA 1CE8A 4G9BA 4BQIA 6REQB 3NDBB 4O1IA 2J9GA 1XEWY 3A9TA 5HQJA 5TQVA 1IHOA 2NXNA 3IPCA 1NKSA 3RIHA 4E5PA 2QN7A 2GXSA 4EYOA 1JYFA 4XCQA 3THWB 2VAWA 3ISVA 1GXSA 1XROA 3D02A 2XCRB 4BLRA 3ZHBA 1GQFA 3AFOA 3RC1A 5JANA 1Z5ZA 3GEDA 3BIWA 2I4RA 3H8JA 1GPJA 2XMPA 3GY0A 4KDRA 3HBLA 3WGZA 4GR9A 3RT7A 4UNIA 3H83A 3U7GA 1T5OA 2F9LA 2VSYA 4LXUA 5L3RA 3RJ9A 2X3UA 1X39A 3E2PA 3S2SA 1G3IA 1JDUA 3W5VA 1LTKA 1B41A 3V9PA 5FEUA 1A7AA 3OIGA 4Y2YA 1B0AA 1HQDA 2C97A 2WKRA 4D8YA 4D3ZA 4DJEC 5BR8B 4TLCA 3TLYA 2GM4A 2VP2A 1H94A 3GGGA 2LZ0A 1UDRA 5K3SA 3VI3B 3RF7A 4E14A 4PE5B 5HFNA 2WICA 3KZOA 3LUFA 4JYBA 5AXDA 1C3EA 4X8LA 5EWJB 3FHTA 3DVAA 5BN3A 2PX4A 3TD2A 2W2NA 5EIFA 3TSZA 1OI3A 1ILEA 4QGSA 2EJWA 2WR8A 4YYEA 2Z6QA 1GRNA 4XQ9A 1CDOA 5E7JA 1Z6AA 3HJBA 5LVAA 1LVGA 2B1RA 1DFGA 2XX3A 3H1PA 3NV9A 1KK0A 2YJTD 3O5AA 3TDMA 4BIIA 3E9QA 3A2MA 3DLHA 4P93A 1USGA 1TA9A 4Z1OA 3CCCA 4GOXA 4C0BA 1XRQA 3H0EA 5EZSA 1RMTA 5EJMA 4RIGA 2NSDA 1VPVA 1E60A 1V8OA 1KIMA 2UUPA 1SU6A 2HDHA 1LEHA 3OA2A 2XEDA 4IH1A 2UV8A 1ZKDA 2QV7A 4V3CA 1WVMA 4H1HA 1WRBA 3CHYA 3MQ4A 2IDZA 1EB9A 4Q9AA 3OD5A 4ZTZB 1W5EA 3A8TA 3NU1A 1NA5A 4FNAA 4P92A 2UYOA 3QEBZ 2GASA 1BEZA 1LKZA 3I4CA 2NW6A 2FX2A 4HAOA 4NZZA 4B7UA 5C9ZA 1DX4A 3BMNB 2D5IA 5FPHA 1RC1A 2GCPA 2AOUA 3NTXA 1GUYA 3TQSA 3UKOA 5BR7A 1C8BA 3BC1A 3KAJA 3Q88A 4NZ9A 2Q21A 4U2KA 5FJJA 3KSAC 1GGKA 5DK4A 5JO0A 3ECCA 1O6CA 1TRHA 4ZAFA 1I2DA 1XN4A 1GT91 2VF2A 1DMRA 3WGHA 4ENUA 4RV5A 1UBSB 2OXCA 3BXHA 4Q3OA 1JILA 4KXFB 3EC2A 1QB7A 1WZUA 4C7XA 4OX9Y 2QM7A 1YBFA 3F5FA 4QGHA 1LRJA 1Y3BE 3L0PA 1Y8ZA 3ANXA 5AD1A 1E1QD 2IU6A 4QVGA 2W6JA 3FR8A 3DONA 3ENZA 4HD8A 4FDLA 4EG5A 4DCSA 2DP4E 5J4YA 1CUFA 3IPLA 2N46A 3PFCA 4ZI7F 4JI0B 1R8QA 4FNGA 3A6HA 3BB1A 3K32A 4RS3A 2O48X 1K89A 3VC1A 3HXKA 3VC7A 1BXGB 3CE9A 1W44A 3I01M 1KNQA 5GWXA 2LV8A 2FR1A 4B3GA 1XZPA 3STWA 3H1FA 1H2RS 3AW9A 2YOGA 1I8TA 2RGGA 2VCYA 5CG1A 5AW2A 2C00A 2HCTA 4Y6SA 1XXHE 4IV8A 1JBQA 2XZOA 3OOJA 1KJZA 4B3SB 2AZDA 3TW8B 4D0GA 2F3RA 1XQXA 1BMFA 4TTRA 2AQKA 5J59A 4DLXA 2V7VA 4OXIA 4NU0A 1WTCA 2C7OA 2EX1A 4MPRA 4OL9A 4PWZA 5AWFC 1DARA 3HO8A 4EPXA 1L7BA 4P34A 4QELA 4GG1A 4NYJR 4Z8YA 1U9CA 2NADA 3B82A 2WAAA 2VSFA 4AQYB 1HMPA 1NSTA 16PKA 1U7WA 4LSMA 1W76A 4WUVA 2RBGA 4HAUA 5DB4A 4RK1A 3D3JA 1ZJJA 5K0JA 1IY0A 4TRRA 1RWMA 1LX7A 4PSKA 4L1KA 4ND5A 3UV7A 1IBLB 3V6LA 2XUHA 1JQAA 1NC1A 4YUXA 5F3WB 4WZZA 3QZUA 1I94B 1D2NA 2W2VA 4C4AA 2ZTLA 1NJSA 4OXKA 1KSFX 821PA 2OO3A 3U3RA 3IIEA 5LQUA 3JY6A 3QU5A 1C80A 1DS6A 3D1JA 4C2BA 2YS6A 4EHBA 4NMWA 3HU5A 1Y5IA 2EFCB 1CY6A 5JLAA 2H0RA 1IATA 3DAOA 3NBAA 4AC9A 4F46A 3U9TA 3AEQA 4I1OA 5KYNA 1P0CA 3H2GA 2CMKA 2CMDA 1VE1A 1LJUA 1Y3HA 1Y9JA 3LP5A 1REQA 1SHZA 3G0CA 3PFKA 3RASA 4A10A 3P9IA 2JLSA 1I51A 1GNPA 3B48A 3OP4A 2CLMB 4YC7A 1IXZA 1U7ZA 4KK3A 5EHZA 1J09A 3COZA 2PLAA 1J2YA 4HVCA 4BXOA 2QG6A 1L4GA 3AM4A 1CD5A 2IP1A 3OQOA 1AQUA 2J6CA 2EAUA 3GT0A 1E63A 3Q8LA 2GYUA 3HL0A 2R1VB 1UBMS 3LPLA 2MTBA 2FB9A 2IYEA 3V97A 5KVSA 2HU7A 2EGHA 2WLTA 3FNQA 4MYTA 2HMAA 2F9MA 5E9WA 1T4BA 5CEFA 3ZZMA 1M72A 3NJRA 1U9IC 3KXDA 1E3MA 1NVXQ 1OLXB 1XMIA 1AKEA 3P4YA 3GUCA 1MAVA 4JX9A 2BLNA 4B73A 3QI7A 2WJJA 5LP6F 4HNRA 4MGIR 3AKZA 4PLZA 4ZP1A 2HSEA 1R74A 3OLYA 2RHMA 4DARA 1LCIA 4GP6A 4BQRA 1YGPA 5F35A 4J43A 2EARA 3GLIA 1R5OA 2GEJA 2I99A 5HK8A 3UMVA 4TSFD 4Y9TA 2A58A 3EFOB 2QUKA 2A30A 3EIFA 5CT4A 3FWYA 3HU3A 2Y1CA 3BRWD 2DJ5A 1NI5A 1W4LA 1M33A 4LE0A 3BWBA 4KP7A 3AL2A 1T36A 3TRDA 1TJ5A 4DL9A 1QLWA 5E6SA 2IC5A 3JPYA 1QOPB 5IH3A 4E5NA 4FYIA 1YRHA 4HUJA 621PA 2WBLC 2JASA 3CO0S 1YJBA 1YCHA 4CFZA 3IIKA 2YWBA 3R3WA 2DHCA 1M6EX 2UZ1A 1Q1AA 1ENOA 5KUTA 3WGLA 3AOGA 1UJ6A 5DP2A 5B58T 1AB6A 1XQYA 5BW8A 4CM5A 2DR3A 4EP1A 5BY2A 1R50A 1VDZA 3C85A 4BLPA 4DCUA 1VZ2A 1EUCB 4HRYA 3LYHA 4HZUB 3EGXB 3HR4A 3MJRA 1OREA 1JMVA 4Q9JA 3D6MA 4GXRA 3UMSA 2ADMA 2R6CA 2JGLA 2RAUA 2Y4NA 4UCWA 5I4BA 3ESZA 1XHFA 1P31A 4QKQA 5J2UA 2GF9A 1BDMA 1ISPA 3AY0A 3G8BA 1OYYA 2HNAA 4L7VA 1E7RA 3DE2X 4OUDA 1E3JA 3N2LA 2ZRIA 3NHFA 4DA0A 4EPTA 4A6XA 2X9LA 2VRCD 4WOKA 2AN3A 5DEIA 1DCKA 3GUVA 2WMNB 1XN1A 2XIQA 1XTKA 4RKYA 4ZRMA 2WD7B 1M2VA 1E2PA 4CKWB 5LPNA 2BH2A 1A1SA 1YZKA 4JBGA 2O8EB 2R6JA 5KQRA 1ZJZA 2R48A 1EA5A 3FDZA 5JH7A 4PNEA 2PKYX 3D6UA 1VSQA 2F4VB 2GHRA 3I76A 3KFXA 4Q1FA 2AC4A 3E5NA 6Q21A 1YJCA 2YFYA 1Q1EA 4LOKA 4GOJA 4K9SA 5FUVA 1WUIS 1K98A 4PRLA 3D7SA 3ZGVA 1RM0A 3O91A 2V7EA 4UASA 2ZPTX 2PRKA 1VSTA 2DUUA 3CIFA 1PW5A 1T36B 2B69A 3AZPA 3MMSA 4OYYA 4ZCMA 5HE9A 5GGXA 3PQ5A 2H4YA 4GUDA 4KU4A 4WLEA 1G8AA 3ZQJA 1M1XB 4ZYZA 4OCZA 4M8LA 2P8JA 1DELA 1XI2A 3OUTA 5CNJA 3IHTA 2YWHA 2R25B 3C15C 3Q0TA 4UJ3A 4U6NA 4WESB 4ALJA 4PGMA 4R51A 1GA4A 1MH1A 2KWIA 2ZJFA 2IOFK 1OASA 5E1BA 4XQGA 2CDCA 4G1UC 3R2JA 3KYBA 5BSVA 1WB4A 3LZ6A 5BYAA 1H6CA 2QN6A 1GAJA 1MRZA 3UANA 3N0RA 4MQMA 1YDMA 1MAWA 4NAVA 5TQ0A 1HNWB 3WIVA 2FI1A 1Y1QA 3HRIA 3EC1A 1QIJA 3GA5A 2OCYC 2LXNA 4QM7A 2ZBVA 5BORA 4CQMA 3TB4A 1P1RA 4BAZA 4M60A 2QE6A 3OY2A 3IYLW 2FHPA 3DMTC 3CRW1 3LWDA 4PRZA 4RM3A 5FUQA 3GNLA 5CB4A 3PQCA 3J80A 2C7RA 3F6YA 2IBSA 1E1RD 5IJXA 4F5EA 3TFQA 5BN4A 3ESYA 3RSZA 4AG6A 3UB4A 1O9HA 5DF1A 4CF6A 3ZJVA 4QYSA 4PC6A 4KPFC 2IYPA 3MGAA 5TB5A 2IYOA 3HVKA 4FZRA 1CRLA 3K1TA 2WP0A 5HR5A 1E8MA 1II8A 4OH1A 2RB4A 1YNSA 4ITUA 4EJ2A 3GZ4A 3LUBA 5E1DA 3D6FA 4NBWA 1H5NA 4ALNA 2OCIA 2WJZB 4QRDA 4ADSG 1HFJA 1X8LA 4RTJA 4KOAA 4IPTA 5D2CA 4MIKA 2G4LA 2YV4A 3ZJUA 4DC1A 2XXAB 1H4TA 2CLFB 2QN3A 3PR3A 1H1TA 5L3ZA 1KVQA 3KXLA 3MWEB 2A84A 3HZHA 5CJ2A 2IODA 2J5BA 3S6JA 4CM9A 4BJ3A 1N8KA 2AVDA 2FN4A 1J07A 4JNCA 5H4HA 4A0GA 1Y0BA 3G0HA 4AYWA 1ZDMA 1XP5A 4QIHA 1MPXA 2GN8A 2YW2A 2FHSA 4J76A 4QJ4A 4B48A 2G08A 1FCJA 4HFJA 3RVKA 3DJFA 3QE3A 2HT1A 3CNEA 1GN9A 1R4MB 2CWDA 3K35A 2JLUA 2H3HA 4DLBA 1I3CA 1EQUA 1M6VA 1RAFA 4QICA 2ZIEA 4XWWA 2R11A 2VNHA 4OH7A 4KAXA 4XRGA 3TR5A 3IEXA 3EXEA 1M8FA 2Q6IA 3ST7A 1NHWA 2PLNA 2Y1DA 4MROA 1G20E 3ECAA 1UKVY 3PPIA 5AW6A 1H2HA 1PHPA 3MLEA 4NL4H 2A92A 5AVRA 2XDAA 5ADUS 5DN6D 2B5OA 2H52A 1FQJA 3DEAA 2PD6A 1PJBA 3U81A 5ES3A 3TDKA 1BD4A 4LJAA 3TOSA 3DXXA 2HPVA 4PCLA 3D0OA 4PYOA 4F71A 3VPFA 3NP9A 5KX5F 3ELYA 3VJLA 5IHPA 2VAXA 1TCVA 1YE5A 1OPRA 1XTJA 2O1EA 4B4OA 4MUEA 2X9NA 2EFYA 4FGSA 1U0RA 2NVOA 2HCRA 5TS3A 3GLKA 1UPAA 4LYJA 2GCGA 2BEJA 4KVAA 4D92A 5A4KA 1K5GA 2X8BA 4JYPA 4DHWA 4MCHA 4O1HA 5EIBC 4F9FA 3OM8A 1L1FA 1H5QA 1H93A 1QNLA 4OGLA 3ZBPA 2H18A 4NNJA 5IAOA 4HDNB 3NKVA 4TZKA 3EPJA 3NOQA 4UXJA 3JR7A 3ZE2B 1SXQA 2E4WA 4XE5A 3R6TA 1O87A 1RHKA 4LXXA 1DC5A 4PPFA 1RAEA 2BCGY 3JWJA 1TYEB 3OIUA 1Q19A 1RZVA 2O8FB 1WCYA 7REQB 4HV4A 3LW7A 4E5SA 1Q15A 5LKAA 2C2BA 2GSWA 1ZMTA 3F6SA 4RZUA 5EXDA 1LBHA 2J9ZB 1UUFA 1XGKA 2JAPA 2QQ0A 3I4FA 1D7OA 2Y1LA 5DW3A 3TR6A 1EWQA 4NYMR 4V2IA 3AVPA 5JOQA 1JDBB 4GI7A 3Q2KA 5FPSA 2JFHA 3BICA 3E5MA 3LG2A 4GYWA 1W6UA 3QLVA 4QOSA 4Y2GA 4Y1GA 1U9JA 3W90A 3WQHA 4NABA 3S7TA 2XSZD 2PY6A 4WADA 3TGWA 4GGPA 3PHJA 5HDBB 1JFSA 3OUZA 2HOQA 2QTZA 3VDQA 3CVVA 3DQQA 3ICOA 3MWKA 2H7XA 4RBNA 1EBBA 4JD5A 2OENG 3MT9A 4TV9F 4WKOA 4XFKA 1AZLA 1CFZA 4KMRA 4EJSA 4B31A 1E8NA 1JG4A 2YJ3A 1RP1A 1JDZA 2BUCA 1XTBA 1L5MA 3FTQA 3WYBA 4LF4B 2LVBA 4ZYYA 2XB6A 3HFSA 1L8OA 4P86A 4QG3A 1FMTA 1KYYA 4KFSA 5LMCA 2VNSA 1OH5A 5C8VA 2C4KA 1E9AA 2QM3A 2VCHA 3RV3A 1DUIA 2BFMA 2Q2NA 3OZCA 3TSYA 1PUXA 2I2FA 2BKUA 5G0WA 5I7UA 1GKIA 1MIOA 3T4PA 4GOLD 3H9QA 2Z5FA 4IGEA 4W9MC 3LECA 1YS2X 1SVUA 1R0SA 1YOBA 1CEQA 1E6MA 3ADPA 3KV3O 1JH8A 2Q9CA 4DBZA 3BRQA 4ZT2A 3R7WA 4YR7A 3MGKA 3MTGA 3RC7A 2G5GX 1EZ4A 1N8SA 1ZVQA 2XLBA 1U2GA 3I6MA 4KBYA 1NAIA 5F5XA 1XVAA 1W0KA 3CLHA 5A6VA 4JI4B 1KJWA 4IP0A 3OOEA 4Y1EA 3HEAA 3EPHA 4CMGA 3PDWA 2W8ZA 5B36A 2WIGA 1IQUA 1FX0B 4NHOA 1ODIA 2VRWA 4LNUB 1NASA 3KSRA 1XYGA 5F7XA 5AW1A 2SNIE 3WP0A 4BLWA 1DCTA 4OBEA 1XNHA 2VT3A 3DVLA 2Q50A 3OLXA 3MWJA 4B3DA 4G8DA 5EXPA 5CA1A 4JDUA 4BNXA 3LLCA 3TVYA 2W6JD 3UHOA 2Y0DA 4R84A 3HR7A 2HBZA 4L28A 3DBHA 1VECA 1X14A 1L1EA 3GYBA 4YRQA 3W3ZB 5JC1A 1KEUA 1MJ5A 4JUBA 4LXIA 1O1YA 4I5GA 4NJOA 3VPHA 1K4YA 1GTG1 2HU8A 2QYHA 3FMVA 4CR7A 3UAYA 2CVQA 1RC8A 2WIKA 2HRCA 2Y2UA 4JI1B 1XXHB 2CUNA 3W6PA 5BSRA 3N6VA 4M88A 5SICE 4MQEA 3STVA 4WVFA 5FKJA 3OSZA 3FTDA 3PGA1 5JMTA 4Y30A 4BMVA 3IH5A 4ARVA 1FZTA 3RSLA 3GF4A 5FHQA 1LPBB 1EBFA 3T3GA 1SUFA 2NYRA 1AKNA 3F73A 2J7PA 1J2RA 4MWZA 4L5BA 2C3YA 1SG6A 3OQVA 5CDFE 1CUDA 1SFRA 5TQ0B 3QOWA 1GQYA 3R6WA 4IQ0A 3G7SA 1KJYA 1GPUA 2J09A 1ONOA 1B74A 4U3JA 1AGPA 3E9RA 5J63A 3FKSA 2AWOA 3OJOA 2JVJA 4QDXA 5IU6A 3GLHB 4ICIA 1TCAA 3MC1A 4R1MA 1CULC 5DI3B 4EQZA 5L3SB 3NVAA 4G25A 1PJTA 4J3NA 3R5TA 4A8PA 2PH3A 2F8MA 1ZMOA 4GGOA 1U3UA 2CWWA 2K6GA 3H97A 1S1MA 1T3TA 4U9IS 2GJ9A 1IN1A 1UBTS 4Q24A 3GPDG 1X8KA 1YIOA 1TZCA 4GICA 3RKRA 5LQCA 4GQAA 1NURA 2XF2A 1ZD1A 3DNFA 1J0BA 1MJHA 1UJ5A 1EXVA 5HCIA 1P1JA 3AUTA 3FW1A 4CM6A 2HCFA 1CJCA 1NP7A 3OQHA 2C9BA 5BWBA 5KCZA 3QXJA 4S1WA 4UUPA 3BZBA 4V38A 2IUUA 5E9JA 4HAYA 4XW2A 5C2JB 1PL6A 4F45A 1J8DA 2HWKA 3CN9A 1LS6A 3FBTA 1E0AA 5ALEA 2VP0A 3U39A 3UV3A 2VXYA 4LX8A 1I1NA 1ZA1A 2X8WA 3DBRB 1O7JA 4J4TA 3WMGA 1SCDA 3UJNA 3IP7A 4LOJA 1F2VA 1V35A 2X5OA 4KQFA 4BYGA 2AC7A 1MTZA 2OILA 4U2CA 1EG2A 5DCLA 1Q1GA 1YS6A 2RH4A 1ISGA 2CKDA 2W2XA 1YKSA 4KB5A 4RL4A 1NOKA 4YO8A 1FTWA 4I4TB 5H02A 4D7AA 1NT2A 2P77A 3KUKA 5CB4F 2PH7A 2PA3A 1HOTA 2I03A 5IAJA 1EM8B 1XMPA 3OHSX 1AIPA 5LP1A 1QFSA 2NZJA 4RQBA 1OAKA 1YB4A 4LYDA 3R5FA 5G4LA 3G88A 2CL6X 3Q7RA 1IMJA 1CKEA 2P0EA 4F6LA 2PQ2A 4DLUA 3GG2A 2IYRA 2I62A 3E9NA 4RXUA 1OLUB 2ZJZA 3PLNA 5ELMA 4EYSA 3WAJA 3UATA 4G0WA 2YX1A 2YZ7A 4H4DA 1KQ3A 1R27A 1DIAA 3IULA 3H19A 3FDJA 1RT9A 5AYVA 5CP8A 3B60A 1AS2A 1CY7A 1Q2XA 1PIWA 3CX8A 4DLLA 1Z38A 3HI4A 3ZU4A 3AIMA 2VH2A 1ABBA 1P19A 1G60A 2RSLA 4D6PA 2ZYGA 3P96A 3PHGA 3RO7A 4TUYF 3U7JA 4C0LA 5HK9A 2LR0A 4ESVA 3EDYA 1DLIA 2NO7A 4C20A 2ZS7A 5CYOA 4EAQA 5D00A 2IS6A 4AZ0A 5K0TA 1T9CA 1DI0A 1Z33A 2ESRA 1TK9A 4TQAA 2R7MA 2C61A 2F55A 3DBHB 1AXRA 1O89A 1YDHA 2H7YA 5HIKA 1JP7A 2D54A 2YS7A 3QBDA 4HWRA 4MR7A 2WU4A 3W8DA 4QO8A 3EE6A 1DEXA 5FIUA 2XAUA 4N6NA 3TZLA 3INRA 4C0XA 2ZYHA 4UHFA 4EW1A 1MF7A 1X9GA 2R68A 3OJLA 3SIXA 2VL7A 4Q9DA 4ZO7A 4HRAA 3WNBA 4NXNB 1KH2A 4HO1X 2FW0A 1QO0D 3AJAA 1PYDA 4LQLA 3G2HA 5IHXA 2Y1GA 3A04A 1G8PA 3C5VA 3G9XA 2Q3EA 4KWCA 3BHNA 4RMHA 5IBQA 3VNVA 3TTYA 1W48A 4TV9A 3ZY5A 4AMUA 3GLGE 3IUBA 1CR0A 3C97A 3VPCA 4MYUA 2BBTA 5FX2A 1MJFA 1GTL1 1QAOA 5BN1A 4JHLA 5REQB 1TPYA 2C0CA 3RAPR 1ZICA 2E4XA 2HLNA 2HRRA 3GLRA 1WSAA 5AM5A 4S04A 3D4IA 3KZCA 4QASA 1UCFA 4KVFA 3C8HA 3G5UA 3TUJC 2IH2A 1ZD2P 2LCQA 4FYKA 4QYWA 2EKPA 2FFRA 3EC7A 3IUMA 1P6UA 2VS1A 5DX8A 2ZE8A 5EP2A 4DAEA 6ABPA 1F06A 5T4HA 3V46A 4HLDA 4IIDA 3D64A 4GM4A 4OMUA 1X7WB 2PZLA 1ORTA 3AR8A 1PR3A 1LVUA 2E6KA 3PI7A 4RSRA 1VIVA 1XP8A 4B6RA 3Q8XB 1SQSA 3AIOA 4YAIA 1W29A 4EENA 2XE8A 4LDQA 4NZPA 2P68A 1ENYA 2ILVA 5EIXA 4Z4EA 4BFXA 2RJNA 2BGMA 2CL5A 1UWCA 2V6IA 2QL6A 3IC5A 4HSGA 2VDWA 3V8PA 4ZRDA 1DAGA 3WLQA 5J5CA 5DOZA 3ZWCA 3LDAA 4FZJA 3FI0A 4W5WA 1JHOA 5ALWA 2D0PB 2JGRA 1VL0A 3HVHA 3QVMA 4HQRA 4IBOA 4DYDA 5LJLA 1OFHA 3LXMA 5AP9A 2CJWA 1XALA 2ZUCA 4JEMA 2RDMA 1M6WA 2FQQA 2HMSA 1E5VA 1M2NA 5LC1A 1BS9A 1XZJA 1WP4A 3RTEA 2IVZA 3FYHA 3EOAI 3CLVA 3I2IA 3R5HA 4HZIA 4KUEA 3ZXYA 1G6Q1 4MDEA 3BE5A 4P35A 2V98A 2VUHB 3V1LA 4WD3A 3O1JC 1XQ6A 4EPYA 4GSKA 3CXRA 3JQBA 5T4BA 4BP1A 3NRBA 3H8WA 5F12A 4WACA 2XOXA 3UTDA 1OH8A 1YMVA 4X1KA 2C7QA 4QWMA 2HDNB 1P80A 2ATIA 2QOEA 4WJKB 5JHGB 3L3BA 5KNBD 1FTQA 1ZXBA 2ORED 4BMPB 3GJXC 4BNWA 2QRPA 3K16A 4ZKEA 1QIGA 1AF7A 2ZBGA 1E6UA 1Z82A 3DL7A 3E70C 3N8NA 1PEAA 1KR5A 1E5XA 4P7JA 1VSBA 4N3AA 3OU2A 3I9OA 4Q21A 1LPMA 1WSDA 2KJQA 1D0IA 2YY7A 3KBOA 5IJZA 2CXRA 4F4UA 3ZS9A 3KPUA 1NBMD 3ZVRA 4R2LA 3ACCA 2PGLA 2VC2B 3AR6A 4DA9A 4YXWD 2ECKA 1ZXXA 3FVWA 1TTPB 4AJPA 3ND5A 2BFOA 5CW2A 4QVIA 5JJKA 1JW9B 1TW2A 1Z5WA 2C3OA 2RGDA 3IMEA 4HDRA 1C7IA 5J43A 5A0TA 3JZDA 1ZJYA 3A28A 4G5XA 3DM5A 2PH5A 3KALA 1X7ZB 1CJBA 1CY8A 1EP2B 1I3KA 2DKOA 3CZMA 3EVAA 3LHSA 4HTFB 4M37A 2GN4A 1YQUA 4RMIA 2I6QA 3AF4A 2OVFA 1TXGA 1YUBA 3LLMA 1DAMA 3PHLA 4RETA 1R4MA 5JZMA 3K2BA 1SB8A 2GD6A 2W4MA 3PIIA 2YW9A 3FHOA 3L7MA 3N2EA 3GMIA 2OK7A 4R8KA 4BRSA 2WSSA 4E12A 3PGXA 4LRTB 2RHHA 4ARAA 3C24A 4UAVA 1TJYA 2PBLA 3G6WA 2EGUA 1M1ZA 4AICA 4OP2A 3KJFA 4MKGA 1AQLA 3UUFA 1C0LA 1N2CA 2QF7A 4LVNA 4C76A 3EULA 1C7RA 3GR6A 4H7JA 3SX4A 2PO5A 1CJTC 5CB8A 4UEKA 2WQZA 4H15A 4JT2A 3D3NA 4YONB 2X9GA 1OWPA 2L82A 3QNMA 4ND8A 5REQA 3BQMB 3H9JA 1UDCA 3K8ZA 1EJ2A 3AR2A 4LBZA 4HWPA 1JSZA 2X0NA 3BX1A 1LBQA 3CZRA 4CV3A 4RFLA 1XEWX 4YFYA 2V7QD 5H81A 3RR2A 2VUSA 3DKKA 4YUVA 3NKLA 2LP4Y 5JQGF 2Y0BA 2Y6UA 2CVZA 2GFIA 3IOMA 4TL8A 4AJ4A 3BFJA 1ZK4A 4YCLA 1N6KA 1N25A 2ZSDA 5C7LO 4AMYA 2AUMA 3TUZC 5PNTA 2CNNA 2XA1A 1K7CA 3HYSA 4CPDA 1JDJA 1V2GA 2IHZA 1NMSA 2ZUBA 3ANYB 3E1SA 3LY7A 1HX7A 1X80A 5DLYA 4HEHA 4WCFB 1LGYA 2QRQA 1QIFA 3ZCXA 3NC4A 1FS5A 3ZV4A 4BTLA 1HK7A 1P9NA 2AQHA 3TX6A 1X0VA 4ND7A 5CLFA 1W52X 1P62B 4HB0A 1CERA 3V5NA 3VTAA 4JC5A 1K86A 1NQUA 1UP7A 3AWDA 2FW7A 4KO3S 2POCA 3IPYA 1FC0A 4FHGA 4H0NA 4HN9A 1KZ1A 4LYGA 3PUIA 5IDVA 4YAUA 2HR1A 4DQVA 3PQEA 1AF4A 2CD7A 2XWSA 1U4SA 2QHXA 3HCDA 3T5CA 1SQGA 1NVWQ 4AMZA 1RJ9B 1COZA 3U1TA 5CYPA 5T6MA 1JPNA 3ZNQA 4CE6A 1DAHA 1Q7CA 4LI3X 3VR5H 3EMKA 1V7ZA 1LLDA 2QTTA 1GPH1 2A1TS 2M1XA 3EDCA 1NQTA 2PS9A 4WA8A 4HQLA 5JCOC 1N78A 4OMFG 5CM9C 2ZUFA 2SCUA 2WWGA 1F48A 3PRYA 5DOVA 4J0DA 3CVWA 1KO7A 1YL6A 1PL8A 3VYUB 4YJ2A 1MC8A 2NXJA 3THWA 5EFZA 2VJAA 3D3WA 3BTVA 4XX0B 3FGPA 5DM4A 1LQTA 2VDQB 3RSGA 3VNSA 3HCEA 3LT4A 3BMOB 1CR6A 3M3DA 5B3KA 3L40A 2RG7A 3LUJA 5CDSA 3BXGA 4ER6A 1GCUA 4JVLA 4IO1A 5KU1A 3B6KA 3L18A 4LTMA 3RBVA 4HEQA 3OT4A 3AB8A 1XQVA 2EP8A 2B30A 1T4CA 2NUTB 3O95A 3SVTA 3EIWA 2PT6A 3V3TA 1CS0A 4GLJA 3HJNA 2PGNA 4TRNA 4V0LA 4JUFA 3V7YA 4X8HA 5L95A 4G2NA 1LC3A 2BBSA 2OHFA 5JZOA 2ORWA 3DVQX 2X7HA 1FS4A 3IMFA 2VTEA 4DLZA 3I5XA 2JBHA 4O25A 1SD2A 1RM4A 1Z75A 1QSGA 1U8TA 1R4NA 1NJ6A 1JQDA 2AE1A 4OJTA 2R8OA 3RVMA 3TBHA 3NBUA 3AR3A 3AY7A 2XA2A 1F0PA 3H5RA 3L1IA 3NHBA 3TTUA 2UUAB 2SKCA 3T4EA 4CKWA 3OETA 4U2DA 4JFRA 3L79A 4XYMA 5CFNA 3O8RA 2JCBA 5EY5B 2QPAA 5K0GA 4KWEA 3DSRA 3ERCA 1C1XB 1FRVA 3K8QA 2BZGA 4ZVQA 4ZAVA 4ZQBA 5DHTA 4MCIA 4BO8A 1A8QA 2FE4A 3NBFA 2BRUA 2QX9A 3FJYA 2EF0A 3TYXA 4BO1A 5B1EA 4GGMX 1J20A 4EUSA 1U2RA 2JD0A 2KX7A 1KARA 2ZCUA 4G5GA 1WHTB 1I3LA 1H0RA 1NLMA 2A6PA 3KEQA 5AI6A 3VR4A 4LDRA 4ZU6X 4S24A 3GEIA 4MV5A 1RPNA 4ER0A 2IEDA 4HDOB 1AHNA 1EUYA 4HX9A 2O2HA 4KI0A 1V1RA 2I0FA 3NAGA 3VISA 2RAPA 4EL0A 3DKIA 3L02A 5JROA 3V2HA 4JJGA 5A4DA 1KZ9A 2O14A 5F98A 3K7EA 4XWYA 4F9GA 4OX9B 3UXYA 3ABQB 4NE2A 3JQAB 1IRIA 4EZBA 1ECJA 4TVOA 4W6QA 4TWJA 4WZBB 4XJTA 2FPRA 2NQTA 1GIAA 2Q1SA 3KQOA 5E6RA 1SMKA 4R7ZA 3VR4H 1ULSA 3IKMB 3ZNNA 3D2AA 4I5EA 3OJXA 1UANA 2PX6A 5ICSA 1E9EA 4LV5B 4CUKA 1S3GA 1S89A 5IJ9B 1IQ0A 4KUHA 1CR1A 3QF4B 2QUBA 3C3KA 2UZIR 1Y4DE 3KQPA 5I9BA 3LQRA 1N33B 5T6BA 3ZY6A 2Q5IA 2ZFUA 1BXZA 2PSFA 1N5OX 1X7DA 2BTQA 1VLQA 3KJNA 4NBUA 1BKDR 1UOOA 2DU8A 4K6KA 4TMFA 1VRWA 1C4WA 5JD6A 3AEKA 3EXHA 3ZBUA 3NTLA 3LDUA 4JA2A 4AS2A 1D2CA 5AHOA 2MDTA 2C5FA 4BX0A 2WF5A 3IA2A 4LXTA 2NZVG 4CF4A 3W78A 4OTZA 1Z73A 1R6XA 1VGVA 2HZ7A 3FX2A 3IDOA 4BQOA 1SM4A 1E62A 4KLZA 2YOFA 3B5EA 1THTA 1K06A 3NHYA 4GP7A 3I2FA 4AY3A 3GJQA 2WWWA 1M7HA 4AS3A 1QC5B 4JP5A 4A7PA 1UWKA 5CYFA 1GLVA 1LI5A 2ORVA 3D1LA 4ZT4A 3NQ41 4JV5B 3MA0A 2PU7A 3EWNA 2FWMX 1P77A 1WIWA 3BXZA 2RC5A 3OFND 5H9VA 3OF2A 3RSCA 4F06A 2P2DA 5BNZA 2YKGA 4MVJP 4BBPA 1T2CA 1HA3A 1TA4A 3W4IA 4TYWA 1GAQA 3GZNA 3MS7A 2R85A 2C0QA 4EPWA 1PLJA 3T1OA 1Z0UA 1Z2AA 1UBLS 2CMHA 3B3QA 4MUJA 2P11A 1TYAE 4DCCA 5I3CA 4KO1S 1P7PA 5EHGA 3TL6A 3OQJA 3OD1A 4CUZA 4DR5B 4REQA 3KJXA 3DWFA 4GZ3A 1NJFA 4LY0A 2OQ2A 2D59A 3A58B 2FVYA 2I3BA 3DDSA 5EJ2A 1CVIA 1AUOA 3WSVA 1X7YB 1YQQA 2PS3A 2QL7A 2A5YB 2GILA 3VGPA 4DVJA 5F23A 1Z7GA 2PV7A 4UAJA 4C05A 4DR1B 1QX3A 5G1OA 2ZRGA 1SQ5A 2EV9A 3L1VA 1LDEA 2O8FA 1IJFA 1NN1A 3SN6A 1DTWB 1NT4A 1RQGA 3HO6A 3N2GB 4JEIA 4KKXB 3P0RA 3T1NA 5CAEA 1CPYA 1PVDA 2MMCA 1E64A 2GBPA 5CIWA 4RF2A 2H5IA 1TECE 3BXOA 2XUKA 3KOZA 3BKWA 4E30A 2VATA 3NP7A 4S05A 3ETGA 3KQLA 3H1TA 3EQ8A 5E4FA 5EIWA 2KI5A 3EQ2A 5DNEA 4R1NA 5LYYA 5JSZB 1RRPA 1Y37A 1ECCA 3E3NA 3F46A 4J1TA 4XJVA 5WRFA 4LHEA 2WC1A 4ZEOA 3URKA 1MO2A 1ODSA 2C96A 1JQLB 4IKPA 4BKMA 3MB5A 221PA 2BJWA 3WOHA 2WNHA 1K5PA 1X9HA 3EAFA 5SY4A 2BFDB 3GJ3A 1V4VA 1TADA 5B7GA 2XWBF 1NW6A 1I1HA 4AN4A 3DUFB 3MERA 2DPHA 2X8LA 2UYGA 1Z07A 3BXPA 2HJSA 3DJYA 4HNGA 1Z88A 5CAEB 3LYLA 4KSYA 1FP4A 4DWWA 4JVOA 1ESNA 4RJTA 5HJEA 2BSAA 2WJ3A 4D9EA 1H2BA 4J3FA 3HXQA 1GTRA 1DXQA 4K3UA 3NVMB 4KIFA 2CSUA 2F1OA 3FUTA 4GF5A 1PV4A 3IL2A 1THMA 5AQEA 3RROA 3QBVA 4EWLA 2H06A 2KMLA 2TECE 3JWGA 1PX2A 1QQ5A 1XDSA 4K9KA 3RS7A 4ZZ1A 3E3AA 2O8NA 4DMKA 4C03A 4LF7B 2QYSA 4E07A 1LQ2A 3N86A 1PBNA 1M6VB 2YYZA 3UA4A 2J5QA 5IVDA 1KI7A 1NBWB 2WHXA 3L0BA 1YTUA 1JR3D 2XGJA 3AP1A 1AV6A 2X0FA 1CT9A 4CIYA 5K8VA 4WWHA 4F7DA 4ZQEA 1ZH8A 2C54A 3RLFA 3SJBA 5LMZA 3GRCA 3C74A 4UTXA 4C30A 2GZHA 2FW8A 1OAOA 5C8ZA 3BHIA 4YRGA 2B4YA 4ZZ0A 1CCWA 2W2PA 2IZ7A 4H31A 3I9KA 3ZIAD 4LEIA 3RREA 3KB1A 1DQPA 4HGQA 3SXJA 2X19A 5CPBA 3KWLA 1UWVA 5F2KA 2LDXA 3KDPA 3MOGA 4BMYA 1C9KA 1LWOA 2RBEA 4Z0HO 5LR6A 3N2ZB 4PZCA 2HNKA 4BNZA 3KE9A 2QT9A 4I9FA 3M6AA 1J0CA 4YASA 5E7MA 4XVUA 3MS2A 1TFRA 3CMCO 3P2EA 1C30B 1M34A 4HZGA 4CU2A 1ZCAA 3QW2A 4M0DA 4GWLA 3LY5A 4M6WB 1A2KC 1MP0A 4RF5A 3BAZA 3KT0A 1FYVA 1L4KA 4B79A 4W5JA 2RE8A 1ECFA 2JRLA 2WF6A 4UTOA 4WEQA 3L77A 5DYIA 4EUFA 4MR8A 1C1DB 1J49A 3A4MA 3QOXA 4K9MA 1SY7A 3SEZA 5C3MA 3DZGA 4TMKA 1J23A 3KUCA 1X7HA 3FDXA 1QB8A 2ZITA 2GM5A 5DHSA 1VJDA 5L3QA 2EF1A 1G21B 5F3RA 3FPSA 3F0TA 5JJCA 3EIUA 2GKOA 4CL8A 2YFQA 1ZK3A 1FBTA 2H63A 1XJ0A 3D3KA 3KT8A 4PYLA 2O0LA 4QGBA 2D5CA 4EFKA 4Z1MD 4EB6B 1OZHA 4DBLE 5IM4F 4O2BF 2J32A 2LDBA 1O08A 2Z8ZA 4UD2A 3OFNA 3PHBE 4XA8A 5COAA 5B1DA 3DLTA 4NJMA 4RHXA 5IM5A 4MR7B 2JK0A 4MP3A 4BO2A 5IXJA 5A7HA 4OLBA 3P32A 2ZSIA 1NV8A 1Z4LA 5B1IA 5IUJC 2R6R1 2P5TB 2JIDA 5H0IA 5HF6A 2PE5A 2VXOA 1E2MA 4G65A 4BBJA 4WBNF 4NPCA 4UTZA 4C4SA 3WYGA 1NOIA 2YN4A 5GAJA 5JSFA 1R4ZA 2Z4TA 4LDJA 4LYEA 1YFLA 2DE0X 1QGAA 2D1SA 4XM0A 1QH8B 2OBBA 4AYTA 5JBIA 1SOMA 2V55B 4M7RA 3A6DA 4ECEA 1Q1QA 2H5EA 3PC6A 3PYXA 2QRVA 2G9QA 4QFCA 4X41A 4DQUA 4EF6A 1A7UA 1BX3A 1G8GA 1PGJA 2ZU6A 3DE1X 3EWAA 4E5VA 1XPUA 3FNFA 3ED5A 4CF5A 4QOHA 1XRSB 1G41A 5LL6P 2RHWA 3ZE0B 2XITA 3W5HA 3X1ZA 1CFJA 2AOTA 3GJSA 3AH8A 4IVPA 4UM7A 1OXUA 2D0DA 5TARA 1J5EB 2GEBA 5ECDA 2FGJA 1XD2B 3NBMA 3OEYA 4JVNA 1Q50A 4MMYB 4I6JA 3U3OA 4BNFA 2FJ0A 3FLMA 2MR6A 3PZBA 1L6RA 1MR3F 4YAWA 2XMZA 3Q6MA 3R23A 5DNYB 1YWGO 1GUAA 1NNSA 1O8CA 3IOYA 2O2DA 4Z9BA 4D97A 1CNFA 2PBRA 2Y9PB 2YJ6A 3OZBA 5K1ZA 4S2UA 4EHFA 5LNK6 2C5EA 1A27A 1KYWA 5DBIA 2VDLB 1OU0A 2M6LA 1XZEA 4ZAGA 5D7BA 2BY4A 1WQ4A 4RA6A 4YCAA 4HLQB 8GPBA 3F6EX 4PLTA 4TGLA 1CUZA 5MF6A 3PUYA 3WJAA 1M2HA 2CGEA 4BAUA 3QGMA 1XMVA 3F3YA 1ZGAA 1QH0A 2O3RA 2XHEA 3PGKA 2GBLC 2PL9A 1UPUA 2VA8A 1U8EA 3OZDA 3PX2A 2B0CA 3QLEA 4WFIA 4XSGA 3ROTA 2C04A 1PO7A 1FY2A 4PO1A 4YH1A 4IRUB 2J30A 3DTVA 4AY6A 4A36A 4JNKA 4D3XA 4D96A 1NU8A 4PHFA 2JHCA 1RLTA 2XLCA 2Y77A 1AXGA 4A27A 2C2HA 3O3MB 5JTUA 3DB1A 4MYHA 5IXYA 2IZ6A 3LKDA 2G1JA 2HEIA 2IF0A 5AKHA 1I2BA 2KM1A 2H2DA 4P08A 1LBTA 1UZUA 4DV1B 2IUSA 2G72A 3UAGA 2AZXA 1NKVA 1RWXA 4Z7JA 2F8SA 2PZFA 3C3YA 3JQGB 3LL7A 4LHWA 4C9BA 4DSOA 2ZS8A 1BDHA 4DUGA 4RE6A 4LNHA 1LBSA 1FU8A 2NWQA 1DIHA 2IF2A 4J9UE 2Z8YA 3U4DA 2V7GA 4UUBA 4XQCA 2VSXA 3KFLA 4HRXA 3GNSA 4C2UA 4EFLA 4IDPA 2QBYB 1I5EA 2B0JA 4QU5A 2IT1A 2WKQA 3A11A 3LQ1A 4UNQA 2JC3A 3QYJA 1JHRA 1L4MA 2QYTA 3DEJA 3TZQA 3UK0A 5A3RA 4E0BA 5KX5B 3KPWA 5CFZA 5ICGA 2P2GA 1GADO 3MCVA 4G4IA 4DIEA 1IAVA 1JIVA 1VDMA 4YQZA 4BPRA 2X6QA 1NLUA 5EIAA 5DK6A 3RYTC 3MFYA 2FF5A 4XSVA 1SPXA 3CGGA 4U7TB 5F21A 2VK2A 3AUSA 3G2LA 5KQPA 3GUHA 1DX9A 4L78A 4ZIRB 4ZVSA 5C1PA 1RWKA 4D4LA 4FKMA 1JTVA 2M6KA 1GPNA 4JSYA 5BOSA 4P3NA 4P5DA 4RPJA 3WB0A 4M0CA 4ETNA 4IUDS 4GLLA 4IFIA 3ZQUA 5LXTB 1IWOA 1R15A 2GT1A 2MT9A 4JLAA 4M9SA 3ZLBA 2IYXA 2DQSA 1QS0A 3FCEA 3OPYA 4DGSA 4J07A 1H4QA 4RABA 4Y2RA 3DULA 3P2YA 2ON6A 4E2ZA 1U8FO 3WKBA 5CYGA 4WOCA 3ZVKA 1LZLA 1YD7A 4XUEA 1W4ZA 3PXCX 4EHHA 2ZJ2A 1XPOA 1Y8AA 2Q2QA 3W1VA 3O8BA 5JATA 4L9SA 3X1JA 4TPKA 3HHEA 5FA6A 5BUQA 1CEXA 2HQ1A 2FUKA 3NRJA 1IC6A 2HCBA 3IOEA 3TNFA 1RYHA 1UFOA 3BJMA 4RDIA 5J9FA 3LWZA 3TEJA 4EMUA 4HGRA 4QOEA 1MC5A 3CUUA 5LDDC 2VQDA 1W8IA 3T3OA 1FLVA 1RC0A 1M74A 3TOVA 1Z83A 2PUJA 2Q5HA 2GLTA 3F6RA 3GLHE 4G36A 1OLOA 3N8GA 4P98A 1K27A 1JEQA 1C1YA 2HWWA 2PKQP 2EJVA 3HRHA 1GSAA 4ODIA 5EAIA 4DJFC 1NW3A 1X80B 2CJWB 3WBFA 4EKIA 2WG1A 2AHRA 3ENWA 1LBEA 1BH6A 2FN9A 4TWZA 2YWJA 1P6XA 2QTFA 3F5MA 4JELA 2VHTA 4XWGA 2WA1A 4OBXA 3QEOA 4FDMA 5FPYA 1P29A 1GGMA 2BP7A 2WSLA 1CZLA 2BBOA 3R40A 3RS5A 1MEOA 1P2SA 2GJ8A 2Q4RA 4HDCA 1VG1A 3V33A 1G5QA 2IU3A 3L01A 3KVNA 3L6OO 1KZHA 3SBOA 4QXOA 4Y9DA 4DWVA 2HPAA 4UQLA 3CQ9A 1HG0A 3HY4A 3BL8A 2PL5A 3CEHA 3SJ7A 3CR8A 2GYYA 4G24A 4V1CI 4MX8A 1N7GA 2G70A 2ZVPX 3ZE6A 4MHTA 3G1UA 3OMWA 4WQMA 3MAJA 1JI3A 4IXMA 5G0VA 3SKXA 3VR6D 5AVXA 1W46A 3A9UA 1QONA 3RHZA 2IYQA 2OWDA 4WLOA 3Q6NA 1LPOA 3V1KA 3SR3A 1G0NA 1N2BA 2EBFX 3FYDA 3TLBA 1UPTA 3PRJA 1BRMA 2GBIA 4Y9SA 1YRLA 2X7XA 2VOEA 4DCTA 7REQA 2W6IA 4NBTA 2B1GA 4IF6A 4L4YA 2ZRJA 2V6MA 4J03A 3PD1A 1C41A 3PITA 1Z06A 3OY7A 4WY5A 1I6MA 1L8XA 4TV9B 4BO7A 4BKOA 3PQ3A 4FT2A 2GUWA 2J33A 2OV3A 1SUDA 1K3TA 5EWLA 4MZXA 4HTFA 1YBVA 1FFHA 1P81A 1M1NB 2OCDA 2YDYA 3GVCA 5JNWA 2H16A 3BJZA 2ZI5A 4GMKA 5AJXA 3TK1A 3GRPA 4XQEA 4P32A 2GPSA 5LM3A 2XUZA 4UQPA 4OU5A 4DRYA 4QEDA 3G0IA 1KPGA 4TVKA 4CF3A 1VE9A 4DKXA 1Y5LA 5AIBA 1FUIA 3D81A 2XVYA 3Q1KA 2GPYA 1FSPA 2ZK7A 1Z74A 2QUIA 3P9CA 1Q1ZA 5DXAA 2AFHA 3H4TA 3T54A 1FVOA 1ID1A 3QEKA 3EPKA 2QX7A 4ZI7A 1WKVA 4YS6A 3GPBA 3L2OB 1ZC3A 2Q3HA 4YV2A 4NC9A 3ACBA 3ZQ6A 2A2ZA 2ZSKA 3H42B 3EDQA 2A5LA 1EQAA 1PWYE 4R1TA 4RTSA 4DY6A 4U2FA 3HCFA 4N49A 1JKIA 1YVDA 3DBOB 4E1BA 4YQEA 3SF0A 2FPLA 1GU0A 4RLQA 1BSVA 1X7WA 1TC2A 4TN1A 3TSOA 4DTIA 1QTIA 4MB0A 2RIRA 1MG0A 1TKAA 1UJNA 2YXEA 3H9GA 4J2TA 3EXIA 4RWEA 4FHZA 2W98A 1U0SY 2HA4A 3A3KA 3W5CA 3IBGA 2VDPB 1C7EA 3VO9A 3DE3X 3HJUA 1KVTA 3IQZA 4M3NA 4OLHA 2WSBA 3OWHA 3GLFA 2INGX 2OD2A 4Z5XA 1PR4A 2XTZA 4LUCA 3RANA 2C5SA 3C5WP 3AEYA 2ZZNA 2ZRAA 1F38A 3L7JA 2NZ8A 4KQJA 4MRPA 4OXQA 4PGGA 3T9DA 1H23A 1CETA 4H7KA 4ALMA 3F4KA 5CCXA 1QWSA 5AW9A 4DEVA 4FC6A 5CX1A 2XUGA 3OHPA 2M32A 1ZK1A 4JZKA 1ORVA 1T25A 1QHSA 4QPCA 3ZYCA 4ALIA 3A1TA 5MHTA 1K2VN 3SEAA 2NO0A 1EVZA 3B9PA 5AK4A 2HQBA 3NONA 3ANSA 4GPD1 3QY0A 4YO7A 4D44A 4F2WA 2IDMA 1E9BA 5FOWA 1H65A 1RFGE 5HZKA 3QFHA 4XLLA 1K9VF 2Z2ZA 4LF5B 1QKKA 2J7PD 1CRZA 2CVOA 2I7TA 1RYEA 3AG6A 3OJFA 4HC4A 2AIRA 4J0EA 4OA5A 5CB4B 3MUFA 1VPWA 3DOEA 1TCCA 2C3UA 1LDYA 1E5DA 4NU5A 4ZALA 3MCUA 1YMUA 1Y8QA 3LCVB 1CW2B 2CUKA 1IXYA 1QYXA 3H7IA 5GIOE 1AGXA 4RGYA 5K3EA 5FBQB 4DIFA 3IMKA 1H6AA 4QXAA 3RHFA 3ZXIA 1EEXB 1WLSA 1OXSC 5HBGA 4XCVA 3VU9B 2PUWA 5ADVA 1JG1A 5EMHA 4JBIA 5BMVF 1EZ1A 4X0EA 4LJ8A 2RIPA 2XDQB 3SC3A 2DQ4A 2J0VA 4IDNA 3QUTA 3ZWMA 4M7OA 4ACAA 5KI6A 3RAEC 3KAKA 5BWNA 3EEQA 1OR8A 5KO2A 1QDUA 3SFTA 4B9AA 3K4HA 1K6XA 3PQ2A 3GELA 1ZWLA 4G3XA 3HRKA 4BFUA 1DBRA 2AG6A 1QBKC 4KDFA 1IH8A 2D06A 1TEZA 1V3UA 2JJ1A 4HEA1 4IEIA 3MLAA 3S1SA 1N0IA 1GR0A 1BE6A 2YJ5A 4GSYA 2EZTA 1SXHA 3AF2A 1JIJA 1QYVA 2UAGA 4DDKA 3X1WA 2PVCA 2E5WA 3SM9A 5IMSA 3T1VA 3HA7A 1HUQA 1KGDA 1B6SA 5KYYA 4U6SA 4EJMA 2XDQA 5EMNA 1OH6A 2W70A 4J0KA 1EWTA 3K1YA 5C5IA 1IQRA 1GU1A 1GTZA 2OSBA 5CLQA 4N3GA 4BX8A 3DQZA 2WSMA 2FR8C 3LVFO 4MB6A 3UT0A 3ZR4B 3W6OA 3M6VA 4K6CA 3DXZA 3V4OA 4L27A 3I2YX 1U0EA 3V00A 2V65A 3DPSA 1QF7A 3CVJA 4B7XA 2WEKA 3JYHA 3N6XA 2W6ZA 1ACJA 4IHJA 3U0BA 2ANCA 2CBXA 4LXGA 1NDHA 1QAMA 3CKLA 2F4NA 3E35A 3QVLA 3QXCA 3FOFC 3RFXA 1OWLA 1PZHA 3KOYA 4LDNA 1T9GS 1WMDA 2VTKA 5TF0A 3ETEA 1R12A 1RU3A 1Q21A 1A9ZA 3DL0A 4HJXA 5FL7D 2OC9A 4YHHB 1NZJA 1A98A 2PRYA 1QGYA 3BKXA 1SOVA 3IAM1 1AKQA 2DWOA 2V4MA 1JDSA 1PS8A 5J4KA 4XJXA 2MSCB 1IHYA 1C1XA 1P3DA 1A5SB 3VBEA 3TZHA 1S9DA 3EEOA 2FEWB 3MJTA 2VBFA 5FWAA 3U7RA 4RDXA 4DA4A 2H6EA 1Q11A 2C4VA 2WFLA 3OMLA 4FDVA 4UUQA 2WJ4A 1ZIDA 2R97A 2C31A 2GNOA 1KEWA 3AEUB 1RCFA 3KJIA 4ZODA 4YV7A 3THYB 2K7FA 1DCMA 1LSJA 4RMGA 1Y7LA 3FPBA 3QUQA 3GLVA 4F1WA 2H9AA 1VJ1A 4X6LA 4L3VA 5ICCA 4EABA 1KHTA 2OZPA 5AK0A 2QX6A 4JJKA 4ND2A 4PS1A 1HYEA 3K6SB 1ISSA 1FTNA 4LJ5A 3I64A 5TEWA 3VX3A 1JHQA 2YFKA 4US2R 4ZK2A 4YP7A 2QZZA 3UJCA 2IELA 2Y8EA 5ALXA 3PUVA 1DO2A 3FLAA 3P9QA 5JPDA 3QIAA 4HMOA 3A4NA 3E9YA 1UT6A 2DHQA 2CXPA 2P6PA 3V7FA 1JRLA 4D5GA 3HYTA 3BMOA 4LZAA 1AQNA 2PKXA 2YWEA 3JQFA 3VH3A 1LRLA 1P4SA 3HJCA 3JQEA 4XB2A 1SRQA 1X1SA 5FBZA 1GUBA 4XXHA 5BQ5A 5DKFA 4PCUA 4B2YA 3PC7A 4OVKA 2UVQA 4G8CA 5B4VA 1I30A 4C0QC 2BEWA 4EUNA 3B13B 3UYLA 2HEGA 3B6JA 2H1IA 3QELB 4JC0A 5T64A 5K0LA 3L9WA 2FLVA 4W6ZA 1QGDA 4CXMA 2DT8A 2VPWA 4N6GA 2I33A 3DLIA 4OB8A 5IAKA 2P3LA 1W75A 2EQ5A 5FOVA 2PRIA 3IUQA 4PQYA 2A67A 2Q5OA 1Y6QA 5AHKA 2HRZA 4FCVA 1I0LA 5EWLB 2QENA 1SCAA 3EODA 3ILVA 3OZXA 1U5BB 1WUYA 3HFRA 4UPVA 3KOXA 3QM1A 1AS3A 1GFWA 1OYOA 1RADA 2C4UA 1VB5A 2FTKE 3PFHA 3QG1A 4LHSA 4MWSA 5HCUA 1X1QA 4JAVC 1I4WA 2FCAA 4GNKA 1RDFA 4QA9A 4BTVA 3RADC 3GCWA 2DX7A 3FWHA 3M5DA 1B8UA 1H9AA 4X63A 1RI4A 1VMEA 1QRAA 4YBZA 5FWXA 5KHAA 4DM4A 1QO9A 5FTMA 1FDRA 5LWQA 3HN7A 3FOBA 1LF0A 3JRWA 2IEIA 5EXSA 2FMFA 1NG9A 2ECOA 1UEJA 2WU3A 4IDCA 3FMPB 1JHZA 1PFQA 2YVUA 1EX1A 1OQAA 4GX1A 5EESA 5LMUB 1EHYA 3G1WA 3BRSA 3N3BC 1E2EA 3A1WA 3OCJA 4HF7A 4FHEA 1JT9A 2DPYA 3A1EA 3FMGA 5C35A 4QQRA 4KIGA 4PTZA 1WY5A 1ZOSA 3IHKA 2J0UB 3KL2A 4X90A 4XFDA 2NPIA 4I14A 1AKYA 3FCXA 4N0MA 2BFCA 2J9RA 4WK4B 1XDUA 5GZ3A 1FRZA 4WY8A 1HTBA 1NIJA 2JLAA 2DLCX 4HUTA 4Y1FA 1DKQA 2BGLA 3UJHA 2QTMA 1N2XA 2I4IA 1TT7A 3QWAA 3PP8A 2KBFA 4TTAA 4TWRA 1MNQA 4B6PA 3WMWA 5JLJA 1A7KA 2JK1A 3ZI7A 1JDBC 1BHJA 4Z3KA 3TSCA 2CLKB 2WM3A 3B3GA 1R0YA 4NPHA 1AUPA 4PX3A 1J0EA 4IYJA 4BLQA 5IAAA 2P9ZA 5DYWA 4KQXA 1TGYA 2QZSA 3FDIA 1Z0DA 3EXHC 4H6PA 1UBFA 1KC3A 2PUHA 1NBMA 2RGNA 4O2RA 4YPFA 1M5RA 3TZKA 3HBNA 2ZETA 4CMAA 2PKQO 3W04A 2UZ3A 4G0VA 4P38A 5E2AA 4ZU1X 1CVRA 2Q0QA 3KBBA 3O3OB 3DZ8A 1M1UA 3IT1A 1RPJA 2B7LA 2EYQA 5FNZA 3EBLA 3NWBA 4R9NA 2WAMA 4HUQA 2BHTA 4I55B 3SOZA 2CEKA 3BJRA 3NYIA 3SHTA 2BMVA 4AY2A 3NGMA 3SXUB 1R4AA 5HJ5A 1P9WA 1SC4A 3HV0A 1Y82A 1B8PA 3CE6A 3RKUA 4B3FX 4D42A 3W06A 1Y3FE 4C5BA 1RWQA 3K0BA 1Q16A 4M9QA 5F3DA 4DDWA 3JVUA 5T5QA 4V39A 4JITA 1I7QB 4X6YA 4OLJA 2BTOA 2H54A 3DOJA 4ITVA 1ZIOA 3LBFA 1KYVA 4YK7A 4EB3A 4DWJA 4TYMA 4BYMA 4CUJA 4GWKA 1OW3B 4UHBA 3K9HA 2JGNA 4PYMA 3UFXB 3AO0B 1ZA2A 1JN0A 3GIWA 1HQYE 2WJGA 1PZXA 4K6HA 3RH0A 2H07A 3AP3A 2QN8A 1IK6A 1GGEA 3H5LA 4AS1A 1Y9EA 4JIMA 1GYQA 3H0CA 4O2AF 4OFWA 2AOUB 2PBZA 4RCYA 3EVDA 1UXGA 1WAMA 3MBOA 2IY9A 4MGKR 5GV8A 2C82A 1G3UA 3D8NA 4FB5A 3PT9A 3HFJA 4QDOA 7MHTA 4ZI2A 4BRZA 4TMYA 1GCOA 2BMDA 2D3WA 2ZYAA 3HWSA 4LJYA 4E31A 5C5CA 2F3TA 1L5KA 3LRPA 1DKRA 3QOFA 4UQOA 2N0SA 2VAVA 1TM4E 2EP5A 4IDAA 2OV1A 1SQFA 3S2UA 3NASA 1NBOA 2DRIA 4KNVA 5KYUB 1XT6A 2OB2A 1AZSC 1SR8A 3D8BA 1WXGA 4FGWA 3BERA 3PUHA 4K9LA 2QE7A 4LK2A 1RKBA 4X7PA 3I61A 4C2TA 5BUCA 3AVTA 2ZJ5A 2C29D 3VPDA 1NYLA 4FCWA 2UYHA 4NFSA 3FYCA 4RD3A 3WTBA 1USUA 3PC2A 3QLVC 2VZLA 3MBKA 1OOEA 1XTZA 3P4XA 3O0TA 4U2EA 2Y3IA 2P35A 1VPEA 3DCNA 4JL6A 1DADA 4LDPA 4CCWA 4L8GA 3AI3A 1MVNA 4MYDA 5KOYA 3LNTA 3AJEA 2HQRA 4RX1A 1QV9A 5ALMA 5HF8A 5TE9A 4WPGA 1DHRA 4V0RA 1N1EA 2R6FA 2C9MA 3TL3A 3L82B 5CFLA 3UJ9A 5FTKA 3WLSA 3EHDA 2SKDA 3OIFA 3QTBA 2OYSA 4M99A 2I34A 3O3NB 2WILA 3CLTD 4JGIA 3WNCA 5CFQA 4KZPA 1FVFA 1M2VB 4OKNA 2NP6A 2C9ZA 2FPWA 2H8KA 3E7PA 1Z13A 3ETLA 3FE2A 4MWGA 3CLRD 5SY9A 2NU9B 1FE8A 2GPWA 3AGQA 3HLKA 1ZCBA 3UK6A 1TJ4A 2IZ1A 3CSDA 4G9GA 4KR0A 3Q8MA 1W49A 3FF1A 2JCGA 3H9UA 2C78A 5J2UB 3GL9A 3Q3EA 3MELA 4RACA 1S4MA 2FRDC 2V7TA 3O47A 5FQOA 3WNQA 5EERA 4BZPA 2FFBA 4J9VA 4PFKA 4I7EA 1N6RA 3PBKA 2X1HA 4MDYA 1XEXA 3T5AA 1V8PA 4N41A 2QRHA 4F84A 5C1IA 4BFYA 4H1WA 2W6MA 1E20A 2Q0XA 2ZUUA 3B9BA 3DP7A 1R5JA 1RRGA 3Q4GA 3Q72A 2FEOA 4JEUA 1IZ0A 1T8RA 3CWCA 3AK4A 2CNLA 1O0SA 3AM3A 2HGZA 3MWLA 4JOSA 5LQRA 5FLXA 3HXMA 1XCLA 4AUKA 3KJGA 1GSHA 3AFMA 3OOSA 4KXLA 1Z2OX 5JWOA 3FPHA 1T43A 1N2HA 3UJPA 3DLAA 5A7FA 1WMSA 1WABA 2JBAB 2V3WA 4Q1CA 5L4SA 4UJ5A 1DBIA 4OYRA 5IT5A 1RVDA 2BONA 2GZDA 2QAGB 4FYWA 2A0UA 3WIEA 3HB4X 2FPPA 3UB2A 3UT6A 4EFMA 4EITA 1KEEA 3AVVA 4A4DA 1Z0FA 3C7AA 4G0OA 2EL7A 1W2HA 1W7AA 3C3BA 5NULA 4L6IA 5CXXA 4F8YA 1EK1A 1PR2A 3NDRA 5DNDA 5F1KA 3M6LA 2R8RA 4QJBA 1TPZA 2ZI7A 3CPHA 4D9KA 3I23A 3BTSA 1MHTA 3JYLA 3DQPA 5JAUA 1MH9A 1E7SA 4C01A 5H8WA 1O0BA 4R2HA 3W77A 3VH4A 4TXNA 3B1KA 1SVLA 4C6HA 1GG8A 3A37A 3NBZC 4IFBA 4IDQA 4URHA 1NUQA 1SQ0A 5ILGA 4B82A 4BC1A 1XEXB 2QVYX 3WWEA 3OEHD 4KMMA 3K20A 3OX2A 1P0PA 2J3LA 4KXUA 1TU3A 4K87A 2HJGA 2NUBA 2HC9A 1U94A 2O1WA 3FN4A 4BGEA 3FSRA 3M6FA 2IKSA 2W2OA 4L8VA 4X54A 5FWDA 3QVWA 4QLBA 2W2QA 3SF8A 1GEEA 2YRWA 4HPXB 4N3CA 3MVEA 2NPFA 3LBYA 1GARA 3P27A 3SMQA 4D8VA 2HXYA 2BUBA 4M49A 4YP5A 5GZ1A 4GW3A 3EOBI 3QXSA 3LIPA 2QSYA 4RHTA 4FUTA 5DX0A 5LCXA 1STOA 3F8WA 3PSAA 2O3TA 5EQDA 5KYUA 1BWSA 2C2OA 3DBRA 4NOJA 4K9DA 3OZTA 1U63A 2O0KA 1NFRA 2HHLA 5CRIA 2ODBA 2JDID 2E2WA 2J41A 5CMLA 4I46A 1MHPA 1WD5A 2FPMA 2P2YA 1KJ9A 2QLLA 2XYGA 3EW7A 3IVGA 5D7NA 1QF9A 3II6X 4K9NA 3FPCA 2YXNA 3KXIA 3OBBA 1PZFA 4B46A 1WXEA 4RE5A 4J2OA 2QTWB 3FCUB 2H1HA 4PQRA 5K4GA 3IP8A 2GA8A 3RS0A 4D8TA 2VKQA 4J90A 5JS7A 3UQYS 1RXSA 1NZDA 2H08A 1NRWA 2OO5C 2G77B 3V9AA 1NW5A 3QE9Y 1B26A 3NCHA 4NBLA 3H16A 3QYAA 5A5VA 1V1JA 2R7AA 3RG8A 1UK8A 3B53X 2Y71A 5ARBA 4KDCA 4KQGA 4XGNA 2I6XA 6YASA 2VP4A 2Q07A 1NTOA 4I9UA 4ZVNA 4B1FA 1KMIY 2OP1A 4O4IA 1XKXA 3FWNA 1FFCA 2XF8A 5JJIA 4NYIR 2ZWVA 1CR4A 2EKZA 3AR4A 1KRHA 5LQAA 4FP9A 1OLXA 2XCOA 1MVOA 5CEJA 1FP1D 2GPTA 1RXVA 4L50A 4RYDA 2Q5QA 4RK0A 4CM3A 5AUNB 3CZ5A 2JLWA 4FS3A 3OEEA 4RLSA 1I2CA 1L5NA 4OYHA 5HIMA 2A9KA 5BN5A 4R1QA 4ZFNA 4YWJA 2NVBA 5CA1F 4ZCSA 3QVGB 3GZJA 4MQEB 2GCIA 1QQAA 5KTTA 1J9ZA 1G8FA 3TW4A 2FWBA 1NUTA 4DJDC 2J9YB 4LRQA 4MIYA 3VPGA 2FN8A 4R7TA 4FGJA 5TC4A 3JVDA 2G06A 5BQOA 3VZDA 4L2IB 5LP6A 4J6FA 1DIOB 1A71A 2H9YA 4ZOLA 3O03A 1T9ZA 4BAGA 2C8VA 2JEYA 4CIBA 1ZLXA 1S6YA 2JFQA 4L5CA 4WASA 2V9CA 3T3DA 4QOFA 1G3QA 2VUUA 4R01A 4ZVLA 5TPWA 3QWIA 1DDOA 2XAAA 1F8GA 2VSOA 2YVLA 1EGMB 3FTNA 4FINA 4EB0A 1CYEA 3OMXA 4YCCA 1JAIA 5IKEA 2FZGA 1MT0A 1ATZA 3RVLA 2CHFA 2OV2A 1ENZA 4LF9B 1X3LA 4EY4A 1ELOA 4ZAXA 2VHZA 1J0AA 3G0OA 1X1EA 4FZVA 4Q0MA 4CQNA 1VC2A 4C89A 5CVJA 3E22A 4ZVMA 1ZJ4A 2JFNA 1X7YA 2Z5VA 3DTVD 5BUSA 3WRXC 3B6MA 4I3FA 2DBZA 4YX9A 3PJRA 1N6LA 5G1PA 2TRSB 3C16C 3WK6A 3Q7SA 3T7RA 1PX0A 1EUDA 1U9YA 3BSFA 3QX8A 1VI2A 1K92A 3RTCA 2ECFA 4AJ2A 3GFGA 1G3MA 4CQMD 4BO9A 1OSNA 2O06A 3LZDA 1T8PA 2AWNA 2C77A 1FB5A 3A0UA 2ZRLA 3NT2A 4LAFA 4RADA 5CA0A 4O1MA 2Q4TA 3P0EA 4Z3DA 3WIDA 3VYVA 1JGTA 2PRZA 2ZWOA 1Z29A 3JQ9A 4EVIA 3DE5X 1MG5A 2JGIA 1JNXX 3EJ6A 3OOYA 3ZCQA 1NATA 1UADA 4L0QA 3C1OA 3HNOA 4G0XA 3B1VA 4A8JB 2OBXA 4TN5A 5FYQA 5HUHA 4ZZ3A 3INTA 4IIEA 1SCBA 1XMXA 4QTYA 4LVOA 3TW8A 3RCBA 3SVLA 4HDMB 1M9NA 1BWPA 4Q19A 2R5FA 5CNMA 5HFAA 4Y67A 5HQTA 4EYGA 1N3LA 1J22A 4URZR 3V55A 1NRJB 5DTEA 2ODPA 3TRKA 2HHJA 3LQQA 4Y1RA 1ZXLA 1UC5B 1W34A 2GQ0A 2BCEA 1K88A 2VP6A 5FV4A 3ZU3A 1KMQA 1RQPA 4RGBA 2CXOA 1ZCZA 3QHPA 4RJJA 1XTVA 1TUGA 4U7JA 4M9UA 4ENTA 4EEZA 1SHLA 2QI9F 3PL5A 4U2GA 1QQBA 2YV3A 1NKTA 2W4IA 3H2JA 3PPYA 2GK3A 2B4QA 2OOSA 1CUVA 2CN1A 1JHVA 1P7ZA 1MIHA 2XD4A 3JD4A 1YTLA 4UM9B 5B57C 4JJ7A 4GKVA 2IX3A 2BAGA 4UHCA 4HWKA 4JI8B 5FR2A 2ZUDA 3JQAA 4FFOA 4FFVA 4FYJA 4PSVA 3QOYA 3QPVA 2IY8A 4DUZB 1N2IA 2ZUEA 4KEAA 4YRFA 2ST1A 4WERA 2O8BB 4ZU3A 4MXDA 4BMOB 5JAHA 3ZK8A 1LQUA 2A57A 1N2CE 1LTHR 2DPMA 3PVSA 4JB0A 3QPWA 4HXEB 1CUSA 4GBJA 2JEOA 2L19A 2W58A 4A03A 4DB4A 3L49A 5FUXA 5GZ6A 4AXBA 1BE1A 4MUBA 3GHYA 4IH4A 5JQGA 1QPZA 4UZSA 3LC1O 5BSUA 1WW2A 4F38A 2QVCA 4NS1A 5KPJA 3LDGA 1L8AA 1O58A 4KKVA 1B0PA 2BEVA 1LW7A 3EXAA 2ZSFA 2NZ2A 4OHFA 4W1RA 4A0FA 1X74A 2R4QA 4B74A 1IZYA 1A2QA 1ZN2A 4WE3A 4I1PA 4KFCA 4TQ9A 5AICA 4NNPA 1RW4A 3U3ZA 1VKRA 4PSDA 2OXRA 4KQWA 4JBNA 2D3TA 4KRXA 3O4VA 1GVHA 4Q15A 5M7EA 2UYCA 1W73A 1PK7A 1XZCA 4MVJG 2IRWA 2V7WA 5EN4A 1GGHA 1KI1A 3E9EA 1MB4A 1DRVA 1VA5A 1M8JA 2QGZA 3CEMA 1GCAA 5EPUA 4ENQA 4EA7A 3F98A 3G9TA 1K7SN 1KYZA 2ATVA 3ROFA 3UHJA 4FFLA 3WL3A 1HDRA 5CFPA 5SYAA 4MJ7A 3DGEC 4MQLA 3A3OA 1PJ4A 3KQTA 5DMXA 2IPMA 1NJ5A 1QCCA 3KT6A 4P4TA 2YN0A 3QU4A 4GOKA 4ZANA 4AO6A 4NMMA 1BKSB 1NQ5A 1OX6A 4KR3A 3FI9A 4LRSB 4W99A 4TMZA 5B3JC 1HE4A 1LDBA 2WUWE 1JHYA 1NONA 1CP2A 3ZWXA 3B6EA 1QUEA 3BMQB 1CF9A 5ALRA 5AXBA 2G5PA 1JAXA 2FUCA 5KVVA 3FJ1A 3ZWWA 2GN9A 2NU8B 4ND1A 5I6DA 1KTVA 4M36A 4W5OA 2XQIA 3M82A 2KYRA 2WT4A 3VOSA 4DCGA 4F6RB 1XNGA 1NC3A 1KP3A 3GFFA 3IOBA 1KQOA 5AW5A 2FU5C 1VCNA 2OCPA 4OHRA 5EVCA 4YYZA 2VTDA 2XE6A 3B52X 2H1FA 3QP9A 4J7AA 3KQUA 1BJRE 2JIBA 2VUTA 1E69A 3NX4A 1KFBB 3GRRA 1QRDA 3R5KA 3REFA 2RGEA 4K9QA 3WBJA 4QUAA 3VRHA 3PQDA 4JJIA 4EGFA 4PZDA 3F3KA 3U4HA 3HC7A 4BVJA 3DF7A 3ZLTA 5GV7A 1FRFS 5KJFA 2I87A 3G6KA 4W9RA 4K28A 2J6BA 4QULA 4YDRA 3DVSX 5C32A 4CLOA 2OHXA 4L5IA 4MO9A 1PFGA 1VHWA 1G5TA 3N87A 3C2QA 3RUPA 6PFKA 3VKHA 5D6NA 2QTHA 3SR4A 4MEJA 3T99A 2F3SA 1G0OA 4AP5A 2RK6A 3I6YA 1B0ZA 2GJSA 1Y5NA 4INPA 2CYBA 5MGBA 2J9FB 3O9VA 3IERA 3UV6A 3AF6A 1X19A 1RS0A 5KWSA 1F4LA 4KK4A 2RH9B 4MB2A 4TXJA 2QAGC 3HU1A 5E8RA 3ETJA 3BN3A 1TM5E 1B42A 1NBME 1X87A 2AW5A 4MHSA 3FZQA 4Y3UA 3W8FA 2GXUA 3EDRA 3N8DA 4JLDA 4POAA 1XSEA 4GI3A 4JS0A 4PZPA 4Z2YA 3KHUA 1XEAA 4PZYA 3TQCA 1ZHHA 1TKRA 4U5QA 5FOQA 2LKDA 3KLMX 1JFLA 3I6ZA 4ATNA 1EDZA 3JZMA 2VAPA 3T7EA 1SURA 4H7PA 2OP0A 1USKA 3O1LA 1E32A 1YS1X 4RVHA 5EYPA 3QBJA 1XLTA 4KNYA 2PSDA 3NZEA 2QYOA 2UUBB 4L9WA 4NAUA 4F2PA 2ZYVX 1OBCA 4UMEA 1GKYA 5B7PA 1TQHA 1L5GB 1FJ2A 1Z5OA 3H6KA 3LUGA 3V8EA 2Q5EA 5CJJA 3SKVA 4JENA 3I2HA 4DV6B 4EFDA 1Y8RA 3WIUA 2NZYA 2GBCA 3ZJ4A 2HSZA 5BOVA 2HMVA 3OJEA 2C2XA 1N2ZA 4DABA 1ABFA 3QSGA 3R3VA 4ZPJA 1DXHA 1BCSB 2A9QA 3HXPA 4ZTBA 4DQKA 2X4GA 4NVRA 4Q48A 3HEBA 4YP0A 10MHA 1CS0B 4YMLA 1WMBA 3KWFA 4M0UA 2R1UA 1RE1A 4MGYR 3WLEA 1E89A 1ZJWA 1J0XO 4P0QB 2E4YA 2WD7A 3AESB 3DAYA 4DIOA 3G0DA 2VSQA 3AHDA 5K01A 4O6VA 1WLYA 2C4TA 1Y33E 2H2AA 3AT1A 4R1OA 5GVSA 4JR2A 4A0HA 2V0CA 4I1SA 4L7QA 3T1YB 1L5QA 3B8EA 4BUCA 1XA0A 4GRAA 1E2GA 1T29A 5KBYA 3E0XA 4HMPA 4XD2A 3R0IA 1JMKC 2AN4A 2FUNB 2E18A 4M0LA 5EZYA 4DLPA 3PEVA 5DBFA 5BSMA 5B4TA 4AKGA 3TIVA 4EJSB 2R62A 4NDZA 2Q6OA 4ZHQB 3TEFA 4NYJQ 3UUEA 5GGYA 3R76A 2HFJA 2ZT6A 1TZMA 4G97A 3ZHZA 3IE1A 3CNLA 3UOAB 1Y6JA 3ZWYA 3AB3A 1N5IA 2ZYDA 3WA6A 1YVUA 4QBHA 4D8UA 2A78A 4O4IF 2H48A 5CW1A 4YRNA 2FKAA 3E0QA 4HBZA 4H7DA 4R8VA 3V1YA 3ZLVA 5KJCA 5KQGA 1D6MA 3FWPA 3FFTA 1UFVA 3IUYA 3VJKA 3HJRA 2V6BA 4WEOA 1RJGA 1T2AA 2VT2A 2WABA 4B80A 1GNSA 3BL5A 3LUDA 4RF4A 5EXXA 4DSTA 4E4TA 3DMRA 3G2JA 3PNYA 4D4JA 4U02A 1HEIA 2ORIA 3D2LA 1M5TA 2HY7A 1RJ9A 4H16A 2QL9A 3DYIA 4K86A 2DSTA 1N0UA 2IEZA 4QDJA 1AC5A 2IEBA 4BQFA 1QGUA 1CNEA 1Z26A 1ZOIA 1UL1X 1CZNA 1PE0A 2G3YA 1AO3A 2R60A 3NFRA 1ZMXA 3I9NA 3RVDA 3SZUA 1HGXA 5HXAA 1SWWA 1T5HX 3OEHA 4ZOLF 4B6GA 2XYRA 4HAVA 3L46A 4FOOA 3WBKA 5KOIA 1NUUA 5C52B 3PEUA 3PTZA 2WIBA 4B8YA 3GJYA 3Q7PA 1N8NA 1RKUA 1XA3A 1GDTA 2J46A 2W2TA 3GDWA 3R8CA 1GA1A 2ONKA 4G56A 4IX1A 2YRFA 2PBFA 5M04A 1I36A 4PSAA 3TCXB 3GVHA 5FULA 1KFEB 4DLNA 3C1UA 3U19A 1JG3A 3G5LA 2GTHA 1CB7A 3SQDA 3EGCA 3AVXA 1Z7BA 2J6HA 2RGNC 4ZMSA 4N7RA 5ABPA 1NUPA 2Q8QA 3SSAA 3ZJYA 5BURA 5ESWA 1V5EA 2BI4A 5AUPB 2FUEA 4RTMA 3QE0A 3ANNA 1S2LA 2PVPA 2RK4A 2XYVA 3BHMA 2FGKA 2OMKA 5AHRA 5DIFA 3U13A 1MZPA 1VCMA 1TGVA 2XCIA 2I78A 1T4MA 4ZAZA 2QB5A 2HAEA 3LH5A 3RRNA 3LUAA 1TOAA 2QVZX 2Y1KA 1AGNA 2ZAOA 4RNDB 3QKUA 1T3LA 5IWCA 1P2UA 1BN6A 4KQ1A 1FIUA 1GTJ1 1QFYA 3SJZA 2O2JA 4PCAA 1RRMA 4IZOA 4L72A 5I7RA 3CW2A 1RIIA 4X61A 3N07A 1KMNA 1FJHA 2ODEA 5LDGA 1R8SA 2C9DA 1TQDA 4LQDA 3A4VA 3ROZA 2JA1A 4I5IA 2GYWA 3E22B 4MYSA 1U5CA 5BWCA 2AN1A 3HCPA 3FCOA 3MTJA 5JPIA 3ZVMA 4EY8A 3UW1A 3N2KB 1ZVMA 2WZBA 2AX4A 2X5NA 3F7TA 4R1SA 4UVIA 4TS4A 4BKRA 4L5YA 3T61A 3IR7A 4EATA 1MLDA 1ZZEA 3QVGA 5M3BA 1V3TA 1WHSA 2FG6C 3KPJA 4J0FA 4X3CA 5TRTA 1ND6A 2JIQA 4Q37A 5DPMA 1FJGB 1E7WA 1SXJB 3NFYA 3OH8A 1PU2A 3F47A 4NE7A 3WLTA 5BOSB 1TZBA 1QXSA 4BX9A 2DUNA 2C20A 2GEFA 2EG5A 3BDAA 3D59A 3KZKA 4FZ3A 3KCNA 3I9V6 3M9WA 3OIWA 4P0TA 4RCZA 5I3ZA 1MOPA 1SCUB 2X8JB 2Z3WA 3HCOA 4RXMA 1E94E 2P4UA 3F78A 4B87A 1L5OA 5KTPA 1XMSA 3SXUA 3ZZUA 3ROXA 2ZAGA 5HM6A 3AVYA 3H6HA 4I4TF 4TYPA 4CLDA 1PZMA 5I7HA 3PNMA 4HXFB 4YRMA 2APJA 4HWSA 2ODQA 2P3OA 1PYGA 4BCBA 5ALHA 1QIIA 1KZ4A 3F9CA 1B8OA 4N01A 4X3OA 1L7RA 2ZRPA 3F97A 4ZVOA 3UH0A 3ZHCA 4EJ0A 2GPJA 1L5ZA 2SBTA 1MBZA 4PVDA 2Z9BA 1AHIA 2QX8A 1H2FA 2IITA 1CEYA 2Q5JA 4QGFA 1RAHA 2N1BA 4UMFA 1TTTA 3K6SA 3HUFA 5LMNB 3V7UA 1MJGA 3ESQA 3MWFA 1WCIB 2ZR0A 4YQYA 1TQ2A 4FN4A 2C8KA 5ITZB 2O19A 3CW9A 3R74A 2E55A 1OIXA 2WYUA 3LWNA 4PZLA 3WR5A 4CETA 3HDHA 3U0VA 3M34A 2E4UA 3UXMA 1Q17A 4B83A 5JZSA 4UTVA 2RONA 3IXLA 4FX2A 5F2OA 1OT5A 2F1JA 1TM7E 1ZITA 4FR5A 2XKKA 5FO1A 2R4UA 1EWRA 4FIDA 3BJIC 4F93B 3W5JA 1EE9A 2XCLA 3MHPA 3AONB 2A0XA 4UZEA 2XXJA 4P36A 3ESBA 4AG3A 2ANBA 2PD4A 1WPQA 2QMQA 1FL9A 1KFCB 1WPXA 3BCSA 3NAZA 2BL4A 3GFQA 3OBIA 5KVQA 2XZTA 3VTFA 1XELA 4EW3A 5MGNA 2PANA 1PT6A 1SUPA 1R9MA 1Y3IA 2P2SA 2HMUA 1DDGA 2V96A 3FJOA 3KDAA 2IK8A 4HQ6A 1LB1B 4IZIA 4R3UC 2FSVA 3KE8A 5K3AA 1QZZA 5COQA 5IJ0A 3UHFA 4WXMA 2XRZA 2EQBA 2CLHB 2YMQA 5CLIA 4R3WA 2FFHA 4QYXA 3UJ7A 3VVMA 1AA6A 1MC4A 5ERGB 1NTRA 4TTSA 5LSAA 3F1LA 5JW6A 2IXBA 2EKQA 2IPLA 3D6HA 4HLCA 5AJVB 1D07A 2EIXA 2Z83A 3UPUA 2X3FA 3PFBA 3HJFA 4LQ4A 3SSOA