4N43C

Human enterovirus 71 uncoating intermediate captured at atomic resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
236
structure length
223
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Human enterovirus 71 uncoating captured at atomic resolution.
pubmed doi rcsb
molecule tags Virus
total genus 28
structure length 223
sequence length 236
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n43C00
5L7OA 1QJY2 1R093 5CFCA 4WM8C 1AUYA 1EV13 3VDDB 4RS5A 3J8F1 3FBMA 4RR3A 1QJX1 4IV1B 3JD71 3ZFGB 2IZWA 2RS13 1BEV1 1QJX2 5ABJA 1FMD1 2GSYA 3JB8A 4WM7C 4JGZA 1TMF3 3JD72 5C9AB 1R1A1 1F8VA 1ASJ3 1BEV2 1OOPA 4CEWC 1C8NA 3CJIA 1AR83 1R091 4YVWA 1NOVA 4CEYC 2RMU1 4CDWB 1QJZA 1EV11 3S6PA 2X5IA 2DF7A 5L7OB 2FZ1A 1B35A 4CDUB 3ZFEB 1X36A 1R092 1E57A 1BBT3 1EAH3 1EV12 2RS11 1NCQA 3VBHC 4FSJA 4RHV3 1TMF1 5JZGA 1HXS3 2RS12 5A33A 1ASJ1 1MQTA 3DPRC 5A32A 3VBUC 1NCRA 1TMF2 2R043 1ZBE3 1ZBA3 2ZTNA 1ASJ2 1RUG1 3VBRC 2HWB1 5BNNA 5AC91 1ND2B 1OOPB 1AR82 3VBSC 4QPGA 2PLV3 1EAH1 1PO23 1RUD3 1POV0 2HWF1 1RUG2 5AC92 1B35B 1F2NA 4RHV1 5CFDA 1HXS1 4RQPC 1EAH2 4RFT0 1NCQB 3HAGA 4RHV2 4YVSA 1AYM3 1HXS2 1RUE3 5JZGB 5BNOA 2WLPA 1MQTB 1AL23 5D8AA 1BMV1 1NCRB 2PLV1 1ZBA2 2HWE1 1PO21 4N43A 3ZFFB 2BPA2 5BNNB 4BCUA 2PLV2 1PO22 1VBC3 4CDXA 1FOD3 4CDQA 4GH4A 3VDDC 2RM23 4IV1C 1AYM1 1RUE1 1VB2A 2WFF3 3ZFGC 4LLFA 4GMP0 1AL21 1VBB3 5DDJ3 1MEC3 1AYM2 1RUE2 1RUI3 4QPIB 4AEDA 3IDEA 5C9AC 1AL22 5D8AB 1ND3A 1FOD1 4CDWC 3J8F3 1W39A 5L7OC 4CDUC 3ZXAC 3ZFEC 5J96B 1FOD2 5BNPB 1BEV3 1VBB1 5DDJ1 1X33A 1FMD3 5C8CB 1RMU1 1R1A3 2FZ2A 1VBB2 1NG0A 5DDJ2 1MEC2 1RUI2 1GFF2 2BBVA 1RMU2 2RMU3 4Q4W3 2GH8A 2XBO3 1VBE1 1VB4A 1QQP3 4EJRA 1ND2C 1OOPC 1VBD1 2HWC1 1RVF1 1POV3 1NA1A 1VBE2 3J8F2 2RR11 5ACA3 1B35C 1VBD2 1WCDJ 4IV3B 3TN91 4JGYA 3NAPB 1K5MA 4PDWA 4GB33 2R071 1FMD2 1NCQC 2R061 3TN92 4Q4W1 1R1A2 2XBO1 5K0UB 5JZGC 3VBFA 1RUG3 2HWB3 5AC93 1MQTC 1QQP1 2RMU2 4Q4W2 1POV1 5GKAC 1NCRC 5CFCB 2XBO2 2HWD3 3ZFFC 4RS5B 2HWF3 4RR3B 4WM8A 5ACA1 1QQP2 2MEV3 5BNNC 3JBG3 2RS33 2QQPA 4GB31 5ACA2 5ABJB 4JGZB 4GMP3 4WM7A 4JGYB 2BFUL 1FPN1 1PVC3 4GB32 4PDWB 5C4WA 3CJIB 2HWE3 4YVWB 4CEWA 2HWD1 1C8M3 4QPIC 1VRH1 4CEYA 2X5IB 1FPN2 2HWB2 4Q4V3 1RUC3 2MEV1 1DDLA 5D8AC 3JBG1 2RS31 2HWD2 2HWF2 2MEV2 3VBHA 3JBG2 4GMP1 2RS32 5A33B 1PVC1 5A32B 5BNPC 3DPRA 5C8CC 1D4M1 1C8M1 4SBVA 1PVC2 1VAKA 4Q4V1 1RUC1 1BMV2 2HWE2 3VBRA 4QPGB 2WS91 1D4M2 1C8M2 1PO11 3VBSA 1RHI1 4Q4V2 1RUC2 1R081 5CFDB 2WS92 1OHFA 1CD3G 4RQPA 4YVSB 1H8TA 1RMU3 4IV3C 5BNOB 3NAPC 4Q4Y1 4N43B 5FMOL 1VBE3 4N53A 5K0UC 5LK7B 1RUF3 2XPJA 1PIV1 1VBD3 2HWC3 4FTSA 1RVF3 1AYN1 2BUKA 4CDXB 5CFCC 4CDQB 1V9U1 4GH4B 2RR13 4RS5C 4RR3C 1QJU3 3VDDA 3TN93 1RUJ3 4IV1A 1PGW1 1V9U2 1RB8G 2R073 3ZFGA 4FTEA 2R063 1H8TB 5ABJC 3JB4C 4AEDB 4JGZC 4Q4X3 1PGW2 1IHMA 1RUF1 4JGYC 5C9AA 3VBOA 4PDWC 1ND3B 1M06G 1TME3 1VBA3 3CJIC 1SMVA 4YVWC 2TBVA 4N53B 1RUF2 1OPOA 2X5IC 1QJU1 4CDWA 2HWC2 1RVF2 1RUJ1 4CDUA 3ZFEA 1CJDA 2RR12 1HQNA 1QJU2 1RUJ2 4Q4X1 1HRV1 1FPN3 2R072 2R062 1TME1 1VBA1 3M8LA 4Q4X2 1VRH3 1HRV2 2RS53 2ZZQA 5C4WC 3VBOB 1TME2 1VBA2 1RUH3 4QPGC 1ND2A 1NA1B 2WZR3 5CFDC 1K5MB 1AR93 4YVSC 1D4M3 2ZAHA 2RS51 3VBFB 5BNOC 4NWVA 2WS93 1RUH1 2Y26A 1PO13 1VRH2 2WWSA 2RS52 4N43C 1RHI3 1AR81 4WM8B 1HRI3 2VQ0A 3ZFFA 1R083 2WZR1 4FTBA 1RUH2 2BFUS 4CDXC 4CDQC 1AL0G 4GH4C 1BBT1 2WZR2 1AR91 3VBUA 4Z92B 3LOBA 4WM7B 5C4WB 1BBT2 1AR92 4CEWB 1H8TC 4Q4Y3 4AEDC 4CEYB 1Z7S3 2R041 1ZBE1 1ZBA1 1HRI1 4QPIA 1AR63 1PIV3 1ND3C 1AYN3 1PO12 1RHI2 1V9U3 2R042 1HX6A 1ZBE2 1HRI2 4N53C 4Y4YA 1R082 3VBHB 1RUD1 1A6CA 3DPRB 1AR73 1RUD2 5BNPA 3VBUB 1Z7S1 5C8CA 1COV3 1AR61 3VBRB 4Q4Y2 1QJY3 5J98B 3VBSB 1Z7S2 1AR62 1NY71 1PIV2 3VBOC 1AYN2 1PGL1 4RQPB 1NA1C 1NY72 1AR71 1VBC1 5FMOS 1QJX3 1PGL2 1HRV3 2RM21 1COV1 4IV3A 1K5MC 3JD73 1AR72 4Y5Z0 1VBC2 2WFF1 5FOJB 3NAPA 1QJY1 2RM22 1MEC1 1COV2 1RUI1 3VBFC 4NWWA 5K0UA 2WFF2
chains in the Genus database with same CATH superfamily
5L7OA 1QJY2 3AMMA 1XYOA 5FZMA 3D5OA 1PMHX 3IB3A 3TRSB 5L19A 5DPNA 3UGFA 5AVPA 5CFCA 1H2NA 1OFSA 4ZXEA 4RS5A 3TEZA 5IVYA 3GBFA 3KT7A 2WNVC 4L97A 1IZ3A 4P9LA 4TXWA 4BQXA 1BK0A 2CV6A 2ZZJA 4LBMA 2XJUA 4CCKA 3WDVA 1SFYA 4TYSA 4PQ9A 2IZWA 3TEWA 2VTFA 4MGIE 3S0MA 1ZX5A 4OQ8A 3D82A 2VCMA 1LENA 4XF0A 5ABJA 4BK4A 5FPVA 5C5UA 2CAVA 4LUMA 1R1A1 1GP5A 1HV1A 4HMZA 1IKPA 1SLAA 1GSLA 3HQXA 3B5LB 2BVVA 2AYHA 2ZKLA 5F3EA 2YBSA 3MIBA 5AFBA 1QJFA 1C8NA 3CJIA 2P6CA 1AR83 5T5LA 4XTPA 4EZHA 3MUZ1 2DUOA 2RMU1 3TBDA 4AEKA 3ECQA 4CCMA 1EV11 1POQA 3S6PA 3T3YA 4XETA 2QNKA 3VD9A 3ELNA 1JH5A 1B35A 1FV3A 4AFDA 1SLCA 4U2AA 2VTXA 4UBHA 5A1LA 4BM8A 2QFEA 4K7JA 1ENQA 1BBT3 1DLCA 3GZAA 3A4UA 1NCQA 3BGAA 4ZS2A 3J7MA 1ZRFA 4I09A 2VBDA 5JZGA 5I93A 4PLMA 2ET7A 2BWAA 2RS12 4X8NA 5A32A 3OGJA 2XLFA 2VCBA 3ACGA 3RMXA 4NVPA 4KH9A 3H42B 2VD7A 1ASJ2 4KBBA 1BVVA 2HWB1 3GALA 1W99A 1UXXX 4XIKA 1ZZ8A 1OOPB 1V00A 3GDBA 3KD4A 4QKDA 4GJYA 1ENRA 4XHBA 1MR5A 3VHOA 4NE9A 3AMNA 4QXCA 1PO23 2VZSA 4P9JA 1LU1A 4W8JA 1POV0 1RUG2 2XLAA 3HNMA 4W6WA 4DRRA 4BXSV 1F2NA 3NNGA 3NO8A 1H9WA 1LR5A 1YFXA 2QBXA 3O0XA 4RHV1 3POFA 4HL0A 3UKTA 1Q8OA 2MHFA 3LGRA 3OBRA 5I8YA 1I3HA 5A6YA 2Q4SA 2DVGA 3HAGA 1KJRA 2DV9A 4YVSA 3ZN4A 4KWUA 4W6XA 2VOKA 1TE1B 1XC6A 4FAGA 1WLDA 2FQPA 2NMNA 3T0AA 4LUKA 2DFBA 2ARBA 4UFJA 3ZSLA 2D5FA 3BKZA 3IDBB 2X09A 2A3XA 1SBDA 1UZYA 4XUOA 4COWA 3E97A 4ATEA 2A6XA 2D44A 2NMOA 1GUIA 1FOD3 4QX0A 2YU2A 5JXGA 3QACA 2TUNA 5JXIA 1RUOA 4MGYE 1DBNA 1YQ5A 4CU7A 1O4YA 1AYM1 2Y6KA 2OPKA 2Z4FA 4LO8A 3AL5A 4KL1A 2WFF3 4XFAA 2GALA 3ZFGC 3HNYM 1QHDA 5DDJ3 2C9AA 4AQ6A 2G9FA 2XDVA 3FLPA 2W1QA 4AEDA 1ODMA 3OB8A 3ZXLA 5C9AC 3E6CC 3VDBA 5DZEA 3BVCA 4M3CB 1AL22 2LRPA 3BALA 1YCIA 3LE0A 3POBA 1OF4A 3KWVA 2W2IA 3GF6A 3WDUA 1WCSA 2W91A 4HG6B 3T30A 1WZXA 1K3IA 3LA7A 4FPYA 2GC0A 4QD2A 2A7AA 4BDVB 5FLJA 4FT8A 4JDNA 1LOAA 4K21A 4ES9A 4UI9L 1W9FA 2EA7A 1YHFA 1ULFA 3HT1A 3NJZA 4YW4A 3LWCA 5F3GA 1FMD3 3W20A 4YRDA 4QDSA 4XJAA 2WNEA 3BCWA 3IPVB 4QKNA 5DAPA 4EROA 3LEIA 3BU7A 4XDQA 4H55A 1NT0A 5LBCA 5E6HA 1GFF2 1QH6A 1RMU2 2YXSA 2ZMKA 4MOAA 2ADDA 2AEZA 4J1XA 1VBE1 2K2SA 4JX0A 5FZAA 5A3PA 5FXXA 1UMIA 1NQDA 1QQP3 2JDAA 2OUHA 4XE9A 2VMGA 2YROA 1DYOA 4I02A 4FPKA 2HLEA 3J8F2 2Q30A 5DUWA 5FZOB 4AE2A 4XJ8A 4EYUA 5A3NA 4DXRA 5ACA3 4Q5OA 3RWNA 3I2FA 1WCDJ 4KG0A 4IV3B 1D0HA 2HBUA 3PUQA 3TN91 4CCOA 3MIGA 4NIIA 3NAPB 2HYKA 4FFHA 4PDWA 1E5SA 2FHRA 4LE3A 3WLUA 3MEPA 4JQRA 4H3WA 4QM8A 1UAIA 2GNBA 2OPWA 1W03A 5FUNA 4D6RA 3BN6A 4Q4W1 3AVSA 1CN1A 5A6QA 2JXAA 5FBZA 1RUG3 4ASMB 5A7QA 2VQAA 1ULOA 1JS9A 1MQTC 2BERA 1VRBA 2DVBA 1AJOA 2V5YA 3GZEA 4LQRA 5FYBA 2P37A 3T09A 4E4HA 3THPA 5T54A 1EUUA 1ACCA 2GAUA 2HWF3 2W68A 3AZYA 4IEUA 2JG9A 4WM8A 5JVVA 1NE6A 2B7YA 4IE4A 2OX0A 3S30A 4B4QA 5GZCA 4IEPA 3NW4A 1UMHA 2XJTA 2YFUA 2QQPA 1EUTA 2UWCA 5DABA 3O1MA 3ZSMA 1JZ4A 4XQWA 3B9IA 4K1ZA 2VZ3A 5JOXA 4IXLA 3IIIA 1FPN1 1IPKA 3MW4A 5FJHA 3EHKA 3HBKA 4FPCA 2PMWB 1JN2P 4ISRA 2P1BA 4MGZE 4QPIC 3FLRA 3NV2A 3R4UA 5GLZA 2JG8A 4HKWA 4ASLA 4XQ4A 2LTNA 1C5HA 4BLJA 1DDLA 2B9UA 3FC0A 5D8AC 2BQPA 4E8DA 1HW5A 1WKYA 2D97A 4PI0A 4UOJA 3VD5A 1D7PM 1X50A 3KF3A 2JD9A 4NPLA 4D7TA 5HCHA 1YO8A 2C9KA 1CR7A 2MEV2 2JKBA 4HK9A 3RZGA 3JBG2 1WCQA 5I8TA 4B8EA 5A33B 2EIEA 5H9RA 3BTYA 1DP0A 2YY1A 3ZVXA 5BNPC 1W2AX 2VZPA 2QDRA 4GKYA 5C8CC 2HH9A 2A1XA 4EZ4A 1XE7A 2BZDA 2P5BA 2WYFA 3D4KA 2A3WA 1LNSA 4FPJA 4SBVA 3TAYA 3P3NA 5EIYB 5T55A 4ISQA 3WUDA 4MG2A 2WNOA 4NJ4A 1XRUA 1BMV2 3EYPA 2CL2A 2GMEA 4FOVA 2HWE2 3VBRA 1ALYA 2VBBA 2WFPA 3ILFA 5E8AA 4XUTA 1XU1A 1D0GA 3JQXA 2VMIA 2P17A 3HN1A 3NJXA 3OEAA 1DQ6A 1RUC2 2R49A 2YDEA 4Q4V2 4AI1A 2VH9A 2X29A 1R081 4ZHNA 3NJVA 5CFDB 2WS92 1ZRIA 4C90A 3M2MA 4ZS3A 4EN7B 5IK7A 3DYMA 4DINB 1FX5A 4GJZA 4RQPA 5B4XA 5F2WA 4M4PA 3J9SA 4HVRA 2ILMA 4LHNA 2I74A 3MW2A 1RMU3 4YG3A 3ON7A 4R4ZA 3FMGA 3I2HA 2GZWA 2GMMA 1BHGA 3K46A 1HQWA 3OBAA 4XF9A 3I4IA 3WW2A 4IEWA 3ZO0B 3I8TA 3PL0A 4CP0A 1OVPA 4N53A 3VKOA 1YIPA 1DQ2A 2JECA 3LF7A 4EQVA 3EMRA 4BHPA 1OVSA 1PIV1 5A7WA 3ASIA 1OKQA 3R05A 3AM2A 1I1EA 3W5NA 1J58A 4XFBA 3JU9A 2PHFA 5CFCC 3NMBA 1UF2C 4RS5C 3E1F1 4K1YA 3RS6A 2NZ9A 2VO5A 5LA9A 3WR0A 2NM1A 5BY5A 2O1QA 1V9U2 3CLPA 4COYA 5A1FA 1RB8G 4QHOA 1CAVA 4LHLA 2FDKA 3AP5A 3OEBA 4DS0A 2YYOA 1J3QA 3JQWA 3KQRA 1H8TB 1OMIA 5ABJC 2RDQA 3JB4C 3KCXA 3LEMA 3H8XA 2VZRA 2VNRA 2XVGA 1S0FA 2WKKA 5LRRA 4LBQD 4RFRB 1TME3 2HKXA 3UNPA 1WW7A 2EAAA 3AKSA 3CJIC 2OYZA 3BODA 4YFZA 2CU5A 4NHXA 2TBVA 2RG4A 4P9XA 5KHGA 3DF0A 2HWC2 2WT1A 3C8XA 3PUHA 4IGQA 3WF1A 3ZFEA 4Q8KA 3RRDA 2RR12 5IWFA 4LTAA 3ES4A 5A7SA 2VZ1A 1DQ4A 1OLME 3CMGA 5GLWA 4EWDA 1YFWA 4D8MA 3I59A 2WDBA 1OI6A 4Y3OA 1HRV1 1WA4A 2GC3A 3O1RA 3W59A 1GNZA 2GNDA 3PVNA 4R4XA 2E31A 2R062 4O9EA 1H6YA 1SPPA 3IWZA 4A3XA 1UPIA 4OLLA 2OS2A 2OUJA 4LA3A 1JYNA 2RS53 2VPVA 2DBNA 5ANQA 1A34A 3WDTA 3KB5A 4O61A 5C4WC 3VBOB 2XHNA 1VBA2 2VZUA 5C5TA 3T08A 1RUH3 1V0AA 2LS6A 3AK0A 4KI5M 5KHJA 1LHUA 4F8AA 4E2GA 3POWA 3ZMOA 4MSVA 1GMMA 1DIWA 4K8FA 3FX3A 4PT6A 3AYAA 4NHKA 1EPWA 4HN1A 5FZEA 3EXUA 3AVRA 4RYDA 5DQ0A 2VMFA 2G1MA 3DGTA 3FBYA 4YVSC 4LOTA 4BIFA 3VBFB 2EXJA 1VLNA 3IM0A 4B3NA 2VJXA 4CCNA 1UZZA 1YC61 4EN8B 2KXLA 3PHMA 2WS93 3E6DA 3M3IA 2G4IA 3I2GA 2Y26A 5F2SA 4AAXA 1VRH2 4QX5A 4F7ZA 4XOGA 1OLRA 1JOJA 3ZFFA 4M0HA 2AZ5A 1R64A 3NVCA 4I2OA 3PVOA 4FTBA 4UFHA 1CAWA 2ORXA 2CTVA 2ERFA 3CQOA 1H2MA 1UZVA 2JDZA 2IFRA 2V09A 1ZYBA 4LE4A 1DYKA 3WNXA 1S4CA 1SFNA 1U5XA 4LO7A 4NRQA 4AFMA 5C3OA 1AR91 2I07B 1G7YA 3RWKX 5IVBA 3THTA 3ZXGA 1ULCA 2IUWA 4HKLA 1Q3EA 2ET1A 1X82A 4CEWB 4AYUA 4AEDC 4CEYB 2XR4A 1Z7S3 4JTNA 4MZUA 4COUA 3RZHA 2NPIA 4MHUA 3T1LA 2AEYA 3B01A 5LEKA 3MFAA 4LO4B 4B7EA 1UYPA 1XE8A 1PO12 2VUCA 4K20A 3OUJA 4DIQA 3AZZA 2CWSA 2SBAA 2VW1A 1V9U3 2WT2A 2R042 1HX6A 4L9BA 4Y1XA 1HRI2 1YI9A 4YYOA 4EN0A 1Y9MA 3OCPA 1YEWA 4BLIA 1S0EA 3GM8A 4DRVA 1A6CA 1VAVA 1CGPA 4JZRA 3ZIWA 4CU9A 2WWUA 1VMFA 3GJAA 4XYXA 4MGSA 3DPRB 2WIIB 3OD0A 4LKSA 4FFFA 4W50A 4NAOA 1Q8QA 3VBUB 3ZSKA 4DXZA 3MYXA 3PDQA 1H8VA 2BEOA 1H2KA 1HB4A 1I5ZA 1AR61 1OSGA 4HONA 4JKLA 5LEJA 2FCVA 1YLLA 3N7KA 1WW6A 3O1SA 3GCWA 1LHVA 2CYFA 3EQEA 5JSRA 1NY71 4CA9A 3KV4A 4FPGA 4Y22A 3WSOA 3BB6A 4BQ5A 1AYN2 1GOHA 2VAUA 2VULA 5A7NA 4AEMA 4YM1A 3I3BA 1W2TA 5EQUA 5FZ1A 1GLHA 1HLCA 3N36A 3SHRA 4B4RA 4URAA 5L36A 3V0BA 1VBC1 2A70A 4Q8LA 2G9GA 5FMOS 1YYNA 3ACLA 2ADEA 5FKCA 4YG0A 5JUVA 4LLOA 1G9AA 2VBPA 1S0DA 3DKWA 2E26A 3M1HA 3OPTA 1XXNA 1HKDA 3PTRB 3QH6A 5FUPA 3WHUA 5FOJB 4Q0SA 1F31A 5KR7A 2CGPA 4COVA 5IT6A 2RM22 2WINB 1JXNA 2LUWA 3CHXA 4R9DA 4NWWA 5K0UA 1URXA 3HQUA 2DBIA 2XJRA 4FPEA 1HJGA 3U0ZA 5CBLA 1O6UA 2J1VA 3SCHA 3O1VA 3LOIA 3DUIA 1NLRA 1W6MA 3GYDA 4WM8C 2OIIA 2JG9C 3CKHA 4C91A 1EV13 2BTVC 2XVLA 2D6PA 2I45A 2XVKA 3J8F1 3FBMA 3NNFA 3VDDB 1CAXA 2FBEA 3OTFA 4ZXKA 4P9YA 1QJX1 1GQHA 4IV1B 5KWRA 2PHTA 2ZAAA 1JOPA 1Z78A 4KWKA 1HB2A 1OH4A 2PHDA 3ALQA 2D43A 4LORA 4UXAA 1BEV1 1GR3A 4AFAA 2FDJA 1QY4A 4XBLA 1XPWA 3CNAA 5BV6A 1XSQA 4GALA 3JD72 1L3JA 5FY0A 5KXDA 4FOQA 2VNGA 1XNCA 1XOYA 3BPZA 1WLTA 2VZOA 5IFPA 2VUAA 4XJZA 3PTYA 1R091 2OZ6A 1NOVA 2BJSA 2JG8C 2A6WA 4L0PA 1QJZA 2J7MA 3AP6A 4CDWB 4R52A 2X5IA 2ZX0A 3CL1A 2F17A 3FHQA 3I3DA 4GZ9A 5L7OB 4CDUB 1FNZA 3NQHA 2OQ7A 3J7HA 4RGKA 4E4ZA 3MLKA 3RZLA 3RYKA 1AZDA 2AENA 3QCWA 1GZTA 4FSJA 2Y6LA 3KV5A 4RHV3 4KG8A 5F6KA 1TMF1 1KITA 4JHZA 4KU7A 3TOJA 3RZMA 1Y9GA 2BDRA 1PK6B 1UKGA 1V6JA 1OC1A 1MQTA 2VGDA 2ZPXA 4I30A 5FYUA 1W3VA 2QQWA 4CCCA 2GU9A 1WBLA 2R043 4Y1VA 4AGGA 4ASKA 1WMEA 3WG1A 4WVZA 5F8PA 4QB6A 3VBRC 1UOGA 4HFSA 4N7IA 1ND2B 5EV7A 1AR82 1PGSA 1N1TA 3DXUA 3I2KA 3VBSC 3WEZA 3U4SA 1ZNPA 2ORZA 1EAH1 4IQPA 4C8DA 3G6JB 5C3PA 2B5HA 4X6RB 1B35B 1GZWA 4QHZA 2VNOA 4LBNA 3KF5A 3MPBA 1HXS1 5DAQA 4JTOA 5HCAA 3MGUA 4RQPC 2G9ZA 5JMOA 2DCKA 4AG4A 5LB6A 3TB0A 4FOYA 3B02A 3JCIA 1NCQB 4QQHA 4BMEA 5E16A 1YIFA 3OY8B 5T3NA 1AYM3 4K6BA 4OVEA 3U14A 5JZGB 5FK7A 1HDKA 1QOSA 4G4FA 4PIZA 5D8AA 1SEFA 1BMV1 2WA4A 1DZTA 5C3RA 3AXEA 2PLV1 2HWE1 3FLTA 2Y60A 1TNRA 3POEA 1UO9A 1O91A 1U5IA 2BPA2 3SLIA 1GNYA 5FYHA 3AKQA 4QX2A 2B45X 1N3OA 1W6OB 2B8MA 4I0AA 4XC9A 1PO22 1YJKA 4P9GA 4QDQA 5E88A 4CDXA 3FFQA 1Y7BA 3USUA 4GH4A 1BCXA 5EHDA 4S2DA 4ZU5A 1J59A 2RM23 3ZYPA 2KA3A 1RUE1 2VC9A 1W2NA 4LHKA 4CUAA 1LEMA 4LLFA 1J3PA 2YPDA 1NLSA 2XL7A 3HEIA 2WUHA 3N7MA 4Q1PA 2UU8A 4AGVA 1K5JA 3NKGA 3ETQA 3OBZA 3DV8A 5F6LB 1N1YA 3HMYA 4JAAA 1ND3A 2RJKA 2TNFA 1MPXA 1O8PA 2VOTA 1OPMA 2P34A 1UNBA 1VJ2A 4TN7A 1LODA 4YW3A 4QM9A 4XABA 5FLIA 5I91A 1W39A 1LB2A 4YGEA 4BK5A 3ZXAC 3ZFEC 4YM2A 1LCLA 2VCCA 1HQLA 4AL9A 1LULA 3KT1A 2W52A 2JDUA 1FOD2 1J1TA 3ZSEA 1VBB1 3WNOA 4HK8A 3LDKA 1X33A 1CIYA 1TG7A 4RN5A 3UL2A 2HEYF 2R6QA 2ZJCA 1ENSA 1FYUA 3BOPA 4F83A 2FZ2A 5DDJ2 1SDWA 1QJEA 3P5BA 3OUHA 2BBVA 1V6NA 4Q4W3 5IVFA 1A3KA 1FATA 2Q1FA 2AH2A 3V0AB 2A3YA 5FP3A 3I2IA 3WOGA 3ORJA 3ZR6A 5FP9A 4EJRA 4L99A 2HWC1 5FP4A 2GNMA 1OUXA 2B46X 1SZBA 4JDOA 1W6PA 1TQ5A 2RR11 4XTMA 3N9QA 1O5LA 2PELA 2WNUB 3H7JA 1VBD2 2R1BA 5LBEA 5CA6A 2F6BA 2XWJB 1UOJA 4FP2A 5GZDA 2JDYA 2Q5TA 2UWAA 1ZA4A 1FMD2 5F1RA 4M4RA 1NX9A 2R061 1JYXA 1UZ0A 5FREA 4LKEA 2JJ6A 3I7DA 4OYUA 4B4PA 2XBO1 3FE5A 3ZPYA 3WZ1A 5GZGA 5IFTA 1YFUA 1ZZ7A 4YM0A 3H9AA 5APAA 3WCRA 3VHNA 5I0DA 4AXOA 5GALA 1MZFA 3EO6A 4NIHA 1G8WA 1NCRC 2PA7A 2QE3A 3ZFFC 5J7MA 4RR3B 4QPYA 4LHSA 2K0GA 1QQP2 4S2GA 5BNNC 4NHLA 2QQLA 1WMDA 2Y6FA 4D6QA 5FBJA 1OD3A 2WWJA 4OCTA 3RJ2X 1QOTA 4GB31 2WLQA 3HIFA 5ACA2 2C6SA 4XIOA 1GOGA 2EIDA 3GJBA 4YARA 4JGZB 3MUY1 1XSRA 4UFMA 3U37A 2OXBA 5JIAA 4WM7A 2DUQA 2BFUL 2FCUA 5C4WA 4PDWB 4LIUA 1GBGA 4XZUG 3ZN6A 1ZRDA 5FY4A 2PHWA 4AVSA 1W8UA 4YVWB 4D7SA 3VHPA 5BPXA 4IL7A 2HWD1 1VRH1 2GN7A 1LKNA 2DVDA 2ES3A 2O8QA 3OBTA 4YNIA 3UT0A 3LDRA 5J37A 1O3SA 1PX3A 2DUPA 4BJ0A 4HVOA 5DG1A 1OA4A 3DKQA 2RS31 2YFZA 1O4TA 3CDZB 4C1XA 3VGIA 3M3OA 4WBBA 1WCUA 2HWF2 3UJQA 3HPNA 4AHYA 4BA6A 1O4ZA 3PVBB 1MACA 4ZZ5A 3VBHA 5K7PA 1KFXL 4GMP1 5I0SA 4R9BA 1M4WA 2ZGQA 2Q1ZB 3DEMA 4JQTA 1PVC1 5FP8A 1GV9A 4E2QA 4Y1YA 5ANNA 3K48A 4CVUA 1F5JA 3BI3A 4YZ2A 1OH3A 5KXBA 2CAUA 4DXTA 3WDXA 1O3QA 1D4M1 4CP9A 2QJVA 1C8M1 2NQYA 4XAAA 2YC4A 1XU2A 3LKJA 4OI4A 5LBFA 5F9TA 5ERLA 3JUUA 3ME2A 1UW8A 4ET7A 1YWKA 4E8CA 4FP3A 4QPGB 2E51A 1VMHA 3IKWA 2A5ZA 1PO11 2DU0A 2DYCA 4FXKB 1LTEA 3LSDA 3CF6E 5K4LA 1W6QA 1HN1A 1WLWA 1DGRA 1QXPA 2ZX4A 4FI9A 4WVVA 3WQBA 5A3TA 4KQ7A 4XJWA 4IE7A 5JXJA 1UN1A 1OHFA 3N9MA 1LHOA 5EPAA 3H3LA 4XFFA 4CZSA 3O12A 1SHWB 3I2JA 3R4DB 2FDGA 1CQ9A 2ZHNA 4AI9A 3VN4A 1O8SA 3HVDA 3NNJA 1US3A 2W3JA 5BNOB 1IG0A 4GXLA 2Q8OA 3ZDVA 4MXWB 4BZ4A 3E6BA 4XUPA 4MADA 1LOBA 5J48A 2JB4A 4GD4A 4N43B 1GQPA 2ZGUA 3U07A 1OD5A 5K0UC 4QU2A 2BVBA 1T2XA 5FYVA 1H2LA 5JWPA 1VBD3 5J1XA 3X29B 1RVF3 3QLQA 5IYYA 1X8EA 1AYN1 4RA0A 1N3QA 3IAQA 4GKXA 3CJXA 3V56A 3ZYFA 4MUVA 4LITA 4CDQB 3RZZA 5FYMA 3NL1A 1DGWX 3B9CA 3D0JA 3V64A 2OQ6A 2DVAA 2Y6HA 3ATGA 1PGW1 1YQ2A 2BBAA 2XGXA 3ILNA 1K45A 2A75A 2R073 4Q0UA 3B3QE 2LM3A 1BLZA 1N47A 2FMYA 2ZGNA 1CVNA 3SKJE 3PUAA 3VZKA 1UU5A 3N9PA 4IERA 4FQZA 3ZM8A 1RUF1 4IESA 4JGYC 4GA9A 4PI2A 2Q8CA 1GZ9A 4J1WA 2VXJA 3ZXKA 1M06G 2IXHA 4D69A 4Y5SA 1UY1A 1WWYA 1D4VB 2IWGB 4YGBA 4D6SA 1OQEA 4N53B 1QU0A 1JYCA 1C4RA 2X5IC 1QJU1 4XXPA 2P3YA 3MBWA 2CSGA 3WDWA 1LRHA 4FCAA 1AX2A 1RUJ1 4UT5A 5D21A 5F5CA 1LHWA 4WVMB 5GJ6A 3AKPA 4AVVA 2DTYA 3H1MA 2CGOA 3VV1A 4F3JA 3H7YA 4Q4X1 4HANA 1IS3A 3KSCA 4C0BA 2WJSA 5D1IA 4AI3A 5FQ0A 5B2GB 1CAVB 4UF0B 5KC5A 2BU9A 1J1LA 1GQGA 1HB3A 4A7ZA 2GN3A 3AJZA 2P4EA 2PFWA 2KR2A 5IAXA 2KD7A 3MV11 3RGBA 4NOTA 2C0ZA 1UPSA 2ZGLA 2BRTA 1TME2 5FZBA 5H9QA 5A3OA 3TWIA 5DUVA 2EALA 4AQ2A 4BYYA 4EWAA 4CU6A 1NA1B 5DXDA 2FDFA 2XL9A 2CDOA 4JC1A 1J83A 1RC6A 2Y0OA 5FFOC 5IHRA 5LA1A 4BQ3A 1QGLA 2E53A 5HI0A 1N1VA 1JTZX 1K5MB 5FYYA 1C3HA 1W8HA 2BNOA 3WV6A 2ARCA 4UWDA 4BU2A 2XQRA 1AR93 2GDFA 3MZHA 1DYPA 2IFWA 3N7JA 4K40A 5LA2A 4BMBA 2D98A 2WRAA 2DURA 4XZPA 3KM5A 4XEZA 4AQTA 4NIGA 4URTA 5E89A 3D0SA 2RS52 1RHI3 2RVAA 1AR81 5JSPA 1X8MA 1G9BA 1H1MA 2RJ2A 4LIVA 2WZR1 1LGBA 2WNVB 4J25A 1RUH2 2P2KA 1DGRN 3VKNA 1BKZA 4EV0A 3VUOA 1SDDB 1KDKA 4CDXC 2FDIA 1AL0G 2A6YA 4GH4C 1BBT1 1W8WA 3D8CA 3QD6A 3K4AA 2UYBA 2YGLA 3KMHA 4HPKA 4Z92B 4ZZ8A 3K4ZA 4D3WA 1V6MA 4AF9A 1DCSA 4OZXA 1WD3A 3ZYHA 1C1LA 3AP7A 3UV9A 2N7GA 4ZONA 1LJ7A 4Q4Y3 3H8RA 3MFCA 3SEEA 4C0HA 4WZCA 3FL7A 2WO3A 1MS9A 1BVP1 4LMFA 4OUMA 1AR63 4QX1A 5CKNA 2XH6A 1ND3C 4M3CA 1AHSA 5FPXA 4XMAA 4AVCA 2OW4A 4ARYA 2XHKA 1GWLA 3AFGA 1ZBE2 2KM2A 1V6LA 2A6VA 2VQTA 4W6YA 3MV01 4Y4YA 3S7IA 5FZHA 3NRUA 1G6NA 1LOGA 1NLQA 1KQRA 4XW3A 3AZWA 4OULA 1OA3A 4H7MA 3O0VA 4QQOA 4Z07A 5A80A 1RUD2 1I9RA 4XF3A 1OT5A 1WMXA 5J3UA 1S2KA 4AW7A 4QPWA 5FDBA 4PBOA 1ZM1A 3IPVA 1ENXA 3HR9A 2XWBB 5DUUA 1PHMA 4CPBA 1RGSA 2Q8EA 4XQDA 2ZABA 1Z7S2 3VZOA 5FPLA 1KD7A 4O9GA 2D6MA 4ZU4A 4Y20B 1JZ6A 2VOXA 2JE7A 4CYDA 5JIUA 2Z2SB 1A78A 4PHZA 2ZEYA 1ZZCA 2ENRA 5G05L 4BXFA 4UW5A 1PGL1 2C5DA 5LW9A 2R1DA 5FZOA 1AR71 1ZRRA 3POYA 2H6BA 2W1UA 5T52A 4BB3A 2ID4A 1HJFA 1GP6A 4HSJA 4G9SB 1W04A 3MIEA 1X7NA 1QJX3 5F39A 2ARXA 4CXYA 1COV1 4IV3A 3ZXEA 1Q8PA 4Y5Z0 2WFF1 3OGRA 3NAPA 2XKPA 1H6XA 3WQ0A 4A6SA 3DECA 4EN6B 1QJY1 3L2YA 3C7GA 1GANA 3RG0A 1PZ7A 5DAWA 3RDIA 4CTEA 1O3TA 1CONA 1BZWA 2ZS6B 3POSA 2IXLA 2VMHA 3LCPA 5H9PA 4NHMA 3VDAA 3UKVA 1ODNA 2Z42A 3DYOA 3MIFA 4A2UA 3HNBM 2QQOA 1R093 1JW6A 1S55A 1ONAA 3H50A 2YHJA 3DCQA 4ORFA 2DFCA 2E32A 2FCTA 4OMCA 1PZ9A 1W6NB 3AMHA 1JMUB 3VD3A 5HV4A 5BNQA 1OQ1A 2DU1A 3ZFGB 2JEMA 2WZ8A 3I54A 3MO4A 1GZCA 1S2BA 3ZXDA 2D3PA 2ZHMA 4LO5B 5EWSA 1DLLA 4YZ3A 1FMD1 3CZJA 2ZEZA 3WCSA 3JB8A 4WM7C 1TMF3 5C9AB 5ISLA 3AJYA 5FY9A 1F8VA 4TLGA 1WW4A 2MPFA 1SG3A 1K42A 1VALA 4Q0VA 3UETA 1AX0A 1IKQA 3CBNA 2XJPA 5FZ3A 1XB9A 2D7FA 2DF7A 4XFHA 1N1SA 1UY2A 2XJVA 1X36A 4P00B 3LB9A 4HOOA 1SCRA 1JBCA 1UY3A 1HB1A 1EAH3 1EV12 2RS11 4GIQA 1QWRA 2ZEWA 3VBHC 3BUCA 1GWKA 1DQ5A 1LOCA 4QX3A 4AZZA 2WC2A 4LBJA 3C7HA 3WUCA 5FOBB 1JYIA 1HXS3 3KQ4B 5A33A 4MVTA 1ASJ1 3N9NA 2DCZA 4IEVA 3RI9A 2J1EA 1IOAA 2ZXQA 4QX8A 3WNNA 1NCRA 4CCEA 3AYCA 4UW3A 4DEQA 3O0WA 2ZTNA 1ZBE3 1ZBA3 2OZJA 4DUXA 5IVVA 1C5IA 5F5QA 5EP9A 1KXGA 1RUG1 2HEVF 3O14A 1SCSA 2R0FA 5BNNA 5C33A 4JHTA 4MHRA 3A0NA 2ZX3A 3PNAA 5FYIA 2PLV3 1RUNA 3MICA 2WT0A 2ZX1A 1RUD3 4A7YA 2HWF1 2PHXA 4JVAA 1UYYA 4LBLA 5AC92 4Y26A 3RMYA 1NUKA 3N9OA 4AOCA 2IVIB 5CFDA 1D2SA 1GYKA 3POIA 4UFIA 5FZIA 3R0RA 5JLVA 5DG2A 3SH5A 2ZX2A 3ACFA 4P5YA 4LBQB 4RHV2 4YGCA 3OYWB 1PMIA 1CIWA 5FXZA 1RUE3 4R8HA 4MH0E 4CXXA 3OSDA 1S0CA 1NXMA 4GWIA 2HBTA 5LASA 2WLPA 1NAEA 1U5YA 2UWBA 1MQTB 5CADA 1JZ7A 4Y33A 4UYBA 4U36A 2VUDA 2WSVA 2PN5A 2X10A 1Y9QA 3HOBA 4RD7A 5FYTA 3T4HB 3VDCA 3A23A 5FXWA 1IPJA 3Q8BA 5AVAA 5IK5A 3NWKA 4BCUA 5KXCA 2VG9A 1CAUB 3H1YA 3ZOIA 2PXJA 1Y3TA 4OHYA 3BTAA 1JYTA 4OUEA 1TEIA 2PQQA 5LZ6A 5G04L 1GZWB 3LA2A 1G9FA 2J1UA 5FO7B 4CUGA 5CAZA 1L7RA 1SFPA 1VB2A 1YXWA 4IEZA 4XXAA 4Z8BA 1FV2A 1FAYA 2R0HA 4AI8A 5FUIA 1AL21 1VBB3 4AGRA 5EZWA 1XBFA 3KV6A 1MEC3 1AYM2 5A6ZA 1RUI3 2RDNA 1KEXA 2E7QA 4QPIB 2PYTA 3B7MA 1AF9A 1QOOA 5FZ0A 1QKQA 5D8AB 2W95A 3DL3A 5FZ9A 3NJYA 4QQLA 1JHJA 3WG3A 3POJA 4XCAA 5DMYA 1W3XA 5T5PA 1E5IA 5I0UA 3ZXJA 2CWMA 2W08A 5LY2A 3S57A 3UESA 2K9ZA 4LR4A 5BNPB 3ACIA 3WT3A 2A6ZA 4NUBA 1KFUL 5C8CB 4Q2FA 5FZKA 4PF1A 5FPZA 3IT8A 1RMU1 2RHPA 1UOFA 1FI2A 1R1A3 1TVGA 3VKLA 2QDNA 4M00A 5I0TA 3C3VA 2IVJA 4PLOA 1AXZA 1NG0A 2JIGA 4XCBA 4YGDA 1ST8A 1DHKB 1PM4A 4HSLA 5JPNB 3LDBA 4Z2WA 4UFKA 1ZVFA 1BYHA 5HCBA 2RMU3 2GH8A 3PURA 2XBO3 5F37A 2BWCA 5CIRA 2VMDA 3AZXA 3IMNA 4H14A 5CZKA 1JUIA 2HEWF 1OBNA 3A22A 1OOPC 1DGWA 1Q56A 4BH9A 3K77A 1VBE2 2WA3A 5LK5A 5M0TA 2W1SA 1REFA 4PIYA 4W65A 2JDNA 3H3ZA 3KGZA 2WBKA 5GLTA 1IS4A 4JGYA 4YW2A 4GB33 3TNPB 2ZGSA 3DN7A 1LOFC 1WW5A 3RZJA 5L73A 4XHXA 3TN92 4CSWA 4K9SA 1IS5A 4GWJA 5L9VA 5F3CA 3WQ1A 3K3OA 2AACA 4FXGB 4LKDA 4ATFA 1Z0HA 3GZUC 4NROA 3VBFA 1BXHA 2HWB3 4BE3A 5AC93 3P3PA 4Q4W2 1POV1 5GKAC 5CFCB 1UZWA 1W8OA 1QNYA 2HWD3 4RS5B 4OFGA 4DB5A 2GP3A 2DCTA 4ZPIA 2Q8DA 1LHNA 1PMJX 1S0BA 3LIGA 3RNSA 3PUSA 4CCDA 1VPHA 3H8OA 2VR4A 2RS33 2XUEA 3O1TA 1RTVA 3ZYIB 1ZZ6A 1LGCA 5DZGA 5EXOA 1F35A 5ABJB 5HPOA 5A3MA 3I49A 3VZNA 4IGOA 3VZMA 4GMP3 5HV0A 1DF0A 5JPMB 4IE0A 4A44A 1OA2A 4A41A 3OF1A 3CU7A 4XUQA 1PVC3 3Q8FA 4OHZA 3W58A 4DFSA 2W9XA 5FIXA 3CJIB 1LU2A 2IC1A 2O14A 3OPZA 4ITCA 4PLNA 5EYYA 4OI1A 4CEWA 3KT4A 2CGNA 1C8M3 5E1RA 5FZLA 4CEYA 2W47A 1UYXA 1FPN2 5C6CA 1W28A 1YRZA 1DZQA 4DEVA 1XNAA 2AUYA 1XE0A 1RXGA 2MEV1 4JKKA 3LEGA 2YU1A 2QCSB 2EXHA 3JBG1 4G3YC 1G9CA 5SV8A 2ZKNA 4N7UA 4V1PA 4IEXA 3SEPA 3BIEA 2P6HA 1SLLA 3AMPA 1QF3A 4QB1A 3HN3A 3NNLA 2UY9A 3ETPA 2B39A 3CIHA 3F2ZA 3JZVA 4FPLA 2UYAA 5JR7B 4AK3A 4B29A 4BPZA 3ZYGA 5A32B 2HJIA 3OGVA 4NR1A 2JDHA 3P1IA 3UKNA 2QQIA 3DPRA 2C26A 5IUQA 2JIJA 4NMIA 3S5AA 1F4HA 3KGLA 3EJKA 3L2HA 4M3CF 4Q4V1 1CX4A 1RUC1 2RV9A 3R4SA 5GM0A 4P9IA 4Y5TA 4XDPA 3E5QA 3ENRA 2WS91 2VU9A 2AR6A 4B1LA 3INAA 5J09A 2V72A 1CESA 1QMJA 2BGOA 2OA2A 1UOBA 1OFNA 1JU4A 2E9QA 2W39A 1JZ3A 2DCYA 1T6BX 5CEHA 4TLFA 3WF2A 2C24A 4IGPA 1RINA 4YVSB 5FPUA 2WQ4A 2XKOA 5CYYA 3SCGA 4P14A 4IV3C 4QKFA 1W8FA 4Y24A 3SC7X 2YZ4A 1ZZBA 3G7DA 3NAPC 2C1FA 2LALA 3AYEA 2W87A 4CP9B 2J1RA 3WW3A 1VBE3 4Y1ZA 1MVQA 5LK7B 4LBOA 1RUF3 3IN9A 4HKOA 4AHWA 4AI2A 4L11A 4PBPA 3WF0A 4EWEA 4MLOA 1WMFA 4DO0A 1NXD1 1W2UA 2FMDA 3MDPA 5BUVA 1V6KA 2VE1A 1V9U1 5FTTC 4MV2A 3JXSA 1QJU3 1UL9A 3VDDA 2YC2A 3TN93 1AXKA 1RUJ3 2B9VA 3OPWA 2V73A 1UXZA 4IV1A 2CNAA 4BQ1A 1E5RA 2P3JA 4LULA 4AVAA 1GNHA 4META 1PNGA 4AEDB 3WINE 3LSEA 5JOYA 1H1AA 4Q4X3 4OI0A 1D2QA 5F7UA 1IHMA 2NP0A 4BWOA 2CDPA 2VECA 4LXLA 5FMDA 1BK1A 5FZCA 1IPSA 2ZGTA 4LK7A 3SXWA 4DY5A 4L8QA 1SMVA 2VUJA 3BOWA 3ZPOA 1X9PA 2ZMLA 5T5OA 2CHHA 1AVBA 1MZ5A 1YI7A 4LBKA 1DQ0A 1CZTA 4A6OA 5AC91 4CDWA 1WD4A 2J1SA 2XG3A 1RVF2 2ZHKA 2A73B 2ZHLA 5FKBA 1Y43B 1ULGA 5FJKA 4AEJA 1GWMA 4CDUA 5LRSA 1UCXA 4CP1A 3PLQA 5L9RA 1CJDA 2XJQA 1UIJA 3RYPA 1HQNA 4FPHA 3W21A 3ABZA 1WGPA 1DZRA 1OUSA 2DTWA 2ZGPA 3H8UA 2ZGKA 3S5QA 4JKMA 4XF4A 3VBSA 1FPN3 2R072 3PIJA 4MYEA 3A0KA 1PK6A 1CZSA 1VBA1 2EAKA 4JRLA 2W92A 2XB6C 1UMZA 3ZYRA 1HIXA 1HRV2 2LROA 5H9SA 5GLVA 4A7KA 1W9SA 3RSJA 1KJLA 5I8SA 2JWPA 4NPRA 2Z79A 3DYPA 2OKXA 2AC1A 4R9CA 1OURA 3PMSA 4P5HA 4LNVA 1ND2A 2ZMNA 3N3HA 4COZA 4M3CE 4LT5A 4XFCA 3ZLIA 5FXVA 1B09A 4QGNA 2WZR3 3WVJA 3AKRA 1EYBA 5CFDC 3W5MA 3VD7A 4AVBA 4OQ9A 1OLQA 2JDMA 2VM9A 1JZ2A 5GZFA 2WABA 4FPOB 5JI7A 5SV5A 4IE5A 3F95A 3NV3A 3V65A 5DZFA 2YBPA 4Q1RA 1TNFA 3OY8A 4PCRA 5FQ0B 3N35A 4UW6A 3WP3A 1OF3A 3ZYBA 5A3UA 1L7QA 2BYVE 4MGTA 1F4AA 2ATFA 2PAMA 2YV8A 3ZN5A 4CPBD 4WM8B 4DXSA 2JG9B 2QUOA 5FV3A 1H9PA 2I2SA 4JDMA 3WP4A 1R083 3KLSA 1F15A 2WO7A 2BFUS 1RJ8A 1MS8A 1V6OA 1W6OA 2XONA 3C7FA 5C3QA 2VNVA 3CZUA 3VL8A 1TZOA 5FY5A 3WHTA 1GOFA 5FY1A 2PTMA 3AYDA 1E5HA 3M3QA 1AR92 4XUNA 2H0BA 1WBFA 1H8TC 2D3RA 4UAPA 1CWPA 2VW0A 3GCXA 2JG8B 4CUBA 2XQXA 2R041 3J7NA 3KZ4C 1HRI1 4IDZA 1PIV3 5F32A 3FFZA 1WA6X 3T0DA 4LEJA 4ZKTB 3THDA 2E63A 5FYCA 1RHI2 1Q43A 5CISA 1H1IA 4LO6B 4I01A 1QDCA 1C57A 3GXUA 4LKFA 1L7LA 3A21A 5BXXA 1N3PA 4TTGA 5FAXA 5FMBA 1RL3A 1ULDA 1Y4WA 1AR73 2W0XA 2VZQA 4HPKB 1QNWA 1VIWB 3AKTA 4QXBA 3WNMA 3OGGA 1COV3 2YUEA 3VBRB 2ZGRA 1DQ1A 1Q8VA 4Q4Y2 2ZCWA 4HT1T 1QJY3 5J98B 3VBSB 4HLTA 1W05A 3BIWE 5KXEA 3BTXA 2RDRA 4OHWA 1AR62 1S2EA 3QH7A 1BJQA 3UGHA 1NZCA 2OT7A 4DY3A 3Q9OA 3V0AA 3VBOC 4CRQA 1WUVA 3KCCA 3AP9A 2NYYA 2Y64A 1OKOA 2L9LA 2Y34A 3N7LA 2J1AA 4A42A 4RQPB 1SLBA 5A1AA 1NY72 1F5FA 3WX5A 1JYWA 1CZVA 2VZTA 1VMJA 3EBRA 3H3UA 3VHRA 4PIXA 1HRV3 1QH7A 2RM21 2WNUA 3PU3A 1UIKA 3I3EA 2GH2A 3I3QA 1VBC2 2JKXA 2WR9A 1YFYA 1PM7A 5FZFA 3K3NA 1ZRCA 4E4DX 3VBFC 4PJYA 1XNBA 5A7WB 3C2UA 3NV1A 2PAEA 3IBMA 3VB9A 1GP4A 1Q8SA 2JB8A 3OD4A 3ZR5A 3GHNA 4YSFA 5F5IA 2WQZC 3VZJA 5CG8A 3Q8EA 5CKMA 1AUYA 2X8KA 1JZ8A 2H6CA 4RR3A 1KGYA 1F9KA 5LCWL 2ETEA 1I6XA 4GQ7A 2YG0A 3JD71 2GC1A 2BV4A 1UD1A 3IMMA 3OG2A 3O1PA 1RJ7A 2RS13 4A3ZA 4OUSA 2R16A 2WYSA 3FUQA 4TSVA 2JDKA 4YPJA 1QJX2 5JI9A 2GSYA 2DCJA 5K9YA 2MNGA 4FO9A 4JGZA 3B94A 2WQ8A 1ASJ3 1BEV2 4RL7A 3U1XA 3W9AA 2PHUA 1OOPA 1UWWA 4MX3A 2VOWA 4PF5A 3C7EA 5CVRA 5DAXA 4CEWC 2VQUA 4YVWA 4CEYC 1YQ8A 2E33A 4XBQA 4NHYA 1IQAA 5JCTA 4Q0QA 3GNEA 1DFQA 3WY6A 5IK4A 3IIAA 2FZ1A 5FY8A 3IDAA 4LJHA 4YW1A 5A3WA 3ZFEB 1IQDC 4QXHA 3UYJA 1MS3A 3LPFA 4S2FA 2BW8A 1QDOA 1R092 3T0BA 3ZYJB 5F5AA 1E57A 5FWJA 2VL4A 5FK8A 4DPNA 1LOFA 2BOJA 4V2WA 2RE9A 3EB7A 3MPPG 5T5JA 5LA0A 4Z82A 3I59B 2V4AA 4IEYA 4MGQA 3E5UA 3OGSA 1W9WA 1W9TA 4NAMA 3POGA 1JU3A 3DPRC 1SPPB 2ZGMA 1J84A 1MZ6A 5JXHA 3QBQA 3VBUC 1W2OA 5I0RA 2BGCA 1PVXA 1TMF2 3LIHA 4YG6A 4YZ1A 1SBEA 1C1FA 2EF6A 3GZTB 3MHZA 3VKMA 2WZPP 3PVEA 1FNYA 3HJRA 2XOMA 3AL6A 3PIGA 1CPNA 4I3PA 4YFWA 3LD8A 2YMZA 4BIOA 2ZGOA 3HBZA 3RI8A 1IS6A 2Y8KA 4DMIA 4QPGA 5IVEA 1YQCA 4QDRA 2JD4A 1KDMA 1W8TA 3USSA 1STMA 1G86A 1X9TA 2ZBJA 3LEKA 3LFIA 1PZ8A 1W0PA 4TWTA 5DN2A 1O3RA 1EAH2 3NV4A 3VL9A 1MS0A 1YJLA 2SLIA 1QEXA 4RFT0 3K4DA 4YZ4A 3I2DA 1ULEA 5CNAA 1XYPA 4DOUA 3T1MA 4L92A 2Y38A 3APBA 1HXS2 3CO2A 5FRAA 3KVAA 5BNOA 3THCA 1APNA 3LZZA 1QXJA 3VKFC 1NE4A 1XNTA 1AL23 4MXWA 3LAGA 3SQOA 1NCRB 1ZBA2 5FY7A 1PO21 4N43A 3ZFFB 4ES8A 4QQPA 4YLZA 4H2AA 4WV8A 3RFRA 2XXZA 3M7AA 1UYZA 1CAWB 1V6IA 2PQSA 5IAVA 3ZX7A 5BNNB 4S2HA 1W8NA 2NN8A 2VTXJ 4HETA 2Z5WA 1KRIA 2PLV2 4KWLA 4FVVA 1SBFA 3WG2A 1VBC3 4BOWA 5FO8B 4CDQA 5LATA 3LA3A 5HXVA 1U12A 3VDDC 3P6BA 3B93A 2BNNA 1IG3A 3GGLA 4N90A 4XBNA 5EJ3A 2VVDA 3RJRA 3H0OA 4IV1C 3U75A 2H0VA 3ZIXA 2CY6A 2QQNA 1WLCA 4PQQA 4GWMA 5JR2A 3BPSA 4AR2A 4H7LA 3J26N 1U5ZA 4GMP0 2R7EB 2GP5A 2JDPA 4D0QA 4M01A 5FYZA 3WF3A 4QMAA 4AFBA 4Z2AA 4FFGA 3PMEA 1RUE2 5DUXA 2VW2A 4CXWA 1KS5A 1W0NA 3IDEA 1FT9A 4QGLA 4DZGA 1W8ZA 2D6KA 2WL1A 5FPAA 1UY4A 1O7FA 4DNYA 5KBFA 4QT6A 1LAJA 3K51A 1Q5OA 1R1ZA 1SQ4A 4QXKA 3RPQA 5K8SA 1FOD1 4CDWC 5IVJA 1W90A 3J8F3 1PX4A 5FO9B 5HXMA 1G9DA 5L7OC 4DQAA 3U11A 4CDUC 3WNLA 4HZFA 3NNMA 4YW7A 5A6XA 1LOEA 3TNQA 4FAHA 5J96B 4WVMA 1KS4A 5FZ6A 1JI6A 2QQJA 4NIAA 1BEV3 5DDJ1 1W0OA 3IDCB 3ZMNA 2K46A 4OHXA 3ES1A 2VMCA 4P08A 5TSWA 5LBBA 5JOZA 3AXDA 1EPZA 2EIGA 3FHAA 4YW6A 1U0AA 2VVEA 4IEOA 1PK6C 1VBB2 2DWRA 3VD4A 4JRAA 1PNFA 5GZEA 5FZGA 4UF0A 4ZY9A 2JX9A 1MEC2 2Q1MA 4AWDA 2QQUA 1RUI2 2DVFA 4AVTA 3ACHA 1DGLA 4XAEA 4Y22B 1VB4A 4M0NA 4BQ2A 2YB7A 4KBZA 3A7QA 5JDBA 1IGOA 5JAXA 2DDUA 4FOWA 1ND2C 1VBD1 4XMIA 1RVF1 5CU1A 1POV3 4LPLA 4KGGA 5HBAA 4NRPA 2D6LX 3V0BB 1NA1A 3MIHA 4Q29A 2VVFA 2TEPA 4YM3A 4IEQA 1B35C 4BQ4A 3M3EA 1H4HA 5KHHA 3AB0A 4HBNA 1K5MA 3MW3A 4QQ2A 4QU1A 3VZLA 2R071 3LFMA 2VOVA 1NCQC 1VAMA 5C3SA 4P02B 4FQ4A 3HT2A 2QVSB 1R1A2 4N9IA 1EY2A 2QZ3A 3AP4A 4AHZA 3OUIA 1RYYA 5JZGC 2Y6GA 1UY0A 5K0UB 2IXKA 5C70A 4LOSA 4KWJA 1QQP1 3SKVA 3R6SA 1CPMA 3KCYA 3OJBA 5C8WA 1RXFA 2RMU2 4MXVA 1W6MB 3AX4A 2XBO2 3KS7A 2E7AA 1P8JA 1VP6A 3U4XA 1CAXB 5ACA1 2FDHA 3UGGA 2MEV3 1UU6A 4RGGA 5F3IA 2QQMA 2WNVA 4ZU7A 5JMCA 3JBG3 1UKRA 3J4UH 4BQWA 1LECA 4JCKA 4QAWA 2YC0A 4HN0A 1QXRA 4L2NA 1RITA 5FZ4A 5LWBA 1A8MA 1LGNA 4MGKE 2B42B 3SMHA 3HD8B 4JGYB 4GB32 3SISA 5FCCA 3T4VA 2HWE3 1OQDA 1AXYA 1US2A 2YPJA 2R30A 3K2OA 3O7OA 3RQ0A 4EN9B 3PU8A 5A7OA 2X5IB 2HWB2 2ZEXA 4Q4V3 2ZA9A 2D5HA 2LW8A 4XJ9A 1RUC3 3KV9A 2D40A 2V5DA 4INDA 5AFEA 3FWEA 4E2SA 1XYNA 5D2AA 2HWD2 5BYNA 1YUDA 4UW4A 4KMQA 4W4ZA 2W1WA 2QTWB 1S0GA 4I3GA 1XNKA 4XACA 3T2OA 2WO2A 3HQRA 3WW4A 4XPVA 2D93A 2RS32 5IVCA 4K3UA 4NPMA 4CP2A 4N8MA 4OI2A 2WN2A 5C71A 5J36A 1YQ6A 4CE8A 4XFIA 2XMLA 2C4XA 3D3AA 1PVC2 1VAKA 1MS5A 5FWEA 1MVEA 4Q0PA 2UURA 1ZA7A 2VZVA 2UY8A 1D4M2 2VXRA 1C8M2 5B4NA 1MZEA 2JE8A 1RHI1 3O1OA 1VR3A 4A45A 1YNAA 1H0BA 4Y20A 4LK6A 4OMDA 2EICA 1HV0A 4R9AA 5CB7A 2X05A 3Q8AA 1CD3G 3L9JT 1J3RA 3O5SA 1JOBA 2XUMA 3Q8CA 3FUOA 3RYRA 1H8TA 4O7XA 4DUVA 3B00A 2WNUC 3T2PA 2D6OX 3WF4A 3T2QA 1LESA 2J22A 2EIBA 4KU8A 2D6NA 4Q4Y1 5GLUA 1GU3A 2P3KA 5FMOL 4XFGA 5FZ7A 3RZKA 3GBWA 2RDSA 1ZZ9A 2XPJA 3WD5A 2HWC3 4FTSA 2QQVA 4HXCA 2BUKA 5EFUA 2W46A 4CDXB 4GULA 5CKQA 3USUB 4GH4B 2RR13 3J7LA 3ROUA 4RR3C 3KHCA 4XJUA 4SLIA 1JZ5A 2R32A 1RIRA 4TZDA 3FHIB 3M4FA 3DXTA 3SITA 2D3SA 4E27A 1W6NA 5T50A 1UQXA 3BTZA 3ZFGA 5FR3A 5A7PA 4FTEA 4DUWA 2R063 4ONUA 2W94A 3FZ3A 4YWAA 4JGZC 1H4GA 2E7TA 3LQCA 1PGW2 2F4PA 2O0OA 3WP6A 2WN3A 3SNMA 5C9AA 3M3CA 4PDWC 1ND3B 3GHMA 3SH3A 3VBOA 1NKGA 3B69A 4WZFA 1VBA3 3H1WA 4X6QB 4YVWC 1ZREA 2JE9A 5LY1A 4QGMA 1RUF2 1REEA 1OPOA 3PJYA 1WCKA 2WZEA 2IXJA 1S0JA 2AREA 5KHKA 5CG9A 5IW0A 3D6EA 4GAZA 5FZDA 3I97A 3SH4A 3O1UA 4B7KA 3WNKA 4CCJA 1QJU2 1ULPA 2WAAA 2FD8A 3ILRA 1OXCA 4RGAA 1RUJ2 1NZIA 4D7YA 2VCAA 5KHIA 2PHLA 3WP5A 3WG4A 4QHBA 2YBKA 1T6GC 1W9YA 1TME1 1I5PA 2PHRA 3M8LA 1S1AA 4Q4X2 2HYXA 1DU3D 1MS4A 4GWNA 5FPBA 3TYJA 1VRH3 2XJSA 5C7GA 4NIDA 3AFKA 3CEWA 4D94A 1NQJA 2ZZQA 3ZSJA 5FLHA 4RSUA 1QIQA 4BQYA 4N9HA 3NSTA 5A70A 2W5FA 3ITQA 4YW5A 4AQSA 3N4MA 5IJRA 3S7EA 4Y4RA 3ZKUA 3N9LA 4QPGC 1JODA 1LEDA 1REDA 2RJLA 3WW1A 2BNMA 1W6PB 3IAPA 5IK8A 1O5UA 3T2TA 3WXPA 3PUIA 3K75B 3C7OA 3ZDSA 3HWJA 3KHBA 3VLBB 4QX7A 2IXIA 2VY0A 4MO3M 3SCFA 3MF6A 1DG6A 4IETA 3E5XA 1UU4A 4XURA 1VE0A 3GBGA 5EJZB 1SLTA 1D4M3 1HN0A 4LBQA 5DAVA 4CCLA 2ZAHA 5HCFA 4AAPA 2GMPA 2RS51 3OYWA 2YGMA 5BNOC 3AC0A 2WSUA 4IW3A 5FYSA 5L9BA 3ZXFA 4YZ5A 4NWVA 1W06A 3BYWA 3MLJA 1CJPA 1RUH1 2BGPA 2E6VA 2F4LA 3MIDA 1PO13 2WWSA 4UBGA 4NRMA 4IUGA 4N43C 1H30A 1XJAA 1XNDA 1AX1A 4NN0A 1HRI3 2VQ0A 1AJKA 3WQ7A 4ARXA 4J6GA 5EJ1B 4I0BA 3KVBA 3OOXA 2QQKA 2P3IA 1A8DA 1OLMA 2X53S 2B4KA 4E4SA 1CAUA 4EE2A 1CX1A 3MF9A 4CDQC 3TEYA 2WZR2 1NYWA 2IXCA 3VBUA 3AMQA 4K8RB 4IE6A 3M70A 2Y33A 4CU8A 1GICA 4FFIA 1FXZA 3LOBA 4XVHA 4WM7B 3TEXA 5C4WB 3NKTA 4FPFA 3ZN6B 3QOPA 2EXIA 1BBT2 4QKBA 3U10A 3UJOA 3MI8A 4X8PA 2EVXA 4KNCA 3I2OA 2QKDA 2XLGA 2GC2A 1ZBE1 1ZBA1 1BQPA 4QPIA 4OZOA 4QB2A 2J42A 2PAKA 4A4AA 2AGSA 2NLRA 2OVUA 4LA2A 1AYN3 5FP7A 2WO1A 4QWNA 2V4VA 4AFCA 2G19A 4N53C 4Q27A 1R082 3VBHB 1RUD1 2BP6A 3BU0A 4WVWA 1O59A 2Q0AA 2A71A 3LPGA 4I0WB 4XF1A 2GNTA 2VMEA 3RVHA 4C1WA 4JV4A 5BNPA 2J1TA 4OHVA 5JOWA 3IZOA 4UFLA 1Z7S1 1JUHA 1V70A 5C8CA 3WNPA 4NO4A 3MLLA 4Q26A 2ARAA 4P9WA 4Y1UA 5FZ8A 2ZOEB 2BOIA 2ZACA 1K12A 2Y0IA 1SACA 2EXKA 3UK9A 4BISA 1S0IA 1UX7A 1W6QB 3WDYA 3PJQA 4E9KA 1PIV2 5FMCA 2Y6JA 3URFA 3I3MA 4B1MA 4V2VA 1JYVA 4XILA 1NA1C 2WAOA 1C28A 4AI0A 3U78A 5EYXA 3AZVA 4HVQA 4Z1VA 5A3LA 1SLIA 4CUCA 1XQNA 1PGL2 3FN9A 4XDOA 2JENA 5JSOA 1EP0A 1K5MC 2O8OA 3ST7A 2QZ2A 3JD73 1AR72 1UX6A 3FJSA 4O65A 4FBFA 2Z69A 2JICA 4KGQA 1MS1A 1GKBA 3ZKYA 5KC6A 1MEC1 1COV2 1RUI1 4AHXA 1JHNA 2WFF2 5IATA
chains in the Genus database with same CATH topology
5L7OA 1QJY2 3AMMA 1XYOA 3D5OA 3TRSB 5L19A 5AVPA 5CFCA 1H2NA 1OFSA 4RS5A 3GBFA 3KT7A 2WNVC 4L97A 1IZ3A 4P9LA 2CV6A 2ZZJA 4LBMA 2XJUA 3WDVA 1SFYA 4TYSA 4PQ9A 2IZWA 4MGIE 3S0MA 1ZX5A 3D82A 1LENA 4XF0A 5ABJA 2CAVA 4LUMA 1R1A1 1HV1A 4HMZA 1IKPA 1SLAA 1GSLA 3HQXA 3B5LB 2BVVA 2AYHA 2ZKLA 3MIBA 5AFBA 1C8NA 3CJIA 1AR83 5T5LA 4XTPA 2DUOA 2RMU1 3TBDA 4AEKA 3ECQA 1EV11 3S6PA 4XETA 2QNKA 3ELNA 1JH5A 1B35A 1FV3A 4AFDA 1SLCA 4U2AA 4UBHA 4BM8A 2QFEA 4K7JA 1ENQA 1BBT3 3GZAA 3A4UA 1NCQA 1ZRFA 4I09A 5JZGA 5I93A 4PLMA 2ET7A 2BWAA 2RS12 4X8NA 5A32A 3OGJA 2XLFA 3RMXA 4NVPA 4KH9A 1ASJ2 4KBBA 1BVVA 2HWB1 3GALA 4XIKA 5AC91 1ZZ8A 1OOPB 1V00A 3KD4A 3VHOA 3ZSMA 1ENRA 4XHBA 1MR5A 3AMNA 1PO23 4P9JA 1LU1A 1POV0 1RUG2 2XLAA 4W6WA 4DRRA 1F2NA 3NO8A 3O0XA 1H9WA 1LR5A 1YFXA 4RHV1 3UKTA 4HL0A 1Q8OA 2MHFA 3LGRA 3OBRA 5I8YA 1I3HA 2Q4SA 2DVGA 3HAGA 1KJRA 2DV9A 4YVSA 3ZN4A 4W6XA 2VOKA 1TE1B 4FAGA 1WLDA 2FQPA 2NMNA 4LUKA 2DFBA 2ARBA 3ZSLA 2D5FA 3IDBB 2A3XA 1SBDA 1UZYA 4COWA 3E97A 4ATEA 2A6XA 2D44A 2NMOA 1FOD3 3QACA 2TUNA 1RUOA 4MGYE 1DBNA 1O4YA 1AYM1 2OPKA 4LO8A 4KL1A 2WFF3 4XFAA 2GALA 3ZFGC 1QHDA 5DDJ3 2C9AA 4AQ6A 2G9FA 3FLPA 4AEDA 3E6CC 3ZXLA 5C9AC 5DZEA 4M3CB 1AL22 3BALA 1YCIA 3GF6A 3WDUA 1WCSA 3LA7A 4FPYA 2GC0A 4QD2A 2A7AA 5FLJA 4FT8A 4JDNA 1LOAA 4K21A 4ES9A 2EA7A 1YHFA 1ULFA 3HT1A 3NJZA 4YW4A 3LWCA 1FMD3 4YRDA 4XJAA 2WNEA 3BCWA 3IPVB 4EROA 3BU7A 4XDQA 4H55A 1GFF2 1QH6A 1RMU2 2YXSA 2ZMKA 4J1XA 1VBE1 2K2SA 1NQDA 1QQP3 4XE9A 2OUHA 2VMGA 2YROA 4I02A 4FPKA 5DUWA 3J8F2 2Q30A 4AE2A 4XJ8A 5ACA3 3RWNA 1WCDJ 4KG0A 4IV3B 1D0HA 3TN91 3MIGA 3NAPB 2HYKA 4PDWA 2FHRA 4LE3A 3WLUA 3MEPA 4JQRA 4H3WA 4QM8A 1UAIA 2GNBA 5HCAA 4Q4W1 1CN1A 2JXAA 5FBZA 1RUG3 4ASMB 2VQAA 1MQTC 2DVBA 2V5YA 1AJOA 2P37A 3THPA 5T54A 2GAUA 2W68A 2HWF3 3AZYA 4IEUA 4WM8A 2JG9A 5JVVA 1NE6A 2B7YA 3S30A 4B4QA 5GZCA 4IEPA 3NW4A 2XJTA 2QQPA 2UWCA 4XQWA 3B9IA 4K1ZA 5JOXA 4IXLA 1FPN1 1IPKA 3MW4A 3EHKA 4FPCA 1JN2P 4ISRA 4MGZE 4QPIC 5GLZA 3FLRA 3NV2A 3R4UA 2JG8A 4HKWA 4ASLA 4XQ4A 2LTNA 1C5HA 4BLJA 1DDLA 2B9UA 3FC0A 5D8AC 2BQPA 1HW5A 2D97A 1X50A 4D7TA 1YO8A 1CR7A 2MEV2 2JKBA 4HK9A 3JBG2 5I8TA 4B8EA 5A33B 5H9RA 2YY1A 3ZVXA 5BNPC 2QDRA 4GKYA 5C8CC 1XE7A 3D4KA 2A3WA 4FPJA 4SBVA 3TAYA 3P3NA 5T55A 4ISQA 3WUDA 1XRUA 1BMV2 2CL2A 2GMEA 4FOVA 2HWE2 3VBRA 1ALYA 2WFPA 3ILFA 5E8AA 3VBSA 1XU1A 1D0GA 3JQXA 2VMIA 2P17A 3HN1A 4Q4V2 2YDEA 1DQ6A 1RUC2 2R49A 4AI1A 2VH9A 2X29A 1R081 5CFDB 2WS92 4C90A 3M2MA 5IK7A 4EN7B 4DINB 1FX5A 4RQPA 3J9SA 4HVRA 2ILMA 4LHNA 2I74A 3MW2A 1RMU3 4YG3A 4R4ZA 3FMGA 2GZWA 2GMMA 1HQWA 4XF9A 3I4IA 3WW2A 4IEWA 3ZO0B 3I8TA 4CP0A 4N53A 3VKOA 1YIPA 1DQ2A 2JECA 4BHPA 1PIV1 3ASIA 1OKQA 3R05A 3AM2A 1I1EA 1J58A 4XFBA 3JU9A 2PHFA 5CFCC 1UF2C 4RS5C 4K1YA 3RS6A 2NZ9A 3WR0A 2NM1A 5BY5A 2O1QA 1V9U2 3CLPA 4COYA 1RB8G 1CAVA 4LHLA 3AP5A 4DS0A 2YYOA 1J3QA 3JQWA 3KQRA 1H8TB 1OMIA 5ABJC 3JB4C 3KCXA 2VNRA 2XVGA 1S0FA 2WKKA 5LRRA 4LBQD 1TME3 2HKXA 1WW7A 2EAAA 3AKSA 3CJIC 2OYZA 3BODA 4YFZA 2TBVA 4P9XA 5KHGA 3DF0A 2HWC2 2WT1A 3ZFEA 4Q8KA 3RRDA 2RR12 4LTAA 3ES4A 1DQ4A 5GLWA 4EWDA 1YFWA 3I59A 1OI6A 1HRV1 1WA4A 2GC3A 3W59A 1GNZA 2GNDA 3PVNA 4R4XA 2R062 4O9EA 3IWZA 4A3XA 1UPIA 4OLLA 4LA3A 2OUJA 2RS53 2VPVA 3WDTA 3KB5A 5C4WC 3VBOB 1VBA2 1RUH3 3AK0A 5KHJA 1LHUA 4F8AA 4E2GA 3POWA 3ZMOA 4MSVA 4K8FA 1DIWA 3FX3A 3AYAA 4NHKA 1EPWA 4HN1A 3EXUA 3FBYA 3DGTA 4YVSC 4BIFA 3VBFB 2EXJA 1VLNA 3IM0A 4B3NA 1UZZA 4EN8B 2KXLA 3PHMA 2WS93 3E6DA 3M3IA 2G4IA 2Y26A 4F7ZA 1VRH2 4QX5A 4XOGA 1OLRA 1JOJA 3ZFFA 4M0HA 2AZ5A 3NVCA 4I2OA 3PVOA 4FTBA 1CAWA 2CTVA 2ERFA 1H2MA 2JDZA 2IFRA 2V09A 1ZYBA 4LE4A 1DYKA 3WNXA 1SFNA 1U5XA 4LO7A 4AFMA 1AR91 2I07B 1G7YA 3THTA 3ZXGA 1ULCA 4HKLA 1Q3EA 2ET1A 1X82A 4CEWB 4AYUA 4AEDC 4CEYB 4JTNA 1Z7S3 4MZUA 4COUA 2NPIA 3T1LA 3B01A 5LEKA 3MFAA 4LO4B 4B7EA 1XE8A 1PO12 4K20A 3AZZA 2CWSA 2VW1A 2WT2A 2SBAA 1V9U3 2R042 1HX6A 4L9BA 4Y1XA 1HRI2 1YI9A 4YYOA 4EN0A 3OCPA 4BLIA 1S0EA 4DRVA 1A6CA 1VAVA 1CGPA 3ZIWA 4XYXA 3DPRB 2WIIB 3OD0A 3VBUB 3ZSKA 1Q8QA 4DXZA 3MYXA 1H8VA 2BEOA 1H2KA 1I5ZA 1AR61 1OSGA 5LEJA 1YLLA 3N7KA 1WW6A 1LHVA 2CYFA 3EQEA 5JSRA 1NY71 4FPGA 4Y22A 3BB6A 1AYN2 2VULA 4AEMA 4YM1A 1GLHA 1HLCA 3N36A 3SHRA 4B4RA 5L36A 3V0BA 1VBC1 2A70A 4Q8LA 2G9GA 5FMOS 1YYNA 3ACLA 4YG0A 4LLOA 1G9AA 1S0DA 3DKWA 3M1HA 1XXNA 1HKDA 3WHUA 3QH6A 5FOJB 4Q0SA 1F31A 2CGPA 4COVA 5IT6A 2RM22 2WINB 1JXNA 2LUWA 4R9DA 4NWWA 5K0UA 1URXA 2XJRA 4FPEA 3U0ZA 5CBLA 3SCHA 3LOIA 3DUIA 1NLRA 1W6MA 3GYDA 4WM8C 2OIIA 2JG9C 4C91A 1EV13 2BTVC 2XVLA 2D6PA 2I45A 2XVKA 3J8F1 3FBMA 3VDDB 1CAXA 2FBEA 3OTFA 4ZXKA 4P9YA 1QJX1 1GQHA 4IV1B 5KWRA 2PHTA 2ZAAA 1Z78A 4KWKA 2PHDA 3ALQA 4UXAA 2D43A 1BEV1 1GR3A 4AFAA 4XBLA 1QY4A 3CNAA 5BV6A 4GALA 3JD72 1L3JA 5KXDA 4FOQA 2VNGA 1XNCA 3BPZA 1WLTA 2VUAA 4XJZA 3PTYA 1R091 2OZ6A 1NOVA 2JG8C 2A6WA 4CDWB 1QJZA 3AP6A 4R52A 2X5IA 2ZX0A 3CL1A 5L7OB 4CDUB 1FNZA 3MLKA 3RYKA 1AZDA 2AENA 3QCWA 4FSJA 4RHV3 4KG8A 5F6KA 1TMF1 1KITA 4KU7A 3TOJA 1PK6B 1UKGA 1V6JA 1MQTA 2VGDA 2ZPXA 4I30A 2GU9A 1WBLA 2R043 4Y1VA 4AGGA 1WMEA 3WG1A 4WVZA 3VBRC 4HFSA 4N7IA 1ND2B 5EV7A 1AR82 1PGSA 1N1TA 3VBSC 1ZNPA 1EAH1 4IQPA 3G6JB 2B5HA 4X6RB 1B35B 1GZWA 2VNOA 4LBNA 3MPBA 1HXS1 4JTOA 3MGUA 4RQPC 2DCKA 4AG4A 3TB0A 4FOYA 3B02A 3JCIA 1NCQB 4QQHA 4BMEA 5E16A 1YIFA 3OY8B 5T3NA 1AYM3 4K6BA 4OVEA 5JZGB 1HDKA 1QOSA 4G4FA 4PIZA 5D8AA 1SEFA 1BMV1 2WA4A 1DZTA 3AXEA 2PLV1 2HWE1 3FLTA 1TNRA 1O91A 1U5IA 2BPA2 3SLIA 3AKQA 2B45X 1N3OA 1W6OB 2B8MA 4I0AA 1PO22 1YJKA 4P9GA 5E88A 4CDXA 3FFQA 1Y7BA 3USUA 4GH4A 1BCXA 4S2DA 4ZU5A 1J59A 2RM23 3ZYPA 2KA3A 1RUE1 4LHKA 1LEMA 4LLFA 1J3PA 1NLSA 2XL7A 3N7MA 4Q1PA 2UU8A 4AGVA 3NKGA 3ETQA 3DV8A 5F6LB 1N1YA 3HMYA 4JAAA 1ND3A 2RJKA 2TNFA 1OPMA 2P34A 4YW3A 1VJ2A 1LODA 5FLIA 4QM9A 5I91A 1LB2A 1W39A 4YGEA 3ZXAC 3ZFEC 4YM2A 1LCLA 1HQLA 1LULA 3KT1A 2W52A 1FOD2 1J1TA 3ZSEA 1VBB1 4HK8A 1X33A 3UL2A 2HEYF 2R6QA 2ZJCA 1ENSA 1FYUA 3BOPA 4F83A 2FZ2A 5DDJ2 1SDWA 2BBVA 1V6NA 4Q4W3 1A3KA 1FATA 2AH2A 3V0AB 2A3YA 3WOGA 4EJRA 4L99A 2HWC1 2GNMA 2B46X 4JDOA 1W6PA 1TQ5A 2RR11 4XTMA 1O5LA 2PELA 2WNUB 3H7JA 1VBD2 2R1BA 5CA6A 2F6BA 2XWJB 4FP2A 5GZDA 2Q5TA 2UWAA 1ZA4A 1FMD2 5F1RA 2R061 5FREA 4B4PA 2JJ6A 3I7DA 2XBO1 3FE5A 3ZPYA 3WZ1A 5GZGA 1YFUA 1ZZ7A 4YM0A 3H9AA 3WCRA 3VHNA 4AXOA 5GALA 1MZFA 3EO6A 1G8WA 1NCRC 2PA7A 2QE3A 3ZFFC 5J7MA 4RR3B 4QPYA 2K0GA 1QQP2 4S2GA 5BNNC 4NHLA 1WMDA 3RJ2X 1QOTA 4GB31 2WLQA 3HIFA 5ACA2 4XIOA 4YARA 4JGZB 5JIAA 4WM7A 2DUQA 2BFUL 5C4WA 4PDWB 1GBGA 3ZN6A 1ZRDA 2PHWA 4AVSA 4YVWB 4D7SA 3VHPA 5BPXA 4IL7A 2HWD1 1VRH1 2GN7A 1LKNA 2DVDA 2O8QA 2ES3A 3OBTA 4YNIA 5J37A 1O3SA 2DUPA 4HVOA 5DG1A 1OA4A 2RS31 4C1XA 1O4TA 3VGIA 3M3OA 4WBBA 2HWF2 3UJQA 5KXCA 4AHYA 4BA6A 1O4ZA 3PVBB 1MACA 3VBHA 5K7PA 1KFXL 4GMP1 5I0SA 4R9BA 1M4WA 2ZGQA 2Q1ZB 1PVC1 1GV9A 4E2QA 4Y1YA 3K48A 1F5JA 4YZ2A 5KXBA 2CAUA 3WDXA 1O3QA 1D4M1 2QJVA 1C8M1 2NQYA 1XU2A 3LKJA 4OI4A 5F9TA 3JUUA 3ME2A 1UW8A 1YWKA 4FP3A 4QPGB 2E51A 3IKWA 2A5ZA 1PO11 2DU0A 2DYCA 4FXKB 1LTEA 3LSDA 3CF6E 1W6QA 1WLWA 2ZX4A 1DGRA 1QXPA 4WVVA 4KQ7A 4XJWA 1UN1A 1OHFA 1LHOA 4XFFA 4CZSA 3O12A 3R4DB 1CQ9A 2ZHNA 3VN4A 5BNOB 4GXLA 2Q8OA 4MXWB 4BZ4A 3E6BA 1LOBA 5J48A 4N43B 2ZGUA 3U07A 1OD5A 5K0UC 4QU2A 2BVBA 1H2LA 5JWPA 1VBD3 3X29B 1RVF3 3QLQA 1X8EA 1AYN1 4RA0A 1N3QA 4GKXA 3CJXA 3V56A 4MUVA 4CDQB 3RZZA 3NL1A 1DGWX 3B9CA 3D0JA 3V64A 2DVAA 3ATGA 1PGW1 2XGXA 3ILNA 2A75A 2R073 4Q0UA 3B3QE 2LM3A 2ZGNA 1N47A 2FMYA 1CVNA 3VZKA 1UU5A 4IERA 4FQZA 1RUF1 4IESA 4JGYC 4GA9A 1GZ9A 4J1WA 3ZXKA 1M06G 2IXHA 4D69A 2IWGB 1D4VB 4YGBA 1OQEA 4N53B 1QU0A 1JYCA 1C4RA 2X5IC 1QJU1 4XXPA 3WDWA 1LRHA 4FCAA 1AX2A 1RUJ1 5GJ6A 1LHWA 4WVMB 3AKPA 4AVVA 2DTYA 3H1MA 2CGOA 3VV1A 4F3JA 3H7YA 4Q4X1 4HANA 1IS3A 3KSCA 4C0BA 2WJSA 5D1IA 4AI3A 5FQ0A 5B2GB 1CAVB 5KC5A 1J1LA 1GQGA 4A7ZA 2GN3A 3AJZA 2PFWA 4NOTA 2C0ZA 1UPSA 2ZGLA 3TWIA 1TME2 5H9QA 5DUVA 2EALA 4AQ2A 4BYYA 4EWAA 1NA1B 5DXDA 2XL9A 4JC1A 1RC6A 2Y0OA 5FFOC 1QGLA 2E53A 5HI0A 1N1VA 1JTZX 1K5MB 1C3HA 2BNOA 3WV6A 1AR93 2GDFA 3MZHA 1DYPA 2IFWA 3N7JA 4K40A 4BMBA 2D98A 2DURA 4XZPA 3KM5A 4XEZA 4AQTA 4URTA 5E89A 3D0SA 2RS52 1RHI3 1AR81 5JSPA 1X8MA 1G9BA 1H1MA 2WZR1 1LGBA 2WNVB 1RUH2 2P2KA 1DGRN 3VKNA 1BKZA 4EV0A 3VUOA 1KDKA 4CDXC 1AL0G 2A6YA 4GH4C 1BBT1 3D8CA 3QD6A 3KMHA 2UYBA 2YGLA 4Z92B 4HPKA 4D3WA 1V6MA 4AF9A 4OZXA 1WD3A 1C1LA 3AP7A 3UV9A 2N7GA 1LJ7A 4Q4Y3 3MFCA 4C0HA 4WZCA 1MS9A 1BVP1 4OUMA 1AR63 2XH6A 1ND3C 4M3CA 1AHSA 5FPXA 4XMAA 4AVCA 2OW4A 2XHKA 3AFGA 1ZBE2 2KM2A 1V6LA 2A6VA 4Y4YA 4W6YA 3S7IA 4E4ZA 1G6NA 1LOGA 1KQRA 4XW3A 3AZWA 4OULA 1OA3A 4H7MA 3O0VA 4QQOA 4Z07A 1RUD2 1I9RA 4XF3A 5J3UA 1S2KA 4AW7A 5FDBA 4PBOA 1ZM1A 3IPVA 1ENXA 3HR9A 2XWBB 5DUUA 1PHMA 1RGSA 4XQDA 2ZABA 1Z7S2 3VZOA 1KD7A 4O9GA 2D6MA 4ZU4A 4Y20B 2VOXA 2JE7A 4CYDA 5JIUA 2Z2SB 1A78A 1ZZCA 2ENRA 1PGL1 4UW5A 2C5DA 2R1DA 1AR71 1ZRRA 3POYA 2H6BA 5T52A 4HSJA 4G9SB 3MIEA 1X7NA 1QJX3 2ARXA 1COV1 4IV3A 3ZXEA 1Q8PA 4Y5Z0 2WFF1 3NAPA 2XKPA 3WQ0A 4EN6B 1QJY1 3L2YA 1GANA 3RG0A 1PZ7A 3RDIA 4CTEA 1O3TA 1CONA 1BZWA 2ZS6B 3POSA 2IXLA 2VMHA 3LCPA 5H9PA 4NHMA 3UKVA 2Z42A 3MIFA 4A2UA 1R093 1JW6A 1S55A 1ONAA 3H50A 2YHJA 4ORFA 2DFCA 1PZ9A 1W6NB 3AMHA 5BNQA 1OQ1A 2DU1A 3ZFGB 2JEMA 3I54A 1GZCA 1S2BA 3ZXDA 2D3PA 2ZHMA 4LO5B 5EWSA 1DLLA 4YZ3A 1FMD1 3WCSA 3JB8A 4WM7C 1TMF3 5C9AB 3AJYA 1F8VA 1WW4A 2MPFA 1VALA 4Q0VA 1AX0A 1IKQA 2XJPA 2D7FA 2DF7A 4XFHA 1N1SA 2XJVA 1X36A 3LB9A 1SCRA 1JBCA 1EAH3 1EV12 2RS11 4GIQA 1QWRA 3VBHC 1DQ5A 1LOCA 2WC2A 4LBJA 3WUCA 5FOBB 1JYIA 1HXS3 5A33A 4MVTA 1ASJ1 3RI9A 2DCZA 4IEVA 1IOAA 1NCRA 3AYCA 4UW3A 3O0WA 2ZTNA 1ZBE3 1ZBA3 2OZJA 1C5IA 5F5QA 1KXGA 1RUG1 2HEVF 3O14A 1SCSA 2R0FA 5BNNA 5C33A 3A0NA 2ZX3A 3PNAA 2PLV3 1RUNA 3MICA 2WT0A 2ZX1A 1RUD3 4A7YA 2HWF1 2PHXA 4JVAA 4LBLA 5AC92 4Y26A 3RMYA 5CFDA 1D2SA 1GYKA 3R0RA 5JLVA 5DG2A 3SH5A 2ZX2A 4LBQB 4RHV2 4YGCA 3OYWB 1PMIA 1CIWA 1RUE3 4R8HA 4MH0E 1S0CA 1NXMA 2WLPA 1U5YA 2UWBA 1MQTB 5CADA 4U36A 2WSVA 2PN5A 1Y9QA 4RD7A 1IPJA 5AVAA 5IK5A 3NWKA 4BCUA 2VG9A 1CAUB 3H1YA 1Y3TA 4OHYA 3BTAA 1TEIA 2PQQA 1GZWB 3LA2A 1G9FA 5FO7B 5CAZA 1YXWA 1VB2A 4Z8BA 4XXAA 4IEZA 1FV2A 1FAYA 2R0HA 4AI8A 1AL21 1VBB3 4AGRA 5EZWA 1MEC3 1AYM2 1RUI3 2E7QA 4QPIB 2PYTA 3B7MA 1AF9A 1QOOA 1QKQA 5D8AB 3DL3A 4QQLA 3WG3A 5T5PA 5I0UA 3ZXJA 2CWMA 2W08A 2K9ZA 4LR4A 5BNPB 3WT3A 2A6ZA 1KFUL 5C8CB 4Q2FA 5FPZA 3IT8A 1RMU1 2RHPA 3VKLA 1FI2A 1R1A3 2QDNA 4M00A 5I0TA 3C3VA 4PLOA 4YGDA 1AXZA 1NG0A 1DHKB 4HSLA 5JPNB 4Z2WA 5HCBA 1ZVFA 1BYHA 2RMU3