4N48A

Cap-specific mrna (nucleoside-2'-o-)-methyltransferase 1 protein in complex with capped rna fragment
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
407
structure length
401
Chain Sequence
VDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDRELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
publication title Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 137
structure length 401
sequence length 407
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n48A00
4N4AA 4N48A 4N49A
chains in the Genus database with same CATH superfamily
4ETIA 4QZVA 3C6ZA 3CXUA 5L53A 4L5IA 3HRHA 5EE5B 3ME5A 2RHWA 3NTRA 4H7HA 1WVIA 3GPCA 3FPBA 5F7OA 2GZRA 2NU8B 4GMDA 4U2EA 4YXWD 2IXEA 4CMCA 5DNCA 4RIEA 2Q2VA 1NP3A 4TYNA 3AKDA 4JMLA 3VDRA 3T7JA 3OY2A 4X7PA 3K5IA 3E3MA 1DVRA 4AN4A 1UP6A 2IYAA 3HCPA 3I32A 1SVNA 2GTIA 1XK6A 1NBIA 1K5DA 3TMYA 3L4BA 4G0MA 3Q41A 2Q9UA 2D3WA 5HPYB 3L8HA 4ZCPA 3KAJA 4TLDA 2ONKA 2CUNA 2BFMA 1Z5OA 4QQRA 5HCIA 2IU3A 2H29A 3UJCA 6CHYA 1O95D 2P68A 5HXAA 3CUEF 1GTRA 3T5GA 4EB3A 3DAYA 3M4XA 5C7IO 2EJWA 3FCAA 3M82A 2X2OA 3TLAA 4JGIA 4W63A 2X19A 2H1VA 1UKAA 1G6KA 1G21A 1Z33A 2DT8A 2QRVB 4FMPA 4R1SA 3MSXA 4DWVA 5B6IA 1R12A 2W2LD 1M1YA 3A1VA 3QVVA 3E18A 3B9BA 3G1TA 1HDZA 3GJXC 4BZZA 5SZJA 3U62A 5IZCA 1N57A 2RBEA 5HFAA 3GO4A 2WYVA 3U7GA 4DSOA 1E4EB 3LIIA 1M8FA 1TJPB 4ZK6A 4EI2A 2SKDA 4KO4S 1OFVA 4ZO4A 1EG7A 4MPJA 4H6WA 1B6SA 5FJJA 1QHSA 1W34A 2E6KA 5H70A 1DCFA 3PXDA 3GEBA 2HUNA 4EY6A 3HO1A 1CIJA 4G1CA 2VJYA 4KWTA 1VFNA 2PXAA 4V0QA 2D5AA 1L4LA 3EVEA 4NV0A 3ZCSA 4ZJYA 3TOVA 1ZAKA 5BUCA 1OHHA 1YDWA 2QX6A 2QVLA 3P9YA 1KORA 3N0TA 3MMPA 2PDAA 1UFVA 1E8DA 1KVUA 4GYJA 4K88A 4QAQA 4Y7DA 3BVPA 1J2YA 2NTJA 1N7JA 1JH9A 3HCBA 2F9MA 5FFNA 1KFJB 1T9KA 3C7CB 4GWGA 2XGJA 2NG1A 2WWTA 2B35A 3IFSA 3WRXA 1SUFA 1QHIA 3TSCA 4MW6A 4D3XA 2QJFA 2CBXA 2M6SA 3DWGA 2I87A 2PZKA 4J9VA 1EUYA 4CG3A 2YVQA 3C97A 1JJVA 3LOUA 1K6MA 5E9JA 2YBDA 1UJMA 4J49A 3FSJX 4IHAA 4M0CA 1IEVA 1H3EA 2XQFA 5BQOA 4FD3A 3SHFA 1KIMA 1XZQA 5IJ9A 2WNSA 2C58A 2JZNA 1X3LA 1JHRA 2A67A 4LIPD 4MB6A 4XZ3A 5JFTA 4FZVA 3UPDA 2F7SA 2HQ1A 1TIPA 3F46A 2ZIXB 3ZGZA 2P0EA 4FMCF 3VX3A 3R9XA 1L7DA 3EXIA 1K3FA 2IQIA 2ZSUA 5LDDC 1Q3KA 1O94C 3IE2A 3SEAA 2HU8A 1YVEI 3ZHVA 3HDQA 1GGJA 3UT5B 3A1EA 4QUIA 2WAMA 4X3PA 2UYQA 1C0LA 1VJDA 3H0KA 3JQAB 4LRUA 2VRCA 1HC7A 4HDNA 3UTDA 4NFHA 3FSGD 5HQJA 2Q1YA 3GFGA 2H7XA 4YCBA 3I1JA 4S2EA 1L5SA 1I3OA 3JQ8A 2LR0A 3BF7A 1GL7A 4M0MA 2VZ8A 1IRXA 3NWOA 3HEAA 4OXXA 3VPDA 1RQXA 4HATA 2QW0X 4ZVOA 1QVVA 1VSBA 1R10A 3DMNA 1G5RA 4JUFA 3RVSA 2ZRGA 3K0BA 3CZMA 1A2BA 2W6MA 1NP7A 5TR9A 2IYUA 4ZJPA 2FWPA 2O8NA 1Y8CA 5HQTA 2M9MA 4RHFA 1LPAB 1ZHFA 4MGEA 2BJWA 2Z3WA 3PJEA 4JDUA 2BHNA 3WYEA 1GUAA 1DJPA 4E31A 1ZVVA 3HJCA 3L77A 4JZKA 3IGFA 1U3CA 2CBGA 3AESA 1XWIA 2D1SA 4GW3A 4XX0A 3A37A 3KEMA 3VYSB 1QYDA 4MICA 3DKVA 4K40A 4CEIA 5EPUA 4Q4JB 2VAVA 5BR1A 1RS0A 5JY6A 2EW8A 4OI4A 4AKIA 2AG6A 3WGMA 3ZD7A 2Y76A 5IDYA 3I2GA 3ZG6A 1LS6A 4P7JA 2ZUFA 4MI9A 1ENOA 3RF7A 2BY4A 5ICCA 1PJTA 2AZDA 2IVZA 1Y4SA 4BKOA 1D0IA 2PSFA 1UT6A 3OQMA 2W8ZA 2IU6A 3I8XA 4PGAA 2R3SA 2G82A 3SXPA 3YASA 3KEGA 2LWIA 2H4YA 4LW8A 3BD9A 3E7WA 2C3YA 2F3SA 3U37A 2HTFA 1PLJA 2CXHA 3R74A 4ES6A 4LOIA 4HD8A 2HYDA 2WVGA 2WC1A 2HIMA 1D2HA 2IBMA 2ZTUA 4JP1A 2KPOA 3D3NA 2QS9A 3V8PA 1FDIA 2XUDA 4PNHA 1JLLB 1A1VA 5E1MA 1BHO1 1UMCA 2J48A 4HTFB 1WXHA 3H2KA 5F1PA 3R23A 3DULA 3R0VA 1KYYA 4RS3A 4UXIA 1CXZA 1VKOA 2H0AA 1HQDA 3PD1A 4UAJA 3ZHQA 4MW0A 4EFDA 1YR6A 2GPAA 2VNHA 3PRYA 5ALSA 1ULSA 1BXRB 3KR9A 4UU0A 1JQDA 5CJ2A 2FWNA 3PYLA 4DRZA 1JYSA 3STXA 3C7AA 2VTKA 4OD0A 1NPDA 4QOJA 2FQXA 2FE1A 1UBNA 4BL5A 1NG1A 4FBLA 2D5CA 4C21A 3SJBA 2UYGA 1L5NA 3EUWA 2VI5A 1GTL1 5JH7F 4QGBA 1JKMA 3D6MA 3B78A 3GLFE 1H1LB 1NVEA 1D8AA 2O3SA 1MQ9A 1N2EA 3UG7A 3TVDA 3UEOA 4DQ0A 3O94A 1KSHA 1MO4A 3BL6A 3HCRA 4G37A 5EIFA 1FDRA 4U3JA 1RP1A 1WZUA 1XA0A 2FZVA 1YZGA 5ITWA 4IQGA 3DEKA 3GLQA 1K5GA 3RODA 2Q41A 3I0MA 3DDOA 3KDAA 3INYA 1VSQA 3TL3A 2FWJA 3G88A 4OFBA 2JIDA 2XUPA 5IFLA 3FTNA 3CSDA 1QNFA 3WWPA 3A9SA 2W90A 4FYHA 4EB0A 4EFKA 3SZUA 2X2FA 2Z5VA 5F2KA 2OY0A 3EGXB 3ADKA 1SCAA 1NQTA 2I6UA 3OFVA 3DLAA 1S2NA 1SUEA 4TM7A 1Z4OA 1MO2A 3ZUPA 2GN4A 4WESA 4YRQA 1NRXA 5BN1A 2XMCA 3EXEA 3JSAA 5IF3A 4L02A 3RD5A 3T35A 3ZEAA 1EIZA 4WK4B 1XKTA 4E1VA 1GCGA 3W05A 1YI1A 3JTEA 4P31A 4LI3X 2R6AA 2FGKA 3UMCA 3H8WA 4U63A 1XA3A 2XUQA 3CKYA 2XYPA 3L0IB 1PEAA 2DJIA 3OI7A 3EBOA 4MGIR 4DA6A 1H6CA 1PT7A 2AFIE 2FPGA 1KMIY 2IC5A 4UNIA 1LB1B 2OILA 5BSFA 4BBZA 3V33A 2CLSA 3FKJA 3FLEA 5CPFA 3EVCA 2O2YA 3FHOA 3LF1A 3ZWYA 4G6ZA 2CE7A 2QP4A 5TS2A 2RIPA 2P1ZA 3RTBA 1RRMA 2PX8A 2ZK7A 3SS9X 4IRUB 3WGZA 3OIUA 1ID8A 3LX8A 1A8PA 4FFBB 3RRYA 1JZQA 1GU0A 1KY5A 1VM6A 3ZCQA 3FOZA 2Z95A 4EI8A 4MZDA 5HMMA 1TZMA 4TT3A 2GJ9A 1D4AA 3ZEIA 3U1BA 2C83A 1RI3A 2JA2A 4KRXA 5DTRA 5IM4A 2ZS7A 3ILHA 2UAGA 3ZZNA 4LOKA 5BWLA 1XDGA 3Q8XB 4YRFA 1ST2A 3FVQA 3HO8A 5JAMA 3VR6H 1MC4A 4D9NA 5LYJB 4U6QA 3B1FA 5M3BA 1A2KC 1DG3A 1GTJ1 3ZV6A 4RTNA 1DS6A 5JZVA 1M2FA 3LHFA 1GZDA 3K0EA 4H2DA 1YBAA 2FK8A 2JGAA 2W2MA 2X6RA 2Z57A 3KYCB 2W6QA 4JEUA 3COWA 1V16B 4M7RA 3RIXA 1ZXLA 4PPYA 2MSNA 3CUUA 3NUGA 4FQ8A 4EPVA 1VE5A 2IEBA 3TRFA 4HX2A 5KSOA 5AOBA 1YMQA 2JHGA 4B3CA 2F3UA 4QL3A 1BXKA 3IRUA 1G55A 1CKEA 3BAZA 4QTZA 3V2HA 1FX0B 3RT1A 5HWSA 4UVHA 3KZ1E 1M0EA 3D6FA 2LV8A 4PW0A 1P0MA 1BN7A 4U8GA 4EHIA 4NCNA 3WWYA 1FFYA 2DUNA 3DLPX 4C06A 1JR3E 4MI3A 2Q1XA 4EYKA 3H9UA 2RK3A 3AY3A 3WLEA 2W6IA 2X9GA 4L7QA 2XUOA 3G59A 2IYFA 2W0SA 5IYZA 3B5EA 5K8LA 4IUYA 4N0MA 3F78A 2PBFA 4L3OA 4KODA 5D1NA 5ESDA 5JYEA 2J7PD 5E6UA 1VOTA 1RKBA 4CTKA 5B4UA 3OFSA 1IM2A 1MB9A 1VCHA 2YWFA 4M8NE 1F2UB 3K5HA 4W9NC 5C52B 4QG3A 3I5XA 1Z6TA 4GWKA 2GSDA 2BGKA 1FQOA 5FBZA 3EVZA 4YMIA 3SK0A 4MW9A 2Q2QA 5ALDA 3G6KA 5BUQA 5K3EA 1ISSA 4RDHA 4XRGA 2CK3A 1NSFA 1VGQA 3W7AA 3H05A 1XDWA 3RYCA 1OWPA 2WZDA 3RUCA 2MJLA 2C57A 3RRNA 3VSBA 3EEOA 1FP4B 4I99A 1DDIA 2V96A 3EW9A 5GY7A 5J63A 3SPXA 3O83A 3VJLA 5IJWA 2W00A 5K09A 3A32A 5K3DA 2AEEA 4P9NA 5CP8A 3UGKA 3VOBA 2FPKA 3LC2O 1CT9A 1KY2A 2EG9A 2ZSIA 1U2DC 3N3AC 3WL3A 2P6RA 1J2TA 1WNFA 2ACEA 1GN8A 2YNMD 4JEIA 4R6WA 2VHQA 1N4AA 1N1EA 1DTWA 3MWDA 3VPCA 4AP9A 2ZWOA 1N6NA 4PR0A 4AJ2A 4ZQBA 2B83A 3KDPA 1S0UA 4CKCB 4RL6A 3G7SA 1GT6A 4EG4A 2Q9AA 1SA0A 2ZRAA 5F12A 4PLHA 4QO7A 5DEIA 3I4CA 2HR1A 3F4BA 3D3KA 3ODGA 5JJ5A 2D8AA 5TT0A 3S5JA 1ZM3A 3WWCA 4L5JA 3T5DA 5C80A 3FMFA 4RDXA 1MAVA 3TBFA 1YRQA 1TZ2A 5AT1A 4GPZA 3UCXA 4HQRA 3K1AB 3IEPA 2UXDB 1F2DA 2AN4A 4NU5A 2BPOA 1OFUA 3L82B 1AE1A 1YRYE 3M2PA 3COYA 3ZXUB 2FN7A 5B55A 1U2QA 4DPKA 5L4NA 3U4MA 1WZ2A 2O2EA 3R75A 4G07A 3QKTA 3SYKA 4F91B 1U8CB 1LVUA 4KE8A 3TOZA 4ZFNA 5GM2A 2PH1A 1XTQA 2P40A 3MBIA 4YH1A 2PK3A 4MDYA 1D1PA 3L40A 8ADHA 4JOQA 2VHCA 3PCXA 4D2IA 1AX9A 2NTVA 2X0NA 3D3QA 3QU9A 1A76A 1GKLA 2E5FA 2ISCA 5CGQB 2H54A 1E3EA 1VHTA 4HPXB 4K3UA 4IIDA 3LUBA 4JMPA 1KO1A 2NO4A 3PFIA 3HVRA 4M98A 1EVQA 1S8AA 4NP6A 1GRRA 1U8YA 4UTNA 3VNVA 3S6JA 2O8VA 3KKMA 1JSZA 1Y3IA 4F5WA 3M1LA 2YHIB 2JJMA 4A0RA 3FH0A 4I3GA 4K9LA 2C8LA 4BATA 1I0ZA 1PQ4A 1JYFA 4HDCA 3DR3A 1YCDA 5BN5A 2HK7A 2CW5A 4FW8A 1K7CA 2Y0EA 3DD5A 4S24A 3URKA 4BB0A 4B09A 1AQLA 1YRWA 3AVOA 4F3TA 1T2DA 4QDUA 3GD7A 3OWOA 4MCJA 5KYXB 3KR2A 2P9GA 1LF0A 2UUCB 2V65A 3BT7A 2IYVA 1U2GC 3MCWA 4PXAA 1XXHB 4R1OA 5AJTA 4CYMA 3UV7A 4HP8A 2HQSA 1PO7A 2I67A 1OYYA 4B75A 1RM3A 1QG6A 3HCDA 5CHEA 4HAYA 4I4CA 2CWWA 1B14A 2DKFA 2IXFA 2QM0A 4MYDA 4YRCA 1Q0UA 4XTRA 1FVXA 5KZMB 4NZYA 1SOUA 3P9PA 4MVCA 5KNBA 1OILA 1CU1A 1JYEA 5HTOA 2G9ZA 2CDBA 4HLQB 1H2BA 4CCYB 2ATEA 4B3JA 2R8ZA 4D9EA 5D00A 4CDMA 4J4BA 2FH5B 1EKXA 3SICE 2CDRA 4RGQA 4KR2A 1RACA 4KSBA 4R69A 3SYLA 1FFSA 3UOAB 3NIFB 2P9CA 1LS1A 3IKMB 2R6JA 3V34A 1KAQA 2RGRA 2CSXA 3LOPA 2VKTA 1YUNA 4LCJA 3DE5X 4P7BA 4TL9A 5I4KA 4B35A 2WHQA 2J6HA 3ZIAD 4FN5A 2P8JA 3ETLA 4HQKA 3PX3A 4NZNA 4KRGA 2X4LA 2I9KA 1NC1A 1CQIB 4QARA 4NBUA 1KE1A 5DX8A 4LECA 4PGGA 4ZU6X 5C5IA 2O50A 1FP7A 2OO7A 3H5OA 1RRPA 3K2IA 1JIXA 3RVPA 3A7EA 1GCIA 5KMGA 1MQAA 4KOAA 1U9YA 2JDID 3H4TA 4R71A 1MH9A 5IAJA 4MB2A 3KJEA 2H17A 4PIPA 1RYFA 5T7BA 2WD7B 1XNHA 3INNA 3L7JA 4X7BA 3SIWA 4BNMA 4WAUA 2YV2A 3VAYA 4F97A 5AM2A 1QZ3A 3G2NA 3K0FA 3N2KB 3REQB 4A6DA 4XCXA 5KNCH 2Q4TA 2AG0A 4CTJA 1U11A 3A06A 4Q1AA 4O02B 4OB8A 3JQPA 2FG7C 3L79A 2KJQA 1KTVA 3J7TA 4HEA1 2HBRA 3SHQA 3SHWA 4CLOB 2Q0SA 1TCAA 3QJ5A 5EE1A 5DI9A 3RRZA 3SDBA 3ONVA 4JOBA 3RC7A 1LZLA 3HA3A 3PF9A 4AO6A 4EYOA 4AZ3A 5EWLB 4YEDA 4C7MA 2E4UA 2HFKA 4EVIA 3EDQA 5JEDA 4B76A 1MP0A 4P7FA 5ANRB 4GP9A 4F7WA 3QVOA 2FZLA 1QGUB 2XLCA 4R8KA 3U3KA 2R9VA 3V42A 3O7WA 4C30A 3DEIA 4ZQCB 4EHKA 1U3FA 3K4PA 4ZP1A 4F7DA 4TKVA 1NVGA 3QXCA 1P80A 3TR0A 5ALKA 3KLOA 3P97A 4KVFA 4WLFA 4OA5A 5F33A 1I2ZA 4BZWA 5I7UA 1GRQA 2ST1A 3COVA 4K6HA 2PAFA 4UOZA 1W36B 2HJGA 2Q1WA 2QK4A 3CNEA 1P0QA 2ZVPX 1QVRA 3FHJA 3RFUA 2XODA 4AX8A 6Q21A 2BGTA 2XBMA 5EE3A 4P32A 2R4QA 5E2AA 4MKXA 3U7JA 4BWYA 1NLZA 3I09A 4J4HA 3GDWA 5LSAA 3B8EA 5EI5A 4UZEA 4DSAA 5JCOA 2D0DA 3X1JA 1E3SA 1J70A 2AOUB 3JR3A 2XWJI 3P0EA 4AFNA 4P4NA 4U0KA 5BPFA 4TRRA 4S12A 4TKUA 2YJ4A 5B3JA 2VR1A 2H2DA 3THYB 3RYHA 5HIIA 1I94B 3RR2A 1WY7A 5EMKA 3TD6A 3V2IA 4EB6A 1RHMA 3PU6A 1I0IA 3W5DA 1XIVA 3RTGA 3QSYA 4HTAA 4HR7A 4WFIA 4PFSA 3CUSA 1XF9A 4J76A 4WLOA 4ALIA 1DJOA 1RWXA 1E0JA 1T29A 1W48A 4MWSA 4BGVA 1C7QA 3LX5A 1CV2A 2G72A 3OQIA 4ZQFA 1VI6A 4A8JA 3TUZC 4JXJA 4OM8A 1Q83A 2QTAA 3W8FA 2YKGA 2FPXA 3UCEA 1ZCBA 1K4MA 2JPDA 1VIYA 2XTNA 4XYBA 1JFFB 2HZBA 2EF1A 1Y6JA 4DSTA 1X7HA 1ZH2A 4JEHA 4MQEB 1H8HD 4LDRA 1U1DA 2VAXA 5HEKA 3CUYA 2W2VA 4KXVA 4P38A 2RSLA 2Y2UA 2RB5A 2AOTB 3GRCA 3MZ0A 4P3OA 2B5VA 2VP9A 4QO8A 5ALQA 3CJQA 3CLTC 1Y3AA 4PQEA 5LBIA 4OP3A 3IT1A 3KZMA 4UM8B 5DIZA 4CV1A 2V7XA 1W2GA 4ZK2A 3QLUC 4RWEA 2OLEA 1GKUB 3VR5H 3QF4A 3SVLA 4Q3EA 4CHGA 4OMFG 5LJLA 1WV1A 3LRTA 1WDLA 3BZWA 2F1RA 4AMGA 4F46A 5BV0A 3LKVA 4FGSA 1PL6A 2Q50A 3MJVA 4TSFD 5C1IA 4ENWA 1G5PA 5K3OA 2NPIA 1F8GA 2R44A 3ELDA 5E7IA 4KE9A 4DMKA 4WJKB 4JC4A 5KBYA 2XMGA 4G89A 4JHXA 5G40A 3W3AH 1XCMA 4Q37A 1XHLA 2BFBB 1FDTA 4AMZA 1MFPA 4PCUA 1VXOA 1WLYA 2ZIVB 3MJDA 3QFTA 1SBHA 4IQ0A 1CY6A 3QXJA 4V24A 1EDZA 2R6R1 5CT9A 1X19A 3SJAA 2Y1KA 2JCXA 3I1IA 5B6JA 2PSJA 2IHKA 3DEHA 1Z63A 3D5EA 4C9BA 1IHXA 1AMNA 4KI0A 4QE3A 4YASA 3F7TA 3KPJA 4KDRA 2ADFA 4FYYA 3J80A 3QX7A 1FX1A 1OWNA 3W8RA 4EI9A 3S1AB 1EXDA 3T7IA 4DA0A 4R0VA 1EWKA 3QENA 4GOLD 5JJIA 4MW5A 5CUQA 1Y8ZA 3NJ8A 2VAWA 2QKYA 1PHRA 1XRNA 4NJMB 3GGDA 3L5KA 1XYYA 3ONNA 4DY4A 3BFKA 3JVUA 4UARA 1JP7A 1JI0A 4OXNA 4D44A 3IOEA 2ONZA 3L2OB 3WTBA 1D1SA 2G4VA 4HLUC 3BDVA 4QYIB 1W0KA 3AXSA 3GY0A 2JI9A 4S1TA 1QDLB 4BVFA 1RWQA 4X1OA 5AVJA 3ADBA 1M1XB 3DWEX 5FBVB 2GYUA 3D7SA 3OG9A 2CMGA 1R5JA 4DIOA 3A10A 4WLNA 3KC2A 1U9JA 1JIQA 4MQFB 4TLAA 1OCEA 4WCVA 3GAAA 2BCEA 3RUIA 3VTFA 2H1RA 3H84A 4YV2A 4D8YA 3DVLA 4K8OA 4AX4A 2ZUVA 3C8UA 2LPMA 5JD5A 1MGPA 5GONF 3T6KA 4W9RA 4N3CA 3JYPA 4X1KA 2ZIUB 4FEYA 2Y0BA 3OO1A 4M46A 3GN1A 3MTGA 4RDCA 3IV7A 3KQOA 1VB5A 3UWPA 1Y1QA 4KNWA 3K0CC 1L5KA 1WMBA 4RJTA 1XOIA 2G5GX 3P9CA 1KZ4A 2IK8A 1NU8A 2FSFA 2HX1A 4RXTA 3VR3A 4F3NA 4ZMSA 4GI5A 5C4IA 4XCVA 4B46A 3LLVA 3GLGA 1W36C 1Y3DE 2QTFA 1BDIA 4GQBA 5L4SA 4B3MB 3FVRA 1TU4A 2ZPUA 1YBFA 1CEQA 1BW9B 5AHWA 1UKVY 3HXOA 4BV2A 3H4MA 4YTEA 2AI1A 3K8OE 4WD3A 4DV5B 3IP9A 2V7GA 3M6VA 5KKCA 1FTNA 1IM5A 1VKRA 3H5TA 3IQGX 2WJ4A 2P5UA 2J33A 1XCJA 2OOKA 3AR4A 4R51A 5AKLA 5BNZA 3HCFA 3EQ7A 4BKUA 1Y6ZA 1QYIA 5EIEA 3KYDB 1EFDN 1VL1A 2I3ZA 4P0TA 5CVUA 3BAFA 4LXIA 4XQCA 2ECKA 1Z7EA 5ARBA 1F9EA 4G0YA 2AXNA 3ACCA 4WV3A 3ORYA 3Q0EA 2FPPA 3LGAA 4PLVA 4G97A 1A7UA 4DLKA 2QB5A 2H7YA 3MWKA 4YP1A 2O20A 3FWHA 1FVFA 2JFOA 3NUZA 5JISA 4TMZA 1ZKDA 2HSZA 4IIHA 4MJ3A 2RJNA 3Q7RA 3UB4A 4AF8A 4AYXA 2L0XA 3AUTA 4LXQA 2OXFA 3OPYB 5HZHA 3GH1A 1M10A 3MYYA 4O6VA 3Q4GA 1N3LA 3P9XA 3LSTA 5BYKA 4XVQA 1P1FA 2FXVA 3TSWA 2IGTA 1AGPA 2IGBA 2ORED 2ZRCA 2IHUA 4MMXB 3ZNQA 4EO4A 3TEJA 3I2FA 4FOOA 4M9XA 3D6AA 2OG1A 2WMDA 4L5YA 4L51A 2PG3A 4F4FA 1IK6A 2DHRA 2GBCA 2Q4EA 3DV2A 3FBWA 3EOAI 1L5HA 3SGLA 1YB4A 5J4KA 3BZUA 4YRJA 3K0AA 5IVDA 3ETCA 5AM5A 2P9TA 3UJPA 3CNHA 3P4UA 5AKIA 4YT4A 1Z6AA 3IDFA 2RGGA 3OFKA 4B48A 4AICA 4AAYA 3R3YA 4FHFA 3OJFA 3QWBA 4D8XA 3GW8A 3I9OA 4FLEA 4CMAA 2ZJOA 1Y6QA 3GCWA 3P9IA 1JLKA 3I01A 3NV7A 4Q39A 3KSAC 1ZSNA 3W5AA 1DKQA 3O4VA 2ZXUA 1QHGA 3CURA 2FSHA 4GZLA 4HOYA 5EXPA 4DQLA 3PPXA 5K3FB 1IOVA 1AUXA 1CJMA 3WMWA 5CNMA 3K9HA 1KTIA 1BH2A 2AEJA 1O96A 1DNPA 3KSDO 3LVRE 2ZUEA 3HDYA 1U7WA 3DDCA 3VHQA 4KYUA 5KQMA 1E6UA 5REQB 5D5HA 1CNEA 4Y2GA 3PIDA 3O1IC 3VPBA 4CT0A 2ESRA 2ZBFA 4Y0AA 2C95A 1C5KA 3RC8A 3D0OA 5KNDA 2WM9B 2SCUB 4ENVA 1SULA 4HUQA 1GXSA 2JIRA 4L8GA 3WZ2A 1ZOLA 2GZ2A 4HDAA 4KFTA 4L4SA 2XPCA 4BYMA 5C7YA 2GX6A 1X94A 4RZIA 3E7PA 1SWVA 3NKVA 4H1TA 5EA2A 3RPEA 1A9YA 1F14A 1R6BX 2BTQA 4JASB 3T7DA 4EW2A 3O8CA 2VDKB 3V3TA 1M5RA 3FGZA 2Y77A 4ZVVA 4IJQA 1H4VB 2EDAA 1Y1KE 4HWGA 3TDMA 3VU1A 3ZLVA 4DC0A 3N59A 3I3SR 4CIWA 1DQYA 3L92A 4Q82A 2FZKA 3X1ZA 4YJ2B 1GFSA 2A4MA 3JPWA 3CNQS 3GGJA 1W85A 3R0JA 4ZV9A 1EWRA 3FCSB 3ZWVA 1Q95A 2CCJA 4GPBA 1IDOA 4WZ6A 1GRCA 2ECPA 4TMFA 1CY7A 4WZAA 5CURA 5H4HA 2ZI6A 4AIRA 2E48A 1EM8B 1T8TA 2Q6TA 1XTIA 5INTA 4N8DA 3BULA 3X2EA 1FS5A 3IR7A 4YP5A 2GUWA 5G0WA 3RVJA 4CTNA 1MENA 5MGNA 3AIOA 2VJLA 2RI1A 4HNTA 1SWWA 2YFKA 4URWR 1SBCA 3D43A 1ENYA 3F98A 4PY2A 4QDKA 5EXEA 4ARIA 5IC6A 4UCWA 1K2VN 2FTKE 5H16A 2CZQA 4EHAA 1FUUA 1B26A 1MOSA 5JAIA 4B4KA 3PFCA 2VOEA 4R2XA 1T4CB 2YWEA 4KMOA 2D06A 4IDBA 1UWKA 2OBXA 2TECE 4NFYA 5EJ6A 2IW3A 1T1JA 1GJRA 3DT8A 3H5WA 3NC4A 3QH4A 4HH0A 1A95A 5D5PA 3ZHBA 1CUWA 1I6KA 3O1JC 1NJSA 1QFSA 3PFNA 1QU2A 1F8XA 4Q4AA 4JJ4A 2Z83A 2R8YA 1FP1D 3K05A 1DINA 3THRA 5K8TA 1G0NA 3JAKA 2MTBA 2QAGC 2V74B 2O8CA 1JMYA 3W5SA 3UO8B 1CR1A 1BWQA 3PVCA 4YJ3A 4UMDA 1JQJC 3NTUA 4R6XA 5HJ5A 2JFGA 2OV8A 2CL6X 1GFWA 4G0OA 4LHVA 4Z0HO 2PUEA 5HFNA 3OLWA 4QTXA 1GN9A 2VQSA 1K89A 3HWSA 3VDMA 1DJQA 3D7KA 1ESZA 3NETA 4FS3A 2O1WA 3OOJA 3L3BA 1OX4B 2PYZA 3EEIA 1GGMA 1MB3A 3ZE7A 1RQRA 1W8IA 4YJFA 1HG1A 1UEXC 4LDJA 1Y8RB 3CLSC 3MWGA 5JALA 1E5TA 2CHUA 2BUAA 2F62A 5MFPA 5JLJA 2FMHA 1M6HA 2WK1A 2VPWA 3BFVA 3GRFA 3ND8A 5LP6B 5DCWA 4BVAA 3QVSA 1CVRA 1TA9A 3Q98A 3VR6D 1FLAA 1E1KA 1HLGA 5LZ4A 3BSSA 1QOQB 3BH6A 4MVWA 4IMIB 4YX9A 1MJFA 1ZUIA 2FFBA 2P2NA 3TOXA 1NZFA 5CU7A 3AHEA 1XV5A 5DX1A 5CHYA 1Q19A 4TSRA 2ISSD 4I4NA 2QG6A 1P33A 4EY5A 2JI8A 3RFTA 1A2QA 2CXPA 2EP8A 1E3WA 2WIDA 1OAOA 1RR6A 2J9YB 3AW8A 3ZWBA 4DDMA 3IHTA 3P8ZA 2VZ0A 2OR3A 1C3JA 1E2PA 1Y9EA 4RHXA 3PK0A 4MQ4A 4I8DA 4PC7A 1UJBA 3VC2A 4U1RA 4XUDA 3JQBC 4FCWA 1B7GO 1EFRA 3H83A 3E9CA 3KVNA 2RGBA 1W59A 2A5YB 1BG6A 2HMYB 2JJ8A 3GDFA 4TXNA 5T3UA 3X1XA 3DMYA 1H4QA 2V4ZA 3WZLA 5DP2A 2Y3IA 4WUVA 5KQSA 3NHSA 5C5DA 3R40A 5ECYA 1R66A 3THXA 2ZJ4A 4KQKA 1Z6PA 3QVKA 1MMFB 1NXPA 1TVCA 1FYEA 2PIAA 1L8XA 3U3MA 2FKAA 3V2UA 1G21B 1NTRA 5BW6B 4MIEA 3SYTA 3VA7A 2PD4A 3N0XA 3FETA 1M1YB 4G65A 4QYTA 1K63A 4C87A 3F97A 3TLKA 3ZJVA 1CY8A 4K9RA 2C5LA 5JAPA 2ZM6B 2XNDD 4C7VA 4ANFA 5SZHB 1JDNA 5ECDA 5FPTA 1SCJA 2H51A 4TTAA 4LHYA 4MW4A 4G84A 4R9RA 3ADCA 3UMBA 1GUYA 4Y0NA 1BX3A 1VSUA 4WXPA 1X42A 1TW2A 4GXNA 3WLQA 4J16C 4JWTA 3FN4A 1Z7YA 2XTJA 1I0LA 3NKFA 2PX2A 2WM8A 2IWHA 1FVHA 1X1RA 2CEAA 4XI9A 4BLWA 3ADOA 2C9DA 1SQ5A 3ZU6A 1QFMA 2AMLA 2H1CA 4PYRA 1DUSA 2XKBA 3O92A 4IP0A 5JD3A 3MCUA 4ENSA 1L5MA 1YRHA 4AP5A 4NBWA 2JLUA 4RPJA 4X64B 1UJNA 3AI7A 1LFDB 3BC1A 3A4IA 1HLDA 1J21A 1NFFA 1VDZA 5JPCA 2BR3A 2IWRA 4YUAA 4QLOA 4E14A 3BUSA 3LDAA 1ZM4A 2PKWA 5BO5A 1XE3A 4D9IA 3IPAA 4MV4A 4IM7A 5K51A 4CR7A 3FPJA 2XUZA 4UEKA 2R7NA 1P4RA 5CXSA 2LCIA 1TTHA 1F0KA 3UGTA 4PS0A 4HH3C 2QV7A 1PR5A 3KUUA 2JD0A 2PFKA 1XVAA 3HB7A 2JGIA 1J2RA 5SYAA 4DCOA 1JTEA 3E6AA 4GDMA 2F3QA 3F2IA 4L4ZA 4OVKA 5FAXA 2EKBA 1OGJA 1SZCA 1GP2A 1FMJA 2F1OA 3IAEA 3K73O 3IRVA 2CNKA 1KH1A 4I9GA 4KAJA 2ZQ5A 4YDHB 4ZOEA 4CM9A 3DFMA 5IJ9B 4H60A 4MEBA 3PC4A 4N0DA 4HZGA 1UBUS 4TN1A 2DX7A 4XR9A 1HT2E 3HP4A 2HCRA 3IBGA 5CFNA 4GNRA 4L27A 1K66A 1RRGA 1YVRA 2H4JA 3AQIA 3EXIB 3R9XB 2QR5A 2RB4A 1NVAA 1WSWA 4BFCA 2FWAA 1KJYA 2JIMA 3L7IA 4HGQA 4TS3A 5AXCA 3CIFA 3V4RA 3VV2A 3K1JA 4F60A 4GM1A 4LNHA 3B89A 4Z6KA 4B44A 1IN5A 4LOAA 4BNZA 2BGGA 3FWZA 3GP5A 1VQ1A 1E7SA 4HDNB 3L8YA 4QX6A 4C0JA 1AN0A 3G1WA 3GN2A 3AEZA 1VPTA 5FA5A 3JQ8B 3A4NA 3X3HA 5LZ2A 1QUFA 1RFLA 4GH5A 2IZOA 2O1XA 4TGLA 2G9NA 1DBQA 3OX2A 4JIGA 2O9JA 5FLKA 3GUZA 1L7NA 5JAQA 4MS1A 1XVIA 3FTPA 1QNLA 2Y0CA 1VP3A 1PSDA 4Z86A 3DVAA 3OUZA 3MTQA 1VRVA 2Y1GA 4OYHA 4RQBA 4CFYA 4W6QA 4MDHA 4D9FA 1YU6A 5E2IA 4XX0B 3HPRA 3AESB 1JG7A 1JX6A 4A6PA 2B1GA 3CW8X 3G2JA 4CEIB 2HW8A 2RHMA 3V8NA 2PWBA 2WB2A 3GNLA 2VP0A 1QO0A 2D74A 2WUWE 5HQ3A 4WVFA 3PP8A 2GLXA 1G59A 4WN9A 1P2UA 3OE1A 3RIGA 2EJBA 3MT8A 4MVJE 1RQGA 2C7PA 3PDCA 3ZK7A 4Q0MA 2YY6A 4C88A 4MYTA 1G7RA 3HJRA 4NABA 5AW9A 3CG4A 2F2TA 2C29D 2XOKA 4KN6A 5I9LA 2RK4A 2WJJA 2WG1A 3IPXA 1DELA 5CMLA 4JLDA 3FCYA 3FNQA 1JDPA 1T9DA 1P5RA 2KB0A 1MNAA 1W7AA 1UMCB 2VTEA 2VKQA 3PV0A 4XW2A 4PZCA 3WV4A 4JA2A 4ZDIA 4EWLA 3CPJB 4AWXA 4TLCA 1G3RA 4M22A 5BWMA 1G41A 3R0QA 3F5FA 4G63A 4BJ5A 1FQJA 5DT2A 5E2BA 1CUCA 3T9EA 1ESNA 3G7NA 2AMVA 3VHRA 4DIEA 2C03A 2C4WA 2RBGA 1FRVA 4DLYA 1COZA 4BBAA 1AVTA 1U81A 4P7GA 4E03A 1KAMA 5IJ0A 2ZITA 3AFIA 4B8ZA 1ID1A 2H4WA 1JAZA 3H1FA 4TYQA 1GCAA 5IZCC 3FSRA 1NI3A 1NU6A 3N2GA 1CNFA 3EQ6A 3T7TA 1Q2UA 3D64A 3LKBA 3NFYA 1IY0A 521PA 4BIIA 1GZSA 1UR5A 3RS4A 1ICIA 3F6RA 3UNXA 4D98A 5LQUA 2DEUA 3D6VA 5ISMA 1I13A 1Q7BA 5K3BA 5KNCD 1DBWA 5A2QA 1WNTA 4U3JB 1QH8A 2GFQA 3IAM1 1JQ3A 3BM5A 4NOLA 1U1CA 2OVBA 3G0OA 3BTUA 3M6MD 3STYA 1Y7LA 1DWPA 2DAPA 4P34A 4GDFA 4F3YA 1VIDA 3FJ1A 1KJQA 4INPA 4OGGA 4S0XA 2UYHA 1Q7GA 2V7PA 4TWZA 3HSKA 2PA3A 4HS4A 1GARA 3WRXC 2C77A 1DXYA 3BJEA 4G8BA 2PXHA 3FI0A 4WESB 4WKCA 2IFTA 3D31A 3VSDA 3EXEB 3UZUA 3ZQKA 1NPYA 2LCQA 1MJGA 3ZWAA 1HT3A 2QW1A 1C2YA 2V3VA 1FW6A 2QWXA 4XWWA 1ZD4A 2OK7A 2P9YA 4FFRA 3UK7A 4ZMBA 1E94E 1SCQA 5CVTA 3ER8A 3RO7A 1U0NA 5SV2A 4GX5A 5J5VA 1PR1A 4E51A 1NBEA 4E2ZA 2I3GA 2FPGB 4Q3AA 1QANA 1FC0A 1VPDA 3B7PA 4KQWA 4U7PB 3PB3A 5F5LA 1Z56C 4BQPA 1SK9A 4QC2A 5FF9A 1MAUA 5IEJA 1ND5A 3AB3A 3K9QO 1OD6A 2Q8QA 4FU0A 3NATA 4M0LA 3DP7A 3C3PA 2JLWA 2Q6OA 3ID6C 2UYCA 5HZMA 2MU1A 2WF5A 3L07A 1U7OA 2UYOA 2ASVA 3K5PA 3C8HA 4JLWA 4KQCA 4G4GA 4ZQEA 3OLXA 4R9UC 2O23A 1NJGA 1AXRA 1NFRA 2AJDA 2O2HA 2ODAA 4UBJA 3JWHA 3VZRA 1KJWA 3AR5A 1Y8AA 2FSPA 1KVRA 1L7OA 3B9RA 1XA4A 2AJBA 2P2GA 3HLKA 2Y71A 3KTDA 1ECBA 1E20A 2M6LA 4YGXB 4BO2A 3TTYA 5C34B 1D4FA 2OHOA 3L0ZA 2VYVD 4JYBA 1Q1EA 3ZS8A 1TEVA 1TYBE 2OMKA 3UKJA 3EIOA 3EIWA 1QPZA 2WIBA 5JJKA 3EF3A 2BHRA 4P6VF 3V4SA 4ZGGA 3RBXA 1YONA 2APJA 4H7EA 2QNRA 1PUXA 3IUNA 3OM1A 2GYVA 1B93A 3H8VA 5JXWA 1XN4A 4LF5B 2H85A 1S8FA 4QVKA 3EGWA 4B80A 3H5AA 3EPJA 1IPFA 5FLEX 3CMMA 2RGCA 3R1IA 4KYTA 4EJMA 3D0RA 3UHAA 3REOA 2HJWA 5ABPA 4URZR 3TF5A 1VE9A 1CY2A 1USGA 1WQ1R 1IE3A 1OTXA 4Q7KA 4B7XA 2J9XB 4KTVE 2BF7A 1RKQA 3OZAA 1DBIA 3MTAA 4E4RA 1J8MF 4RZSA 5K3SA 2EV9A 2EHJA 2FMKA 1KDOA 3A6FA 1BD3A 2EZTA 3O1HB 4DSUA 5IYZB 4FT4A 2WQ6A 4R1LA 3WDLA 1OAKA 5KYYA 1GFZA 1LEHA 4J3FA 5E6UB 2OSBA 4FYMA 5EKSA 4EJSA 2FOIA 3R5JA 2LIVA 4FX5A 1D6NA 3V5NA 3TIFA 5AQ1A 2TYSB 2Q3LA 3KUCA 3W3AD 1YHNA 2CMFA 2WJVA 4PSCA 3VU9A 1DUVG 1NN0A 3A31A 3LLUA 5G4KA 2Z9BA 2VT7A 1XD8A 2G5TA 3U39A 5I9NA 1I7NA 1MB0A 4WVLA 1FNMA 1Z5VA 1XD2A 1WKBA 1SD2A 1D6JA 1Z29A 3KB8A 4P81A 2CLLB 1ZUD1 4XIIA 4J6FA 2XQKA 5CB0A 3RYCB 1BNCA 4YV7A 4W9MC 4B3GA 3SEQA 2FJ0A 1XNRB 2A30A 1XLTC 2A35A 4K28A 2H6EA 4CNQA 3LC1O 3ND6A 2X5OA 2FG6C 1ODIA 2D6FA 4JAVC 3EVAA 5FI5A 5FL3A 4ZCTA 4HGRA 2QOEA 1GAEO 4W5RA 3F73A 4C7BA 2FSGA 3OTWA 4R9SA 1LSSA 1T4MA 1X9HA 4CIDA 1JS1X 4LC0A 1I5OA 2A1TR 3E3NA 2VXOA 1PTJA 3WKCA 1DTWB 1C9JA 1N9ZA 3MWDB 4I81A 3A6ZA 1LLFA 2BGWA 2E4YA 4LMBA 1EI9A 3OO0A 3FRJA 1AURA 4QUKA 1D2NA 2IYWA 3AR8A 1P77A 1I24A 5DMHA 4C14A 4ND6A 1AKYA 4KLCA 4CMGA 3PQ7A 1SA0B 1SB9A 2B7CA 2HO5A 3CF0A 3KKEA 5DYIA 2R48A 5K4GA 1E18A 2Q7XA 1QKIA 3FDIA 2Z3VA 3DZJA 1RQ7A 3AM3A 2ZZNA 3OIFA 1MPTA 1U31A 1W0JD 4H4CA 4NZOA 2RGNA 1PF7E 4PYMA 4WA7A 4GQIA 4C6HA 4IFTA 4MV3A 4A8HA 4DA9A 1E9DA 4L5AA 3NTVA 1CY0A 1GGKA 4QATA 4QYSA 5UKDA 7YASA 3EWNA 5ICSA 4FR5A 4RV4A 1ODLA 2WSMA 3GJ4A 4HRVA 4C7JA 2XCIA 3PHHA 1IY2A 4OFZA 3QYFA 2QUHA 1BQ3A 1G21E 3HJAA 2XWSA 2VSOA 4N40A 1V5EA 4Y1RA 3HU1A 3WQRA 1M1YE 1D3AA 1EK1A 3V7FA 1VL0A 4CG2A 5BMOA 1UQUA 1WY5A 2A9RA 2IT1A 3FX2A 4R05A 1EK0A 4ZDWA 1XZDA 4FJ1A 4YJGA 4X97A 4WA8A 3ETNA 4GGPA 1NOKA 2YZKA 1ZIYA 1AK9A 5DGHA 2CVPA 4M9QA 1QR6A 5I3ZA 2QSYA 2RGYA 3LFHA 3PTZA 1JDVA 4IRMA 1UADA 3ACBA 4JBIA 5DHUA 3VSEA 1TMGE 1S2IA 1HT0A 2I29A 4U2CA 4YLYA 3V2GA 4RBNA 3T9AA 8AT1A 3IXMA 1VKZA 2IH5A 4C7OA 4L9AA 3MYRA 3E8MA 1M1ZA 3ANMA 1YI0A 5JCJA 5BN5B 3GGSA 1BROA 2FOLA 4FKBA 2CNDA 2AYYA 3AR2A 5K4HA 4OKIA 4FEEA 1JB9A 4EBFA 1R8YA 2OWEA 1LNSA 2G6TA 2OBMA 3GNTA 4OQYA 1CR6A 3HDGA 4F2GA 1O3YA 4H31A 3Q85A 4LZOA 2KW5A 2H9IA 5E3JA 2DBVO 3TR6A 2XF2A 4CUZA 2AX4A 1ACJA 4OYLA 1UKEA 2WABA 1L5LA 4DDUA 1TQ2A 1SO8A 3C1TA 5EZ6B 1IXKA 1O6FA 3EGCA 3ITKA 3QE3A 5AK5A 3SQWA 1C9NA 4WKNA 1OYOA 4RZUA 3UMMA 3ZE8A 5BSMA 1TL7C 4AJEA 1PK8A 1HXHA 1B6TA 4XX1A 4KQ1A 4MR7A 4FGUA 4EHHA 4FEAA 1OLUA 3EUEA 1MG5A 4GVPA 4DNXA 5EKUA 1RZ3A 1Z8FA 3O47A 1QGZA 3OBIA 4YAKA 2JFWA 2J5KA 2HMTA 3E9RA 2YHSA 2OPBA 1Z35A 1X0XA 2WUVA 1RT9A 3UY4A 4QGHA 5AUPB 2OZLA 3PQ3A 4QJ5A 1UFRA 2HSWA 4IYJA 4JSRA 2ZAMA 4MO2A 3DE0X 2XQGA 2GVDC 3D4IA 5TMEA 4FEGA 3IA7A 4MPRA 4YP9A 3PCTA 2PQ2A 2G1JA 4MQ6A 2PCJA 4RPIA 5CFRA 2P41A 4Y2JA 4BWGA 4LXGA 4LF9B 3ENZA 4IIVA 3WBKA 2ZRNA 3OZCA 5I01A 3DZDA 4IJWA 1R5BA 2LBPA 5AP9A 3UXYA 3LDGA 1UBOS 1CE8A 2BW0A 1NPTO 2GCPA 4GO1A 4RVFA 5HF8A 5CDSA 5FOSA 5KMGB 1Z8NA 4EA8A 4G0WA 1XMXA 2OV6A 1P7VA 4B45A 2C42A 5HF9A 4FP9A 3TZQA 4HZIA 1EBFA 3C85A 4LSMA 4S1OA 4RXMA 5EMHA 1YO6A 2JRCA 4TS4A 3F3KA 3K0FB 4CLHA 4D3YA 5BSVA 4ZPJA 1U0BB 1KP2A 3JRNA 1SHZA 4PQRA 3A3YA 3C6XA 3HZZA 1M74A 1SXGA 1V3QE 4LE1A 1E69A 1PG0A 2V6IA 2X15A 5L40A 1F4VA 3AUJB 3MW8A 5K0NA 1EB9A 3I2HA 3KB2A 3PUZA 3Q5EA 1RBMA 2Q1UA 1V1MA 1W4CA 2QSJA 4AZ3B 3LQYA 4H7IA 4ICIA 1C29B 3CO5A 4J0EA 1RC8A 4MNTA 1KYVA 1ORHA 5DDIP 3HYNA 4EGQA 1II9A 3VR4D 3EPKA 3PI6A 4IL5A 3K96A 1OBOA 5EZYF 4I50A 1YCFA 4OX9B 4TKVB 4ALMA 4CG1A 1OB5A 3G0CA 4UHDA 2ZM5A 4KN8A 3ABOB 1ESCA 2ZIAA 1JAYA 4S04A 4Z54A 2VFAA 1MX5A 5DBGA 5A5FA 5CFZA 2GZ3A 3VYWA 5IBCA 5DHPA 4JI4B 3P4YA 5I9BA 1KDPA 4R41A 1P5JA 2YJ5A 3C3JA 1HMPA 2OQ2A 3R41A 4RK5A 4FZJA 5GIPE 3BILA 3U16A 4L07A 3I5UA 3OLQA 4IZOA 3OTQA 3Q87B 4M1ZA 3CN7A 5CEJA 2JGKA 4DIUA 2JIZD 3QPVA 1LVGA 5ITVA 4YT5A 3A3PA 2G25A 4TKUB 2PX3A 3EN0A 4KXWA 5FTNA 4AJPA 3RYHB 4Z1OA 3IH5A 4HNHA 1EDDA 2VYFA 4JI1B 1YFKA 4EB6B 4NQRA 4PPGA 1QYVA 3TQQA 2LP4Y 1UPFA 1Z9BA 2BBTA 5E1DA 2FUEA 3VPGA 2PBLA 4Q03A 5JWRA 4DM3A 1THMA 1VLQA 3D2AA 2ZR7A 3LCUA 4L57A 4PN7A 1CS0A 3OQIB 4A8JB 2Q21A 3I1FA 4L5CA 2A33A 5IKXA 4C01A 1FU7A 2BMWA 1CYDA 4WEOA 3K8ZA 4BO3A 2XMZA 3WYNA 4RLSA 4ME6A 4HMPA 2NXJA 3E9NA 3JCZA 2O52A 2Q27A 4LTNA 4TMWA 1SNYA 5K6AA 4HB0A 3OSZA 2X1LA 1BZYA 3CRRA 5TPZD 2ZSEA 1CY1A 2VOJA 1L7BA 1AC5A 4O5OA 4Y2RA 2XXJA 2NQ2C 2NZXA 4K1XA 2CLIB 2PKQP 4YREA 3W4KA 3OTGA 4WNIA 5K0ZA 1B8OA 2BM0A 2KWIA 1G18A 4Y2TA 4JBNA 1GKKA 5AKZA 4B3FX 1KEKA 1JSXA 1NXVA 4II7A 5K6RA 4EZEA 5IBPA 1E61A 5D51S 3QF4B 4IVQA 3A8TA 5ALIA 4UHJA 3WIUA 4C1NA 4BFXA 4LZJA 2ZT5A 2VYNA 3RUPA 1ZM7A 3JD0A 2JD1A 3ZGXA 4QOHA 4PAQA 3RLIA 1TVEA 2ZBEA 2DPMA 1N0HA 3PR1A 2XTZA 1D8TA 4WMLA 3WLLA 3B1KA 4RA9A 2VDPB 2C2GA 3CFYA 3KT8A 3LPMA 4OY3A 4XD2A 2QNBA 3HNRA 3L6CA 3U3XA 4BVLA 2HPHA 5FTLA 3W77A 2WY2D 1KY4A 2ZI4A 3PYXA 3TFWA 5JPDA 3RRMA 3RADC 3SDZA 5FQOA 1BHQ1 3OZWA 3U61B 4BLVA 4LJSA 4F1KA 1W52X 3MAJA 4RY9A 3NOOA 3PJGA 1P2VA 3L06A 3QWHA 4YMWA 4F85A 3SG0A 2C54A 2G5PA 4D0GA 2YS6A 4DDKA 4IDAA 1BKSB 4Q19A 2QT0A 4NDAA 4WTOA 3G7UA 3MUFA 4JJ7A 2HNKA 4V2IA 4DOMA 1G3QA 2PO5A 3OQ1A 4IFEA 2W48A 3B1XA 4UFOA 1UANA 2XUHA 1LNQA 3CGGA 3KM0A 1R0CA 5AIBA 3T1TA 1Q7EA 1KE2A 3TIVA 4ETMA 2ZB4A 4O2AA 2UV8A 3B9QA 4ISCA 5G41A 2XT0A 4GPAA 3FDFA 3RC9A 4ZI7F 5J3JA 4F9EA 1A3CA 3UM9A 3BXFA 2Z04A 3FPKA 2DHEA 5T5QA 3C5VA 5CCDA 5TJHA 5CK5A 2YBEA 5DVZA 2E4WA 3CZQA 2FB9A 3EIFA 4CF5A 3VYRB 2GM5A 3QE9Y 1W6UA 1F8FA 3I3OA 1QM5A 3DHYA 3EARA 3L7CA 5J2TF 3IA2A 2ZBUA 1P29A 4TVKA 4FZ5A 4H1WA 4L8WB 1HPLA 1DJMA 5F3RA 4YXWA 5CLJA 5JE8A 4ZEOA 5AHOA 2CZCA 4KXFB 2VDQB 3DJFA 4X1KB 4BU1A 4EITA 1R9JA 2H1IA 2IYQA 2B5WA 1DBRA 1GDHA 2IS1A 3CT6A 2X3UA 1YOBA 2NXNA 4IIBA 3VI3B 2EKDA 2E4VA 2WIKA 4Z3KA 2H08A 5TEWA 2EFDB 3FBTA 4G4IA 1ZUHA 1GPMA 1GZ7A 3GLGB 1DP4A 3LXXA 4RKQA 3WICA 3B6JA 3FIUA 4EO7A 1RRKA 5KSZA 4N0EA 3T99A 4EKEA 1SUSA 4RMHA 5FI1B 3DBIA 2FFQA 3RCBA 4YAJA 1PW7A 1JWLA 1RI2A 2OAGA 2VJAA 5FI0B 4QA9A 3OLVA 4M0KA 2VCYA 2PNFA 1GUBA 1L5VA 3LPNA 3HZOA 2W6JD 5D3ZA 2A3RA 1R3DA 3SF8A 2AFHA 4PU0A 5LC1A 5B3JC 3ZYZA 1WXWA 3VBCA 1KJNA 4LJ6A 3N0VA 5H80A 3IEUA 3QTBA 4FE4A 4MIYA 4ZRMA 4BQOA 5KTNA 2O57A 3NIBA 5FWNA 1RXUA 2YXNA 4UPDA 5IN5A 4C6TA 3EVNA 1JGTA 1JHYA 4R2LA 2FPPB 2LXNA 4D82A 4UW9A 3O2JA 3EGEA 4R16A 4BNTA 2ZUWA 5CA1A 2IZ6A 3V4VB 2YS7A 3RBZA 5CDHA 3H75A 1QG0A 3GUHA 4TXMA 3K4HA 1NBWB 4D79A 3MS4A 5EHXA 2ZTVA 3F3MA 3WAGA 5F9HA 1UH5A 4A8JC 1EUCA 1XPUA 5F1OA 5M34A 4DGSA 3ZE2B 3U4HA 5DHSA 1A0OA 1PDVA 3DXFA 4W5JA 4EMTA 2GXAA 1DAPA 1EHYA 5T6MA 3OJEA 4TWJA 2BI8A 4JYCA 1K92A 4WY2A 3FKSA 2WKQA 4QXOA 2PZLA 2EZ8A 1GPNA 4NYIR 4O4HA 3CT4A 4JROA 3U5ZB 4LF8B 1OAAA 1L5HB 2FYTA 1WKCA 3RVRA 1WUIS 3K0AB 4ESVA 1BWSA 3JQFA 3TZLA 1UBHS 4Z9FA 2R7MA 1EXMA 4U7FA 4MJLA 5C81A 1XCGB 3KETA 5J9FA 3LKZA 3OWHA 3B5JA 5DF1A 1FSZA 3VVMA 3SZGA 3ZGOA 5EJ9A 3KSBC 1JIIA 4KREA 4RSGA 2WFMA 3L8ZA 1VCNA 3BWMA 1JW9B 1CUGA 2PUJA 2BGNA 3CJRA 5DNUA 1EPUA 5TQ2A 3GP8A 2C5GA 1VJ1A 3I5MA 1WV0A 1D9ZA 1BE1A 1OBCA 2A1TS 2Q2OA 4U5XA 1PK9A 3QIVA 4OLHA 2PH5A 1QIKA 3NYWA 9LDBA 4BP9A 3KWJA 3ZH9B 2FSIA 2A9KA 3L04A 2ZWMA 3KELA 1OXUA 2HWYA 3EXFA 1HGXA 3S4YA 1DQZA 3F6EX 3DEYX 1PV4A 1F7UA 1SZPA 2YQZA 3OEHD 5DZSA 5TARA 1W4RA 2ES4A 1O96B 4KPEC 2PRJA 3B6ZA 1YZUA 1BJTA 2VPPA 3DTYA 1PUJA 1AF7A 4HN9A 5P8WA 4B43A 1VJTA 1T26A 2GJKA 3OEED 1RCFA 4QOEA 3EZNA 1TX4B 3VZQA 3WWDA 3VNUA 2J9ZB 2JEOA 3BIFA 1YE8A 1TTQB 2YUIA 3B85A 4R1UA 2ADOA 4LWPA 3M1YA 2VAPA 3FSGA 4M9CA 4NLLA 4HUQB 1GXSB 3KBBA 4IDEA 1US8A 2E82A 2HMUA 5CT6A 1C7EA 1IG3A 1TFRA 5HKLA 3PTLA 1KR2A 1NRIA 4RHYA 1SXPA 3X1MA 1C8VB 3E0QA 3FJYA 5CB6A 3PNPA 1ZJZA 2CVQA 2BTQB 4TYPA 1NSTA 3S1LA 3T7EA 5DNYB 1SFRA 4FYKA 3O9MA 4MQLA 3OZXA 4MV7A 1GUZA 2FLWA 2R7AA 1CS4C 3A28A 4Q3DA 1OWOA 1KI7A 1FW8A 1XMJA 2IHYA 2VH2A 4OLJA 2WM2A 1Z13A 1VCOA 4DB2A 2GF9A 3P4XA 3GK3A 2NT3A 3Q9NA 3UENA 4YR9A 4RULA 3R8FA 3VVBA 2AJTA 5EHNA 1W85B 2Q6VA 3CXRA 4Q1CA 5I7VA 5JNWA 2XZPA 5GZ3A 1ZH4A 4CCSA 3H9JA 2B8WA 2HD4A 4IJUA 1MORA 1G8KA 1ZGZA 2WYHA 4MGKR 4RKWA 2HA5A 2LZ0A 4WZAB 4QXPA 1N1GA 3MGAA 1RZVA 1AV7A 4B2IA 1FFEA 3HO6A 1EFUA 1WMAA 4ZOAA 3RDPA 2PZAA 1FTSA 4RVGA 3AZQA 4UNQA 3ZHUA 1WPXA 3BGSA 3WGGA 1Z2OX 1GUFA 1QHNA 1NHWA 1SVWA 1V9LA 4ZYZA 1HY3A 2C2ZA 1WB5A 3LBNA 3L8CA 3I92A 3ON5A 1L8LA 5C1DA 2ZUDA 1JG1A 1SHLA 1V3VA 5IDQA 5CA0A 4LFBB 1WDMA 1JIJA 5IUKC 1X1EA 3OP1A 1U0OC 2HLHA 3D6JA 2GHQA 4I1SA 4L0MA 2H0RA 2F3TA 4BEWA 1QHEA 2O6LA 3EXHC 4PLWA 4B6JA 4F38A 4BX3A 2AJCA 4AN0A 1Z5ZA 3T1HB 3F7OA 4JLVA 1NW4A 3A27A 2I7VA 3JX9A 4Q4AB 3UT0A 3ETDA 4L08A 2A57A 5AW3A 3BRWD 1LV7A 4TV8A 4DMRA 5CD9A 3MWLA 5AW5A 1T13A 1G5FA 2CLOB 3H1BA 2EXXA 3JAKB 3M1IA 3KQQA 3V9AA 5IT9A 2O8CB 3R2JA 4LKRA 3S2IA 3QU7A 2XMBA 4FFWA 1X1AA 1Z0ZA 3EEYA 4YJ3B 3E3OA 2P67A 4DG8A 3G2HA 3RVKA 1E66A 3IIIA 4LVOA 3LFUA 3OOYA 3Q3VA 1YVUA 4M9ZA 4AMYA 3R5HA 4RGYA 1UJ2A 5JQWA 2XE6A 3CR7A 4Y2PA 1YS1X 2A7QA 3HRKA 1VZ2A 3GJ8A 4H0NA 5JJLA 3EIHA 4PLCA 5GWXA 1VG1A 1KF0A 4MUAA 4QVGA 1IM8A 5JI2E 1SKQA 2QZZA 2C5HA 3W2EA 3PVZA 2GR9A 4YJFB 1OLOA 4WOKA 1G6Q1 1RD4A 1PZMA 2O7VA 2PJDA 3JWEA 3CH6A 3T38A 1GZUA 2GI4A 4GPD1 4DR4B 1WULS 5JHHB 3URMA 1TAQA 3VKHA 3C48A 1QAMA 3L6OO 1L9XA 2OP1A 4HSEA 4JQZA 3VJKA 2Y6VA 4PQFA 2D1FA 4I55F 1XQ6A 4MH0R 1ZOOA 4D5GA 4II2A 1Z6YA 2RHOA 1SCUA 5JBNA 2MMGA 5CITA 4HYEA 2C9BA 1Q0PA 3SC3A 1Z4LA 4QSHA 2VXBA 3SR3A 3T9FA 1E3WB 2OYSA 2VK8A 2FZ4A 1K7FB 1NW5A 1GO2A 2NADA 4RADA 5ALWA 3L7DA 5AVQA 1T1SA 2VDOB 2WU8A 2XVXA 3NR2A 3PXEA 1G3UA 1B0PA 3JQCA 10MHA 2IS2A 5THXA 2A5FA 3NHZA 4YT2A 4X24A 4HDSA 2J5BA 5CLHA 2W70A 2TMKA 4KDEA 3CRVA 2Y93A 1G4UR 1ORRA 2IPAB 1JPJA 1E3DA 1P81A 5BURA 2V5AA 4MKHA 2DLDA 1MV8A 2AEFA 3HYCA 2RARA 3OIGA 4HXEB 3UV3A 4ROTA 3THXB 3WI7A 2BELA 1C7RA 1E1QD 4V0RA 1ZH0A 2GUGA 3C6KA 3TIIA 4BP8A 4B87A 2BN4A 3G8YA 2NT4A 3RTEA 3CPHA 1ZITA 4C07A 5LDHA 1QV6A 3T3OA 1ZIDA 1ITZA 1XJ5A 2L42A 1L1RA 3CB2A 2BMVA 3HS3A 2YIMA 3DL0A 3ML1A 1Z5WA 3PC8A 1RC0A 4UBIA 3R4CA 2WU0A 4CUKA 2ZE5A 4AL4A 4XWAA 2JLZA 1O5IA 1QS0A 4PIMA 3AILA 1RBYA 2WLSA 1TQ6A 3LVBA 1Y9JA 2B98A 2YJTD 3BXHA 2PWAA 3NHKA 4M0PA 1T91A 3ZDAA 3RHZA 2Y0PA 1Z2CA 5JS2A 2VPYA 2VP2A 3HEBA 3LNCA 1O58A 2DRIA 1R6UA 2ZATA 2VQDA 4J0HA 5ALXA 3HMQA 2VEOA 4BMOB 5KVVA 1M75A 4KQEA 2I6FA 4R31A 1JVSA 2BIFA 2QTZA 2ZREA 4J8PA 2R5NA 3WGKA 4URUR 2J3EA 4JJEA 3ADPA 4BPBA 2PGLA 4O5AA 1EDEA 3QVWA 1KNXA 4MUIA 1DCKA 1LSJA 2NP7A 4IV0A 1E2QA 2GD2A 3VR1A 3QWIA 5FEUA 2CFRA 1U2SA 3KHSA 4IR7A 1KEWA 3ASYA 1U28A 5BP7A 1QQAA 3KKQA 1EH5A 3G5LA 1EK6A 4MW2A 3RGWS 3T3PB 3ZU5A 5BSGA 1X8JA 3PWTA 1G64A 1ZD5A 4EVSA 1RPJA 3H1PA 5BSHA 1P2TA 1E3JA 3PIRA 2H06A 2GOYA 1A71A 2PUHA 4WX2B 4BWFB 4A1FA 3NZEA 2YOHA 1T24A 3OAAA 3VO1A 2D62A 2ID8A 2QU8A 5FWDA 1LBEA 3MMNA 2J9RA 2P75A 1N8SA 1CB0A 2VATA 4JELA 5L4LA 2IXDA 2F64A 4NCJA 2GM9A 4YO7A 4LYDA 3PF8A 4MKFA 2IOQA 1NXWA 2C2KA 1NI4A 4H6VA 4D6XA 4JIMA 1FSPA 2AKEA 4OF4A 3UJHA 1F6BA 1DLJA 2BKEA 5FL7A 1YJQA 3DGEC 4HC4A 4D0RA 4MKRA 2XH8A 6ABPA 4M7PA 3ZE0B 2B7BA 1GGNA 2ZWVA 1B8VA 3LDUA 1Z0JA 5FWXA 2JB9A 3RWMB 5LKAA 2IDKA 4ZD6A 5EL0A 3SHTA 3M6IA 3DPUA 5H68A 3T12A 1RWKA 3V80A 4CM3A 2YWDA 3W5CA 3K9WA 3C6MA 1R18A 3CN9A 2RIRA 3H5LA 3VSAA 1GV0A 2XDQA 3OHPA 3HPQA 2TSYB 4P0PB 1R4NA 1NBAA 1ZSVA 3FCCA 2FZCA 1ZVQA 3A6EA 3FXAA 1G2IA 3I2KA 4QBFA 1BKYA 4MS1B 4RLQA 4TZ0A 3K30A 1LDMA 1QVAA 4ND1A 1MB4A 3ROZA 1X7WA 5KI6A 1N7GA 4R2WA 3DVAB 3PKZA 3GJZA 4NBNA 5GQSA 3FYCA 3R44A 4UUNA 1WPQA 2N9UA 4NV3A 4UMFA 5KU7A 4DBLC 2XUIA 2QDXA 3GEIA 2BKAA 4N47A 1K08A 1B8PA 4C04A 3INRA 3H1TA 1UPXA 3ZC3A 1XEAA 8ATCA 4C5AA 1H1DA 2M2IA 2Z2KA 1O9HA 5HQ3B 3T54A 3T3NA 1SXQA 4UTRA 4ZANA 5J2UA 3OOHA 4WN9B 1S3FA 4C4YA 3OCUA 3OKCA 1LVHA 1Q50A 2W6PA 3PFKA 5AK6A 5JQGF 1EIWA 3GLGE 2KI5A 1UAGA 4U5QA 2VJBA 1DRKA 4R8VA 2ODNA 1O03A 3SZOA 2JLVA 1AKWA 1UKCA 3PITA 4G24A 3RI3A 1GA6A 3VH4A 1BQ4A 4C0BA 5KVAA 1BGVA 2O8FA 4EBBA 4NCIA 1E1DA 1WD7A 3TCKA 1TUEA 2B0CA 2GETA 2L18A 1QFYA 3HXKA 4WOBA 1B4DA 1SEPA 2HRDA 1Y7HA 4Q7EA 4KV7A 2GF0A 3MB8A 1XMIA 9ABPA 1KH2A 1D5CA 1OTYA 3CX6A 5FPYA 4M2LA 5JVDA 3I72A 4RCZA 3LCRA 1YAHA 4KGZA 1RLTA 2JBAA 2ZWAA 2F1KA 1AKUA 4Q9AA 3WOHA 3CINA 4YWHA 4NBRA 1CW2B 1TD9A 2KBEA 2Q4DA 4DT1A 4WXEA 5JZSA 3PDHA 3UXEA 2M98A 4G67A 3VU8A 1USIA 4C5BA 1VHJA 3WFZA 5IJ0B 2JIOA 3U5TA 1UDRA 2ORYA 5CIWA 3N1UA 4IGFA 2DE0X 1UC4B 5EE0A 3N2GB 1ZMTA 1M8JA 4IX9A 5BWNA 2O0LA 2PBZA 4YAUA 3IVCA 1XLUA 3ELWA 1T35A 5LB4A 3EGVA 4ALNA 1GILA 9LDTA 2AF3C 2XMDA 1P75A 4DV6B 2QA5A 1SCDA 3O2NA 2GN1A 4MRVA 1QH8B 3HABA 4IO1A 1NAHA 1NASA 1U6JA 3A4LA 5KYVA 3U2QA 5F23A 3TAUA 3FWYA 1ZY2A 3VPSA 1C30A 3DBOB 3VH3A 4D25A 5CT8A 3ZI7A 4YIHA 1I1OA 4JN6B 3P27A 1F0YA 2VZEA 3RIYA 3U6BA 4KO2S 5EXTA 1RZUA 3D2CA 2RHLA 3H3FA 1IAQA 3MCAA 3QPCA 3R77A 2OXTA 4OLFA 1JR2A 1JEOA 4C4PA 5GAJA 1EFKA 3CEMA 1TMYA 1HTBA 2AOVA 4KLZA 1A1SA 5LBTA 3AFHA 1XP8A 2AQ8A 2ZSBA 2XA9A 5EJ4A 1JEEA 1MDBA 3KSUA 4J0KA 3VGJA 4EVQA 4KHPB 4CM7A 1T3TA 3NGXA 4J0CA 1SOWA 1H23A 3DL2A 3KQMA 1JWAB 3OECA 4N5HX 3OIYA 2CHVA 1UZAA 4QPZA 3T5TA 4GZ6A 3MGGA 1W29A 1FXUA 1WUJS 4FPXA 3WLFA 1E5LA 1F1BA 1Y98A 5ES4B 1W1WA 3CVOA 4A5SA 2FFAA 4EKIA 3NVDA 5L3SB 3F5SA 3N75A 2Q4BA 1MH1A 1XDDA 3MPOA 4RJIA 3U3OA 2IH2A 1AHIA 2JLSA 3H7IA 1NW7A 1P31A 2AKYA 1A5TA 5CXXA 2H1OA 2I7DA 1O77A 3PPIA 2YC2C 4PHFA 4BLRA 4ZN6A 1XF1A 3ND7A 4A2PA 3N7TA 3AVWA 1AHHA 2J6IA 2OKGA 3GEGA 5ER6A 1KI6A 1C0PA 3AM4A 3HLYA 5BR4A 5LN1A 2G1PA 2AZ4A 1FU4A 3NI2A 4ZVQA 3QPAA 4GPEA 4EJ6A 3LK6A 5EEGA 2DKOA 1FYFA 1OT5A 1AS0A 2FEOA 2ZAOA 3P26A 3A6DA 3CLHA 4RANA 2HMVA 4RZ2A 4F4JA 5CCBA 1DOZA 4B6PA 4JNCA 1F5SA 1R6XA 3VYUB 3WNDA 2WI8A 1OOEA 3EJ6A 3L8GA 3LC0A 5B58T 4EOGA 1IN1A 2GZMA 2PXCA 2ZT7A 1HL7A 1GAXA 4CQMD 2FCAA 5IVIA 1W49A 4DEVA 1A9XA 1I7SB 1R0WA 3IUBA 3LO8A 3LCJA 2H2GA 3FUTA 1ZEMA 4H16A 2SICE 1NG9A 1GTVA 4WZAE 2IXGA 3IHWA 1ISRA 1NDQA 2OE2A 4KXYA 4NNJA 3ROGA 5IC5A 2H3EA 1MXHA 1S96A 1IXYA 2J3JA 3FGOA 1OZ0A 2Q3MA 1AZTA 1U1FA 2EIXA 2XB9A 4KJZA 2E49A 3L6UA 5B1DA 4NXNB 4LDZA 4XDZA 3ENWA 3ILVA 5AJVB 2PAAA 2C7GA 2JGDA 3RUAA 3FF4A 3KTAB 3QWAA 2D2FA 4FOSA 1A9OA 1NBMA 1QORA 1R64A 2DKNA 3B60A 3ANNA 4KUHA 4F86A 4TS9A 3KKNA 1YZLA 4BASA 4XXHA 1L7AA 3RHSA 4ON9A 4CUJA 3IE0A 1ZD1A 3Q72A 3RAGA 2F6RA 4Y2QA 2VT2A 2IHJA 2JI7A 5H83A 3ILSA 3OWXA 2AR0A 5FNVA 2OC4A 3MTEA 1UDXA 4QRDA 4B3BA 3O8QA 4DRYA 4J6EA 1Q17A 5KYYB 1BC5A 3EIEA 4P3PA 4EJSB 1I4WA 4R9VA 4ZKDA 4F12A 1Z12A 3O4FA 4H1VA 1T5HX 2W71A 4TV9F 1PBNA 4ZVKA 1L8OA 3RVBA 1ADCA 1N2HA 1RJEA 4P4LA 3VU9B 4BKRA 4ZGWA 1GGFA 1N5JA 2F1IA 3CSUA 4QGSA 1LDNA 1YGYA 1YH3A 1DWQA 2W93A 3ANXA 3BH7A 1UBMS 1XD2B 2ZWIA 3CB4A 1T8YA 1E2GA 2HBQA 3QEJA 4IJ5A 3QVGA 4ZWNA 2OBLA 4M0UA 3UKOA 3UWDA 4BN4A 4NDNE 1PFKA 2O8EA 1QRUA 1GITA 2GJAA 3A4MA 5ELLA 3CR8A 4PZYA 5IBRA 3T3DA 3L0SA 1XX6A 1W47A 3Q7QA 3FE2A 4BQRA 3DMTA 1MC1A 3TRKA 3WX0A 3GDOA 4DBLE 3KKZA 1RHRA 1DAIA 4GWLA 1Z2AA 2KE5A 1QZTA 3TKYA 4F45A 4YBZA 1ABEA 1KO8A 4X3OA 3W6ZA 2H3HA 2HA0A 3I8SA 4ZTBA 4LFCB 1K8RA 1L1EA 4G5HA 3N2ZB 1EWQA 1IOLA 1WXEA 2GZHA 2K2WA 2JC3A 4OJNA 5IKEA 2W2XA 1KHTA 5JNUA 1EYZA 2YYYA 4IPTA 1I5RA 1S1MA 2RGAA 3A58B 3DA8A 4UBOA 5BQ5A 3S2EA 1T0JB 5JIBA 2I6XA 3WGVA 4RCYA 5DTJA 2ZFUA 2J5QA 3OKAA 4W7SA 2QPOA 1VI2A 3C3CA 3HJHA 2Q0XA 4QIHA 1CUEA 5C0OE 1XJ0A 3N39C 4NMMA 3MBKA 4U6NA 4WOPA 4IQ8A 1QRRA 1G0OA 4YO8A 2Q5CA 3B36A 1EUDA 2HXSA 1N1DA 1YS6A 4ZCIA 4WACA 4RESA 5HRUA 4IXDA 3JZMA 5I5GA 3H9EO 1JR6A 2GARA 1CHNA 4TKZA 1TXGA 3NTOA 1E6EA 4L8VA 4LRTB 5CEFA 3PUKA 1OJLA 1NI5A 2ZIZA 4QFDA 4U6SA 1XI2A 4GSYA 4HFJA 4DRXA 4N76A 4EZIA 3TPZA 4BCDA 1XEFA 4Y1RB 5HGJA 1Z0KA 3BCUA 4O8CA 2AI3A 2WYWA 1DQPA 2Y1EA 3KQSA 4I6GA 4PZZA 4J7XA 4LMRA 5AUOB 3KCNA 2AZXA 1N6IA 3DLTA 4YJGB 4P3XA 3DPSA 4AZSA 1M2NA 4WZBA 1GAWA 3QEBZ 2IHNA 4MZXA 5EVJA 4B6SA 2PTGA 2XUAA 3AGPA 1K6EA 2I91A 3VX4A 1KRXA 1B76A 1R9GA 4NPCA 4NECA 3MB5A 4N4AA 2YCLA 4ZC8A 1G63A 2NO1A 3I2IA 2WSSA 1BFUA 1KSJA 3ETHA 4FLFA 2W58A 4E88A 4B4DA 4IDFA 5I6DA 5F98A 4C7OB 2EQ5A 3AP2A 1NJ5A 4LZAA 1FXWF 2DC1A 3NHFA 1S4MA 4EEXA 3HXLA 3MN1A 4MVJH 2GPYA 2I9PA 2JAPA 4DV4B 3BA6A 2X0EA 1QF6A 4J90A 3HL0A 4IH4A 1FQWA 2IODA 2JNWA 3JYNA 3OD1A 5DTMA 1X8XA 2ZI9A 4MQ5A 2DETA 1E2FA 1GYPA 4U7WA 5AVYA 2Q5OA 4UC0A 2HJSA 4GZMA 4H6XA 1LW6E 4JI7B 3E9DA 3MFYA 3MHTA 3NWJA 1WG8A 4N3GA 1DC6A 2XECA 3G23A 3RS5A 3HM2A 5JXJA 2O0JA 4KKVA 5IU6A 1MC5A 2QX9A 4MR7B 1T0BA 3C41J 3KFLA 2QLFA 5LA6A 5JROA 5KOJA 1DMSA 2FPWA 1H2HA 1NKTA 2ZRPA 3ELYA 1YBMA 1DO2A 5HOEA 5L51A 4FHCA 3FOFC 2OGZA 4LK3A 3HR4A 5B1EA 1A8HA 3EJWA 1JFTA 1AQIA 2WICA 4L0CA 3KQTA 2Z8YA 2V0GA 1JJIA 2ZRLA 5KTOA 1N7IA 3QVTA 5CXQA 4HEHA 2OZLB 4ZAFA 2PV7A 2ZYTX 2HLDD 4YRAA 4FR2A 4PAOA 3ZWMA 1VPWA 4MV5A 4ZPXA 3UMJA 3WLSA 3W5BA 3KR1A 4YI3A 1Y48E 5H02A 1NC3A 3OKFA 5IARA 2QGFA 4EECA 2WWGA 1KHHA 3MF4A 2LW7A 4HNGA 2IOFA 1JHPA 4EJSC 4N48A 4A16A 4HGOA 4C2BA 4IXWA 4AB1A 2X8BA 3NYRA 1CE8B 2QLBA 2EBWA 3SFZA 5IPFA 1MX1A 2ECFA 4DR3B 1O8CA 1JBQA 3BREA 4PZ0A 2V7VA 1FLNA 2OAEA 2WUDA 3LY7A 3OZGA 2I7TA 4IQ4A 1JSLA 4RH3A 3G2LA 3SNHA 3ZKAA 2NXWA 4AROA 1VI5A 3OOSA 4EG6A 1UMBA 1NZDA 2AEMA 1C9MA 4QQNA 1JTFA 2J7KA 5E9QA 1HK7A 3UOWA 4ZYYA 4OHYA 3OM9A 3SVZA 5FHRA 4CT4B 1COWD 4DFDA 4YRKA 5D84A 3QTTA 4JR1A 3E81A 2P0AA 4PLGA 4BO0A 2GBPA 1V1MB 1SD1A 2QF7A 5CVDA 2HBYA 1T2UA 1ETHA 2VUHB 2XMPA 3K9GA 4HGYA 4F56A 1B73A 4YCNA 4F8JA 3AEUA 3QFCA 4NOJA 8GPBA 4O4JF 4LN1A 1N75A 1O6GA 2PSSA 3FVTA 4GGOA 4JL6A 3AUXA 2P2LA 1Y1PA 4B74A 4I50B 1RKVA 3CS3A 4BEBA 4F92B 4QDOA 1I6MA 3K1ZA 4GMFA 3PLAE 2XLBA 1DKLA 4KWCA 2PY6A 4LYGA 2JEYA 1T9HA 1UEIA 3VTZA 1Q22A 3EODA 1PVOA 3UBMA 3ZS9A 3H0EA 1JBEA 2GD1O 3QFSA 3CLUD 5CIQA 4B8WA 3BXOA 1CUUA 5JDCC 3B7GA 2RGNC 4PG5A 1GSHA 5CLFA 1Z7WA 4MAFA 4Q1VA 4MOWA 3ROQA 2P77A 4BUZA 5C51B 1X7GA 4OQQA 3OICA 5COAA 3RS9A 4BNFA 4YJKA 1MOQA 1FJGB 5LJIA 1ISMA 2GMWA 2AN5A 2QMOA 3N2YA 3AUUA 3PQ2A 4JENA 4IIGA 4H3SA 1DIAA 4BMSA 4EPWA 4Y9RA 4UM5A 3ZJUA 1RAEA 1P5ZB 4H4EA 4PYLA 2J31A 4LBZA 3AQ4A 3UFXA 1T1EA 2G5CA 2RFLA 3AIKA 4QSMA 3RANA 1YR1A 1T9GR 2H18A 3PR2B 2HSDA 5DBOA 1CD5A 3RAJA 2CCGA 3U80A 5CFLA 2IL1A 2BM9A 1LW7A 1SBNE 3IUYA 1Z47A 3CH7A 4O63O 4IICA 1M2EA 2WFLA 2WMYA 1IN4A 2YOFA 4C08A 2GFHA 4NICA 4Y30A 4MGYR 4EPYA 1E2LA 2REBA 4D9KA 1MX9A 3DXXA 4G01B 3ND5A 5I48A 1O97C 3ENVA 3COJA 1XRSB 4D8WA 1XYVA 2CMKA 3UUWA 4BGIA 1CS0B 1VMKA 4RPCA 1PDWA 4YPOA 3EFOA 3WO0A 4YCSA 2WTBA 1VCMA 2HA7A 1TPYA 3GRAA 2EL9A 1DC4A 4CGZA 4GLLA 4S1VA 1FSSA 2X5JO 3BDIA 3R3ZA 1SHKA 1KEVA 1M6WA 1GNLA 1SN7A 3ZOKA 1E96A 4MQUA 4CM5A 3H3XA 1BA2A 3EVDA 1QIJA 3GNSA 4MVJI 1H2ZA 4LDPA 7ADHA 4Q93A 2HDOA 4GR4A 4UQLA 1SIBE 4NFLA 1XROA 4V3BA 3ZXXA 3U3ZA 1ONSA 4RA6A 1Y7IA 1IZ7A 1V5IA 2I2CA 2QD2A 3GBPA 2QRHA 4TMTA 3EBLA 5F78A 3CW9A 2GWHA 5ELMA 1RWBA 3PFWO 4M8IA 2ACVA 2ZBRA 1QZZA 4CKXA 4YR7A 2ZJ0A 2GRUA 1V7ZA 4KV9A 5CNJA 2V45A 1Z8DA 3KOZA 3R9IA 1KK0A 1RE1A 5IAEA 4EGCB 2QENA 3UJBA 3EUFA 1DCTA 4OGLA 3SMVA 1SOMA 2Q28A 1S89A 4LY0A 5D3KA 4LJYA 3LP8A 3UK0A 1DOHA 1L7EA 3HBMA 2UUOA 3B2EA 3IDAA 5FUYA 1V45E 2GRJA 2WV7A 4RA9B 1P1CA 1PZHA 2CFOA 5G0UA 1U8TA 3DG9A 3TJMA 3MJCA 1IXRC 1ZU4A 3BE8A 3OPYI 4B31A 4LQLA 5U9CA 1VHWA 2P9FA 3OFND 3OZ7A 1Z17A 2PZMA 3BK1A 4W4TA 3ICPA 1R6DA 2LE0A 5EYPA 3UV6A 1ULHA 4BQIA 5FH9A 1XSEA 2VHZA 1KJ8A 3UWMA 2GCIA 2JH9A 1TJ5A 2B20A 2OVFA 1QVWA 1JNXX 2I55A 3E5NA 2A1IA 1WSDA 4QJBA 2WUGA 3UHJA 4Z51A 2ZYGA 4E15A 5M04A 4P86A 2O1SA 3SJCA 4MMYB 5C8ZA 4BLSA 2MINA 4WSOA 3BMNA 4GRIA 2NXEA 2BMDA 3IP7A 4FSDA 3TZKA 4G23A 1CF2O 2Q49A 3ZLTA 4ZU3A 4RJLA 4DS3A 4EB8A 1L5ZA 1QC5A 2EU8A 2A58A 3M4JA 4KWIA 5DM1A 3K35A 1BOFA 4O2AB 5A7GA 1M8KA 2CYCA 2PX5A 3IAFA 4AJ4A 5TRTA 4ENUA 3FPFA 1WKVA 3VKVA 2P9JA 4MGHA 1CTQA 5DSTA 3VR6A 4GFDA 4OFXA 3BX1A 5LMNB 1QBGA 1Z4JA 2L2QA 5B1IA 1JHMA 2BV3A 2HIAA 1JG3A 2R6ZA 3M9LA 4HK4A 4DJAA 4D3ZA 3BKXA 1TRHA 2LD4A 1LZKA 5AM4A 1E59A 1TC2A 2GTPA 1Y3HA 3W1WA 3PT5A 3LXRA 4GBGA 1WW8A 1V6SA 5KPDA 1SVOA 1W5TA 2XXAA 1T5DX 1XMOB 5C8YA 3WKAA 2X7XA 1L3CA 3H11A 1CEEA 4MP3A 3TD9A 3AUSA 3AIMA 3ZGLA 1I2CA 4ENRA 1N25A 3L9XA 4Z9BA 2OHGA 5DMXA 1RAFA 1T5TA 3N05A 4IWNA 5IRCD 2B4YA 4N8EA 1DDOA 4JFRA 2YY7A 2EEZA 2AJLI 4M0EA 1OLSA 2PT9A 4MI6A 1G8MA 3E35A 2VL7A 4V02A 2VHXA 3FCUB 4ZT4A 4CJXA 2XEXA 1H6BA 1ACMA 4MK4A 1AT1A 3SF8B 2AFHB 2QR2A 3E22A 4ECEA 4XM2A 2FX2A 5EP1A 1Z83A 1FPMA 2BFPA 3OZEA 4IFBA 4JJAA 2PV0A 4RQUA 2QQ5A 4KXUA 2DWOA 4C6TB 3KV3O 1FDSA 2QMHA 2OO5C 1IUNA 5JARA 3GFTA 5CM9C 1K4KA 5CA1B 5KO2A 3T3HA 3KD3A 1YCGA 2IU0A 4UE2A 1KDYA 4RE5A 2WIAA 1XCPA 3FDZA 1LD3A 1EUCB 3JU3A 4PVCA 5CAEA 2O0MA 2J9FA 3B6EA 3DBVO 5HRAA 2D1QA 3UQZA 5DGCA 1TVMA 3LLMA 3MOGA 1N6HA 3FOAA 4O1MA 4IJVA 1RPZA 2UZ1A 3FWKA 1N5KA 3VZDA 3BKWA 2YN4A 1YB1A 5T6BA 2G0NA 1P17A 5IVKA 1V8BA 2JFFA 4O4HB 5T57A 1CZOA 4A23A 2NV2B 2YRFA 3SS7X 1J9ZA 5BV2P 1YDFA 3P9NA 2EARA 3GNQA 5J4HA 2JL1A 1YNOA 4R4JA 4B2LA 3KOWA 4W1PA 1QHXA 5DHAA 4D26A 1REQA 1W88B 4MITA 1F1JA 2D4HA 1Z3IX 2A14A 2PRZA 3TSYA 1T3LA 4K9KA 3EULA 3SX2A 4MRAA 2QI9F 4JXXA 1QP4A 1CETA 2F90A 3IQDB 5AOVA 4LMAA 5KCMA 2Z5FA 1KERA 2I1VB 1WCIA 3H9CA 4NAVA 4IMRA 2H92A 4BX8A 3MM4A 5TQ2B 3TAHA 1PK7A 3BSFA 3K0SA 3RUDA 3UICA 4GZ5A 1DB3A 2YXPX 3LZ6A 1W1UA 4IO0A 1L5GB 4CKZA 3C1OA 2VPXA 4YLEA 1BU5A 1CUXA 4AM8A 3EXFB 5JC1A 2PSHA 3DW3X 3WAKA 4JOSA 4J0QA 5HK8A 3V1LA 1MQSA 3ZY6A 1JAHA 1UDCA 3DOOA 5AOAA 7REQA 5CCXA 5SY9A 1RIIA 2XJ9A 3W2FA 5B36A 4C03A 5EP4A 5IXJA 4ABTA 1VJ5A 1CC1S 2PLRA 4K9OA 4GL2A 4F5DA 4HUTA 2ATVA 2IEYA 1GFIA 3DMRA 4GHWA 4IUDS 3ULKA 1NQAO 1XRRA 2G28A 2QJWA 4FSXA 2CY0A 5J5AA 4TLMB 4NU8X 5CK4A 1TVKA 2NZUG 4QPDA 2WWXA 1EK5A 1F06A 2RD2A 1TLTA 4PG6A 4PLYA 4TRJA 1US8B 4DW8A 3EC7A 2OHHA 3NALA 1G8SA 2GHIA 3MD0A 2RKOA 4BO9A 3WFIA 2DCUA 1LJLA 1R6AA 1QLHA 2DFDA 16PKA 2FKNA 3QUTA 3E5RA 1Y4AE 3C5HA 2JK0A 4XFJA 3O73A 4R1MA 5KKAA 3R7LA 3V8RA 4C3ZA 2BR4A 1Z5GA 4D7AA 1SB8A 4G25A 3B6KA 1AD2A 1ZM2A 3DHWC 1CYEA 2H07A 3QRWA 4FI3F 4IH1A 3KXPA 5DCYA 4CMIA 5KUTA 1PEDA 1DKMA 1GV1A 4JT9A 4JSYA 3GFFA 4DLUA 5J4LA 5DTQA 3SCZA 2EQAA 2DERA 3TINA 1RHJA 5CDUA 2WTXA 2B1QA 3C3XA 1KP3A 1KFCB 1U90A 2E4ZA 2CXNA 2PRKA 4FQ5A 4JLPA 4KG7A 4O4IA 3NASA 3F67A 2R8BA 3KFVA 2QVXX 5ILQA 3L1HA 3NHUA 4NZMA 2O4CA 2H31A 5EZ5A 3U48A 5BWBA 2MSDB 4RORA 3SBEA 3HUTA 4DJJA 1QB7A 1DADA 3HV0A 4LE0A 4X1IA 5CA0B 1J22A 1THZA 4BNDA 1EJ0A 4RE6A 1JE0A 1E2DA 3KUXA 5PNTA 3S2GA 3UIEA 1T43A 3H65A 1E4YA 1QO7A 2XYHA 4DMLA 4XWYA 4