4N48A

Cap-specific mrna (nucleoside-2'-o-)-methyltransferase 1 protein in complex with capped rna fragment
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
407
structure length
401
Chain Sequence
VDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDRELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
total genus 137
structure length 401
sequence length 407
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n48A00
4N4AA 4N49A 4N48A
chains in the Genus database with same CATH superfamily
4H0FA 5DTRA 1X0VA 3RSZA 3WDKA 3TNLA 4NJMB 1DMRA 2O9JA 5ARDA 2DTXA 3UCXA 1ZIPA 1K6XA 3F1KA 1NVBA 2MSEB 1R6TA 1RAIA 1TEXA 2A84A 4QTYA 1D09A 3I8OA 2PA0A 2YIJA 2BDUA 3CE9A 5DTIA 3T7CA 3RSGA 3W9YA 4DHWA 3RYHA 2C9OA 5EJ5A 1KY2A 2RAVA 3STYA 2R0QC 3THWA 2PRJA 2FZVA 4QLBA 5IF9A 1E7YA 1XXHB 2GJ8A 2YRWA 1W35A 4QXAA 1DQSA 1ZPDA 2BGNA 4RWEA 3HADA 4ZV4A 1PFYA 1WXIA 4B4VA 1SBHA 2WDZA 4RK6A 1ZLYA 2WF6A 4KP7A 3D43A 3PQFA 4MARA 4PSCA 4OY3A 3ZXIA 1N4DA 3CBGA 3GJZA 2C2KA 2BGLA 3OZWA 3B1WA 3I52A 4Q02A 4TLMB 2ZI4A 4WGFA 5DEOA 1XQ1A 4OQXA 4JLVA 4RTLA 1OH8A 3WLTA 1D1PA 1Q19A 3C3XA 1T2AA 3EA0A 5ALJA 1N3LA 1TUIA 1G5QA 1XIVA 3IP8A 2YJGA 1KORA 2JZCA 4LY6A 4Q7EA 5FL3A 1MO5A 3A3OA 3EEFA 5LSAA 4AQYB 4ITVA 3OQHA 4EJ6A 3AEKB 4NWIA 4FMDB 1BS2A 4UTOA 3ITNA 1GVNB 3FNRA 1H42A 4DJFC 1ZD8A 4N8EA 2HLPA 3RT1A 2BIFA 4BP9A 4IDQA 4JKIA 4F9FA 1VSTA 2I9KA 2WWTA 5LZ4A 4KE7A 2VEOA 4JENA 3NHWA 1BX1A 4J16A 4RC9A 1TYDE 1T1JA 4AKHA 2OGSA 3STVA 5JCXA 5CFPA 1RXEA 1UWVA 1EDEA 1YKGA 4HVTA 1GFIA 4Z49A 1DEKA 4PE5B 3HR4A 5EPOA 3EBPA 3QVVA 4IVPA 4KFRA 4J0KA 3IAXA 1FFBA 2QRHA 4ZN6A 4O0LA 5TF4A 1QVRA 1WMSA 4AX8A 1G6OA 5F1PA 4J91A 4JP5A 3W3AD 4C0QC 4I50B 1CIPA 3OIVA 3IHTA 3ZDYB 4EG4A 1DKMA 1EWYA 4GP7A 1T3GA 5CXQA 1MO2A 1ZOOA 4MVCA 5JAMA 1N8SA 4C4ZA 2WG1A 4D02A 2HPZA 2XBUA 2JGLA 1DBSA 3FCCA 5F51A 2JAXA 4XCVA 3WJ1A 2HU8A 1JIQA 3IP9A 5EHZA 1A8UA 1JLLB 4HAYA 4F46A 4DXDA 3M6FA 3FOAA 3H99A 1NM5C 4JJ7A 5C1DA 1FSFA 1Y9ZA 1GPAA 1V45E 3FCAA 3Q9NA 1RP7A 4H6VA 3NCTA 2ODAA 1IXZA 1LBSA 1KC3A 2C94A 1UM8A 2GYVA 4IS2A 1U3VA 2WHQA 5LOVA 1X9HA 1N2GA 1B0UA 4MYTA 4DDHA 1F1JA 2B6NA 4YECA 4HAWA 4CMEC 2R7LA 3K0EA 2FP4B 3T7KA 4CZ2A 2NXCA 2G4CA 2XUIA 5EL0A 4AQDA 4Q7LA 3S4YA 4WK6A 4S3MA 5KNDD 2R6JA 3PUXA 4P1ZA 1NMXA 3B52X 3HXKA 4PZ9A 4WCDA 5KSPA 1RPAA 2F9MA 3W7BA 3S8MA 3BIWA 4KXXA 3AUKA 1DXOA 3KAKA 4WNYA 1ZBQA 4BJ1A 2HZ7A 2QLFA 3TFWA 4BMNA 4CW7A 5LFAA 5D1HA 1VHLA 2BEWB 2PSFA 3RKSA 4WX2B 4W6ZA 3NVMB 5GVSA 3RLIA 4P82A 1UBSB 1OH6A 4R9VA 4ZYYA 1OLXA 3OZCA 4Q7MB 1PJRA 5CDFA 4KNVA 2A5DA 1SHKA 2X9LA 3KUDA 4BXOA 4LBYA 2CK3D 5LZ8A 1YCGA 3FPCA 2NP6A 2WJGA 3GA5A 1TEZA 1BJKA 4TKVB 3SC2A 4N9QA 1RFLA 1IY1A 2YICA 4V0QA 2EFCB 1BS1A 3NGMA 5DT2A 3ON5A 3UJ3X 5FPYA 5AUNB 4QVIA 4TQGA 5B1HA 3IPAA 1Z4OA 2ZUVA 2FFQA 4KBYA 4MTLA 2FPPB 2ATIA 2F9LA 3H2KA 3HBAA 1N3YA 4Q16A 3URMA 5ITSA 4X63A 4O2AB 2EQBA 5JV5A 1E1QA 2UXBB 1OMOA 1E2BA 5AM4A 5CAEA 2Q1XA 5K2MA 3USES 3I9KA 3PXUA 1RI2A 4C0BA 2XR1A 1LDYA 1W76A 2PZFA 3EC7A 3MWEA 2ZWAA 1GAEO 4BFXA 2O2CA 3BZBA 3TOCA 1AF7A 4JQCA 2FK7A 1JFLA 2GYUA 3SIWA 4CVNA 5J23A 4QUKA 1DCTA 4DR7B 1W5TA 3Q0EA 2OHIA 1AO3A 4DM4A 3CX4A 2FG5A 4R8SA 4YT5A 2WQ6A 2PZAA 1D0VA 1CQJA 3HN6A 4IEEA 3D6HA 3LP5A 1HOTA 3COWA 2H18A 3G5AA 1IJFA 1E7WA 3N2KA 1ZGZA 2ACWA 3IAS6 3B5JA 3UV3A 1SB9A 5H3CA 2IU6A 4ZYWA 4QXPA 2BKXA 3PVCA 1P0CA 2JGJA 4KRXA 1ZMBA 1IMJA 4KYVA 4CCWA 4M6WA 3F9RA 4Q6BA 4WESB 5ILQA 3E8XA 3DDWA 4N4AA 4RK5A 4LXIA 4IIHA 1SUWA 3E22B 4IWNA 3G2KA 3P2EA 1U80A 2CLKB 4WVFA 5ESXA 3M9WA 3UQYS 2BVNA 1L7QA 1XO1A 2VYND 4F5YA 5HZMA 1E0DA 2BFFA 5TQVA 4CEJB 4D4GA 3QEOA 1GZ7A 3F1LA 5K1ZA 2YFQA 1RTTA 1PNRA 1RE1A 3ONWA 3RC3A 4U5QA 5L3RA 3WGKA 2QA5A 3IP6A 1X19A 3T1TA 3WIDA 1GCIA 4UDNA 1NVAA 4F5DA 3MEQA 2PKQO 1GDTA 2ZB2A 3JVDA 2AG0A 3OO0A 4A1OA 2H65A 1G98A 1H6AA 1QYIA 1YR6A 1W93A 1SZPA 1VFNA 4JT2A 1P18A 1K4MA 2A57A 2BFDA 5KVAA 3C41J 3L49A 2WSIA 5JPIA 3OBIA 5HF5A 4LTDA 4OB8A 1PT8A 1Y1SA 4Z9FA 1O97C 2R60A 4QQRA 3JWJA 3QEJA 3EA4A 4S1OA 5K0SA 2EFJA 2QVBA 1O5IA 1RZ3A 2FH5B 2Z58A 3BS4A 4KVAA 3N0TA 4F4DA 5EOVA 4F6CA 4F8JA 3DNFA 4KQHA 1B0PA 1QPGA 3QUSA 1I10A 2O14A 4UULA 2GEFA 3HU5A 3JCZA 3ESYA 3GIDA 4H6PA 4YT4A 4W5QA 1FFCA 2D74A 4F72A 3PEYA 1WAMA 2PSJA 3QYJA 3RIEA 4BFCA 3TXXA 4X7RA 2CVFA 3AFIA 1E60A 1LS1A 3I2FA 1ZL0A 3FN4A 3O82A 4PAMA 3UXHA 4QXOA 1DAIA 1T9DA 5G40A 1YZQA 2Q4EA 2Y0BA 4GI7A 4BMXA 2P3QA 3JD3A 2WJ3A 1Z3IX 4PWYA 4FONA 4M8IA 4F2PA 1G20B 4BKQA 2O19A 1DAMA 1IRIA 2VUTA 3VJLA 4OTZA 2FX3A 2JGIA 1C1XB 1M8GA 3MJFA 2J6CA 3KZKA 4WD3A 3T7RA 2FDRA 4XWWA 1M83A 4TUYB 4WXYB 4URHA 2RGRA 1N9KA 1Z28A 3PGLA 3LSTA 2OFOA 4AUMA 3LL7A 4BCCA 1ORVA 1U5BB 1W25A 1ZI9A 1SKMA 2HXSA 3E9YA 3GLUA 4ARBA 4QEZA 3VO8A 3C14C 3TQFA 1OGIA 1OHHD 4F6RB 5BUQA 2ZKIA 5IDWA 1WLYA 3SYKA 1SHJA 2IXGA 2PVSA 2JHCA 1LLUA 2CD7A 3GGPA 3GH3A 3PUWA 1ZSYA 3EUAA 3RVPA 3RFXA 4C4PA 2GCIA 3TOZA 4KIFA 2VCYA 3PCXA 5AVOA 4XJSA 1M1NA 2QX8A 3HKEA 4C5AA 3QEAZ 2DE0X 1FRVA 1OFTA 2GBIA 2CFOA 1IHXA 4U9HS 1MB4A 2QUJA 3VR3D 4C08A 4PN7A 4BFUA 5KVVA 1C3XA 2G9RA 5ALSA 2B34A 3JQFC 4XLZA 5F98A 1XPOA 2PSDA 1Q77A 3RU2A 4UDYX 4Z51A 1H9AA 4H16A 1QIDA 1YB4A 2Z43A 3VAAA 4CF4A 4ZMSA 1NN0A 3H2JA 1ZGHA 2F64A 4WZ6A 3R40A 1ETHA 1RRPA 2F90A 1GZUA 4NPHA 3UC5A 3OJLA 3OEED 1NM5A 2ZIEA 3I2YX 3L0ZA 1X8JA 5AKLA 3CIFA 4RQTA 3UV6A 3VTAA 4GDFA 2E2WA 3B78A 5DK4A 5F9MA 1NRXA 5ALNA 5EP3A 2W7TA 4TYQA 2XD9A 1KVSA 2VP2A 1UDCA 5JY6A 2R6CA 3PPVA 4AZ0B 3I72A 1QHFA 2R6GA 3QKRA 1WCV1 3EZ6A 3ZHZA 4G1FA 4KLAA 2JJ1A 2XYQA 3PPIA 3QF4B 5T5QA 2VHEA 3MOSA 5HZHA 3ODGA 1DHTA 4HQKA 2UZ4A 4B17A 4W8HA 3DJYA 4LYFA 4BY9E 1IQ0A 3KCQA 4BFWA 4XWYA 2H1LA 3U4GA 2DWOA 1HE2A 4HQNA 3E7XA 1YJCA 5F2OA 4E7PA 3H05A 1E9FA 4D82A 4ZHSA 4L74A 4S35A 3VDQA 3CT6A 4IGIA 3HMKA 3RR2A 4E7OA 3KB8A 1KI3A 2G76A 4EYKA 1OZHA 2BTQA 2VL7A 2ZJAA 4ZKDA 1XTSA 1O0CA 1K1EA 5AK0A 5K0LA 4HH3C 1DC6A 1IK6A 1OR8A 5LN1A 1H94A 4FW8A 1SKYB 3FHOA 3FOCA 4X8OA 3BWCA 4CFZA 4PCLA 3NIDB 1CBUA 3EW7A 3OKFA 1VP3A 5M7EA 3FPJA 5T4EA 1EXNA 1HEUA 4PNHA 5BSUA 4B47A 3V1NA 3FTDA 1KNQA 2VVTA 1WXHA 2QAGB 1DOZA 2FVYA 1P31A 2Q8PA 1USIA 3OTWA 4BAUA 4MKFA 5EEHA 3TMAA 4EMUA 2W2NA 1KMCA 2D0OB 3LBIA 4C4AA 5FQNA 3Q98A 3OE7A 4C22A 3D6TB 5IG2A 1JDJA 2HIAA 2VJQA 1O1YA 3ECSA 4OJMX 2CL6X 3F7NA 3K0FB 2GHQA 2QD5A 2RB4A 1Z4JA 2JKYA 3WWEA 3R6LA 3HKDA 1M2OB 1Z37A 1O03A 4KAAA 1WPGA 3I3SR 4QQ8A 5D85A 3LUFA 3SHWA 5AK3A 4CLOA 2EX1A 4GC9A 1L5LA 3BGWA 3VPGA 3KKMA 1NN5A 1V1MB 2P6MA 3O4HA 5E4FA 3B1KA 5SYNA 4D4KA 4CDGA 4RTJA 4HGYA 4Y2TA 1H0KA 4P3XA 5AKIA 1RYFA 3UG7A 3DUFA 5EZ5A 4FFPA 4JLMA 1CKEA 4Y2VA 1CY8A 1SD1A 3QXJA 4HNGA 3IEUA 1NLFA 2GAAA 3DEHA 4UVDA 4TPKA 4E21A 3ZJVA 5JZOA 4GSKA 1ZM7A 1FP4B 2FUEA 3A37A 3EJ6A 2IBTA 5MDHA 3IDAA 2L18A 3LCMA 1ZINA 4AIRA 1BWSA 5DSTA 5IZ4A 1TYBE 1M66A 2ZTMA 4KXUA 1H2FA 1BE6A 1QKIA 3VHRA 2O0MA 1WCYA 1ZH2A 3A06A 4QFCA 3MUOA 1W0JA 3BGSA 1R4NA 3M49A 2VNKA 3GFFA 3GMIA 4EARA 2O0KA 3ISVA 4AX4A 4YR7A 3NEJA 1UPFA 4F5ZA 3K4HA 2YNMD 1S7GA 3WV5A 1JYSA 3HCBA 4ZVSA 3R0IA 1CUYA 1ODCA 4B71A 1KIMA 3LY5A 3BF7A 5GIPE 2CNBA 2VYNA 2BGJA 2DUWA 4L15A 1QVVA 3KSUA 4ESEA 4RLHA 2GDZA 3VM6A 1EESA 4IQFA 3IRUA 4YRAA 4TKUA 3T52A 3FYHA 3BSSA 5D5QA 5EG5A 5WRFA 3DTVB 3M1LA 2GO7A 4L7VA 3HS3A 5BQXA 1RM4A 4Q1CA 2CUZA 2RGXA 2QI9C 4Y2RA 3AB3A 1QZZA 5FOXA 3D3WA 4C4OA 5IKEA 1CC1S 2HA4A 4J2OA 4NZZA 3ZN2A 1MW9X 1CDEA 1W4RA 1MGOA 4QOJA 1FU7A 2MTBA 3MSXA 3C4QA 5EP4A 1M1YE 1OLUA 4DBLE 4UZFA 3JQAD 3G13A 1H2ZA 1NU6A 1KEPA 3F3SA 2QS9A 4TTJA 3WRVA 4B83A 4DLWA 3OM9A 3RWOA 1CSEE 2ZUSA 1ZGJA 1ZIDA 3CLKA 1Y8RA 4JJ4A 3M8KA 1SHTX 4DV6B 1QG2A 2MYTA 1B00A 1V8FA 3O9MA 4ANFA 1M2FA 1UM9A 2J3IA 3MYRA 1QQTA 3JWPA 3A1WA 2P2NA 3IALA 5L3SA 2H4YA 1N5KA 3CWCA 3DCJA 4BVBA 3IULA 5FO1A 2VSQA 5I8PA 1GXSA 2CUNA 1DVRA 3ZLBA 2BGMA 2OKCA 1K2WA 2GQ0A 1ZCBA 4QGGA 5H4GA 3WLIA 4QTTB 4F56A 4LMPA 2W6ID 2JAQA 2AC2A 1NMEA 1EJ2A 1PUJA 4NYMQ 1H2WA 4Y0VA 4YJDA 2Z2IA 4RORA 3IO5A 5BVGB 1L1RA 2R6R1 4O4HA 2JJ2A 3NUZA 5BXQC 1ACLA 1N2BA 4NARA 2A1TR 1D1SA 2FZKA 1QGOA 1G0OA 2ANBA 3LYUA 4FXPA 4P3NA 5H3LA 1M1YB 4DAOA 2DH6A 1U0OC 2XGMA 3DDNA 4JBWA 2C2BA 4CIBA 4FM9A 1JX6A 4DV2B 2Q50A 1IE3A 4W99A 1EZZA 3KEOA 1DZ3A 2VYCA 3PF8A 3NOXA 1VE7A 4MVJF 5C8YF 1JKIA 1Q0UA 5TDHA 1W30A 3TRFA 4B4UA 2OXIA 4DUGD 1PAUA 3F9IA 3HY4A 3G2LA 1SVWA 2B4QA 4BP8A 1DRWA 1UOQA 1VHQA 2H29A 1EUZA 1TA0A 2NVUB 2G1UA 3ZBPA 5LJLA 3BXXA 2OHHA 1U6IA 3ANNA 2C82A 3NFYA 3Q87B 1FFWA 3QBTA 3TPCA 3PJFA 1RAHA 1Y3DE 2E48A 4N0PA 3WYCA 2B1QA 4PGHA 1QPBA 3NBYC 3T1QA 3D2BA 3CRRA 2BCJQ 2IX9A 2ZLBA 4I3HA 1YC5A 2Q2QA 1RQPA 2H31A 1JPUA 3LLMA 3CU5A 4ZI7B 2ZRQA 3U37A 3AKCA 2ZRNA 1F6WA 3C8DA 3K6RA 5FI1B 4RZXA 1ZIXA 1Q1BA 3H5AA 5TS2A 1SQ0A 3P0IA 3ONDA 3S2IA 1DQRA 4ZVRA 3H1EA 4Q66C 2WWGA 4I9UA 3I04M 1RJ9A 1PVDA 4RJ2A 2P0YA 1AUQA 2JFGA 3O2NA 1I2ZA 2P9EA 1GPKA 4N3NA 2OHGA 1UKYA 2NXEA 4ZQGA 4A15A 2G40A 4IMPA 1TIKA 2DFTA 3H42B 1KS2A 3ZV3A 4ZVKA 1RYNA 3MWFA 1Y8QB 3A6EA 4G56A 3RUIA 5KX5B 4MRNA 5B55A 1N5LA 2BN4A 3GRUA 3H1TA 2I76A 3L1HA 3L9XA 4YAIA 4EQ6A 4D98A 5IBQA 3O3CA 4H6WA 2PH5A 3EEYA 2RAPA 3UKDA 2REQA 2O8NA 4YLEA 3DBLA 1Y6JA 3WMWA 1QVWA 1K4KA 2ZE5A 1U0GA 5BQ3A 4KYIB 4YREA 4JODA 2OFPA 3LY9A 4QRIA 3FCXA 1CXZA 1F2UB 2RC6A 1C1DB 4MUKA 5F78A 2WJ6A 3MHTA 1CLUA 1A9XA 1ZW6A 3ZDAA 3O03A 4AS3A 2F3UA 3A2LA 3BICA 5EXDA 2GXUA 3HCAA 4KK3A 4EPYA 5J1SB 4DBZA 2JANA 3EIOA 1MIHA 4FDAA 4DV7B 4JVNA 2JLSA 3PUVA 1K6JA 4L76A 4LCBA 3PX7A 4WKGA 5GJVC 2HHJA 3FFAA 1APBA 1BWPA 1FP7A 1OVGA 2ILVA 2C0PA 4J0FA 5HGJA 5BVHA 3FMGA 1FQWA 1TVKA 2G06A 1TZ2A 3DM9B 3N2KB 4TTRA 5KQMA 3QHQA 3R6WA 4IJ6A 2Y05A 1PWZA 2ECKA 3QBEA 2IYUA 2LXNA 1OA0A 4GAEA 5EQFA 3ZIAA 1K7EB 1LFDB 4YJHB 3QSGA 1YB5A 2HF2A 4Y6GB 3EPHA 1ISRA 1NTOA 2OHFA 1I30A 2KPOA 3ETNA 1S1CA 3ORRA 2MINB 2WZBA 3C6YA 5AKYA 4F9GA 3A36A 2OPBA 4D5GA 1NBME 2VHYA 1F8YA 5KJ6A 4NI5A 3CGWA 3TW8A 3NH9A 2FMXA 3VHXB 1LW7A 3HNPA 5E9JA 1E2HA 3WLQA 2NUAA 3G6KA 3H9CA 5I9NA 3VC1A 5TQ2B 5CLHA 3QF7A 4EKDA 1QRAA 1V3QE 4E4TA 5LMNB 1IXYA 1T3HA 1T9AA 2YHSA 2BE9A 1G5FA 5HS6A 4R84A 2QRLA 1WA5A 3B12A 3CR7A 3CEMA 3DEFA 4LJ7A 5DGDA 5HFNA 3VR5H 3KM0A 3TBKA 2OMKA 4UM7A 3N0XA 1AXEA 4HX2A 2R44A 4QYTA 5L51A 1R0XA 2PU7A 4JVSB 5EE9A 4F86A 3OZUA 4DA4A 1BCRA 2G80A 2WA1A 2QE7D 4QASA 4JI0B 1Z6YA 3CZPA 3VH3A 3AEXA 2KLBA 4FFDA 3U3RA 1LXCA 4RD2A 4BLWA 4RTNA 1FFGA 2ZPUA 4X20A 4GZLA 1UK7A 3GD5A 4WECA 1NVKA 1TQHA 2BDEA 2OEPA 2ZSJA 4M1OA 2J33A 2AC7A 3NONA 3PT5A 1YI8A 2AG8A 2CDRA 2CLSA 2UUCB 1W36B 4M0EA 4IILA 4EYGA 4YUYA 1FY2A 3EGCA 3PNQA 4FNGA 4X97A 4ER5A 4ABTA 2MR5A 1SC3A 2QXTA 3IJRA 4E15A 2W8ZA 4NENA 3KPYA 3IP7A 1NOIA 4JS0A 2PUWA 3D6VA 3KYDA 4NEGA 4URZR 3U9TA 2R62A 4HQ6A 4IIFA 2C61A 2OHOA 1FFSA 2H3EA 3MJVA 5CM9C 5IULC 1M5RA 4FX5A 1B2LA 4K9MA 2K7ZA 1J5EB 2PBZA 2TMDA 3AHHA 4K1LA 4QG3A 3WWZA 5KVSA 1M74A 2BFNA 5IM4A 3THXB 1MH9A 2J7KA 4GXQA 2PLRA 4FYHA 4A2QA 3HWX1 3KTAB 4JV5B 2RGUA 5MN4A 1F12A 3M9LA 3IR7A 4Q7KA 4EI9A 3BG5A 1NV9A 1Q0QA 2Q0HA 3SLGA 1IXSB 1P1HA 4PYRA 2IUFA 5IT5A 4A6PA 3LECA 2M6LA 2FFJA 3AUXA 1DWOA 2EATA 2OK8A 2PDAA 1VP9A 5K0GA 2HJ9A 1N75A 1M1NB 3HKEB 4GXTA 4M9XA 4EFDA 1BD3A 3EQ9A 3TLGB 1HDEA 4MQ6A 4PFJA 1K3TA 2J6IA 2J0SA 3VH4A 1HFJA 3FWPA 4DLAA 3U56A 3IEPA 4E2ZA 3K2BA 1QFMA 3M5PA 1Z18A 4D79A 1FVFA 1E0KA 1F8UA 1GGNA 3AO0B 3LRPA 5E9WA 3FOEC 2DEUA 2DGDA 3ELUA 2VDRB 5LIRA 3BKXA 3UA3A 1NG9A 3ZWWA 1O0SA 2BR3A 1EVEA 1CUWA 1G6Q1 4H59A 1Q0HA 3TTSA 4H1TA 4BU0A 3CKYA 3BA1A 1ADCA 3CJTA 2ZJYA 1RXWA 2BONA 4GMKA 2RGEA 1GVHA 2NGRA 3G0CA 4AT1A 3S99A 4J0GA 3EXEA 1IN5A 1XEFA 3IQIX 1ADYA 4WJKB 2R79A 1QIJA 4D9IA 5FWYA 2PRIA 4AKIA 1W2WB 2PFGA 2VZLA 3OPYI 3H2BA 2A9QA 3JASA 3OLWA 1I4TD 1L7BA 3K73O 2WM9B 4TL8A 2ODNA 1NLMA 1Y63A 3FH0A 3OMWA 1JFFA 4P7KA 4DLPA 1RJFA 2EX0A 5AESA 4ACAA 3GLHA 2WTAA 4I55A 3UGTA 3SXUB 2XMZA 3ETJA 2FMFA 3A1VA 3CH4B 3QMVA 1SHZA 4MVJI 5AQEA 1DRJA 3KT8A 4AN1A 4TVSA 5FTLA 3R23A 1GPDG 1MB0A 4QU0A 4MS4A 3TL6A 2IP1A 4A0SA 4WKBA 2V3CC 3WNBA 2OV3A 1OFUA 1EDDA 2LCIA 4RY9A 1OX5A 4J3NA 2LP4Y 2ZAMA 3U19A 3TINA 2QSYA 2BKAA 3JQ6A 4KO4S 5BN1A 2Q5OA 5A3RA 1Z8DA 5KWEA 3PXEA 4BZWA 1IPHA 3K16A 4XCXA 1Z2EA 4RH1A 3MELA 2FQYA 3L82B 3UWDA 3EZFA 4YONB 3GGCA 1L4MA 1YO6A 1JVBA 3AFHA 1LRKA 1UXKA 3WAGA 4MDEA 4WA7A 3FD8A 2HPVA 1Z9BA 3TGWA 3D4LA 4MV9A 1ITZA 4LDZA 4ZT3A 1WXGA 1VE6A 1PP4A 2JBHA 2PKQP 5TARA 1CY2A 3E61A 4W5WA 4UVGA 2IHNA 1OASA 3RSHA 3JTMA 4E1BA 3H75A 1MRSA 5DX8A 1G2OA 1UH5A 2BSQA 1E20A 3PXCX 3T4EA 1A1VA 1Z22A 4RVCA 2BGRA 4BZZA 5LP6F 1TD9A 1LBEA 3OMXA 3DBIA 1LPSA 5GWXA 3AH8A 1T9CA 3AI3A 5BWLA 2HGSA 1II9A 1TK9A 2QL6A 3LIIA 4MEBA 1UIRA 5FFFA 3HKDB 4DREA 2OYCA 3NEPX 2D5CA 4GD3Q 4LSMA 2B94A 2IYEA 1T2DA 5A1JA 4G4SP 4RZSA 2WYWA 2A3NA 4JB8A 1KI6B 3WGGA 4L72A 1OZFA 1IVNA 3U4CA 1OBFO 2J08A 2X6TA 5FBLB 4JELA 1FF9A 1JKMA 5TMEA 3UYLA 3AUJB 2F1JA 4R3UC 3GEHA 1R4MA 3BDIA 2ZBQA 4TLCA 2P40A 4WOBA 1CS4C 2Q6KA 1IVYA 1DB3A 3T7IA 1T10A 3DDCA 2FR8C 5F1KA 1PF7E 3KL2A 3L6RA 3PUKA 4FQ8A 4GE0A 4JLNA 4RGYA 1X38A 4F11A 4BQSA 2I71A 3EIHA 3HXTA 5DWVA 4RJIA 3TZHA 4MYHA 1B74A 4UUNA 1KJ9A 3RADC 4MZXA 3HO6A 4G2TA 2JFUA 1JG2A 4D9NA 3EVTA 3ESCA 3WZLA 1KMMA 2OPHA 4LOIA 5BR8B 4OX9Y 1TDJA 4LJKA 3E15A 5E4TA 2EKDA 4EB3A 4ZGBA 3A4YA 5HRUA 2CXUA 4DSUA 4GVXA 1XF9A 3U4HA 1PNTA 1H8EA 3DHYA 4HKTA 2E3JA 3FWHA 2YS6A 3V46A 3OLYA 4F7WA 3DE5X 1YZKA 2IF0A 4GMGA 3R8CA 2F7SA 5KYGA 4GNKA 4D0RA 3AOEA 2OCDA 2ZRFA 4QBIA 2IWRA 2FE1A 4H18A 1XXHE 4M8SA 1XDZA 1KIFA 1ZJYA 1B6GA 2L69A 4RLQA 5T8KC 2O8EA 4KB5A 1L4GA 1LTKA 4YMVA 1LD3A 1AHIA 2CVOA 3UJCA 4YMLA 4KREA 4HWSA 1BS9A 5AKZA 4QRDA 1NL3A 1YOVB 4MUMA 1EFDN 4C29A 1XDBA 1W6UA 3C5EA 3DE3X 3W8RA 1O77A 2AA3A 4KSBA 3EHDA 5IJWA 5J2UB 2FPIA 3FPAA 5DBEX 5ALPA 4B5LA 1YL6A 2QTFA 4I6JA 2ACEA 2ZUDA 2CXNA 4UUBA 5JUWA 3I5XA 1NXWA 2BSAA 1LTQA 2C9DA 3AHCA 4GBMA 4BQFA 5JVDA 4CUZA 4G01B 4S1NA 3ZV6A 5IYZB 1DDGA 1P2GA 3B70A 3RV3A 2FEKA 2QR5A 4BCBA 5C5IA 3U44B 1K9SA 1OV6A 1JAIA 1SELA 5HJ2A 2NT3A 2JIZA 1E99A 1H2BA 2VHZA 1T6BY 2BH2A 3GLIE 5JYDA 3O4GA 3P94A 5CIYA 2AZTA 3ZXSA 1L7AA 4HDSB 9LDBA 4PG6A 4O3FA 1BXKA 2WICA 4E11A 3L7MA 2JIDA 1SIOA 2Z30A 3H2SA 2QTVA 1MTZA 2QMUA 1Z4PX 1XJQA 4U5XA 3SC3A 3UJAA 1J23A 2CLCX 2POCA 3I9FA 1VHWA 3ASYA 4QHTA 4JUCA 5CPBA 3VR0A 1CZRA 1PR0A 3H0EA 6CHYA 2KSQA 3U7FB 1RR6A 3OQIA 3HTXA 3K09C 5CLLA 5JTTA 3DO6A 5T4HA 4D9FA 1OZAA 4AKEA 3D4OA 4ARSA 5IEJA 3HXOA 1UF9A 1WLSA 4N6OA 1BWQA 3TVDA 3V4RA 3VDXA 3W05A 3INNA 1NQ5A 3SSAA 4W82A 5LQCA 3R5SA 5CURA 1C9DB 1UFRA 4HTFA 2JD0A 1D03A 3D9QX 4LRXA 3T0FA 2ZYAA 3GEIA 1KI9A 4TTVA 2J5XA 4CKEA 1Q7TA 4XWOA 4B45A 4FVTA 1QP0A 1KPHA 4GPIB 1PQYA 4R7ZA 2HSWA 4BNDB 4N1AA 4CR6A 4EY3A 1AUVA 3ZHYA 5JDIA 1VYHA 2JLXA 3HA2A 2IHUA 1G55A 3R0JA 5E2IA 1TW2A 4C4XA 1S6YA 4J6EA 3ICWA 4ZHQA 3BE8A 3FWYA 3ZQ6A 1AQNA 4NQRA 2A94A 2EKQA 4XDGA 3BM5A 1FLNA 3FCEA 2E9SA 5CYPA 3IOCA 3OFJA 3BKWA 3QMWA 1SRRA 4QHYA 3KB2A 4O4IA 1L3CA 3TFQA 3ASZA 1QG0A 4MKHA 5KTYA 5KOJA 4GRAA 4P2GA 2VDWB 2B4KA 3OQ1A 1G2PA 3C3WA 5KNBA 1PR5A 2AH5A 3BWEA 4UM9D 3I09A 2IYTA 3ADKA 3SXUA 4ZHQF 4X3CA 2PUVA 2B4TO 4DDVA 5JNLA 2NVWA 4YC7A 1RYZA 3HDHA 1D4ZA 2ZQYA 3HU2A 3LS2A 3KD2A 2NU7A 4IGAA 3RKUA 5EJEA 3H2YA 4PX3A 2IW3A 5JIBA 4NXMB 1PR1A 2FLKA 2GBFA 2R4TA 4G1UC 4WWHA 2Z3WA 4FYMA 4DSZA 3D5TA 3PGXA 3C74A 3GRCA 1RYYA 2HA2A 3MGAA 1NNUA 3AF3A 2GFIA 2IYXA 4V1CB 1CUDA 3OPQA 4FR0A 2I33A 2XKKA 1WEKA 3I9LA 4G36A 1NI3A 1R3UA 1M6VA 3PFHA 3Q2KA 4FEEA 1NX6A 3AQ4A 1ZGBA 3K5PA 4EG5A 5LLTA 2BEJA 1M76A 3MBOA 2IEAA 3HA5A 4P31A 4EG8A 2IH4A 2V7QD 3NMUF 3HY3A 4AAYA 4FPXA 3M9XA 1K5DA 3MS2A 5JQGB 3CO5A 4IJKA 5F12A 5GTDA 2AXQA 1G5RA 2YWFA 1NVXQ 3IOMA 2XV1A 4MINA 3SSNA 2R00C 3A6GA 221PA 4C7KA 4YACA 3E1GA 5M5BA 4J90A 5KKAA 4CDRA 1O5OA 1XHFA 2EWWA 3K1AA 4F1KA 1B6TA 1GZVA 5FUYA 2QQ0A 1BH2A 3GZ4A 3NP7A 1BKYA 1KO4A 1F9AA 1W73A 2FPIB 1GPH1 4NSNA 2YMLA 3U48A 1Y8ZA 4J94A 3PDCA 2H07A 2H5JA 4HI0E 3TX2A 3BWYA 1TUGA 3AL3A 1EZ4A 4EGSA 1WP9A 1N2SA 1VHDA 5CB4F 2RSLA 3M3HA 2IHZA 3TLXA 1NVFA 2AFHE 3NT2A 4RH0A 3VNAA 4DV4B 3ZX5A 2DJ5A 5IUKC 3V4FA 3ID6C 4DC1A 4UQLA 1NOKA 4MUAA 4R5MA 3V33A 3WQQA 3IEVA 2PQMA 2GFQA 1YRLA 3E81A 5LYJF 2ZI9A 1NY5A 2CMFA 2Z8XA 3WP0A 1K4YA 2B7LA 2W83A 3IXQA 1G7RA 4FSDA 1G38A 3LY7A 3L8CA 3L6OO 1UJNA 3SD7A 1Q7BA 4GI3A 4OXKA 4Q3NA 3W2IA 1P17A 1BAPA 5JVDF 4PLCA 4V0OA 3I01A 1Z12A 3ONEA 4B3FX 1XU4A 5CRIA 1JZQA 5GPBA 3U3XA 4KAXA 2VTBA 1EX7A 4HPXB 3UGJA 3NFRA 2FMTA 1WMDA 2BDTA 3E3AA 2VYFA 2YZNA 3S2YA 3ELWA 2ZSAA 4OK3A 1TLFA 1NONA 4J1TC 2VZ9A 5HMMA 2R47A 3AU8A 1G3QA 3FPHA 3EXG1 4PSKA 2JS7A 3PA8A 1QBGA 2FWPA 4J75A 4K03A 3REFA 1Z0ZA 3MGGA 5A9RA 1XVVA 2VAVA 1DIBA 5ILGA 3S55A 3UGKA 4PANA 5SV2A 1SOUA 4PV7A 3OTOB 2QMYA 4IQ8A 1JHZA 3A25A 2XUZA 4MKGA 3UAVA 4KDFA 1MIOB 4NU6A 1K8YB 1U9CA 4CT4B 2CYAA 1SK9A 5FJIA 5F5XA 3ZJYA 1FEZA 2B2XA 3HXMA 4DM7A 3HZZA 4KX5A 3L77A 4YRCA 4R2JA 2I2WA 4YA6A 2FY8A 4LK2A 4TTPA 5E38A 4LECA 1NI4B 1PLLA 2HF7A 3ZX4A 5EJ6A 1VIAA 1QZUA 4KH1A 1WBDA 3B38A 1DWUA 4PIPA 1LRLA 1PFGA 3MLAA 2Q46A 4IZHA 4N65A 1QZ3A 4ZARA 1VJ0A 5CW1A 2YXNA 4B3JA 2PL5A 2RKWA 3GJ5A 3WZ2A 4IV8A 1LQ2A 2Z8YM 4OUDA 5LA6F 1G8HA 4R2MA 2VT2A 3MJRA 4TLLB 5ERXA 4JJ6A 1C8BA 4NP6A 4X95A 3T0GA 2VHUA 1W96A 3L07A 5CFNA 5C52B 4DJJA 2WQZA 3I9JA 4MUBA 4D3YA 1V9LA 3TEJA 2BZ1A 1CUZA 5JD6A 4DL9A 3W5UA 3TB6A 4L22A 4IGEA 4OQ4A 2FAXA 1W85B 3N8GA 4NYMR 1EE1A 4XIYA 3BD8A 1NYQA 3N53A 3QVXA 2BMFA 3UWSA 3LTNC 5JNSA 1XZJA 3D81A 3JZAA 4G1MB 1ZC3A 3R0ZA 4Q47A 3FYUB 5BY2A 5AP9A 2O8VA 1I1OA 2R84A 5FPPA 4PC3A 5AJZA 5HVNA 5JDIC 3FVRA 3Q0IA 3C3CA 1PZEA 3G23A 1C2TA 4IKOA 2AK3A 2CE2X 3ENWA 4I6EA 4KO1S 3F3MA 4LYGA 4P9NA 1K9VF 4NNOA 4WLFA 1P9WA 5AHWA 4C3ZA 3IHLA 2LCFA 2HYIC 3EQ6A 1OPRA 1M6VB 1LNSA 1R9GA 3MB8A 3D7RA 2ORYA 5AI5A 5AD1A 5ICCA 1ZFNA 2XRYA 3A4IA 3BTVA 3SSOA 3WVNA 3ADOA 2EBWA 4FFSA 2GZHA 3G8BA 3MBKA 1GAWA 3MCUA 2VHVA 2OESA 4PQFA 4RGBA 5EE1A 3V8PA 1GU1A 1QIMA 2A78A 1B6SA 1ELOA 4RA6B 1XMPA 4R41A 1TX4B 5K99A 4ZTUB 1L2TA 3LUDA 4FMBB 3BWMA 4O08A 1PVVA 3DTVA 4OLJA 5AVJA 3TLMA 4PYKA 2VJMA 2W2KA 1GNLA 3DKPA 4WKNA 4XSVA 3WGMA 4C1BA 5CITA 4MRRA 4UKDA 4G5QA 2UUAB 3DE2X 1LJUA 5MF6A 2QG6A 1RJ9B 4M8NE 5CDGA 3JVVA 3CWZA 3IYLW 4RF5A 4BB5A 3IQEA 3AZQA 1JDTA 4FK8A 1FU4A 3U7IA 4RVNA 1HV8A 1E3SA 1CJCA 2HSDA 3MA0A 2Q41A 3M6LA 4HDMB 3VPSA 3LDFA 5FFNA 5DISB 4P6VF 3UHAA 5LDGA 2CJFA 4F3CA 2Y0CA 3ZDBA 1LBHA 4UUPA 2H57A 1TEHA 4K6HA 1ABFA 5JSHA 3QIVA 4MHSA 5JMOA 4ZT6A 4LQLA 2BCEA 3MQFA 1NP6A 3IVGA 3TO5A 4E2YA 3H7AA 4MA4A 5J2TA 4CEHB 1JQLB 1HFEL 4URUR 5CP8A 1KE2A 1T26A 4K2AA 2WHPA 1YGPA 4I9HA 3ST7A 1RPJA 1JA9A 3K9CA 1GPWB 1TCCA 2BFBB 3ORYA 1GGKA 3SYRA 2Q3BA 2PGNA 2Y1LA 2QRVB 3Q3VA 3ET5A 1CZHA 1OKKA 4L5YA 3RM3A 4FDMA 3KJGA 2V7TA 3C4VA 2CB9A 2I4TA 1XMXA 2PQ2A 1OGYA 2AUMA 3KOMA 1CFJA 1ZEMA 5EERA 1F5SA 2XZOA 2AFIE 1B2RA 4JC8A 2VBGA 2IEYA 4ZO9A 5JDCC 3ER6A 3T15A 4D44A 3D3QA 4BVHA 1AKMA 1LDGA 2OO7A 3NATA 3R3XA 5T8KA 3R5FA 1CULC 2NO5A 4KDRA 4E2XA 1VG1A 1LBTA 3MJDA 3NAQA 2YJ6A 1NKVA 1VRVA 2CV2A 2PAFA 4GMHA 1V48A 3W5HA 2BM9A 3ELDA 2W42A 2H17A 3F96A 3RRYA 4G25A 4WXPA 3N75A 2GJ9A 3WHLA 3EAGA 3J81A 3THXA 5B2EA 4I8XA 1U7PA 4MVJD 4FFBA 2P35A 3OJWA 5DHFA 1B23P 4ZT4A 2GFHA 3T5CA 1TQ4A 2P2GA 1R16A 3ENKA 3QYPA 2ZVDA 2PZGA 2HPHA 4I3FA 1KBOA 1QE5A 2QV7A 1O9BA 4XKJA 1IN8A 1H5NA 4ZTZB 1CQXA 2CHQA 4A6XA 2XE7A 3B6EA 2HW8A 3LH5A 2OILA 4QAJA 2FRXA 3KRTA 3PGJA 4X7PA 4I7EA 4XR9A 3DV2A 5A62A 2GO1A 4INAA 2C8LA 4BGIA 1C3OA 1G16A 1MXFA 2B8JA 4RTKA 1DC8A 2P5SA 3IE1A 3BWXA 1D5WA 1YZNA 3D7NA 3PDWA 4B7CA 1GPMA 3STTA 2IXBA 4ZEVA 2O8EB 4TSFA 2O2YA 2F1HA 3NP9A 1RWXA 4NZ9A 1BQEA 3OC6A 1VB3A 5FI0B 2H0RA 3TR6A 5K0FA 3I58A 3CEPB 4I81A 3VNRA 1D2MA 3SQNA 1WABA 3J81k 3D6AA 4JH0A 4A6DA 4P0TA 2VDQB 4AZ3B 1JG3A 3H3XA 3WB0A 1AV7A 1YS9A 3L0SA 5ALZA 1TO1E 3CYFA 3I2JA 3VO9A 1KR2A 4DRYA 4FN5A 1QUFA 2J3EA 2VI5A 3G7NA 2HIHA 4X20B 1O0BA 4ZMRA 1NXPA 1FQJA 3RFCA 5FWXA 2GCPA 3FOZA 3IEMA 3QPAA 4GP9A 2EKPA 1OFIA 1NBEA 1ZYUA 4K6OA 4FFVA 4EPRA 2YXLA 3S5JA 4EW1A 3IO3A 4M0CA 5CGQB 4PPYA 3LO5A 3KDSE 1AXRA 1R10A 5TR9A 3ANSA 5CCEA 1T8SA 1A5ZA 3KCNA 5DTEA 3ZTTA 2V7UA 4LXUA 3DW1X 3T12A 2A59A 3DNPA 4OJNA 3MT9A 2QLBA 1WW3A 1FB5A 3ZNQA 5K01A 4ZZ1A 3VC3A 5KVQA 2DPMA 3RBXA 5HKKD 4U2CA 2BFFB 4LZWA 2VXOA 5DYYA 4KE6A 3RI3A 3CPJB 2R97A 4S24A 3CTMA 3WWCA 1CUUA 2D0DA 3F98A 4Y2QA 1ULZA 1Z47A 3MB5A 3OZRA 1UZUA 4Q4DA 3WBJA 1Q0TA 4YRMA 1SXJD 2H7XA 3TM5A 2IY8A 2MINA 4NV3A 5F73A 2W8BA 1JXMA 3G0OA 5FJJA 4PIVA 2IPXA 2GOYA 2I4LA 3FGZA 4LS3A 4XUDA 1IEWA 1G8SA 2P9GA 3L7IA 3SEZA 1KRHA 1MKYA 4JGIA 5D51S 3RVDA 1PDWA 2HJGA 3URKA 5ER6A 4E31A 1GV0A 2WSBA 1NPTO 1XGKA 3KQWA 3BAFA 2PMCA 3N28A 1RAGA 2ZQZA 4IDCA 4UEJA 2R1TA 2ES4A 4MW4A 1PZGA 3WYAA 4L02A 2HWKA 1EDBA 4JJ8A 1E0JA 2JARA 5JU6A 1C0IA 1V7ZA 2B4RO 2KYRA 1ES9A 2MSCB 4ICIA 5B3JA 5I9MA 3C0KA 1PVOA 4AF6A 1QIEA 5A0TA 1U3CA 2QM3A 3S68A 5LU9A 4CDNA 2Y76A 3KXIA 3K6SA 5H8WA 4YV7A 1MAAA 1PZFA 2Y0PA 1YIDA 2O2DA 1ZP6A 4OV6B 4NHOA 3I1FA 4OHMA 1YRAA 4HSEA 3KQKA 4GWGA 4IM7A 1U3DA 2GN6A 2CWWA 5FI3A 2X9VA 3EFEA 2QJRA 3NEAA 3TMKA 4ARAA 1QZXA 4YXWD 1RRKA 2X8WA 3VU8A 2B0JA 4KMRA 2XAUA 4MW2A 3V80A 3KB6A 5CTJA 2D1QA 1IHUA 2LCQA 1Q6YA 2Z56A 3LTEA 1W87A 4DIOA 4BNVA 4JLOA 2O7NA 4FEGA 4IXWA 4UMDA 3E5MA 2X0JA 1NHGA 1XFDA 1BVRA 1RC1A 2BP7B 2CDBA 1W0KA 2A4KA 2D5LA 1SKQA 2LR0A 2PLWA 2C3UA 2VP5A 3GJXC 4LNUA 4QFBA 4WGGA 5H80A 1PTJA 4WERA 3I53A 5DNAA 2CKMA 4M9UA 2QPTA 3OJFA 5G0WA 3FUWA 3AM5A 4NOJA 2YWBA 1UQTA 3D4IA 3NOVA 2D13A 4ATNA 3I8XA 3N8KA 2B2NA 4ASUD 4YQEA 2HCTA 3UKOA 4XW2A 4BEVA 5AVSA 1H5UA 3I28A 3P32A 1U7DA 4Z86A 3N87A 3WZMA 3E8MA 4ER3A 5LWQA 3WYEA 4MCJA 5ERYA 3FGPA 1L5VA 4DCVA 2BHRA 4ZO6A 3HL0A 1RSZA 2V1XA 3EWNA 3M81A 3N0VA 2D00A 4KRYA 3KKZA 2WM3A 1E1NA 4MQ4A 3NIFB 4OHXA 3SYLA 1BHJA 1V96A 1PJLA 2J85A 4MW5A 4IOJA 4UZSA 4OHZA 2V3WA 4IV5A 2IV3A 1Y6ZA 2MYPA 1ZIYA 3FLEA 1QU2A 2ZIXB 3EZGA 4PR0A 4QDXA 1CY4A 3PC7A 4Y2JA 1JF8A 1TMYA 5BW8A 4BMZA 3TR0A 2VPQA 1II8B 2I6TA 2VPWA 1KDYA 2XLBA 1JEJA 1FRFS 3U44A 4M9RA 3WGTA 2FF7A 1K5GA 2HMVA 3WX0A 3V32A 1FZTA 1K63A 2IF2A 2GZAA 4QJ5A 5EJ7A 2VDLB 5DP2A 2X4DA 4XJXA 3A0RB 3DZJA 4ZZIA 4BFSA 5DXFA 1RM3A 4JI3B 9ATCA 4TYYA 3LF1A 4UTXA 5B3LA 1R50A 2KMLA 1L7VC 2RCNA 3RD5A 1Q44A 4LX0A 1SCUA 2GZ2A 3QUCA 4R9RA 3BFPA 3EGXA 3I45A 4A91A 3AF4A 4LJYA 1C1XA 3ZXXA 2IOYA 2HLHA 1RJGA 3HWRA 2HA3A 2HA0A 1GNTA 2O2XA 2P9JA 3K6JA 3O4JA 5HCIA 2YHIB 3VYUB 2ZP1A 3HB5X 2OZLA 4H08A 4IHKA 4QEDA 3WOVA 5K8JB 4DCMA 4WZBA 4A73A 3S6JA 5K6TA 3PEFA 4FCWA 4E4YA 3I0MA 1YZFA 4MB2A 4FE4A 4BQPA 2V1UA 4YAFA 4O29A 2EF0A 3A7DA 2O50A 3RAGA 2VYVD 3NTUA 4KGZA 1MJHA 3HH8A 5C51B 4WBNB 4C06A 1CR2A 3CNOA 2JA2A 5A4AA 1PYDA 3CX3A 3O3NB 1V25A 3EXIA 3ZOKA 2AXNA 1JQBA 2FLWA 4Y6LA 2X0FA 3SYTA 3CLUD 1ID8A 1I2MA 1VYTA 3D6UA 3FRHA 1OXSC 4IFBA 3D64A 4J0QA 4BB0A 3CVVA 3A6KA 4NMLA 2DFNA 3HACA 2EJUA 1ORWA 3T35A 1IPEA 3R24A 1FPQA 3Q3EA 1X14A 1QWSA 4LWZA 4MLPA 2MJLA 4GW3A 2AI1A 2XBLA 3AVXA 4BP1A 2VA9A 4XRGA 4E12A 4IDGA 1OC4A 3BK1A 4HD8A 4M37A 2BTEA 2AGVA 3IKMB 3UAWA 3RRNA 2CNNA 4ZCTA 1KAQA 1U90A 2YZ7A 4LVUA 5KTNA 3AT1A 3MTEA 4PRLA 3AY7A 4PO9A 2KBFA 3IMFA 4BNTA 3HM2A 2NG1A 5HRCA 2XOKD 1V4NA 2PJRA 2WD9A 3KWFA 2V8BA 5A5EA 3I0ZA 2A1IA 3PLAE 4MUEA 4I4NA 1B15A 1UWLA 5BSTA 5K3FB 5K2OA 3GN1A 4DSOA 2V98A 1IY2A 1Z75A 1GTVA 4JAVC 5EUBA 2X15A 1KZ6A 1O94C 3H13A 4K86A 2VO1A 5M3BA 1SQFA 4O2BF 3PNOA 4AJPA 2D1SA 5FOUA 3EPLA 2ZJOA 4F2GA 3LQ1A 4R54A 5LLDA 2VAWA 3VDNB 4BO6A 2WE7A 4YP9A 4A1FA 1EQUA 2ZRKA 1DQZA 2GTPA 4MRMA 2FSPA 1V2HE 2X1MA 5D2CA 3UV7A 1GT91 3PBKA 1DO0A 1BEUB 1GY8A 5JNUA 5U9CA 1XAHA 3LKVA 3A70A 3C3JA 5KCMA 3BZWA 4B73A 4DT1B 4YAGA 1ZH8A 4ZD6A 4QYMA 5DNYB 4LF8B 4EFKA 2H5LA 2VZ0A 4S0XA 2HUNA 2ODBA 2VKQA 2ZVQX 4MJXA 3JARB 4YCJA 1U9IC 3RC7A 4YRLA 3CJQA 1G7SA 2XGJA 3BTOA 5IKXA 5BSGA 4YPFA 1YBHA 2ID9A 3NAZA 3IOEA 1N1DA 5C37A 5AVXA 3WRXC 3I4CA 3ANTA 5PGMA 1GP2A 2C4TA 3ZY2A 3K70B 4JYPA 1JECA 4ZAFA 4YRBA 1T5TA 1H2XA 1S2MA 3GFVA 2GJ4A 1ZRSA 4C3UA 3RRXA 2YWCA 4UBNA 2W6OA 1TCAA 3O6VA 4ZYVA 3WR5A 1LC0A 4BC1A 4L8WB 5MN5A 3P96A 3CLUC 2DB3A 2YC2C 1UMDB 2P0EA 4UM5A 5CFRA 2V74B 1P2BA 1IM8A 7YASA 1QAOA 1WIWA 4M0UA 2C3YA 3GLHE 3A6LA 1OXMA 2HLDD 2X1VA 3OIFA 1JB1A 4MYCA 2WU8A 2Q3HA 1WZCA 3RC8A 1DTEA 1SZJG 2MMGA 3I9OA 4BO9A 2ROQA 1EFAA 1OSNA 1IPFA 2C3MA 2QDXA 4ZO4A 1QK5A 3H5IA 4ZQCB 5JDCA 3ZU3A 1AMUA 1MD9A 2AB0A 3MT8A 3EDQA 3NIWA 4M0DA 4ZKEA 2QTBA 2Z5VA 4ERNA 3B9QA 4JR2A 1EFTA 4OKNA 2P3LA 4QL3A 2WU0A 3ZHVA 4FN4A 2VTBB 5IABA 1U0EA 1OX4B 1XLWA 1QUEA 1YZHA 4HYTA 4E32A 1ZXLA 4DQDA 2RI6A 2IEGA 1GTZA 1CRWG 5F3WB 3HVIA 2IQIA 3R4CA 3LC2O 1DJPA 1HBJA 4O25A 3TTUA 3UO8B 3N8DA 3DF9A 1NZJA 1R4NB 3AF0A 4TVOA 1XMVA 4H0NA 3VYWA 2IOQA 4JXJA 3OCCA 3C6KA 4JT4A 3U1VA 1RKBA 4EKGA 5GY7A 3S27A 4XYBA 4IFTA 3WSTA 1NQUA 5FLXA 1UKCA 3I2KA 1OA1A 1BGWA 3Q11A 4IRXA 4XSHA 5K0CA 1W36D 2YJ3A 4BLQA 2G5CA 4ZZ0A 1JNXX 2VXBA 4Q0MA 5E6SA 5CT4A 5EE3A 1HLPA 1JSLA 3IC5A 5FUBA 1GA6A 3X1ZA 3R9IA 3HYSA 3TMYA 4N03A 1CUVA 3RIXA 2WIBA 2YFKA 5FUVA 4NYIR 4YP5A 5DCUA 1K86A 2OXEA 5FR2A 3I6ZA 3DWEX 1HDCA 1VIYA 1C8VB 3NORA 4KQEA 2EFDB 2JLBA 1KH1A 1OFVA 2BI8A 4EB8A 4JI4B 4DG8A 1QH1A 1CJKC 1OU0A 3D8RA 3MJHA 2RK4A 4PQYA 4AY3A 2JGEA 4H1WA 5JJLA 1YK0A 5DTMA 3S2SA 3PR1A 2GVZC 1L3IA 2AEEA 1SKYE 1CNMA 3GEBA 5G0SA 1IUKA 3CUVA 3H1PA 1VHTA 2ALJA 3BK2A 3RSCA 3S44A 3U7JA 3VZCA 4DCGA 2WP0A 5ED0A 3NLLA 1MCZA 3CUEF 3N58A 5CH5A 4LNHA 3TTWA 4PGGA 1RWKA 4KBGA 2IOFK 5C5CA 2X4GA 1EVKA 5D3KA 1WCXA 2V6BA 1FL9A 3PPYA 2RIRA 2ZOSA 1KI4A 1P19A 3ROPA 4UNPA 1CJTC 2DM6A 2A86A 4ZCIA 1CY7A 3BMQB 1E69A 5D01A 5ELLA 3C8UA 4IYRA 3WLAA 2G8NA 4ZODA 2WLSA 3AUSA 2ZRAA 3H2HA 1T6YA 4M1KA 5DTQA 3R7LA 5HP4A 4JGBA 3ZCPA 1UZMA 3NW9A 1BCRB 1XMIA 3G02A 3FB4A 3MVEA 5JHHB 1XXHA 2B4AA 3PFFA 4ZQHA 3NETA 3EGIA 2NSYA 4L95C 1E63A 3SHFA 1AOXA 1Q1EA 1ZRNA 3MTJA 4TTTS 3FTCA 1VZ2A 4IXDA 1QCZA 2HKIA 4Q3KA 3MLBA 1YQQA 4JOCA 1P4AA 4XB2A 4BMPB 4LXHA 4CIDA 5I7VA 1K8ZB 3U60B 2WSLA 4Y1FA 3UWMA 2UUBB 1JAXA 2GCGA 2GD2A 4XFKA 5G02A 5HIIA 3S3TA 5CPFA 3TQSA 4E14A 2J4DA 1AB5A 4ZOQI 1LTHR 3O26A 1NMYA 2F1KA 1T4CB 5HCUA 3K1TA 4AJNA 4J4HA 2X8AA 2Q1WA 2FTKE 1QZTA 1V3TA 1Z5ZA 1M8KA 4QUAA 4X8LA 1KZ4A 3QUQA 2PUEA 1MOZA 1W46A 3CFYA 5LOVF 2Z8ZA 1YR1A 1XLUA 4OLFA 1HT2E 3GMDA 4RACA 1COWD 1OFHA 1U8CB 2H4FA 2IHKA 2Q28A 2R68A 1GUDA 3KX2A 3K1JA 4QOHA 2G8LA 5AUOB 4MDFA 1GA1A 2WV9A 3CKKA 1LEHA 2VT7A 4GXRA 5EIXA 3KB1A 1DBIA 1WZEA 1DAHA 1HQKA 3PHHA 4M9SA 4QTZA 1ZNWA 3KZMA 3ONNA 1G6HA 1LVHA 2ABWA 4JLDA 4FS3A 4YRJA 4G1CA 1XEWX 2R751 5A4FS 1GFWA 3B2NA 1P1KA 2AOXA 2AI2A 2G7ZA 3DFZA 4MVWA 5LNK1 3T0IA 3SKYA 3E70C 4D56A 5IZCC 5LQKA 1C7ZA 1ZVJA 3C3AA 1X42A 4BUJA 1IBSA 1O96B 1YC2A 4DV3B 2X7HA 2IPNA 3MWDA 1XCGB 2JFFA 3SLKA 3C43A 2FPSA 5DOVA 3I1JA 2DWCA 3PNPA 1EH5A 4IDFA 4KC0A 1DTWB 4G0PA 1PT5A 5FWDA 3UB4A 2Y1EA 3QTBA 3VC2A 1VA5A 4FD3A 3NWPA 4CODB 4B2PA 5H68A 4AY6A 2I1QA 2FWRA 2CD9A 4W1RA 4RU1A 5F33A 1CJSA 2HJSA 5CA1A 1DP4A 5E6RA 2PUAA 3E35A 4JNKA 2FFAA 2HK8A 2YJTD 1IB0A 1XTRA 3BTSA 4H77A 4QULA 5C7YA 5H9WA 3A3NA 3U5TA 1GJRA 2AN5A 5ALYA 2JGKA 3PG5A 2R6DA 3OA0A 5HRAA 1YRYE 1JFFB 3OTHA 4GMFA 4QGHA 3UHJA 3QYAA 2Z4SA 2WJYA 3GR6A 1WV1A 3W9BA 2OOSA 4EKIA 4WH0A 3NCHA 2H48A 1XTZA 2VHCA 2WJIA 1HDZA 1PHRA 3LVFO 2N42A 2ZUWA 3HEMA 4UU8A 2PJUA 3UQZA 2C57A 4G0OA 3UCFA 2W4IA 1V8PA 4BECA 1UDBA 2C4KA 4YI5A 1J0AA 1ORIA 1VFPA 2OBMA 4KXVA 4MQLA 1MFZA 4J29A 3ZWDA 4BB6A 1Y6FA 2IYQA 2C5EA 2QQ5A 3IELA 4MYSA 5HJ5A 3I73A 3NDPA 4F06A 1RW4A 4M0KA 4CQLA 3DT6A 1I5OA 2ISQA 4YNBA 2NUAB 2CFTA 3AC0A 3I2HA 2FR1A 3L7BA 4MI9A 5C4MA 1HT3A 1EX1A 1V7PC 1EK1A 1BMTA 4XD7A 3TSCA 4MAMA 1T9GS 5A3QA 1Y9AA 4N5MA 2H2IA 1J1ZA 4HMQA 2VDKB 1C1YA 1HT1E 1JJBA 3NHAA 5CU7A 5D3QA 2DMRA 2C88A 1A9QA 1ISHA 1L8XA 1QO0A 2OK7A 3QRWA 4ME6A 4PZEA 5G0UA 5CB6A 2G63A 4GBGA 2Y99A 2DY0A 2XHEA 4JQZA 3B3FA 4PYIA 1T5IA 3LLCA 4PZCA 5C1PA 1P61B 2XMGA 2V7QA 5EIAA 1AV6A 1ZH4A 1OU4A 4LDPA 5FFMA 4ASUA 2K7FA 2QDKA 1GU0A 1QFSA 1HNXB 1P3JA 3AOEC 5IP5A 3SVZA 1HXHA 1AC5A 2ZR7A 1TJ5A 1DV1A 1XYVA 3LFUA 4PFSA 4QNNA 3LYAA 3RYFA 5EIBC 1UZLA 5AM2A 3ZD6A 1N2CB 3KK0A 5BW4A 4ALIA 4J7CA 2BEKA 3OOHA 1OUMA 1YR8A 1DUSA 4WK0B 5BWOA 1SUCA 4NENB 1T4CA 2PMDA 4IQGA 4ARUA 2TMGA 2ZGVA 2QAIA 3RKRA 1DUVG 4FGKA 4LFBB 5DRYA 3KR9A 1PG2A 1KYQA 1VJGA 1GTJ1 4JIGA 3OU7A 3QW4B 3CNQS 4XB1A 3LCUA 5ALIA 3GFRA 4DC0A 1T8TA 2HJVA 3RCBA 2H54A 1AKTA 3DAYA 1A8SA 1CETA 2Q21A 4LOJA 4C6TA 1W1IA 4G9GA 3O4VA 3B6JA 3GLVA 4YN3A 1ISPA 4JL8A 3RTBA 2A1UB 3KOWA 3LQ4A 3QPCA 3H84A 2HMWA 2HD4A 3MNFA 5ADUS 5EJ4A 3PL1A 1IZ9A 1NN3A 2PGJA 3L6EA 3A0UA 4AUEA 4IXMA 1UXIA 2IS4A 5BV1A 4O2BB 1H3FA 1HQDA 4P4TA 4CM5A 1NP7A 1ZO8A 2WW8A 3BZUA 4WW0A 3S2ZA 5BYBA 1C0KA 1DX9A 1TKBA 4J07A 2O23A 1O94A 1X80A 2Q1YA 1EE9A 1QFYA 4NAUA 5C31A 2DQ4A 2CXHA 1CD5A 1XCPA 3OPVA 4FC7A 3L79A 4HBZA 1XR3A 2VT3A 2QMQA 1BYIA 4D9EA 4ENTA 2EP8A 4BKRA 4BNJA 1P77A 1QHNA 1OVMA 2DQSA 3P9RA 4ZXFA 4F4FA 1U7UA 2PANA 4K6MA 1PV1A 1FBTA 3LF2A 4LHSA 3TSWA 4PSUA 4Q1FA 1DDIA 5ITZA 4L0CA 3WMRA 2R2GA 2QV0A 2VBFA 4MVJE 5HKKA 2ERXA 4GFDA 2HQ1A 4NHEA 3V7FA 5JPCA 2YASA 1VBFA 2QOEA 5D3ZA 5IXJA 4JYZA 4E13A 3V2IA 1G9TA 4PZDA 2JEOA 4P54A 1BGXT 5HQ3A 2VSXA 2WUVA 2B1RA 1FJHA 3DOJA 1RACA 1XA3A 4P81A 3U3JA 1V5FA 4F60A 2WIGA 1WDKA 2LTAA 2WU3A 4S0ZA 3TIXB 5IJXA 2FETA 3E7PA 1ULTA 3QF4A 4P98A 1QTQA 1HI9A 521PA 1PFVA 5TX7A 2BFCA 4RFSB 1CZLA 2QGFA 1EP1B 4RK7A 2CLEB 1V1RA 4WBNF 1BYUA 3BMOA 3GZJA 2B37A 4PLGA 4PHGA 1YQUA 4KMSA 2ZTVA 1P33A 2D5BA 4B44A 5LNK6 4Q1DA 4O6VA 2IIQA 2ZYHA 3EFOA 1GAXA 2PZMA 3KQSA 4UW9A 3T5MA 1WW8A 4XIIA 1E4EA 4OREX 1WOMA 4CMGA 3DOOA 4UXHA 3HNRA 2DC1A 2CHEA 3FETA 5AW0A 1Q1ZA 5IJ9B 5B1DA 2CL7X 2GT1A 1U5BA 5BSRA 1O87A 2QD2A 2NQTA 3HA7A 5AKKA 5IC6A 5CLJA 4JYAB 2EWVA 2A4MA 2J0QA 5BSHA 1EGAA 1JWBB 1TUBB 4XM0A 2C1EA 5DNVA 2WUFA 4HNUA 1IN4A 2GBPA 5ICFA 3C1OA 5EMLA 4CJXA 1Q7CA 5EINA 3PL5A 5CK5A 2VLIA 3QPBA 5HBGA 1YULA 4YAWA 1DCKA 1YVRA 2ADMA 2VZ8A 2JRCA 2GD0A 3DDUA 4KQ9A 4KZPA 4BRZA 4KITB 1N32B 3I4FA 2BFEB 3P2YA 4FJ1A 2GHIA 3NWEA 3G2HA 3GO4A 3LO8A 2QMHA 1OBOA 2H2AA 4GX2A 3MJCA 4L28A 4XUEA 5CB4A 4CQMD 3AG5A 5FR1A 4HUQA 3IL2A 1U4OA 3ZBUA 4DLSA 1H23A 5AVRA 5HM6A 4OX9B 2ZRJA 4AF7A 3DAHA 4KACA 1DTSA 4DLXA 4N3CA 1CJMA 1E2NA 2GN8A 2DWPA 1CR4A 3RUAA 1QRRA 4D26A 4X44A 3KXDA 2QM7A 5FOTA 4IW3B 1N1EA 1H69A 4A8JC 2OV8A 5B6JA 1KQPA 4YCCA 5KNLA 1FUYB 3T3OA 3OFSA 1TK3A 5IYZA 5A2QA 1IOZA 1O5TA 2R5FA 3A3YA 2I6GA 4UAUA 4PX5A 3SMQA 1SG9A 1IL0A 3Q41A 1OXBB 4WIAA 3I37X 3UATA 8LDHA 1MVNA 4YCLA 1QG6A 2FNAA 1PSWA 5CVEA 1NQAO 3QFTA 2Y9MB 4AZWA 4XR4A 2SECE 3QZUA 4DABA 2E89A 1B8PA 1GPJA 2FR0A 2VHTA 2WT4A 4JX8A 4YXWA 5FUQA 2AYXA 3UJDA 1AZLA 2ZYDA 1JHRA 1W0KD 1XB2A 4IIUA 1TF5A 4LJ5A 1DPGA 1NXQA 2E21A 4RD0A 3ILXA 4RQBA 3S0JA 3WS7A 3SR3A 5I9IA 3GF4A 3OX4A 1QIFA 1X8KA 1CK4A 2XQJA 3MOIA 4R2XA 3WGLA 2QBYA 1WZ2A 4UCQA 1PL6A 3B9PA 4C0AC 1CQPA 4OK6A 3M4JA 2NUTB 1DPFA 2AG5A 3E9NA 3FB1A 5JMPA 1YBVA 3EUWA 4KR3A 2WZDA 4BASA 1GILA 3DF7A 3GGOA 2LBPA 3QXHA 3HG7A 4B6PA 3CWQA 1DQNA 1E0AA 1HE3A 2XSZD 1W5SA 1W0JD 1GFZA 1FLDA 4QD3A 5SY9A 4DIUA 1RLMA 2WOJA 1T3SA 1VJDA 3FMOB 1C7QA 3VR6D 2I91A 3G85A 1XCLA 4HP8A 4NEHB 5HM8A 3NKVA 4I2NA 3SPXA 4EVRA 4W8OA 1KOGA 4BVAA 4UFPA 1POWA 4JVOA 4QUHA 4JBNA 1AQUA 4V2UA 5JZSA 1XDWA 4TSRA 3D6FA 1WETA 5CDUA 2WP8J 3ABQB 2WKQA 2I29A 4G86A 1XEAA 5AK5A 5ITZB 2B1GA 4ZOAA 4G37A 4YYEA 1X3LA 3WGQA 3TLJA 3W77A 1H0SA 4KYUA 1WL8A 3K4PA 3T5DA 1RI4A 1U6JA 2D54A 5DKFA 1QTIA 3DPUA 4CR7A 1Y34E 3FOWA 2AZDA 1U8XX 5JRZA 3WY9A 3OIUA 1TYZA 4I9NA 3K0HA 5G0VA 5CIWA 4AG6A 2RGNA 3VHLB 1SOMA 1C7JA 3I2IA 3ZHOA 3G2JA 5A5GA 3THYA 3PYLA 3ZEIA 4RW0A 3O73A 5GZ3A 5GINE 1NIPA 3DLIA 3LYLA 2YWXA 1AKNA 3VJRA 5JAIA 2GXSA 3D2CA 5KSZA 5DWQA 1HDOA 2VUSA 3SCZA 3CB2A 1JQKA 4L78A 3RUEA 3R3WA 4BZPA 2AF4C 4PHFA 3CF4G 5F3DA 2XQGA 3FCUB 4W5RA 4G8DA 1YCDA 4WJZA 3GIWA 2PN1A 2VS1A 5J5VA 3GL9A 5A71A 1JHYA 1GRQA 3BQMB 4J43A 5DLPA 2P65A 3AJEA 3BSWA 2WJZB 2WUGA 2BSXA 2HTFA 5IAEA 3ADPA 5B1EA 1YZYA 2PUHA 2VXCA 1JRLA 5EIEA 4RMIA 3KUXA 4UMFA 3FUXA 3PHIA 1F1BA 2IPLA 3AETA 4FI3C 3FKSA 4OOFA 2IHJA 4RM2A 5ISMA 3R9XB 3X2EA 5SZHB 3UT5A 1R2QA 4D5EA 5FUXA 2O48X 3OWHA 2LWIA 4F7DA 121PA 1RM0A 2Q5HA 3G0DA 2WT9A 1OOEA 2W2VA 4W6QA 1Y1LA 3MN1A 4G85A 5FULA 1UEJA 1K06A 3CUSA 2OY0A 3LYHA 4R2LA 4JXZA 2H85A 4KPUA 5C3MA 1ZD2P 2R8YA 4HXYA 4NBVA 5E8RA 1GR0A 4CV3A 4DR5B 1HNZB 1F60A 3M5CA 1MT0A 1OYOA 5JAUA 3U16A 2W0SA 4LMAA 1NN1A 2PSEA 1RCTE 2RHGB 3AESB 3OECA 5TMBA 1ZRHA 1WKBA 2V5AA 5ARBA 2V96A 3UG6A 4MAFA 1H6CA 2ECPA 4HQLA 1TC1A 3BD6A 1XWFA 3T4PA 1TJ3A 2N3ZA 1QC5B 3F4LA 3FUCA 3BRWA 5FTMA 4BCDA 3KALA 5KKCA 3C3MA 3BTUA 2BFOA 2X0NA 2F9FA 5K8IA 2DHRA 3TDMA 1PZMA 2PBLA 3SZMA 3FNIA 3FIJA 3CE6A 4MH0R 5ENZA 2PKEA 4KN5A 1COZA 4TTSA 2P6PA 4LX8A 4XUGB 4Y6OA 3D8BA 5K3SA 3KZ1E 2BFAA 2XKBA 4G4SO 1FDWA 4MWZA 4BFYA 1VGVA 3JR3A 1Q6ZA 1RRFA 3JTEA 3MILA 4JBYA 5L3ZA 2PVPA 1QYXA 4U1RA 5HX7A 2LDXA 4RETA 3COVA 1Y4DE 3AG6A 5JCOC 3OURA 2OAQ1 3ZWKA 4B3DA 3R2JA 4UXIA 4UE3S 3GV0A 3IIMA 3IOBA 3V8NA 1I24A 4WT7A 1QJCA 3QXCA 2WY2D 4BEWA 4BNXA 1YZTA 1WDTA 4B32A 1X7WA 4K2HA 3CUUA 3QVKA 5ECWA 3SY8A 4MO2A 1PZNA 3CPSA 1W5FA 2INGX 2A0XA 4UVHA 3H1FA 5EIOA 5H70A 3P9PA 4JI6B 3AVVA 1L9KA 1NG1A 1QWOA 2BEWA 2IY9A 1GGEA 4LK3A 4N41A 1E1YA 4UE6A 2QZZA 3E0XA 4JT8A 1SCJA 1K97A 3T99A 4EZEA 5KZMB 3SWWA 2G28A 3CJRA 3IP3A 1U0TA 4KAJA 2CFCA 4EY5A 1VDZA 3DC2A 2FZCA 4LJAA 5LP6A 1M7BA 4UUAA 2JVKA 1RLTA 2JAPA 4BE7B 2NO4A 4KKXB 3ZD8A 4R71A 4LOHA 5ALRA 3WQSB 5BN3A 1HQCA 2R8ZA 3UMBA 2XOKA 3HHPA 4PTZA 1X87A 4ZFNA 1Z6ZA 1NLZA 2GA9A 3EW9A 1QKKA 1XKLA 4JI5B 2ZDGA 2RG7A 3G2PA 3GT3A 3RU7A 2FZWA 3OJEA 5FLYA 3QTTA 1H2YA 5TQ2A 2WM8A 1QP8A 4M89A 4BB9A 4HVLA 3HE3A 4CKWA 5IBRA 3BIJA 3K9WA 3IKJA 3HC7A 3O1LA 4RPJA 5KU7A 4QYWA 4CG2A 2AQHA 3FMFA 4W4TA 2Q4OA 3R7WA 3WI7A 5IKMA 3RF6A 2JDIA 2FPWA 2XY4A 1UBNA 2BMJA 3FPKA 3I83A 4UQPA 1LCIA 2I1LA 2CZGA 4PXSA 3DL0A 1G7TA 1YUMA 2X9GA 2YJ4A 1ZLXA 2AWOA 2IODA 3MC1A 5CJ2A 4KFCA 1UBUS 4E09A 2O0JA 1O95D 3K9HA 5TT0A 3HR7A 2I1WA 4ZVUA 4TXNA 2J6BA 2XX3A 1TJ4A 2O7RA 3QVTA 1WUHS 1U1DA 3HBFA 4Q9DA 4ZYUA 4Q1BA 2JC3A 3JR7A 4XVCA 2WKPA 4BV3A 3IAM6 4FU0A 4MVJM 2DFVA 3TLBA 4EL0A 2DFDA 1NW7A 4HH4A 4RKWA 1NI5A 1GGHA 2HF9A 4IDHA 4DSAA 3QLUC 4HN4B 4W7HA 4HGNA 5ALXA 2H59A 3SOPA 3RBZA 1AQLA 1XXLA 2HSEA 1X7GA 2WWIA 4DIMA 5JTUA 2HQOA 3OF3A 1E9RA 1KHHA 3BSYA 3PWZA 2NU9B 4RTMA 4UPVA 5JSQA 4GOMD 2IHBA 5TVKA 1N5OX 2LDBA 1YKSA 3N5CA 1T8RA 4MI1A 4P92A 2HWWA 4AUNA 2HL6A 3O8BA 4KQCA 1XE3A 4BV8A 4EECA 1J5XA 4PPGA 5DYGA 3LXXA 4EX6A 2Q4DA 2K2QB 1NR1A 1XI2A 2CXPA 3EGWA 3UW3A 5IUJC 4MWGA 2CGEA 1WUTA 5E7QA 1YJBA 2GPBA 1CE8A 2YVUA 2QJOA 1SG0A 4ZPJA 2XT0A 1MFPA 3QPDA 4RSRA 4XQEA 5LLSA 1KK2A 2FWNA 2XQIA 3G89A 3H5VA 4FJ2A 3TAUA 1Z6GA 5AI6A 2O7SA 5LB4A 2EZ4A 4R7TA 2I55A 1W94A 4EGFA 3PE6A 3ZEAA 4FB4A 1IBCA 2G71A 3D6JA 1TO6A 5K3AA 5MFPA 5LA6B 5A7GA 4ETMA 2JLAA 2RH9B 3EYWA 1VTKA 5DM4A 4NCNA 1OFGA 2P9TA 2BBSA 3RK1A 4ZCMA 4NMMA 1IJKA 1SBZA 2PGXA 1FTGA 2IHVA 1UP6A 3BBPA 3FJ1A 3IE0A 3QVWA 4B35A 2DT5A 2CYCA 1XD2B 2AN9A 3HDYA 2PX0A 1XEXB 3MJEA 1V4VA 1QS0A 2XHZA 3ZWXA 2OVFA 4LZLA 5ETJA 1ZH6A 2QTZA 1P3Y1 2OZVA 3OPYB 4JBGA 2UVQA 1P9RA 3OQOA 4BNLA 1EAMA 3RHFA 4PN3A 1JEYA 5AQ1A 1E2PA 3SQWA 1CIVA 1MA0A 2VZEA 2Z5LA 3TIGA 5CB8A 3VNUA 4RULA 5LKAA 4MR9B 1XMOB 4D99A 1H9CA 4M7WA 4D4JA 1Z26A 1UEXC 1CYDA 2GUGA 2IVZA 3MD9A 4MUIA 1SUEA 5KMGB 1XROA 3WFIA 2YY5A 4UXJA 3RQIA 4C4RA 5EP1A 4CMJA 2E4UA 2DUNA 1KDZA 4GL2A 4CM9A 4MXDA 4FBLA 1BA3A 1OROA 3ESRA 3LHKA 3K6SB 3BMOB 5AHOA 2D3TA 3KU4A 3W9SA 3JWEA 5B1IA 3X3HA 1QV9A 1XKTA 2HA7A 3AERB 3W0LB 4HAIA 4KGXA 3PJEA 4PGFA 4ROTA 5AR1A 2EBFX 2XKJE 5DXAA 1KY5A 4BVJA 3NM5A 2JFHA 3VYRB 3PGA1 2ISCA 4KWTA 1X2BA 2DTEA 1VB5A 2QZSA 9MHTA 4EF4A 3GEDA 3D8NA 3MSCA 4YP0A 3E27A 2ODEA 5A1TA 5FXMA 4TVKA 5JVDB 1Y8QA 1X3SA 5EYPA 4MDYA 5KX5A 5L6LB 1AQ6A 2HEIA 5IFLA 4WXEA 5AKXA 1EYZA 1JNYA 1Y8RB 1ORHA 1JBEA 4PGMA 5JXJA 1FYDA 1DC7A 1PQPA 2BFWA 5LYJB 4FWIB 1G41A 2CVHA 3FZYA 2AOUB 3N0RA 2C7PA 1JYEA 1EIWA 5L3SB 1R9NA 1UFQA 2JGFA 5F21A 3WFJA 3K0KA 4K46A 4K8RB 4LBZA 2IEDA 2AT1A 4CTMA 1OKKD 1Y1RA 5FTNA 3M5WA 2FPRA 1LI7A 3H9BA 3K7EA 3PXBA 3SDSA 3TKYA 3O2QB 4YHHB 3ZWCA 2ZJ8A 5CB4B 3OUUA 2PZEA 4P4GA 3FROA 5IU6A 1L7MA 3MWYW 2QNIA 4NMHA 2AMVA 4Q4HA 4GM0A 4J1NA 2CT8A 4X1YA 3DKKA 4V1CA 3K8YA 2CBGA 4QSHA 1F8XA 4BV9A 2ZJ4A 2RARA 2D2FA 3OCVA 5EQTA 1NDUA 1F0PA 3TW0A 2C8JA 1IH8A 3Q2OA 1GPBA 5E6RB 4Z0PA 2C2YA 1FNNA 1TVEA 3N3AC 4MI3A 4ZALA 1BMFA 2DSTA 2NO9A 3OZTA 4LE1A 3ZZTA 5JQGF 3UVEA 1V5IA 3NUQA 5SY6A 2OBLA 4EGQA 2CFIA 3T9DA 3I9V1 1O6GA 2FDCA 4PG8A 2ODPA 1Y3HA 3OY2A 1JXOA 4HPWA 4LZOA 3U7QA 4RK4A 4ETNA 4LC9A 1NKTA 3TTTA 2OM2A 2ZU0C 2ZT5A 2A1UA 3WNQA 3BB3A 2CXQA 3AILA 2ONKA 3RC9A 3NWBA 2C8VA 3BBLA 5KNBD 3DTVD 1A8HA 2W6MA 3QE4A 5JZVA 2GPJA 1YQXA 2YDXA 4PYJA 1YB6A 2X9NA 3IPCA 3MAAC 4M0LA 1Q17A 2WRZA 3ZNPA 4CLEA 3COPA 1FYEA 2UYQA 1FDUA 4ZHQB 3VU9A 1KJIA 3K15A 3KLPX 3QWFA 4JA2A 4NJMA 3SS8A 1ZXXA 1RAFA 2PL9A 1B7GO 1CR0A 4ALLA 4L8LA 4O2RA 4RKYA 1YMUA 1ZVMA 4UOQA 1WB4A 4XQGA 4DSNA 1QGDA 2EQ5A 4TLDA 2UZ0A 3OHSX 2Y4NA 5EJAA 4CT0A 1NUQA 3GPDG 3G1WA 4KQXA 3B1ZA 3GFTA 1DG3A 3W5VA 2NTNA 2CVQA 3KLMX 1XN4A 1UKAA 2E4ZA 4YS6A 4TZTA 3EG9A 3L84A 5BOSA 5IBCA 2JLVA 3MTDA 4CLOB 2OO5A 2HSGA 3DBVO 1G2QA 4D8TA 2C5BA 4WOCA 4WLOA 4KLCA 2JJ1D 4GU5A 4D6PA 3Q8KA 2I3BA 3QLTA 2G17A 2IXTA 4RV4A 3P2KA 3DYVA 2I8CA 2NWQA 4L9RA 3OOEA 5AW1A 2HHHB 1NFRA 4MR8A 4YFYA 4YV2A 1WOYA 5EHNA 2XYHA 5EPEA 4E5NA 2ZXUA 1WHTB 3KU1A 4PC1A 4AD8A 1Y8CA 1CUEA 3HDVA 3CF6R 3ND7A 1X1DA 4RE5A 3ICQB 3PA6A 3BQNB 1RQRA 3R5HA 2OCBA 5AK6A 3VR1A 1GQOA 5EKDA 1I33A 5EIWA 5TXGA 4PS0A 4AP6A 1XEWY 4YMTA 4HS4A 2JZNA 2XMSA 4IYJA 2IC5A 3L05A 4LSZA 5KHAA 3ZHTA 4EPXA 5A9SB 1H8HA 2I4IA 3DAGA 4G8BA 5JROA 3ZCVA 1ZQ9A 1L4EA 3BOSA 3KC2A 4KVFA 2PEZA 3BPSA 2Q9CA 3CH7A 3CURA 4BO7A 3Q3IA 3L6UA 1T9GR 1VL8A 5F64A 4BNIA 2VK1A 4DNFA 3Q3GE 3EVZA 4XEHA 2QJFA 5CLGA 4YJHA 1LFAA 2PRKA 1FQOA 5DB4A 4GUDA 3PC3A 2ZWOA 4EJMA 2QGNA 4FYWA 4U7HA 3CG4A 3GP8A 1UJBA 4FYKA 4V1CI 2ZYWX 2Q0SA 1U0JA 3VV2A 5TLSA 3PC2A 3TBFA 4DA7A 2PSHA 1X7DA 3DMGA 1F9EA 4WQMA 3HO8A 2UXDB 1JPNA 3EVAA 5AM5A 2H9YA 2X0EA 4B43A 3AFNA 2XE6A 5I5GA 2JLZA 5B58T 3UJHA 1XHEA 5IKPA 5IYZF 1WVIA 1BMQA 4LGYA 3PSAA 1YVUA 2Z5GA 2XRZA 1DJNA 4XSGA 2R48A 3CR3C 4WZAE 2WB4A 2OFWA 4F3KA 2NXNA 1T2NA 1SB8A 3DP9A 3WYBA 5BN4A 1LF0A 3I3OA 4C6HA 1W52X 2IOHA 3QVGA 4H7IA 4RDHA 5J2UF 1Q1GA 2VP0A 3VZDA 1YONA 1JEAA 1I9GA 2Q6VA 3AFOA 3GXOA 4OEHA 4LMRA 1NW5A 1NW8A 2BJHA 1DDOA 2D5AA 1IN6A 1A8QA 7REQA 2WVHA 4CMIA 4IX9A 3MD0A 3WLNA 4HVCA 2NZJA 2AD5A 1SQ6A 4L9AA 1U6KA 3DZGA 2RHMA 3HN7A 2R4UA 4Q4AA 4E07A 2HRDA 1Z82A 4XDZA 5LQSA 2YINC 1HC7A 3I30X 3JQDA 3JRNA 4IV0A 4JEHA 5JSZA 5KMGA 4DPMA 1O08A 3DMTC 3AU9A 3V97A 2V4UA 1NF2A 1NPDA 4HLDA 5CVTA 5DM2A 2JGDA 1K5HA 5EVJA 5C4IA 3SZGA 4CNQA 2QYHA 3N74A 2B20A 3OUTA 4DJDC 2RJNA 1X7YA 2C54A 1VSQA 2ATEA 3E4DA 4KWIA 3KJNA 3OICA 1PJ4A 5HILA 4W9NC 1R8QA 1VBMA 2Z3VA 3JW8A 1ZOLA 3WRYA 2C2WA 2PNFA 3G7SA 5H1YA 2P0AA 4JK3A 5K20A 1RNLA 2QTTA 2XYVA 1XVLA 1E1CA 3GT7A 1IWPB 1M67A 4YV0A 4M60A 4ZVNA 5J5CA 1TECE 1MQ9A 2ZM6B 3U61B 2GAOA 3S1AA 4NAHA 2QG9A 2WZQA 4D8WA 3E4CA 3L9WA 4C0XA 1N0UA 3F4KA 4GKKB 4F2WA 1HKUA 1HTBA 3L18A 1DEOA 2ZULA 1F20A 2XRFA 3AVQA 3AWIA 1O7JA 3VR4D 5IT4A 4W1PA 4N18A 1UC9A 3PIRA 1JFTA 4O5AA 4KN9S 3VH1A 2F3SA 1EFPA 1RE0A 3AHDA 5ECGC 3DFUA 1DAOA 3KL4A 4MS3B 4I46A 3SFZA 3Q9UA 3ZY4A 1N7HA 1Z15A 2L2QA 4TZ0A 4IIXA 1FW6A 3C6ZA 3E1SA 3I9MA 1THZA 2ORED 3QLVA 5SZJA 5GMOA 3PPWA 5I7WA 5CNKA 1UR5A 1PCXA 1SN7A 4HUQB 3AVWA 4Y2XA 4YIKA 1ESDA 3BIXA 3PRYA 3T7DA 1N34B 4Q3LA 5AIAA 4BX2A 1JE1A 4D4IA 1ZNZA 5LP6B 2F3RA 4Q82A 4CM4A 1NUHA 2OQVA 1YZLA 4MULA 3DCYA 4YWJA 2W2MA 4II2A 1NOJA 1D7AA 2CXTA 3CZRA 2NO1A 1XQVA 3ENQA 3N07A 1T2VA 4I9GA 2ZSHA 3MHPA 1BFDA 3EXHC 3I4LA 2HIGA 1PR6A 4MS4B 4B6FA 1CUJA 4RJTA 4EHKA 2PV7A 1KFKB 2I7CA 4PBRA 3RTGA 1I01A 1HYHA 2PGAA 3WGYA 4DILA 4FLMA 3DKRA 4EYQA 3GLGB 2VDVE 1K66A 1RBQA 1Y8AA 2VOJA 3K1YA 4HLUC 2YH2A 4JVMA 4IIBA 4UEKA 4A0GA 5JZBA 5FKJA 2GXAA 4P86A 1N0IA 2A9RA 2NU7B 1XYYA 2VDUE 3PSHA 4MI6A 4XVRA 1DCFA 1GLVA 1BROA 3BIOA 1EWVA 2UZAA 5IJAA 3OMLA 3UGQA 5HKAA 4QGFA 2VSFA 4LI3X 2ORWA 1KXZA 1WHSB 2YVQA 4FYYA 2B1JA 2V7EA 3U4AA 5KHLB 2CHVA 1V1JA 1SR8A 1XV5A 3HGQA 3P71T 2FZLA 4C4YA 2G4LA 3VU9B 2HFJA 3LBAA 1JEEA 1BN6A 1QVZA 1Y7PA 2C8KA 2JGMA 3EWSA 2WNHA 3C3YA 4GPTA 5DGHA 4IF4A 3EWAA 3KVOA 1KAMA 1EBBA 1G5TA 2GN2A 1N7JA 3ZDQA 1Q11A 3OC0A 4OOEA 4RSGA 3PIIA 4CWAA 2PX2A 2R25B 4MDHA 1J2RA 3U5ZB 3JQAA 3LX4A 1U2QA 4GH5A 4QYXA 2DX7A 1GDDA 1R00A 1BXRB 3B7WA 3Q1KA 5F1YA 1D4OA 5FI5A 1K6EA 1LLFA 1L5MA 1O8BA 2IRWA 2OO5C 3B2QA 5TJ9A 3B6KA 4B3XA 1I3KA 4HGRA 3G5UA 3T5TA 4I4CA 5DLQC 5KINB 5GQSA 3OFNA 4C30A 1DIOB 4K9PA 2IBSA 4G0XA 1RT9A 4NCHA 1BNCA 2Q1SA 3BJEA 4OF4A 4KNYA 3PLNA 2FFRA 3ZI4A 1FXWA 1GPNA 2G5TA 3F7MA 2E82A 2D0IA 3JQFA 4RXTA 5G1PA 3AW9A 4M38A 1QGED 5DI3B 4HZUB 4BQNA 3UKJA 3IR6A 4GLLA 5A4DA 1D7OA 1FOEB 1FSSA 5IZCA 3M6UA 1QQ6A 3FFBA 1PDVA 5CT5A 5B7GA 3NV9A 1I6MA 1ZOSA 3CLTC 4EBBA 3U4IA 1MX9A 1T43A 2PAAA 4GXNA 1KK0A 1Z0DA 2C5LA 4ZOLA 5DHTA 4EHFA 3K70D 2AJCA 5LA6A 3P0RA 3QKSA 2K87A 4M53A 3E3MA 4MV1A 1W7AA