4N48A

Cap-specific mrna (nucleoside-2'-o-)-methyltransferase 1 protein in complex with capped rna fragment
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
407
structure length
401
Chain Sequence
b'VDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDRELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
publication title Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/rna
total genus 137
structure length 401
sequence length 407
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12760 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n48A00
4N49A 4N48A 4N4AA
chains in the Genus database with same CATH superfamily
4AN1A 3OQ1A 3HO6A 3VC2A 4OQ4A 4CM3A 3JQAD 4U3JA 2AJDA 5EIBD 2GA8A 4F1WA 1KETA 3DTTA 4AJLA 1PZFA 3DT6A 5IK2D 1Q1EA 3KZKA 4GR5A 2NVOA 621PA 3ADDA 2JVJA 2CMKA 4RPLA 3I32A 1NVFA 4BKRA 3O8CA 1KO4A 3MN1A 4BO4A 4YRKA 1SEPA 3HO8A 2F9FA 1KDRA 2C3MA 3FB4A 5CIWA 3AESB 1HMPA 2UDPA 3CZCA 4JT2A 3V1LA 4JL8A 1O8BA 1SNYA 2CXHA 3RABA 1G19A 4Y0NA 4Z0PA 4AS1A 3LXMA 1RC1A 3OEYA 4H4DA 2EC5A 3DDWA 2C94A 3CLUD 1PZHA 1SVNA 3F3SA 3L84A 1A7AA 3O8DA 4MKXA 4NE7A 1TAHA 3WLEA 4DMLA 4UCQA 1TW2A 2F3PA 4G4SP 3EW9A 1M2NA 1SU7A 3B36A 4P3NA 3ZVKA 3K3PA 4PR0A 2OGWA 5COAA 2CYBA 2HOQA 2VJDA 4GX5A 4O4IA 1Y8RA 4G6ZA 1VL8A 2XNKA 3CLUC 4XGQA 3ICEA 1HYGA 1SBZA 4Y67A 4AX8A 3RIMA 4ZFNA 4OLHA 1F2UA 1ZUD1 2OXRA 1I3OA 2HHCA 2LWIA 5BW6B 3BKXA 1J99A 3BGDA 2WSSD 1I2ZA 4EFNA 1C9YA 3QBTA 2A1UA 5HM8A 2BN4A 2PCJA 4UZFA 2B7LA 2YDYA 2P40A 5LQRA 2VYCA 4EGFA 3O03A 2IUSA 5LM3A 1IN5A 1SUWA 4U8HA 5FNVB 2R6CA 3F6SA 4KE9A 4B6GA 3UBTA 1O58A 2X6TA 2JLBA 3HBAA 4Y6SA 1M0EA 1UAAA 1M2OB 4W7HA 2BFMA 1VJ1A 1OVMA 4G63A 1MIOA 5FOUA 4WZ6A 3CVOA 2VHCA 2A8YA 2HHJA 2XVXA 3BULA 3MBOA 1L7OA 3VBCA 1RFGE 1VCIA 4RETA 2I1WA 2I6SA 3KG2A 4V03A 1RIFA 3BKWA 3KLNA 1VFNA 3P2JA 2CWDA 2WVAA 1DKNA 3DQPA 4FINA 4BQPA 2G7ZA 3CRZA 1VJRA 3G0DA 2DLCX 4TWIA 1Y4UA 3O93A 1X7ZB 2P3SA 4FR5A 1SUEA 4GKJB 1EJ0A 1Z6GA 4NCXA 2HIAA 5DU2A 3AVWA 4ESOA 2YYZA 2M6KA 5TE9A 3HVIA 4UNQA 5LP6F 3G8DA 1GDDA 2CD7A 3KYIB 4I3FA 2FPPB 2OE2A 1NP6A 2Q21A 4MYSA 4PAQA 1N2XA 1Y6RA 1OIXA 1OXBB 3IEKA 4GP9A 2A9OA 1XZ8A 3PQCA 5FI0B 3UK2A 3ZZTA 5BR1A 1TK3A 4A8TA 4UAJA 3NCTA 4NYJR 4NQZA 3ET4A 1MLDA 3O82A 3DTYA 4K6FA 3TKYA 3EXHA 3STYA 1FTWA 2QWXA 3B6JA 3OP4A 4UEWA 4X44A 3TOCA 3KXIA 5IBRA 5FA6A 1IG3A 5KVQA 1H6CA 2BFEB 2ZTLA 5T8KA 4AP9A 5LXTA 5GMOA 4BQQA 1J6UA 1TKBA 3P0FA 3ISJA 1SXJE 4N8DA 2VF4X 5EWLA 2H4WA 1AQLA 3L6EA 4MLZA 3UWKA 2SKDA 4ABYA 2BM9A 2C1EA 1CQJA 4HXGA 1I2MA 5K8JB 5HCNA 3VQTA 3N59A 1CLUA 1GZ6A 2B94A 3CG4A 1HNXB 2Y0EA 5JYCA 1TJ3A 5JTUA 4HRYA 3LYHA 1HTBA 1RABA 4M1QA 1PT9A 3GH3A 4UREA 3ONWA 2IYTA 2QIOA 2W2LA 4YFYA 5KJFA 2OCDA 1YR1A 5M34A 1M1YA 4XM1A 1UKEA 2B0CA 2Q0SA 4JU8A 2H0RA 4EH1A 4NOLA 1JR3D 3SSAA 3F5DA 1YWGO 3OZAA 3V55A 2WPDA 5AKJA 3V8QA 1CJTC 3PDWA 2EFJA 4BRSA 3R6TA 4XX1A 1BQ3A 1GL7A 2ZYIA 1V4BA 2X15A 3C1TA 3IB6A 5CU7A 5F33A 4EOGA 4A5SA 3LPAA 1SCJA 2XW6A 2Y1WA 4JNCA 4RTJA 1CP3A 5C18A 1VLHA 2P90A 2Q4TA 2OXFA 1WDKA 2N75A 3CT4A 2CLHB 3WRVA 4XSVA 4EG4A 3PNLA 2EYUA 4C14A 4ZT2A 3N0XA 3DTNA 3QI2A 5FI1B 3EUAA 3TSYA 5HIAA 5HPYB 2FNAA 5F73A 1IN1A 2A7QA 1R0BA 1GGVA 4H17A 1ZGAA 4MS1A 3U37A 3T0FA 4LJ7A 3K9LA 3TZKA 3VU8A 1QYVA 4MVJF 1K27A 4BGUA 1L4MA 3GLRA 1Y6GA 1Z3CA 1QHYA 3PG5A 1MC1A 2Q6OA 3NJRA 2AOVA 3DVRX 4ZCQA 2Z09A 4MTLA 4BJ3A 4EGQA 1LDNA 4Z4QA 3FPKA 1HDEA 2YHUA 4BNTA 2Q27A 1SC6A 3DGFC 3AZPA 3U16A 2GZ1A 4O33A 3WICA 1EXWA 2CFCA 3H7IA 4RGVA 3OE4A 3WHLA 5JS1A 3KSAC 3ZU4A 3B8EA 4J3JA 3W2GA 5KUTA 1CUVA 1PSDA 2FSUA 2QTAA 4EPVA 3RYIB 1F7UA 1PEKE 4D9FA 2GBLA 4LYFA 4E7PA 1DKUA 3R9XA 2PJUA 5AHXA 1CEQA 3IHTA 3LZ6A 3ICQB 3MTAA 1TM2A 1DTSA 2TMKA 2G0NA 3JQRA 1PE0A 4NCHA 4R83A 3H13A 5CX1B 1USVA 1EEHA 5REQB 2V4UA 3UOWA 4HFJA 3I0ZA 2WYWA 2V96A 5JBIA 1Q1GA 2CHUA 5HIJA 2WVGA 4IIHA 2VPYA 2WUGA 1WW3A 4H1UA 1CY7A 1H2EA 5AKIA 1E92A 3I6QA 5C7OO 3K32A 3NKLA 2DB3A 1IHXA 4LOJA 1SXHA 3S44A 3WGOA 2CSUA 3F0TA 1UKCA 4X97A 1ZJZA 4NQRA 1DBSA 1DWUA 4UCFA 4LDZA 2WTBA 3IAFA 2WQ7A 2UYYA 2XA1A 1T35A 2IHBA 4AMYA 4TS1A 2EW1A 4UEKA 5K0JA 4BXOA 5BNFA 2F8LA 4M36A 3DLHA 3FTEA 1O96B 4IHAA 4UDOA 3L7CA 4YXFA 1NWCA 1DOHA 4IUBS 4UDNA 3BILA 4HNSA 4WKGA 1T6NA 2GJAA 2R7AA 1XCBA 1CDOA 3UC5A 4JC8A 3JQ6A 5IASA 2O54A 1N5MA 4EB3A 3IPYA 4EQZA 2ADOA 2BCJQ 4J6EA 2XCSB 3MMPA 3WGNA 5DGIA 3OX3A 4XM0A 4OHWA 3OCJA 5JFGA 4XOUA 3HCAA 1KAOA 2CHQA 4IGKA 4OJNA 3D6NB 1QAMA 2P2YA 1DLIA 3B8HA 4ZCSA 4HWOA 3VZPA 4W1SA 3OZTA 5DM60 1U1EA 4NIMA 2WFLB 1F1JA 1M1UA 1QTIA 3EIUA 3H75A 1P1IA 4JJ7A 1ODTC 4KK4A 4L51A 3D3NA 2JD2A 4QQ8A 4DUPA 2Y8EA 2O3RA 4CQJA 2MR5A 1LTHR 3OIVA 3DMTA 1AVTA 2J5RA 3V46A 3W77A 1N33B 1VYUA 2WRZA 1Y7TA 2XVZA 4JWKA 2ZDQA 2X9QA 1XAJA 1MN6A 2X5NA 3FY4A 2W48A 3JZFA 4MJXA 4X3CA 1VCNA 4Q9AA 4DCUA 1DIAA 2IOHA 4RTMA 3L7MA 4YCBA 4NYJQ 4OSPA 1MAUA 3GRYA 3ZE6A 4OJTA 1UP7A 2YVUA 1VSBA 1IZZA 5K0SA 1FP1D 3LD9A 2HUPA 1ZGZA 1FXSA 1JV2B 4FHFA 1BXRA 3H1FA 1BN6A 5JDIC 2C9YA 4BX2A 1UT5A 3E7WA 3FLEA 2GK7A 1CY0A 4NBNA 1S2MA 5BQFA 1BD4A 5JALA 3PYXA 4GWKA 1NBEA 1W1IA 2HXSA 1UBMS 2OFFA 3ORYA 3U7HB 5C1PA 3HKDA 4XYMA 1WVGA 4XGKA 1U6IA 3UJCA 1ECBA 2HU5A 3VZCA 1WNTA 1JQDA 4ZQFA 4JJAA 5HYVA 1H8ED 4NR0A 5LZ7A 3GGPA 4TWBA 3DVAB 3B5IA 5K4HA 3M1YA 5JROA 1A95A 2K7ZA 1FS5A 4TZKA 2F59A 2RGNC 4RVDA 3WYBA 4IYJA 5EY5B 3ZEIA 5IHXA 4OFZA 2C04A 3A4YA 4MB2A 1V1MA 2GXQA 2EF1A 3WLHA 4BO5A 5JBNA 1JQEA 1JXOA 5J43A 1JIVA 3FOAA 2G9NA 4C7XA 3QKRB 5LYJA 1XDUA 2VJQA 3T9BA 1PUJA 3GMIA 1BJRE 1AE1A 1Q7TA 4OMDA 3HCCA 4BN4A 4GOND 4XYGA 3HJAA 4C0KA 1I94B 4EVSA 1ADGA 1DC4A 1IATA 3K15A 3EGOA 3GARA 3V6MA 1T29A 4IIBA 4YK7A 1LU9A 3VH3A 4QDJA 4FDVA 4RCVA 4XIFA 2ORVA 2IE8A 3AI2A 1J25A 2IPXA 2D59A 1RE0A 5AD1A 2PMKA 1OC4A 3MELA 4HN9A 3JVUA 3ANXA 4HYTA 4U2BA 5BUQA 1YXMA 3JYLA 3S70A 3RQIA 2B98A 4RWEA 4F3TA 1X7HA 2ZJ8A 3OKCA 4HNVA 1VHDA 3BOSA 2BEKA 4QM7A 3IPXA 1NMXA 2DBRA 3HN6A 5FNVF 1FYXA 1P17A 2ASEA 4DNXA 1NXPA 3D43A 4NATA 2P0EA 3AJRA 1DEXA 3JARA 1S0UA 1V8PA 1FQOA 5G1NA 4LAFA 2VYVD 4C3VA 1QX3A 2I03A 4Z2AA 2IS6A 1C1YA 4R7ZA 3WRYA 1N2HA 1UK9A 2VJKA 4P1ZA 4PXAA 3JVIA 3U13A 3VM6A 4F5YA 1QQAA 4INZA 4CJXA 5C9ZA 1JA9A 1XRQA 2CDNA 1J06A 3B13B 1J22A 2X8JB 3C4JA 2J85A 3EVDA 4EF5A 1C9JA 1P61B 5CDGA 5CXQA 5LLDA 3DCYA 3RFXA 5AVUA 4UKDA 2NPOA 2ZT7A 3AHIA 2J0QA 1BSVA 1SXQA 3PXBA 2ODNA 1OHHD 3BXPA 4IILA 5AVOA 4RENA 1DCFA 1IOVA 1G16A 1PKEA 2Q07A 1IY8A 3CUSA 3N2GA 3PUXA 1HQCA 4KO8A 1IWOA 3RASA 1IMOA 4AZ3A 4UHFA 3LL7A 1DKMA 1XYYA 1UOEA 2WKWA 4UD2A 2XRZA 3JAWA 3RIYA 4BMNA 4UVHA 1Y6FA 3UUEA 3HRHA 2BSQA 3N2KB 2ZAOA 4BO8A 3GJ3A 4FM9A 2E3JA 3GEBA 1JG3A 2AXNA 5JHGB 1DUVG 3DONA 3VSAA 1TCUA 4OPMA 5LN1A 2BGJA 1R5OA 2ZWMA 4MUGA 2WW8A 2BJVA 3Q9NA 3IBYA 2OO3A 2P27A 1MO2A 3CKKA 3KOUA 3T3NA 1SCIA 5J23A 3CEHA 3A14A 5DLEA 4LZAA 4R2MA 4JLSA 4W5TA 4O3FA 4G24A 1I6WA 3HS3A 2BKUA 4MYDA 1UMBA 4BTLA 4OLFA 1UCFA 1KARA 2BM0A 2WF7A 5AOVA 5A7GA 3U2QA 4WBNF 3JR3A 5DM0A 2FA9A 1T9BA 5JNLA 3ZHZA 1GRVA 1TGYA 1YL7A 2XQJA 3L6BA 1PG5A 3ND6A 2P6RA 2P0AA 2F9MA 2Y68A 1PWZA 3WXMA 3QP9A 4MVJI 5TPZD 5IXJA 4X66B 5AJWA 1YJ8A 2DPMA 3BDVA 1FRQA 1JJ7A 2CB9A 4JSRA 4MYTA 1E7YA 3UATA 1ZD1A 2P30A 1U8UA 3MMZA 3SICE 1J4AA 4HJXA 2GD2A 1LV8A 2B8JA 1O89A 2FMXA 3R6GA 4RMJA 3GN1A 3BK1A 3M34A 4KFSA 3E4DA 3IKMB 4OHVA 4RK7A 2OORC 3NGXA 3IPLA 2MTBA 1W44A 3I4LA 4L50A 2PL1A 3ETLA 3I2YX 1JJFA 3NONA 7MDHA 2OEPA 4XWTA 2H7CA 3F8SA 2IWHA 3S8YA 2CD9A 1J8MF 5DGTA 1JB1A 1J8FA 4CMCA 4KNVA 3IAM6 1S4MA 1V3TA 1PR6A 2HDWA 3PHGA 1L5KA 3B3JA 3N8HA 2PQMA 3OU7A 4AKHA 3CHYA 4QPCA 3ER8A 1UWCA 1XCOA 3VYSB 3X0DA 3CXRA 4R9NA 3FBWA 3H9EO 3G5AA 3IT3A 2HXGA 4R41A 1JR6A 2FQXA 5IAKA 4KR9A 1IXKA 4G0YA 3AHJA 3TL2A 5I9BA 2NTYC 3ICOA 3UJ9A 1J56A 2GERA 2GSWA 3BBLA 4OHPA 1E8NA 4EMTA 3GGOA 1WABA 3B1XA 1L5NA 2VDWB 3OPYI 4J2TA 2DUNA 1JT9A 4JB3A 4HTFB 1ADBA 2A5JA 4EKDA 4EK9A 3IUPA 4OJKA 4S24A 1VI6A 1SHLA 1RP7A 3M9XA 3M9LA 1XZPA 3HLYA 4D9EA 1RMYA 3KV3O 3HY4A 1KR2A 1NNI1 1QU2A 4Y2JA 4JUCA 3WLSA 3CRW1 3ZXYA 2F43B 5CT9A 2G40A 4JAVC 2NZ2A 4IXWA 5FA5A 4MR7A 1M2KA 2GO1A 2R8XA 3ECCA 5JH7A 3EPPA 3LCCA 5JD5A 3L1JA 5IF9A 4NENA 1SHZA 3M5DA 4LHEA 5F76A 3RI3A 2WSYB 3PXDA 4BDSA 1NBMD 2HBZA 2IOQA 3LT1A 4MPDA 4TXLA 4X64B 1L5RA 2PS0A 1PS9A 4NJOA 3D0KA 4RQTA 3SCZA 3KTDA 1BYIA 3VU1A 3AOGA 1JALA 1XTJA 2DBZA 3HJGA 1FEZA 1R0LA 1R8SA 2WNIA 4UCWA 3LFTA 4FGSA 5AVYA 1EGQA 1JEDA 3DMFA 3AMVA 5GGYA 3V4LA 4URHA 5FFFA 1U4NA 1LI5A 3FX2A 3IX7A 4Z2YA 4CHTA 4F8JA 1AU9A 3KEOA 3M4YA 1B8VA 3N2EA 1Z5OA 2G80A 3P4YA 4BFWA 4EATA 3VTFA 5BWLA 1G41A 1YBMA 3Q72A 3UN1A 5HX7A 3HJRA 3KJQA 3N8NA 2H3HA 2A0XA 3GUVA 2VTBA 1T8YA 2A0FA 4Z4FA 3IBSA 4AS3A 1ZISA 3SKXA 3BWMA 3FDZA 1HEIA 3ESAA 2PZKA 4PRKA 2DY0A 4DA6A 2FF5A 2CMDA 2A30A 3QK7A 1XTKA 1II0A 4RF5A 5ALDA 1XB2A 2QG4A 1Z08A 1VCHA 1A9ZA 1UWLA 2QW1A 4UPDA 4XLTA 4XCVA 2ZYVX 2FJUA 3S29A 5B3KA 4EI8A 1E6CA 3R4VA 4PNZA 1WF3A 1IJKA 1T4BA 2H0AA 3OA2A 4KR0A 4B76A 3FBGA 2BE7A 2XEDA 3MK31 3NIDB 1HEYA 1EXVA 2AUMA 3TYXA 1HLDA 4BQNA 3OA0A 3CR7A 3VHXB 3UQZA 1Z5NA 5K0CA 3ZXUB 4HH3C 4HWTA 1AUXA 3O4HA 4PLYA 1VPLA 2QD3A 5AK0A 3Q3JB 4GRIA 2J0UA 3BZBA 2NMVA 3DDCA 5KYYA 2DQ4A 1MQ9A 3ABRB 4HX2A 2A5DA 2ZTSA 3JD1A 1XT6A 2VQDA 4W82A 2QTTA 4OHUA 3VV2A 2W4MA 4BO7A 3BWVA 1LBIA 4LJ9A 4OHXA 3IQWA 4DBLC 1O97D 2VO1A 1C9KA 1QCCA 1KFJB 1CY1A 4MVJH 3DP9A 2XNDA 3KP1A 4N8EA 3CCFA 3MJTA 2R60A 3KYJB 4BCCA 1U8ZA 3G49A 4QUKA 5HDQA 3FHTA 4F6CA 4RD0A 1KU0A 4RIIA 3SX0A 1A2KC 1DAOA 2DFDA 2XAAA 1NN3A 2I4TA 2VJMB 4H0FA 5J2UB 5BV7A 1O97C 2YJNA 2CEAA 1ODJA 3RRZA 4MHOA 2JFPA 4RW0A 4EB8A 3SNHA 5KYGA 1GCGA 1RM5A 5BWOA 2RBEA 5JI2E 3ROMA 3KZOA 2FFQA 3DW3X 3DMDA 5D51S 5DT2A 4I1IA 4M0EA 1A69A 2AT1A 5CCXA 1OROA 1P6UA 5AJTA 3TECE 4BNFA 2ZBPA 3SBEA 1HOXA 2FG6C 3RVSA 4NABA 3QX7A 1Q0LA 2BFPA 2UZ3A 3BB4A 3MCZA 1OMOA 4X84A 1I3KA 3TQCA 1AQIA 2QUKA 2VP0A 1MKYA 4WASA 3ZWXA 4D2IA 1K7XB 1AB5A 2BAGA 3CZQA 2X0FA 2Z2ZA 3KYCA 3R7LA 4B6OA 2BEUA 1DP4A 3QLVC 4IDFA 4MW5A 3T1OA 3O91A 1DL5A 4OM8A 4PLVA 4QFMA 4RHFA 4F3CA 2YBDA 5KAPA 3X1WA 2QV0A 1NBHA 1XLVA 4TMWA 3TLXA 4RD2A 3JYPA 3KUUA 4X63A 4AQYB 1G6Q1 3ZH2A 1NY5A 5EP2A 3EFOB 1GTSA 2UXBB 3DSRA 2YX1A 3LCJA 3RC2A 3WRXA 1P1BA 1I7DA 4Y1RA 4NJEA 1Q50A 2WIGA 2QAGC 2YVAA 4HAZA 2I8CA 3ZY4A 4ZAVA 1W5AA 1LX7A 2AG6A 3GROA 4PZUA 4D46A 3WL4A 5DV9A 5KYUB 2Q0XA 3M1AA 2QVLA 2ZRQA 3AU9A 3DCJA 1P7ZA 3K5IA 3N2NA 2OV2A 4YDQA 5DSTA 2OBMA 4Q05A 1ORVA 4ZVTA 4QO8A 2C4KA 3EISA 4LDRA 1N7GA 2F8SA 3NNNA 4QYMA 5ALEA 3RJ9A 1L8AA 1NVWQ 3UHJA 4BC1A 4ZYXA 1QC5B 2V0CA 3KBBA 3OT1B 5LQKA 4NTZA 4ZVVA 1ZHFA 4HF7A 4DM3A 4BQIA 3TJRA 1HFJA 3ZKWB 3RYHA 5FH9A 5TJHA 1SOWA 1KVSA 1NIPA 2GKGA 2INGX 2QYSA 2YMQA 3KAPA 4ITRC 1WXEA 2WU8A 1S7CA 3VVMA 3BB3A 2ZBVA 3WE7A 1D04A 3FTCA 4B3HA 1T1JA 2WAAA 2DUMA 4CMEC 3OQVA 1FPQA 3F97A 4TYMA 4OXNA 4FFNA 3ANTA 4M1ZA 2BDUA 1KTVA 5GJBA 3M3HA 1H5QA 3MT0A 2QENA 1PG2A 3IERA 5G3YA 5AVJA 3BXOA 3OWXA 3CUKA 3HP1A 1K7EB 2H5EA 2AN4A 1CUAA 2EWVA 3AVOA 3GJ6A 4JEMA 1XUOA 1XTUA 4MV4A 5CVCA 5TMBA 1ZYUA 3FSGA 2IIVA 4WCFA 4GRDA 5E3HA 4HAVA 2PSHA 1RBQA 3I12A 4Y2RA 4KE8A 1MFPA 1X1DA 1X0VA 2ZITA 1GLNA 3JQBC 4US0R 4B6EA 5IF3A 1XNHA 2FHPA 4PZPA 2YHSA 4BMYA 4V0OA 1XZAA 2Z1DA 4WX2B 5LP6A 1QQ5A 3ROZA 2ZOSA 3PGA1 3DOIA 1G0NA 3SVTA 4OAOA 2JAOA 2PQ6A 4J1NA 4YMTA 3HM9A 5JY6A 2XQIA 4AJ4A 1PJ4A 3N58A 3EWSA 5DHQA 1WR8A 2IYPA 1BH6A 3T5TA 4HDKA 4F38A 1EXDA 4TVBA 2Q8QA 4QXRA 4YX9A 1GAEO 3EQ6A 4JYCA 4JYAB 4YV7A 1XDZA 5BUZA 4X1KB 5ADHA 2OSBA 4KTVE 4ZXPA 5EVJA 3AVTA 4L57A 1T8WA 4FFVA 5A4DA 1L5MA 4FW8A 1XKQA 4D3XA 2OXTA 2JPDA 4F6RB 1RLUA 2QMOA 4EVIA 4F9FA 3PNMA 4X3OA 2HA3A 3OZBA 3H1BA 1C7RA 5E1MA 3ORRA 5C1IA 4FS8A 4GQBA 1EJ6A 4RA6A 3VTAA 3GUYA 1R16A 2ESRA 5G41A 3SFVA 3TSWA 2P65A 2E5LB 5J5CA 5CYFA 1T2VA 1G8JA 2X0IA 4FZJA 5DI3A 1VPEA 5K05A 3OIWA 3VHLB 1ZIDA 4F2PA 2V7QD 5JYEA 1PBTA 5A9RA 3LJKA 4OU5A 5L95A 1LPSA 2F3QA 2IXTA 4AX4A 2FPLA 4M88A 4WKPA 5COQA 5DHSA 1KORA 5ERGB 5JY1A 3T7EA 3E3LA 1E9DA 2IPMA 4TTQA 5JRJA 3UV6A 1K2WA 1ILEA 1LS6A 5MFZA 4EJSA 3DV9A 4H7PA 1TLTA 3QPAA 1OXVA 4G0ZA 5F21A 1FDVA 1PJ2A 3IL2A 2W6OA 3L7AA 1RRMA 3ND8A 4CF6A 2F1KA 4MROA 4HNRA 3VRHA 1L1QA 4ATNA 4HDAA 4UTZA 4Q37A 1MGOA 3IJ5A 1D3AA 4MR9A 4LJ4A 4H7IA 3P2IA 2XWPA 4FDUA 5EPUA 5EINA 3WKBA 1NATA 4MP6A 2JLRA 3THYB 1I6KA 1S8OA 1TKAA 3O3OB 4AIIA 3SHQA 1C1XB 4F9TA 2LGJA 1D7OA 2LTAA 2YN0A 4N1AA 4MKFA 1DG3A 4MVJA 3T7IA 5BNWA 4H7DA 4FJ2A 5IC6A 2WINI 4R5HA 1H6BA 2I29A 1YS7A 3ETEA 3MPOA 3QVJA 1P5RA 1GAWA 3E9ZA 3IVAA 2CLDX 4K9KA 2BFBB 2I0FA 5KVSA 3KQNA 4BVEA 1JZSA 2C8JA 3RSHA 5TT1A 2CNDA 3HMQA 1T9AA 3GLFE 1C7EA 1W581 2OBYA 1BJKA 3ZLUA 1H2FA 3TIGA 3B82A 3THWA 5AXAA 2L19A 5ICSA 4JMLA 2IZ6A 3SIRA 4EHHA 16PKA 3STTA 3U1TA 2B7CA 1EDOA 3PGMA 2EFGA 3DAYA 3SIPA 4CUJA 1G8AA 3H4TA 1B8PA 3PQ8A 4ML3A 3TM5A 4KQGA 3OFKA 3Q1LA 4UMDA 4DNOA 1U3FA 4ONEA 4UFNA 1R9GA 1ZNQO 2FSPA 1FFGA 3R9KA 1YUMA 2FR0A 2QJWA 1F8YA 4D44A 2DUUA 3QVLA 2Q5QA 3RUFA 2UKDA 2V5AA 3TOZA 2O50A 3LF1A 4AD8A 4FQ8A 5CFOA 2YVLA 4D9KA 5DNCA 2ID9A 1UK6A 1WB9A 2BI4A 1DC8A 2VDKB 2OBNA 3MQ2A 3QYJA 3F49S 3OPYA 4KFUA 1HFEL 5EESA 2ERCA 5T3UA 2XCIA 4KDRA 3RJTA 5K8TA 4JBIA 1FX0A 2SKEA 3L1IA 2WHPA 5DWVA 3OURA 4KVFA 1VGQA 1QV9A 5DIFA 4L8GA 4PZZA 1M54A 3WI7A 4EPTA 5BN3A 2Z6AA 2W6ID 5KJCA 1UMKA 3MWJA 1Q2XA 4BO2A 4ZMBA 2DWQA 2NSJA 3WTCA 1NUHA 2MR6A 2QNRA 1Z4JA 2EKZA 5HFJA 2IKQA 4WN3A 4P4LA 2BF4A 3D8RA 2E85A 3DMRA 4WFKA 3E1GA 2GWRA 5BSMA 1K4KA 2BGGA 4BLOA 3K7EA 3GYGA 3AOEA 1JJIA 4TMKA 4DJFC 4QJBA 4JELA 4CG3A 4I5GA 3GN2A 2HPZA 3KEQA 2YN2A 4UE6A 3IAAA 3F9RA 2BUCA 5CG2A 2CVHA 5C1OA 1W25A 2JKVA 2D2FA 2J3IA 3E9QA 4JJFA 2M1ZA 2X1HA 4R1TA 4URUR 2X86A 4URZR 4XRGA 4WGFA 3ZYZA 2FVXA 4II2A 4ECEA 2I6XA 4WOBA 4E0BA 2GHQA 4Q0MA 2R1ZA 4PG8A 2IHNA 3DM9B 4EDFA 4YR7A 1X3SA 1XTBA 2AOTA 1JHZA 4L9RA 5TF0A 3RUHA 5KNCH 3MQ4A 4IG9A 3R3UA 4UHHA 2D7CA 3C8HA 3CWQA 4POAA 4Q4DA 4XLLA 4EQ6A 4A15A 3KRTA 2QM7A 3LTEA 3A1FA 1XJCA 5E38A 5F5LA 3N6RA 3OLCX 3IDSA 4BJ1A 1X9GA 2J3QA 3AGPA 2ETXA 2WE8A 3NOVA 3OE5A 2UAGA 1ORIA 4JJZA 4NCIA 4Y7DA 2Y1CA 1V25A 5I8WA 4BRZA 4YMIA 3CLHA 3S7ZA 4V2IA 5SY4A 1U0NA 3DO5A 3DOOA 2Y05A 4RK1A 3JQDA 2R9VA 3AFGA 3CNOA 3KB6A 3M81A 4IS2A 4EPWA 4J0JA 2RI0A 4GLFA 5ALZA 3WHIA 2PMEA 1ISIA 1PJSA 5DNWA 1DTWB 5CB8A 1UJCA 1P0QA 2XYPA 1V3UA 2JFQA 1ZESA 4IUYA 1BDHA 5FO1A 3SYTA 1T0IA 2H2IA 3JD3A 3DOFA 5GPBA 1P91A 2ZCJA 1ZQ9A 2ZZMA 1PGJA 1WX1A 1L7QA 2O0HA 3GPBA 4LZWA 2W4IA 5IULC 4DVGA 5K8LA 1Q0HA 1V1JA 2A9PA 2G9UA 2Z4TA 4MRAA 5LIPA 3VA7A 2MSNA 3B9PA 1XK7A 3O9MA 2C4VA 2VS1A 4TVSA 4U6QA 3ND5A 2V9PA 2I2DA 3BH7A 4JN6B 2WU1A 4CV1A 5ABPA 3WAKA 1V9CA 3V4RA 3DXZA 3RF7A 1M74A 1ZP6A 2YQZA 3AT1A 3EVAA 3KOMA 4EZIA 1D0VA 3FROA 1JEJA 5D1HA 2OCPA 2W2KB 3WP0A 3DR3A 2OQ2A 1IK4A 4ROSA 5EIAA 1L5GB 4ALMA 1BW9B 1L4HA 2HREA 3ENKA 2D2IA 5LWHA 4C6TA 5CDFE 2HLDD 2FB9A 2R65A 3PI7A 3H1GA 3VU3A 4BNZA 1G66A 4HZGA 4PO3X 5K8IA 2Z6UA 3P2OA 4D9MA 4G25A 2ZQ5A 2EZ8A 1PEDA 2PO5A 2G83A 5FQOA 2CMHA 1D8TA 4CFSA 4CL2A 3G3EA 2AI1A 5F51A 3HKCB 2IYXA 5FNVA 3VR2D 4ENPA 3FCCA 5EKSA 1FK8A 3OWOA 3CF6R 4Q3LA 1RJGA 1ZA1A 7ADHA 1M2OA 2BTOA 4KUGA 4JUFA 3VPBA 1G8HA 4P0PB 2FXVA 3EHDA 4QG3A 3FZEA 3OP1A 3IP3A 5EJIA 1SVSA 1FMLA 1DLJA 2RAFA 2VH2A 1SD1A 2ZBEA 3KQYA 3AF4A 1QU3A 1PNOA 3FUWA 4D9CA 2YW2A 4UMVA 4EO9A 2ODQA 5BSTA 2VNHA 3OIFA 4DLNA 2EXXA 2O2EA 2IVFA 1KS9A 4WV3A 4Q9JA 3RC9A 3O0TA 1N92A 3PWZA 1E1QA 2X0DA 1LB1B 2FPPA 1CX9B 3B48A 3H9BA 3T0GA 1INLA 3U48A 4DSZA 3TJMA 1NVBA 4OATA 2V58A 4PQFA 4EA6A 3P4UA 3PUZA 5EC8A 4QU9A 2XDAA 1XQYA 4GMKA 1V8BA 5F9HA 1FQJA 1XVTA 3A36A 3SF8B 4L2IB 1CEXA 3EZYA 1M1ZA 2QQ0A 2ZI6A 1RAIA 5FBZA 1OA0A 4DLTA 3EEOA 1MIHA 4B71A 1DHRA 1HDZA 3ODGA 1RI4A 5BWCA 2QTRA 1Z22A 4WBNA 1BU8A 1CUUA 4E09A 1HQDA 1J8DA 4EHBA 3I72A 2HSWA 2FWAA 2VDRB 2ZWAA 3NJ4A 5LQMA 4PTZA 1OB2A 1G63A 1PQYA 4OBWA 3AL0C 4GKVA 3ZDYB 3I2FA 1CQIB 3TSZA 1A4RA 1DXYA 1G6HA 1JYEA 2HCTA 2Y0BA 1ABEA 4IIJA 2XCUA 1ZD9A 3GLSA 2PEZA 3HFGA 2DHRA 1UANA 1X9HA 3LLMA 4N3GA 5FUVA 3WVNA 4D6XA 1VIVA 4U5QA 3MUEA 3NEAA 2AQIA 3E2MA 3UT6A 1ZCBA 5DTJA 2O8EB 4ALJA 1C1DA 1US8A 3LK7A 4AJ1A 1Z6QA 3B78A 2IUFA 4I2VA 1BJTA 2QMYA 3Q0TA 5EHGA 2JFOA 1BXZA 3HNPA 4LEIA 2C5GA 2WNHA 2YWJA 4RKYA 3MAJA 2WZCA 4CMGA 2ORWA 1H1LB 4GXQA 4YDSA 3TZCA 2B34A 4DMKA 2JLSA 3RNLA 1MB9A 2EBWA 2JGDB 2XODA 4BASA 4PANA 1EVZA 2GZ3A 2RFLA 1NLZA 4QELA 3RAEC 2BHLA 4B3TB 1OWMA 3L1UA 2WT8A 2ZBUA 3CH6A 4IS3A 4FEGA 4LY0A 1SZDA 3GP5A 3E9RA 3AEQB 3VV3A 4FYJA 4XKJA 3LDAA 3RTCA 5JPCA 2HIGA 2ZE8A 1WMEA 3PQ2A 1ZM4A 3VJRA 4MTCA 4D79A 1RPZA 1IYZA 1VPTA 4LOLA 1N3YA 1F5NA 5GJVC 2QHXA 4ES6A 2BBOA 4OKIA 4R84A 1S7GA 1EK2A 1GLVA 3C5CA 2VJNA 2C3YA 2IZ7A 3RDPA 2GLXA 2FLKA 1SM4A 3DDNA 4Q15A 3BMNB 4EHLA 2YXNA 4HLDA 5AESA 3RYIA 3NPMA 3TVYA 3KB8A 1TK9A 4ZI7A 2CY0A 4M9CA 3CUVA 1YTUA 3D4LA 3O8RA 1UQTA 4UAVA 3HK2A 3MJRA 4HNTA 3NHMA 4UBKA 3OZRA 3O2JA 3OE1A 3EEYA 2YIJA 5D3ZA 5REQA 1WQ1R 2QU7A 4DDHA 4KODA 3X1DA 2G76A 1VLZA 3E1SA 3LUCA 4CDRA 3QEBZ 5BQOA 5BV2P 1TVEA 2H08A 3L8MA 4UBIA 5DOVA 2WSLA 3G7NA 1I4OA 2XEXA 1W76A 3KZNA 3R3ZA 2GKSA 3TNLA 3B7GA 5GTDA 5LB4A 3R3YA 4LRQA 2P4EA 1NUAA 2P9JA 3AZQA 2Z1NA 3Q11A 2X0EA 5C3MA 1KEKA 2GVZC 3LGXA 1XRSB 2C1XA 4Y2GA 4V0MA 2AQHA 2LE0A 4EITA 3BEDA 1ZHOA 1NFFA 3T54A 5CJJA 3EWNA 2QDXA 4UHDA 4AU1A 1IOWA 3R3HA 3P0HA 5B1HA 1DAMA 1P18A 1RHUA 1NMZA 8OHMA 1KAQA 3DOCA 1N2CB 2PLNA 4UW9A 5ADWA 5IDXA 2JI7A 1XOIA 1I3NA 3L4SO 2A1IA 3UHOA 3ONNA 2IP2A 2VDOB 5AM3A 3A2KA 3CQ9A 1GARA 3TW0A 3ILHA 1D2CA 1LPAB 1WXHA 1A27A 3FJOA 3INYA 3QXGA 2ZSBA 5SICE 3VH2A 4BRWA 7GPBA 1Y7HA 3AFIA 1DI0A 2Q1TA 2Y0CA 4BLUA 3NDBB 2ZEJA 4LOHA 5LR6A 2QRMA 1GFZA 3QW2A 4Q7QA 1RWKA 1JYFA 4FFSA 4Q00A 5FBWB 3GCGA 2WFLA 1UJ5A 3FRIA 4LV8B 1EUCB 4YRIA 1YVPA 1SXGA 2V7QA 3T5DA 4C0QC 2B2XA 1GEEA 1P7CA 5H82A 4GBGA 1XV5A 3D6VA 1L7DA 4IWXA 4WE3A 1R4AA 3L46A 3ET5A 4WQMA 3L18A 5COBA 4D8YA 2R68A 2BFOA 1A5TA 1RKUA 3LX6A 3BIXA 3MSCA 2RGBA 2OUIA 3KKNA 1ACLA 2MDTA 3ZN2A 5AK6A 2FQQA 5SYMA 1PGOA 2GHIA 3OFJA 4DIOA 3D59A 1QLHA 1O03A 1SZPA 4QUHA 4YMGA 4QOGA 4GFDA 1AJEA 4J3NA 3TQSA 1M5RA 1Z4KA 4BHTA 3G6KA 1JQJC 4NJMA 3VMFA 2AHRA 4N48A 2UYHA 3VJMA 1IPEA 4XJTA 1Z63A 4Z53A 4YASA 5FYDA 1NPDA 1MPTA 1KEVA 1ZKDA 1K4MA 2V65A 4FOPA 1PR1A 1B8NA 1PLJA 1Y7PA 2QY6A 3N05A 4RS4A 2H52A 2I7TA 2ZRKA 2ZQYA 4GGOA 5ILOA 2ZXUA 1R5NA 2E4YA 4LYDA 3VZBA 3W7BA 1J2RA 1SCNE 2RIRA 4D0RA 3GOQA 1UBFA 1PTJC 1ZGJA 2VBIA 1SOUA 2X8AA 2ZJ3A 1B6GA 1F20A 4CFYA 4QPNA 5GWXA 2XZTA 4D0GA 3QKRA 4OFBA 2DP4E 2IEDA 3P5SA 2VAVA 4KXLA 3SG0A 2UYGA 1G8GA 4KRFA 1P3DA 3WJ7A 5C5EA 3L4BA 2I33A 1X7WB 5FXMA 4ZICA 2GCPA 1COWA 2GKOA 1NJFA 1TQDA 2W37A 4LBZA 2G0TA 2XT6A 1JN0A 3RWOA 1QO9A 4FS3A 4E33A 1FC0A 1UOOA 2H63A 3BYZA 2RHDA 4YPFA 4D45A 3WYGA 2WWWA 3HE3A 2H4XA 3UA4A 3A9CA 1IB6A 1Z7GA 1UZLA 2C84A 1SAYA 3IR6A 3QX9A 3R0JA 4DA0A 3PNOA 4TZ6A 2DG2A 4G4JA 1J97A 4BCBA 2QUBA 5LUBA 5FB3A 4DQUA 1XCLA 5ICGA 4MAFA 3OPNA 1IRIA 1NUQA 1EK0A 3NTVA 3R44A 4XB1A 1OAAA 1Z2OX 3IIEA 1F0YA 3WLMA 2AYZA 4P84A 5HMLA 4IIYA 2ETVA 1FNNA 1ND6A 1GL9B 2J4DA 2QLJA 4NU0A 5B36A 1HZZC 1T9GS 2N1MA 4LJRA 4FN5A 4C3OB 4M1EA 4XE5A 2PX3A 1R6BX 1ESEA 2ATEA 4FTWA 4UTPA 3LQKA 3PRHA 4EIWA 1Q74A 5JEEA 2B83A 3GEIA 3GHHA 4WMLA 4B47A 3N75A 1ZHHA 8ATCA 1TQHA 1U0OC 4P3OA 1H23A 5GOZA 4WWHA 4DR3B 3D2CA 5FD8A 4PIPA 4FU0A 1L9XA 1OYWA 3HG7A 1W52X 2L2QA 1VSUA 2VEOA 3SY8A 2R6HA 4DV6B 3NV7A 3L40A 3P19A 5CD1A 1G8MA 3GPCA 3UJDA 2AB0A 1HE2A 3ASVA 1EM8B 3H11A 1XTPA 2V59A 4JGGA 2H06A 3PC6A 5AXBA 3P45A 5D5QA 1PWHA 3P0RA 4W1PA 1NV8A 1BIFA 1VE9A 2R79A 1A4XA 3O26A 2IYAA 4ZJUA 4C29A 5MF6A 2WSBA 2YWDA 3KZVA 1TYBE 1OBVA 2X0JA 3FPSA 2I4LA 4YP7A 1PQWA 1Y6JA 2GN8A 4GE3A 2AOUB 4BV8A 5TC4A 3ROGA 2XKJE 3QE4A 1V43A 5I7OA 4PCAA 2NZYA 3AJEA 3T12A 2YCBA 2DHQA 3SLKA 4YLGA 4HDMA 5AH0A 3QGMA 3I76A 3VOTA 4CN8A 5EYPA 2I4IA 3FPHA 1GY8A 4A3SA 1ZSNA 4J90A 1R4MB 3EGXA 4GC9A 5DNVA 5IN5A 2QM8A 2VDLB 4I9UA 2CZQA 1HOTA 1DKOA 2P11A 4GZLA 2VG8A 5BT9A 1OT3A 3QVGB 3BXFA 5BMVB 2BP7A 2HLNA 1H2AS 4N5LA 3PQEA 1K2VN 1WP4A 3AUFA 1OB5A 3W5SA 3KUXA 2GZSA 2CFOA 1D4FA 3SS8A 1XPOA 3DBHB 2GDZA 1RLIA 1FJXA 2QRJA 4QYXA 3OCZA 3OPMA 1TJ4A 1YZ3A 4MCJA 4MW0A 4P82A 3O8NA 1NRJB 4YWHA 3NMUF 4M8IA 4RCZA 4BNIA 2VT6A 1RM4A 3LVQE 2NTNA 1HRKA 5BXQC 3U5ZB 2I34A 3MYRA 3T7RA 2CVQA 4TKVB 2Q3JA 3BJIC 3NJ8A 1ZD8A 4MV3A 5CXUA 1QANA 5BXYA 4CIDA 3ZLVA 4Y6QA 4GS5A 4G1VA 3W8EA 3ER9A 1O95D 3EQZA 1NYTA 1TCCA 3NS7A 6CHYA 4OBEA 3DAFA 4LIPD 1JG7A 2HUNA 5F4BA 3BZUA 4UU8A 2ZREA 3CVWA 4UMFA 1IBMB 4FYYA 3I6BA 1RLMA 1O95C 4E5DA 5LMUB 2O23A 5BSVA 3FAKA 1Z4QA 4JH0A 3L43A 2P2DA 3OZXA 1UMCB 2NUBA 4ND1A 3RVRA 3ZQKA 1VCOA 1DBWA 2ZIWB 2HW8A 2FF7A 4EUEA 3BQNB 1T13A 1DRUA 2DYKA 3TZBA 3WL6A 2EERA 4CUZA 1U7TA 3I2IA 2QAIA 3HN7A 1ABFA 1EZZA 1GNVA 1YR6A 2IW1A 4KRXA 3VPCA 5HJ7A 2J6IA 3GAFA 2RHGB 3DAHA 4Q66C 3ZZ1A 5A4AA 1SB8A 2EQ5A 3VJLA 4DF3A 1YQEA 3CS3A 4RC9A 5HZKA 1EUQA 2D1QA 3IKTA 1NP7A 3HY3A 3OTQA 4M9RA 1G5IA 1G20B 5T4FA 2FUG6 1ILWA 2I2AA 2VPXA 1QKIA 3QLJA 5IBCA 2FMHA 4BKUA 4RADA 1C1HA 1THZA 2FP4A 3O5AA 4XX0A 5D5HA 4GL2A 3TPCA 3A28A 1S96A 3PU6A 2ATXA 4C4OA 3FZGA 1Z07A 2RI6A 1NNEA 2QRZA 4C0SA 1B93A 4FWTA 5F2OA 2YWCA 2DKOA 1F12A 2CLKB 3BK2A 3W9UA 1I2CA 3ZWPA 2QN6A 5BSGA 4QX6A 5CB4F 4A03A 3WLLA 3FUCA 2G0AA 4J75A 4QFCA 1J0BA 1TZKA 3BXXA 2OHJA 3R5FA 3F73A 1YR3A 1LI4A 4W8OA 4GYJA 4NCBA 1KSGA 2D8AA 2A5GA 2X5JO 2OAEA 3ESCA 3TTXA 3OAAA 1V71A 1DBRA 1ZXLA 4HFRA 4OBBA 4QUBA 3OWHA 1E5DA 3K0SA 3QA9A 1W93A 5G0UA 2A2ZA 4BGEA 4BP9A 3PT5A 4OQDA 4Y9SA 1D09A 5EZ5A 3EUEA 2F48A 3FA2A 1W4CA 5KSPA 1QAOA 1SQFA 4CL0A 4MUFA 5I47A 1GKLA 3GGCA 2JHPA 3FVVA 4RGBA 3CUEF 3LUPA 4PC6A 5BRNA 3RYFA 3K9FC 2HTEA 4B09A 4UNSA 4G0WA 1ZM2A 5MN4A 1WZNA 3UJ3X 3FKSD 3KQMA 4C7BA 3JAMA 2HRQA 1P44A 1ZH4A 1IBKB 1LDEA 2H92A 3TM4A 3GEMA 4BNJA 1MJ5A 3HLKA 4OYHA 1SBHA 4IDAA 4TT8A 4MVJM 4JBYA 2Q7DA 2XXBA 1UXIA 1ENOA 1O6ZA 3ZDEA 4B43A 2IXGA 2OV3A 3HSSA 1DXHA 3A1CA 5IW8A 1UC5B 2IUUA 4F4DA 3UMMA 3O8QA 2YWFA 4KXMA 1JJVA 1NA5A 3EXG2 3LCUA 3QOXA 4PQEA 3TF5A 2OXEA 2VJMA 1OI4A 2XGSA 4C21A 2Q2WA 3A1EA 2G5TA 1UPUA 1NM5A 4CTNA 4XWGA 3IAM1 2YYSA 1SXJD 3OLWA 4F92B 4GI3A 1TUEA 2FY8A 2N9UA 1DCKA 1KYQA 2AXEA 5B7NA 3QLUA 1E77A 3PJRA 5JS2A 5E4TA 2RBGA 4WW0A 4C30A 5LUAA 4PEVA 4DZTA 1IZ7A 3IVXA 1PX2A 1SXJC 1GZ4A 5JJCA 2O0KA 1LBSA 3WMEA 3EJWA 2GZMA 5JD3A 4UM9D 4E31A 4XLZA 2CCKA 2Y6VA 5HJ5A 3OG9A 1JUDA 2BKVA 2BZGA 4GKAA 4WN9B 4E1VA 4ZHSA 5JAOA 3ZDCA 5AK3A 1BXGB 5EP4A 2QP3A 4B4VA 1A96A 1UJ6A 3M6MD 1YL5A 1N8SA 2BFAA 2VA8A 3IKLA 1RDFA 1YZUA 2Q62A 5AI9A 1CS0B 3OQIB 1KVUA 2JIBA 3LCRA 2D62A 3PL1A 4O2RA 2DFVA 1M6VA 4XZ3A 1V48A 1L5ZA 2O7QA 2PEYA 1GUZA 3GGSA 3NH6A 3ELDA 3GJ8A 3P96A 3TQFA 1MV5A 1DXQA 1T5IA 1DZ3A 1W94A 1WUKS 2B6NA 2C31A 2DWPA 3ETGA 4PHFA 4RKQA 5AK5A 4IHJB 5F3WB 4MVYA 3NCHA 4BX0A 4PO8A 5A7HA 5KNBH 4MDFA 2IHJA 3FR8A 1C3LA 2LCFA 5AXDA 3HCOA 1HDRA 1FNMA 2B78A 1KF0A 3EVNA 3VKVA 1L5YA 1W2WB 1HE3A 3STWA 1JH9A 1KA9H 4WTOA 3GVIA 3SFTA 1ISSA 3BGIA 5GY7A 3TEJA 1DEHA 3Q15C 3T52A 1XZCA 2JFXA 1VDMA 2POCA 2Y3IA 2WTEA 2VLBA 2CUTA 1G9XA 4CI0B 3ILSA 1QC5A 1MV8A 1Z8DA 3HBFA 3OT1A 2GS9A 1ISRA 4O1IA 5TSDA 4EBBA 2TYSB 1FVFA 4O8CA 5K3DA 4E5NA 1Y42X 4BQFA 3TUZC 4JGBA 3RSQA 4P81A 3TCKA 2F8TA 5DLQC 2VQ3A 1XFAA 3G9XA 4YRAA 4YMHA 1W36D 2NP7A 1BWRA 4MX8A 5KYXB 3UNXA 1Z6PA 3FCOA 5I45A 1MENA 1NT4A 5DLDA 2DETA 1R12A 1G5TA 3EVTA 1NZDA 3LC2O 4JP1A 2YNMD 4X20B 1DKQA 2W6QA 4KAJA 4MWCA 3A3KA 2EKQA 3M6UA 2VZ8A 4HKTA 3LGAA 3IAUA 3QPVA 4KGVA 4BMXA 1WRBA 2XLBA 3RS5A 4ER7A 3NHWA 1F51E 1HORA 4RXTA 5F4ZA 1MT3A 1ZD3A 1I80A 1P75A 1Z13A 2RHRA 4LBVA 4MV8A 5EWJB 4H27A 1U9IA 2YNMC 1LVUA 3RSSA 3SYNA 4KYTA 1N2OA 1WQ4A 4MI1A 3V8VA 3LPLA 3WL7A 4AY5A 4DARA 3PE6A 5FAKA 1H9CA 2GESA 1EP3B 3LBAA 3VSBA 3IVMA 3EXEB 4NMMA 4UUNA 4TYNA 1IFXA 2Z08A 1E5TA 4B3XA 1CHDA 3PC7A 3UMRA 3SQWA 1Z2PX 5GIOE 1YE8A 1PFWA 2CNKA 2GZRA 5B4TA 3KK0A 4FNOA 2Q7XA 1CIJA 4IG4A 1KZGB 1FP7A 4RZ2A 3JQQA 1V3VA 3QEJA 4YMSA 4RIFA 1E9RA 2GBIA 1MQSA 4Q3BA 1PVDA 1NX9A 4X1KA 3V2HA 4B40A 3JRXA 3EVBA 3IFSA 1G60A 3MTGA 1IZ0A 4DDUA 3TX2A 2PUCA 2GTPA 2W98A 1MC5A 2IV3A 5DNEA 3A4TA 3IDAA 4AZWA 2BV3A 3M33A 2PWZA 4QVGA 5EZSA 4RY0A 3QBVA 4F6RA 3FHJA 1RYYA 2FX5A 4R1NA 3AKDA 1CUHA 4QOEA 3P2YA 1V5IA 1UBSB 5FR1A 4C5BA 4E6PA 2WYIA 1S9DA 2NQ2C 3COZA 1FMCA 3DLIA 2DTDA 2GBGA 4WOJA 1F8UA 2FFJA 2ZSKA 3LHIA 5HF5A 4FYXA 5DN6D 2IS1A 1SO8A 3S7TA 2VRWA 3IUEA 1OLSB 1IZ9A 2K6GA 2FFAA 3CF0A 4LJKA 3GFQA 5DBHX 3JWJA 4BBAA 4S3MA 5DXFA 2C9OA 3TTVA 1V6SA 1H2YA 3OLVA 1K0UA 1RI5A 2ODAA 4QEKA 3IEIA 5KBYA 1QNFA 1LGYA 3QSGA 4D81A 4YBRA 4YJ3F 2HK6A 4OLBA 5EXDA 3RGWS 5KVAA 3FR7A 1T9ZA 4DIMA 2B4AA 1UFVA 1MD9A 1P4HA 2BOVA 4LQ4A 3LP5A 2V7PA 3IA2A 2EP7A 1HTTA 3G8CA 3PUWA 4KX5A 4XI9A 2PX4A 4Y6PA 4PAGA 3V4ZA 1QLJA 3QKSB 4DZZA 1YTLA 1AQUA 1D2MA 1AHNA 1F17A 1XMXA 2A9JA 2B69A 4ZV9A 3ZGZA 5I4CA 4LZPA 4UQOA 4DNFA 3Q3GE 4K9DA 4LFCB 5ALHA 2FPMA 1ZMBA 3BQMB 4H3VA 2CBXA 1DDGA 4K87A 3PHLA 1B2RA 1LC0A 3FJYA 3UV7A 3K9BA 4TV9B 3WO1A 4IKPA 3THYA 1M3SA 3OE7D 4TL6A 3X1ZA 3CVYA 1DC7A 2D00A 1KVQA 2R96A 1EG2A 3A05A 2MT9A 2HRBA 3GRFA 3HZOA 3T7CA 4HS9A 3L5KA 1YFJA 5A3QA 1E98A 1JDTA 3SYKA 4E5KA 4HTAA 4EG3A 5DP1A 4ZO4A 1V7PC 4PN3A 3WV4A 4I5FA 3RHSA 4JV5B 2EJWA 1R8XA 3DMGA 2J5BA 2QE7D 5AQ1A 4I4TF 1QSGA 1ZIXA 3KAQA 3BIWA 3PL5A 2FN9A 3WK6A 1D2GA 2V0GA 4QG7A 2GTIA 3ZBTA 4Z7NB 4P3XA 4WHMA 2PPVA 4YNBA 2J9YB 2JFGA 2P9TA 1SRQA 3I6IA 1F14A 2CCGA 4JDUA 4DSOA 4I1UA 4E46A 2Z4SA 3DE6X 3PR3A 4RNDB 4XIGS 3W3AD 4QGBA 3UJ8A 5C7YA 3KXLA 3PJGA 4G2TA 4QEZA 2QN9A 1KJIA 3LVFO 3I9FA 4WKCA 4EA8A 1M2HA 5AW0A 3A2LA 1ORRA 2NIPA 3LBIA 2XMPA 4GUAA 4LC9A 2NXJA 4JJ8A 2AUTA 2J9FA 1QYIA 4YAJA 3ZD9A 4NAUA 3MMXA 3ZD8A 5A5DA 4TTJA 2N1BA 2JAUA 3S2GA 4D5GA 5BQ3A 3MB8A 5JSUA 3OQMA 4IKEA 4LDJA 1Q0SA 2ZJBA 4NCNA 4B4UA 2R8OA 4L15A 1QUEA 4C6SA 4NBVA 4W5NA 3CZPA 3R74A 2V7XA 1FUKA 4YBZA 5IVKA 1G21B 1SG9A 3ZCVA 3C87A 3GFTA 1KI1A 4FLFA 4TQAA 4B31A 5KQRA 4MGHA 1BMFD 1UL1X 2F1JA 5KNBA 3IVCA 4IXNA 3ZWWA 1OBHA 3I9V6 2YZKA 3OHPA 3SQNA 2GUWA 4MI3A 5CBPB 3W6UA 3EPHA 1XRPA 3TW4A 1OOEA 4QBKA 1PIWA 1WLSA 1RWMA 1H2ZA 3VJKA 2ZI3A 5CURA 2OHXA 1ZN2A 3LUHA 3IA7A 1BAPA 3J7TA 3K0AB 4PHHA 5CDHA 5DCLA 3B85A 3FWNA 5TDHA 4LXXA 3A3NA 3U7IA 1AQNA 4WI1A 1AQJA 1CZRA 2ZBDA 3NDRA 3SZGA 3I2KA 4IGFA 4DMHA 2AFVA 1SQ0A 2YTZA 1YOVA 5DNAA 2C58A 2BBTA 4LI0A 1RRKA 2C2KA 2R00A 5DNDA 4DN6A 4AW9A 3TNJA 3GUCA 1MNQA 3RSLA 5TGDA 4E2ZA 5AUPB 2PX8A 4HN4B 4J7XA 3O47A 4QYWA 1WD7A 4XVHA 3TLEA 3ZI0A 2AWOA 1ST2A 4ZVOA 3DHNA 2MINB 3GFOA 3KAJA 4YDHB 1PR2A 2GBFA 4L3WA 4ZWNA 3A6GA 5JWOA 3FI9A 2OYCA 1Z5VA 2XUHA 2GJ8A 2IYLD 2QD1A 5IEBA 2ZRBA 2F55A 1DJNA 3IUBA 3HABA 3I5MA 5ALTA 1DDIA 1ZBQA 1UADA 1XZMA 2ZT6A 2X1LA 1YMVA 3USZA 2PUFA 3QV2A 4P3YA 3AR5A 2Q9BA 4TRNA 4JX8A 4DR1B 2ZE5A 1G55A 4BX8A 1DRWA 3ZDRA 2HA4A 3H84A 3T8YA 1AKYA 4ZEVA 1M1YE 1EBUA 4W8GA 3C97A 3W5VA 2VPIA 3LM8A 1AG9A 1W75A 3VZDA 4F4FA 3AU8A 5E9WA 4V02A 2BPOA 4UUOA 3GOHA 4LHVA 3T7DA 3BIOA 3RHFA 4NP6A 1RXYA 1Q91A 3V4OA 5B7QA 2C1ZA 4IUDS 5FV4A 2BTEA 1JG4A 1U9YA 2IEZA 2WHYA 3RVKA 2PA0A 4RTNA 2QI9C 3GLQA 2CLLB 2O57A 4DLZA 1LZLA 3D02A 1C9DB 1CQZA 1W85B 4K86A 4O4JB 1T1SA 4DUZB 1JWBB 2CK3A 3TAUA 4B74A 2V4ZA 1NV9A 4QBHA 5EE1A 3NEYA 1T26A 1J2TA 1RWWA 1Y3AA 1R4NB 4EEZA 4L5IA 4NBTA 4EGCB 2DTEA 3I09A 5L4SA 1Z25A 4PLCA 3OHSX 4D80A 1ODSA 1XDWA 5CVJA 2YKGA 4IBOA 2DERA 4H4CA 2AZDA 2GD6A 1O2DA 5CFMA 3Q8MA 1P4JA 1EBFA 1B1AA 5DN9A 4BN0A 1CCWA 4RH3A 4PZDA 2DQYA 3OOYA 2W2KA 1KJ8A 5E0KB 4DHWA 4ETMA 4NECA 2ERYA 3DNFA 1BW9A 3GPIA 9ABPA 4RWZA 3QVKA 3EVFA 4DA9A 5L40A 2O6LA 5C52B 2V6BA 3W9SA 1TAUA 4XEUA 2H54A 2E21A 2OAQ1 1C3OB 3O21A 5F2EA 3GC6A 4L27A 4UTNA 2A9VA 3SOPA 2PRZA 5CAEA 1DIGA 1GUAA 3GAAA 3HKCA 4K9OA 1JA0A 1FL9A 5DEIA 5D3KA 1QQ6A 5IDVA 3ZDQA 4RPCA 3F47A 4FN4A 2CJWB 4AB1A 1W0JD 3OJXA 5JVDA 4JOSA 2MSEB 5CFZA 1T2NA 1S5PA 2WK1A 1JFFB 1YJXA 3LI2A 3OJFA 4OH1A 4W5QA 1GGFA 2GD1O 1VIDA 4PE5B 1OZGA 4KUHA 2A86A 2N3ZA 3RUAA 4E32A 1W7AA 5HHTA 5IANA 3ZX4A 2B6HA 3GD5A 4Y2UA 1Q0RA 2CVPA 1U0RA 3W5HA 3VZQA 4DV4B 2VTVA 1OWPA 3KQPA 1FDOA 3ORSA 5K8UA 2CNWD 3ZU5A 2ZUEA 3EDOA 2WUFA 2V6GA 3MT9A 3EOZA 4DTIA 2HWUA 1K7FB 2LIPA 1Z4PX 3PGKA 3GPLA 4EAAA 4OHBA 4LCBA 3KSZO 4UULA 1FCJA 3ZDAA 3NOXA 2CT8A 3D0OA 4XQ9A 4GBMA 2IYUA 3A2MA 1YDFA 3INTA 3L06A 4L08A 4NSNA 4P4NA 2C3UA 4JLWA 4R71A 5C4MA 1ZK4A 4D3YA 1EX1A 1G3MA 1P9RA 3R24A 3ANSA 2II6A 1Y1TA 2WUWE 3SF8A 2M9MA 4G0VA 2EDCA 4DKXA 5B6JA 2RGRA 4QREA 3MYYA 3I52A 4NK4A 3AXTA 4O0MA 3EWAA 5TVKA 3I4FA 5L4NA 4C1BA 7REQB 7MHTA 5KB3A 3HCEA 1X70A 4KHZA 4WACA 1XYGA 4P92A 3W04A 4ZVKA 1NQOA 2D1TA 1SKQA 1AQ6A 2B1JA 2QXUA 2GXUA 3KIPA 4O63O 1MC4A 2RK4A 2J08A 4KNYA 1V6AA 1CQIA 1JKIA 1QOPB 2R5FA 3A37A 3G8AA 2ZULA 1UFRA 3MA0A 4HAXA 1SMKA 4KQKA 4YRTA 3C74A 3KPUA 2ZWVA 3WMGA 5B30A 5TQVA 4OREX 1LLQA 4HFMA 4Z3KA 1Z5PA 5DK4A 1LI7A 5TEVA 1T6XA 2Q0QA 4UEJA 3P9XA 1SVIA 4K3VA 4LWPA 4PC7A 4JHLA 5CM2Z 2C7GA 4ZQIA 4ZOLB 5BWMA 5FI5A 1ML3A 1NUSA 2XX3A 1G8FA 4CCYB 2I62A 4UAUA 4UXIA 1YQ9A 3R7WB 4JB2A 2CHFA 1HXHA 2A1TS 3T7SA 3FLAA 3VDQA 5HRCA 4GYWA 3V7NA 4OKNA 1G6OA 4WVFA 4C0HA 4DPMA 3A1NA 4MYCA 3B1FA 4FHCA 4GH5A 4AMBA 2AMJA 5AJYA 1YZVA 4QQNA 1LDYA 2JGDA 3NRJA 2P0YA 4QPDA 2GN4A 3SSNA 3RR2A 4BLPA 4OJYA 3LRTA 4CG1A 3MB5A 2ZJ6A 1ZRNA 3ZIDA 3CRQA 1W88A 1KH2A 3NHYA 1P2DA 4RE6A 5DGCA 3C3AA 4DMRA 2WM9B 4ZCIA 4IEIA 3TG8A 5EHQA 2EIHA 3FPGA 3I2JA 5B58T 2X3UA 2JC3A 4IDHA 5IPFA 4F46A 3ZH9B 5ALGA 3UVEA 3ILYA 5FBLB 2HDOA 5FJIA 5J1TB 4AYWA 1DO2A 2NZVG 3F9CA 4P4SB 4W1RA 2PX2A 2XSZD 3R3WA 3OLQA 4R1UA 4ETNA 2JCGA 3E5NA 1O4WA 5ALKA 5TQ2B 3E22B 2BKXA 4RIGA 1F2TB 1I14A 4NNJA 3IOMA 1UT6A 3MTIA 2PWPA 2GO7A 2PRJA 1NJ1A 1RLTA 3D3WB 1BDJA 1A98A 3IR7A 3S1AB 1F6DA 2OZVA 2WB4A 4I1PA 2GR9A 5ECWA 1USWA 3MTDA 1IUPA 3TR0A 4QUAA 2HJRA 4Q1AA 2XMSA 5GJWC 3K0FB 4GL4A 3TVTA 4BNGA 4DGQA 5TMPA 3L7YA 1R0WA 5JYDA 3ABSB 3MWEB 4KAAA 4LWOA 5B3JC 2OHGA 3BSFA 3DTVD 1HL3A 3RVOA 2IH2A 2NVUA 4UU0A 1JLHA 1POWA 2FW8A 2AEEA 2IEBA 2NNWB 3HCBA 1Y7IA 3O73A 4LS3A 2VQEB 2JLVA 2XUOA 3P9KA 4RVUA 1ZR2A 1BX3A 2XUJA 2JFYA 3WIBA 4LWQA 3I3OA 4WXYB 1N2CA 3LGSA 5DHPA 3PGXA 1IK6A 5K3SA 5CB4A 1ABBA 4A73A 3ROQA 3DZHA 2GHTA 3HUUA 3L0ZA 3OUZA 2RARA 3TEMA 5IT0A 3UC9A 3OOEA 4MINA 3N2ZB 4D6YA 1GGNA 4PLHA 4MCIA 2WIAA 4E21A 2HSEA 1OI2A 3BMQB 4ZVQA 4QXQA 5ARCA 1IVSA 5HQ3A 1UUFA 1E66A 1VRWA 3FWKA 1CSEE 1PEYA 3KAKA 3NBKA 3KB2A 3PF8A 1S02A 3RBAA 1SOVA 3ENWA 2ACVA 3JQFA 3AINA 2PD4A 1SKYB 2H5LA 4YMLA 3FVQA 4XRRA 4MWGA 1K63A 3L8EA 5HRUA 1EUCA 2VAXA 4PLGA 1RQ2A 3LUGA 1W5TA 4CKBB 3IJPA 1TA0A 3PDCA 3PSHA 3TFQA 5I51A 4GPD1 4OX9B 1Y8QB 2JGIA 4ZI5A 1AM4D 1AKEA 3L0DA 2EU8A 4Y2VA 3G2HA 3PEVA 1GU7A 1S89A 4COOA 3MLAA 1B0ZA 4UARA 1XWFA 5FF9A 4EKYA 1Q1QA 5C5IA 3ESQA 3DFFA 2I4NA 1CQWA 1GT91 4IMRA 2UZAA 3Q5EA 5EZYA 3CLKA 4LECA 2JJ1D 4R0VA 4RYDA 1YHYA 2BDEA 4OAPA 1L2TA 3V8NA 5LWQA 4Q21A 2XCTB 1PDOA 2Z6QA 3VDNB 1MG0A 2O52A 4QOJA 1IY2A 2E5WA 1CT9A 4GE0A 5DI9A 3WFZA 1QR6A 3H2BA 1GSIA 1CY4A 4L4ZA 2C20A 4C7JA 4CL8A 2Z2IA 3D7NA 5DWQA 1G8SA 2WOJA 3OE7A 3EPLA 3GJ5A 2WT9A 1CUDA 1EESA 2JHGA 3RVDA 1BE1A 3ACCA 5MN6A 4CM4B 3WB0A 3DR5A 1CRLA 1M73E 3N53A 1M0SA 4P7BA 5SZKB 1A4UA 1NSTA 2OV6A 3LX5A 3JVDA 1ZMRA 5HOQA 1JFTA 4F6LA 4O4JF 4UBJA 3CTMA 4IQFA 1QDUA 1WEHA 2OPBA 4DB4A 4WOPA 2GN9A 3JVVA 2IYEA 1E3DA 2J46A 2I3GA 4BV3A 2QRVB 1YT5A 2LXNA 1R00A 3F71A 3JALB 3O2NA 3OZ7A 1NBAA 3MG9A 4UQPA 5IYZB 4JI1B 5IJ9B 4CF3A 5A9SB 1X1RA 1L5SA 1X7WA 1OTXA 4B85A 4YHBA 3W4JA 4M7OA 1KI8A 4C4YA 4E14A 5JCOA 4H6XA 1JU3A 1JIQA 2FR8C 4EG1A 5JJBA 1EFAA 1PS0A 2HCFA 4A2PA 4B75A 5MHTA 4OP2A 3GRUA 4B80A 4DLSA 4BBJA 4EAQA 4RTRA 2J3DA 2JAPA 3QPWA 1CXZA 2BR3A 1P72A 2FKNA 4B7XA 4IY1A 2LIVA 3DCNA 2OO7A 1GPNA 4F3RA 1P2SA 2YC2C 1EFPB 2R6ZA 2AG0A 2YBEA 2CWWA 3ASZA 4J43A 4X54A 4JQCA 5AW9A 4TLDA 4HXYA 3BTOA 3H5VA 5KMGB 1QP4A 4X3PA 1PUXA 4CMIA 3ICCA 1R7RA 2NYUA 2YS7A 4A91A 3NAGA 3HP4A 4I2NA 4Q3NA 4DLXA 5KVCA 1XEAA 4W4TA 4N47A 5DTEA 3R2JA 3KVVA 3FPJA 4Y98A 4ZK2A 4WLNA 4TTSA 4B2YA 5CLIA 1IDN1 4DCSA 2Q1WA 4L5JA 1TLLA 4RDIA 1QE3A 1Z8NA 3LIPA 5FUXA 1KO5A 4PWZA 2XTMA 3PTAA 4QL3A 1SK8A 3ZW9A 4IYRA 1E0JA 2VR1A 3FHLA 3WGVA 3KR2A 3ONFA 4D4MA 3F8WA 5FOXA 1DAIA 5EP3A 1L1EA 5K2OA 5ITZB 3CZMA 2RH4A 4C4PA 6PFKA 4LOKA 2CJXA 4KQ6A 3WQRA 2FSIA 3PC4A 1EI9A 2PO7A 5T67A 3WYDA 1M2VB 3ZE0B 1KNQA 5HSGA 1K66A 4AZTA 5I7EA 1J5EB 1IDOA 4X65B 1YOBA 2HMWA 4YQFA 4M9SA 3OLYA 4J16A 2PU5A 2QMQA 2XAUA 2B3TA 3L7JA 4IZIA 3ISVA 4HAYA 5HFNA 4EI7A 4CDMA 1W35A 4N7RA 5KSZA 3V5NA 1STOA 2ZSDA 3MSXA 4IQ4A 2G1JA 2O8NA 5ULLA 1S3GA 4EG7A 4MS3A 1W48A 3W8DA 4P7FA 4TL8A 3MZ0A 4G0XA 1VHWA 4C4AA 4DUGD 3T38A 3V7YA 5DW0A 4PCVA 4LVUA 1I0ZA 4QUDA 4EX7A 1A9PA 1SQSA 2HKIA 1E2QA 4XVRA 3ZWVA 4BGVA 3GAMA 3V1KA 3GJ7A 3ENVA 1UBNA 2AOUA 2XF8A 4OXKA 5DCWA 2H4HA 3KL2A 4EI2A 2BZ1A 3GRPA 1I5EA 3ANLA 3FCYA 4DANA 1GUDA 4UTXA 3U56A 1Z88A 3RM3A 1L7EA 3ST7A 1TZBA 3L9XA 4HDRA 3WR5A 4KB5A 3AEKA 1W9HA 1WKBA 1JNYA 1R4MA 3FD8A 1BCSB 4MQEA 4JLDA 4PQYA 2I6FA 5CDSA 1JL3A 2I91A 3QELA 2GF2A 4YRZA 3LG2A 2C4NA 5K3FA 2BEWB 3DH0A 1KMHA 2JLZA 4BECA 4JP2A 1FUIA 3DWFA 1YB5A 3I8OA 3QYFA 4J4HA 5IMBA 1RQRA 1TFRA 4MEAA 4DPKA 3F6PA 1BE8A 4Q24A 3LIIA 5FWXA 3DBHA 1CRPA 1N0IA 4GWGA 4ZOLF 2A9QA 1C4WA 2YV1A 1LH0A 2QEQA 4Z5XA 2GJ4A 2F7SA 2MSLA 2VK8A 4XUDA 5KC9A 3ZDBA 5CPFA 2JW5A 3ZCXA 5KPDA 2XB6A 3D7LA 1OGYA 2XADA 1RJ9A 3M49A 4YGXB 1JBKA 3HB4X 5U4XA 3TB6A 4ADSG 4B3FX 2CLFB 4TUYB 1M7BA 4AKEA 4TKVA 4YJ3A 3UCEA 1MTZA 1XEFA 3I4CA 4NG4A 4YRPA 3AF3A 3U61B 4I3GA 3KU1A 1YCFA 1YS4A 3IUYA 3DD5A 1UZUA 4RMHA 5AHOA 3FNEA 1Z0AA 3P9ZA 4DLLA 1Y9ZA 3UXHA 1LVHA 5AVRA 5KKCA 4O1HA 3HUDA 4QDKA 5AW6A 1Q6YA 3LBFA 1SCBA 1SBCA 2QRUA 3BCSA 1P5JA 4ISBA 4MJ7A 3AO0B 4OGGA 4KL8S 1SCKA 2GCOB 5CMLA 2FV8A 3A4VA 4M49A 1QYCA 3IT2A 3L8DA 3UH0A 4DJAA 3VVCA 4EP1A 5K6AA 5JZMA 1N5LA 3EVEA 4JC5A 4QKQA 2DCUA 1R88A 2WAMA 3L79A 5B1DA 5FFMA 3HV0A 1IXZA 1W73A 3DFUA 2JIQA 3ITEA 2IX9A 4HLUA 2QS9A 3ID6C 1ZN7A 4V24A 5DRYA 4N03A 2BEJA 1LPPA 2ODEA 1Y7LA 1ODIA 1DCTA 1Z73A 4RLSA 2VJYA 3MRXA 5E6RB 1QIHA 4F06A 4KX3A 1GL6A 4JUDX 4XD2A 1SC1A 5GZ1A 3OJWA 1JFLA 1CUYA 3JATB 2YJ5A 4P5PA 2ET6A 5FOQA 3G0HA 3UJAA 1G20A 3FAZA 3LY9A 2G9VA 2IXBA 4KXWA 4I4TA 5E3JA 4NDNE 5PGMA 4A6EA 2D0OB 2ZROA 2VA9A 1BHSA 3MILA 3OBBA 3U3KA 4EFKA 3PUJA 2H1IA 1EWKA 4UE2A 1RWOA 2VATA 3U7QB 1UT8A 1I9CA 2ZBQA 3B1JA 2H5JA 4MQLA 1FMFA 2ZRPA 3UMFA 4AWBA 1FLVA 4HWPA 3VYUB 3S1LA 3UK0A 4A8JA 4MI9A 2YJTD 3QWAA 1XDDA 5FWAA 5G02A 3T7AA 1A0OA 3H6KA 2ZSEA 1LY1A 4FGKA 3MM4A 3LKDA 3OF5A 4R8SA 3EUWA 1FU4A 3JQ9C 2G72A 3HVJA 3HJBA 3QNUA 4Q1VA 3N28A 2O3QA 2DLNA 3E8MA 2GNAA 1P77A 5CT6A 4QXMA 5B1SA 1OVGA 1CNFA 2VZ0A 2JIZD 1SC3A 3DL0A 4G2NA 4QIHA 2VXCA 5E4FA 3G9ZA 5LYYA 5FWDA 1CY6A 2YJ4A 4PRLA 5E7MA 4IKOA 4NU8X 1AB6A 4F96A 1YFKA 2G88A 3EHEA 3ZGYA 4YP1A 2YZGA 1AUQA 1U28C 3HDJA 2PUDA 3KL4A 2VH1A 3JASA 4NOKA 1QPBA 3ZHOA 5AI4A 1E2UA 1YJCA 3O92A 4TQGA 5DTMA 5G0VA 1GSHA 4B3CA 1XQ6A 2BI8A 1WBJB 3TCXB 4QNNA 3NDJA 2O2JA 2CLSA 1TD9A 2Z5FA 2W7TA 3GFPA 4I55B 4KLRA 4CG2A 3CINA 5IC4A 4KFCA 3SR4A 1QZUA 3R5XA 3SX4A 3EH1A 3WA6A 1OJ7A 2SCUB 1DC3A 1LLDA 3K0CA 4Q7MB 3PIRA 2NO1A 1DDOA 4RNCA 5FADA 2EX1A 1Y33E 2Q4EA 4PYNA 3UGKA 3HLTA 3WNBA 3ZLJA 3M6LA 2D5AA 5F9MA 2FYTA 1HLGA 1L5LA 2RDMA 1W0KA 5AVVA 1E6UA 2P2CA 2FFBA 2F17A 3SJAA 4AG5A 5LU9A 1Z7EA 2M6RA 1XLTC 5JR3A 2UVDA 1FP4A 3C45A 4BQEA 2DY1A 3LC7O 1XVLA 2R97A 1QG0A 4BLQA 4BNKA 1NFQA 4ZHQB 5L6LB 2VP5A 4JIGA 2O5EA 3KDPA 1AN0A 2ST1A 1T3TA 3GBPA 3BGVA 4OXYA 1E9VA 2JEOA 3E7PA 4Y6RA 4CKEB 1JIKA 2O1WA 2Z56A 4YJFB 1XK6A 4CQMA 4GI2A 4DLBA 4IIVA 1GRNA 1KJQA 5HJEA 1R0XA 1M76A 1M6WA 4WXHA 3EVCA 1KXJA 2DAPA 4UM9B 1PD0A 1TUIA 4MRVA 1MB0A 3NHFA 4FCTA 3RGGA 3UGTA 4BNVA 4YLYA 4R2JA 2W2PA 5EHIA 3ZNOA 4PLFA 1Y4SA 3F7OA 5JJKA 1MO3A 4IZOA 4OK6A 2C54A 5A04A 1YJAA 1AD2A 1IHUA 4WN9A 3PFBA 2AUNA 4KR3A 3HUFA 1BXGA 1FVHA 3HACA 4GI5A 4MAMA 5LJIA 5LOVA 1ZUNB 2Y4OA 3U9SA 1J5XA 1I51A 4ND2A 4BFZA 2PGLA 4NV3A 4W5OA 4E3WA 4E5PA 2ASVA 5B4VA 3W5BA 2PZLA 2EEPA 2XI4A 3RARA 2XVAA 3CJRA 2EGUA 4JA0A 4Q4HB 1YS1X 2X7HA 5DYIA 1T5OA 4G85A 3HBMA 1GILA 1WUYA 1H6AA 1WSBA 4BKMA 4DMCA 3BTSA 3NHAA 4QYIA 3EGEA 5EHZA 3UWDA 5K0EA 3GVPA 1GHTA 4FT2A 2GAOA 3B1ZA 2WKSA 3E27A 1R8YA 1V41E 3CGWA 4YCCA 3OQOA 2FUG1 3R0QA 4L8YA 1N6RA 4A0HA 2EWMA 2B36A 3FSEA 4YUWA 1XD9A 3NYWA 4K6MA 1I2DA 3T1HB 1J8VA 1GG8A 3DTVA 3ZWBA 4MVJE 4R1LA 4Q3EA 4TMYA 4CMEA 4Q18A 1DV1A 1S3FA 3AKZA 4YWJA 2BFFB 1HY3A 4B8YA 1XA0A 2MYUA 2QMEA 1U1FA 3H87A 3CVUA 5ED4A 4ICIA 5A6VA 4A7PA 4UBOA 5J9FA 3V4FA 1DHTA 1DADA 1A9RA 3L0IB 2IUEA 2CJYA 4MQFB 2OO5C 2XQFA 3B53X 3BJEA 3C6ZA 4JLBA 4LX0A 4YUZA 5H0IA 2YHBA 1H2BA 4ENSA 1J0DA 2XYQA 3EDYA 3DE5X 2DFKB 3LUJA 3M6FA 1RRPA 3O4JA 4KQMA 4N49A 5JDCC 1KYYA 1T0PA 5KYXA 1QJCA 5IC5A 1C0IA 4AUKA 3ZNQA 5DNYB 3JQBA 4FOSA 5EERA 2CUZA 2DPGA 4KQFA 3WMWA 5F98A 3LT0A 1T8TA 2IL1A 3UBMA 5F7OA 4EEXA 2EBUA 3VHQA 3QFCA 4E88A 3NX4A 1HL7A 3KFVA 1QK4A 4MDHA 3L6RA 4IDPA 5AI6A 5ALUA 1K75A 2FN7A 3WIUA 1QHFA 4BOYA 3FYHA 1UJMA 4A5OA 4OB8A 3O1HB 1Z4IA 3ONEA 2OZEA 4BYMA 3KWFA 2YY7A 4NULA 5EWJA 3LH5A 4PWYA 2XXAB 4TM8A 3AIMA 2IGBA 3GPDG 4ZCTA 3QUAA 4RDXA 3ORQA 2P9YA 3U3JA 4W7SA 1NHGA 3ZHBA 1PNQA 4L9SA 3V1UA 5JNRA 1MQ8B 2QR2A 4EJ2A 3RUPA 2G1AA 3L5OA 1C7ZA 1FNDA 3EZNA 1SWVA 1U8FO 3AP2A 3Q5DA 4JLMA 4RK0A 4FPXA 4PBRA 3E7DA 3AVQA 1EGMB 1WCXA 1JAXA 1ECFA 1Y3CE 2IZ0A 3QA3E 1OA1A 3ZJ5A 4EECA 2ZSHA 4L0DA 4M9QA 2QTHA 3AHFA 2X8BA 3MGCA 5F35A 3SGLA 3T94A 2O1XA 3MJDA 2CXSA 4O8ZA 4F71A 4KNWA 5D6OA 4CM7A 4B17A 3ZCSA 4D92A 5JYBA 3F46A 3IT1A 3THRA 5FTKA 3OD1A 1P62B 1NDQA 2RB4A 4IDDA 4BJ6A 1YI1A 2OBXA 5B4UA 1WTAA 5FOTA 5FUYA 4P98A 1GFSA 4BATA 1SA0B 2C95A 3IODA 4OH7A 1X6VA 3DXXA 1KY4A 4YN3A 5GONF 2AX3A 2GMWA 4WAUA 4ZAFA 5JNVA 3DAGA 1UMDB 1W4RA 1NWHA 3IE0A 3QVXA 1X8XA 3U3XA 3WGUA 5TXGA 4ZK6A 5IABA 5L53A 1DAEA 1VXOA 2F3RA 1O9BA 1OLSA 5ESRA 3KOYA 4KREA 1EE1A 3BG5A 2OFOA 3HXTA 4RJLA 4FOLA 4TUYF 4II3A 5EJ6A 2ZG6A 2WA1A 3NTLA 3Q8WA 4Z1MD 2FTKE 3HADA 1KEEA 4UDYX 2FPWA 3IBGA 2OM6A 2WKQA 2YXPX 2OOKA 3NBAA 1RQNA 4IDBA 1RI1A 521PA 1Z7YA 1W5FA 3GL9A 4G1MB 4G8DA 3WKDA 4YV2A 2D1SA 4DPLA 1T9CA 5SY9A 1NYLA 1ZW6A 3ZCRA 1Y5RA 4JVLA 2JBAB 3MEQA 1YV9A 2A14A 4IR7A 4PONA 4WFJA 3SZLA 3UT5B 4BVHA 4RZSA 3U31A 5KWSA 1VLVA 2O3JA 4WH0A 2XB9A 4WESB 1RYDA 1VPWA 1T5TA 2VBGA 4HDNA 2YC4C 1CNMA 2PZMA 3IAXA 4WLUA 2I6QA 5T7BA 2WF6A 4IXMA 4U00A 1ZNWA 3PNQA 1FDSA 5AWFC 1LJUA 3FZQA 1L8QA 4GG1A 2LPMA 2DRIA 5C35A 5JCXA 1R10A 3R3JA 2YRFA 3BE4A 3R7BA 1RKVA 2LKDA 3H4VA 3C3XA 5CVEA 1Z8FA 4MQMA 4B48A 3J81k 4N6OA 2Y76A 4U7HA 3U6KA 1BS1A 2EV9A 1PQUA 4YP9A 1JLRA 2IE0A 1AKVA 1U0HC 4IW3B 4YO7A 3U9TA 3ZV4A 3HEAA 1WY5A 4GXTA 4MEBA 5J40A 1OZFA 1NBME 2FQYA 3DAOA 2IODA 3ZTYA 1XPJA 1C8VB 1A88A 3OZCA 4F4IA 4ZDWA 1PR5A 4CL3A 3NDPA 2C0CA 4Q4JA 4QVIA 4N3NA 4JJKA 3IIIA 1KDTA 3M5PA 3LC1O 1JRLA 1P6XA 2L18A 3WSVA 3KHTA 1JS1X 1IEVA 1L0BA 3OJ0A 3LPMA 4D3FA 5TGTA 1ES9A 4J4TA 3OJCA 3LYUA 4KQEA 1L7VC 4CT5A 1EVYA 4E5MA 3KU4A 1ZNXA 1MAWA 2Q8NA 3NATA 4P9NA 5CLHA 3UH1A 4C0XA 2QT0A 3EZXA 3FYDA 2HLHA 3FDIA 2WJIA 3QI7A 1QJ4A 1YR2A 3QG1A 2AK2A 2HHLA 2B4YA 3QQPA 1SGWA 1TK2A 4N6GA 4RVNA 3OCXA 2R1TB 4ACBA 3PA6A 4XIIA 4LOIA 1IHOA 3A9SA 2OESA 1NOKA 1GPMA 1JP7A 1Q19A 4Q02A 4AJPA 4AVYA 4EY4A 3BMXA 6GPBA 4AKGA 1E99A 2VFAA 2AKYA 3CW2A 3G7SA 1Z4LA 4UBLA 4F2GA 6ADHA 1VIYA 2I2CA 3JWGA 4FXOA 4IQ0A 2QW8A 2WM3A 4U6SA 3INNA 4GQIA 1CFJA 3EVGA 5DHRA 3X2SA 5FUMA 3CKLA 3WBJA 4YROA 2Q3BA 3B2EA 4NF2A 1Z5UA 4I55F 5CBPA 3E9MA 3ZGVA 1VPDA 3SC4A 5T41A 3DYIA 1GRRA 4CIBA 3R5KA 5CHYA 5HVNA 2LP4Y 4FX2A 1EQ2A 3GLHE 1J00A 2QR3A 3K0AA 3B9RA 3PXAA 4KV7A 4TS3A 4XSHA 1XAHA 4G5XA 3W1EA 3QKWA 1HWYA 4FYVA 2GXSA 2YICA 3I6YA 2VRCD 5IDYA 3MUOA 2KWIA 2V7VA 3HVRA 4QGAA 2N47A 2ZI9A 5A05A 3VC3A 2M6LA 2HRZA 5JV5A 3HWX1 1Z18A 2FOIA 2I1LA 2O3UA 3BICA 3PNBA 3PZRA 4J7CA 4P80A 4XD7D 1CPYA 1CYEA 3FGPA 4MQBA 5JE8A 3V7UA 3VPDA 3WLOA 4J49A 2GB4A 1EFRA 2NO7A 3TLMA 5K8VA 1L4NA 1N6HA 1N9KA 3DLCA 1U6KA 3BXGA 2PS1A 4D8TA 2PPLA 1EHCA 1PFUA 1RRVA 2FU5C 2SKCA 4YS6A 5ALIA 2D0DA 3FUUA 4OOFA 4BFCA 3FYUC 3IEMA 2D1YA 2OL4A 3B1YA 4WXMA 4F4CA 1DRJA 1OH7A 4BL5A 5EMKA 1BGVA 4U2GA 4ZEWA 3CVJA 1QQBA 2G1KA 2WIKA 4PC3A 2QSJA 4BWFB 4U2DA 1Z15A 3IEXA 1NXVA 1YR7A 1NW8A 2EHDA 4M87A 4QGFA 3ZK8A 2XV1A 5G0WA 4BFSA 2FWBA 2RK6A 3ESDA 2FSVC 2Y1KA 3HRIA 2G67A 1RLJA 5ALSA 1M34A 3FWZA 4OUKX 1E4OA 5J4LA 3HPRA 5KJ1A 3C4QA 2V74B 1SXIA 3Q12A 3ROXA 2OECA 2FG7C 4IF6A 1KDOA 2FX2A 3SE7A 1NAHA 1EG7A 1X87A 3OTWA 5E9AA 1LBHA 5JAIA 2VNSA 3CPJB 4TXHA 1V9SA 4KWCA 4XDGA 1D2EA 2GK6A 2OWEA 2ZAGA 1EIZA 3M4NA 5AVWA 1N5IA 1PT7A 4O4JA 1W85A 1FDIA 2WV7A 3OMLA 721PA 2AXPA 2F3TA 4GSLA 1RKBA 1VA5A 2PYZA 1M7HA 4MS4B 1DOAA 5IARA 5CA0B 1GPJA 2GPAA 1B23P 4IF4A 4BMOB 1R4NA 1B26A 4YA6A 1K0FA 1RVDA 2CXOA 1JR2A 4PBSA 5HF9A 4O08A 1DARA 2MIIA 1WLYA 1Y3FE 2BW0A 2Q3MA 1H93A 2IPLA 4RLFA 1ODCA 1RBZA 2VSFA 4IDOA 2P5YA 2X2OA 4FHZA 1BHJA 3P9SA 3RV4A 1UZAA 4US2R 1HH4A 4CCSA 1OD6A 4WEOA 1AMOA 2I8LA 2NYRA 4S1NA 2BMAA 4FZRA 4QYTA 1YQQA 3GQBA 1ZLYA 4LRWA 1Y6ZA 4MRPA 1EVLA 4LMPA 2Q1SA 4P4TA 1GU1A 1YONA 4CM5A 4MITA 1M8JA 1KQ3A 1A5AB 1II8B 4XDYA 4DOMA 2DHDA 3RRJA 2PBLA 2FI1A 1X19A 2FEXA 3H8JA 3GP3A 5AVXA 3AEYA 1C3OA 4IV5A 2FUKA 1I7PA 1H3EA 4F2WA 3GUUA 1FYVA 3KQWA 3ZOKA 5CEJA 3FDJA 3F8TA 4Q9LA 3TIVA 3T41A 1VLMA 1GDTA