4N4IA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.3k36me3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
192
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDLVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 65
structure length 192
sequence length 211
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4iA02
3H6ZA 2PQWA 2DVRA 3OQ5A 3DWYA 2DKWA 4YYGA 5FE7A 5D7XA 2R5AA 4IOOA 2RNYA 5CY9A 1OZ2A 4GPJA 3OS2A 4C5HA 5FB0A 2LVMA 2RO0A 2DWWA 4Z1QA 4TT6A 3MUKA 1WUGA 4O7BA 5A7CA 4Q0OA 3TLPA 5IGNA 4WIVA 5F60A 4TQNA 5TB6A 3OYIA 4KV4A 2DVQA 4QC1A 3P1EA 5IGKA 2DIGA 5DFDA 5ENFA 3UVYA 4XUBA 5CUCA 4YYJA 5C7NA 4CUQA 4QYDA 3DB3A 2GFUA 5EPBA 5FH6A 4BHWA 4YAXA 3S91A 2LDMA 5D3LA 4MR4A 4ZQLA 2YRVA 5E9VA 3OYMA 4BACA 4HXMA 5CUDA 5EQ1A 4TT2A 5I7XA 4ALGA 5EICA 5I80A 4OGJA 2RJDA 5FG4A 4GY5A 4LR6A 4YC9A 4O76A 5CUGA 4Z6IA 5IGLA 5LVQA 2LTOA 3ASKA 3LLRA 3LQHA 4C5EA 4HXPA 2DIQA 1E6IA 5CUAA 5HEMA 4CUSA 4IR5A 4A4EA 4A4GA 3AQAA 3JVLA 5DFCA 5KE3A 5FH7A 2QQSA 4NR6A 5COIA 2E7NA 4X2IA 3UV4A 5I1QA 3HMHA 2YW5A 5EWDA 3O34A 3U5LA 4QSPA 2RNWA 3PMIA 3U5JA 4CURA 2MJVB 4O7FA 5D0CA 5D3RA 4IUPA 1XNIA 2M0OA 2E7OA 3P1CA 5A82A 5DKDA 2YELA 1G5VA 4A9NA 1EQFA 4IR3A 5CRZA 4BW3A 3MULA 5A5RA 2F6NA 5C6SA 5HLSA 4Z1SA 4QB3A 5CUEA 3U5MA 2R5MA 3H8ZA 3QKJA 5IIDA 4QC3A 2CKKA 4L59A 1N72A 4BDZA 5CFWA 2N9GA 4J3IA 4O71A 5CQ4A 2R0VA 4PKLA 3UV5A 2E5QA 3OS0A 5EWWA 4A9KA 4QSWA 5E7DA 5HQ6A 5KTUA 5CQ3A 4MEPA 3NTIA 3PMTA 3OY9A 2RI3A 5FE2A 5D26A 5FFWA 5L99A 3P1FA 5I88A 2JTFA 2I8NA 4NS5A 4HBWA 5DFBA 1SSFA 4E96A 4Z02A 3O36A 4NQMA 4RG2A 5A5OA 5DYAA 5C8GA 5HM0A 2WACA 2DVVA 5HFRA 4HXLA 3S92A 3OYNA 3SVFA 3OMGA 3LGLA 5CTLA 4YADA 4C67A 4NQNA 1KHCA 5DYUA 2O4XB 5FROA 1WJQA 5LKXA 5D3HA 5DYCA 4HBVA 2EQMA 4YY6A 3EAEA 4A9LA 2D82A 4YY4A 5ENIA 4B9XA 5AD2A 3FKMX 5FE5A 4ZTJA 4BW1A 3E9FA 5KCOA 3L42A 4E7LA 2LRQA 5FE6A 4ALHA 2OUOA 4NYXA 5HENA 4CUTA 2QQRA 5KTXA 4UYDA 4WHUA 2X4XA 2K3YA 3UVWA 5LKUA 5KE2A 5F61A 4QZSA 4A9EA 5K29A 4LC2A 2BUDA 4YH4A 4O72A 4QR3A 2F6JA 4NUEA 4O7AA 4QUUA 4TS8A 3MEAA 5TCMA 5JI8A 5IG6A 4PY6A 5EV9A 2VYTA 3MEUA 4NR5A 2F5KA 3QBYA 4WHWA 5LJ1A 4YABA 4YYIA 2FHDA 3FLGA 4QY4A 4UYFB 5ENCA 1H3ZA 5HRVA 2R58A 2RJFA 5EPRA 5ENEA 4YATA 3S3NA 4MEQA 4UIZA 5HQ7A 2RJEA 3MQMA 2YDWA 5LVRA 5F36A 3JVJA 4HXOA 3E9GA 2D9EA 3O35A 5EM3A 1RI0A 4IKFA 5EVAA 4B9WA 4A9FA 4LD6A 3SVGA 5DLXA 5FRNA 2JZ2A 5L8TA 2X4WA 5KU3A 1ZS5A 3QJ6A 5JWMA 2YYNA 5CU8A 2NLUA 3NTKA 4FU6A 4Y03A 4NR7A 5J39A 4UYHA 5BT3A 1OI1A 5E73A 3NXBA 4Q5WA 2G4AA 5ENGA 4LYIA 4QSUA 3OYEA 5HJCA 3D7CA 4XYAA 3Q1JA 5EISA 5CZGA 2RFJA 5FFVA 3O37A 1OYXA 4KCXA 4II1A 4YBTA 5FRMA 5FH8A 5L97A 4NYWA 5H1VA 2EFIA 2NXBA 3NTHA 5J26A 5FFYA 4IR4A 4TU6A 4O78A 2OSSA 5C87A 2P0KA 3HMEA 1WJSA 4QQGA 5DBMA 4HBXA 3LQIA 3MP1A 2YEKA 4N3WA 5I40A 4UIYA 5CRMA 4IUTA 2RI5A 4BDYA 3DLMA 5A5SA 4IUUA 5E9KA 5FE3A 2GF7A 1WUMA 5DX4A 4J0RA 5EWHA 5CQTA 2L3RA 4LZ2A 3MB4A 4A4FA 3MP6A 4QSRA 4FL6A 3L2VA 2M1HA 5KO4A 2M16A 4UIXA 3UT1A 4LRGA 5D3PA 3UVXA 2DAQA 2X35A 4NR4A 5E9YA 3SD4A 2L5EA 4E7KA 3Q2EA 3S3MA 5CUBA 5ETDA 4NXJA 3P1DA 5F3AA 4QW2A 2L85A 5C4QA 3MP8A 3U5PA 4O7CA 2RHYA 3BDLA 4KV1A 5C0MA 4TT4A 4O77A 5FE0A 2BKDN 4HXSA 5I7YA 4LYWA 3OYJA 4PCIA 2BIVA 5CQ6A 1OZ3A 2RS9B 4J0SA 5KTWA 2R10A 5DKHA 3MB3A 4UIVA 3U5KA 5L98A 2O4XA 2HQEA 5FE1A 4O70A 4NR9A 3AADA 5FE9A 4Z93A 3FDRA 5DYXA 3LQJA 3LJWA 4N4IA 4YYDA 4DONA 4YYNA 3MO8A 2HQXA 4QEVA 3FC3A 4QSXA 5D25A 2GFAA 2K3XA 4N4GA 3QZSA 4LDFA 4HXRA 2MWOA 4NUDA 2B8AA 3HMFA 5FB1A 4TZ8A 5KH6A 4PTBA 4N4FA 4HXKA 1MHNA 4OGIA 4QVZA 2YEMA 5HELA 5II1A 4QR5A 5D6XA 5F1HA 5D3JA 4OVAA 4E7HA 4FLPA 3UV2A 4QQDA 4UC4A 2E6NA 3P8DA 5E0RA 2RHZA 5DW2A 4BE1A 4IURA 4QSVA 4BJXA 4LZRA 3DB4A 5E74A 4NRCA 4EDUA 5ACYA 2E3KA 2EKOA 5EWCA 4UYFA 5E9LA 4Q0NA 2G3RA 4HBYA 1JM4B 1X0JA 3S3OA 5HCLA 4CL9A 3L2RA 4PS5A 5E3GA 4QSTA 5HQ5A 4NUCA 5CPEA 5EA1A 1JSPB 2LSPB 5DLZA 4IUVA 4ZTFA 5J0DA 5HRWA 3S6WA 5ENBA 2L84A 5KHMA 5CQAA 3IU5A 3IU6A 4QR4A 5CQ8A 5A5NA 2R57A 3KUFA 5F2PA 3QZTA 4MR3A 2LCCA 4XY8A 4Z6HA 5AMFA 2R0SA 5F5ZA 1N27A 4CRIA 4X34A 3UWNA 5EK9A 2FSAA 2RHUA 3QZVA 3MEVA 4IR6A 3I3JA 4QEUA 2RHIA 4YYHA 4CUPA 2YQDA 4O74A 4ZW1A 4BW2A 4LYSA 4IORA 5EU1A 5A5PA 3O8VA 3PNWC 5D6WA 4CLBA 4CFKA 4MR6A 2DVSA 1WJRA 3OYCA 5HRXA 2EQJA 3LXJA 3OMCA 3UW9A 4C5IA 4MEOA 4O75A 5D3SA 3LGFA 5H1UA 5I83A 5EGUA 4MR5A 3Q2FA 3LX7A 3LH0A 5ENHA 3P5OA 4C5GA 4YK0A 3U5OA 5FG6A 5A85A 4OUFA 5D24A 5IBNA 2DATA 5BT5A 4XUAA 5F1LA 3RCWA 4F3IA 3LYIA 3OYAA 2XDPA 4YH3A 5DY7A 3F70A 4TU4A 4A9HA 4QNSA 5H1TA 4YBMA 5I86A 5E9IA 4C66A 3SVHA 5ETBA 4E7IA 3U5NA 3OYKA 2WP2A 3ZYUA 4QQ6A 5IAYA 4RVRA 4ZC9A 5E9MA 4QSSA 4BW4A 2RI2A 4A4HA 3L2QA 2EQKA 2D9TA 3L2UA 4J1PA 4A9MA 3PFSA 3OYGA 4PLIA 2GRCA 3O33A 4UYEA 3OYFA 3M9QA 3ME9A 5AD3A 3OYDA 5E3DA 5A5QA 2L8DA 3G0LA 5II2A 4QUTA 5LKZA 4HCZA 5EI4A 2RI7A 2IG0A 5LKTA 1F68A 5DKCA 3C4SA 5HFQA 4TYLA 4A9OA 3JVMA 5ENJA 2R0YA 4YYMA 2MWPA 4NR8A 3OB9A 3GOXA 4MENA 3K2JA 5FE8A 5CGPA 3G0JA 4PLLA 4UITA 4BD3A 5DW1A 5CQ7A 4UYGA 2I7KA 4TZ2A 4CUUA 3MXFA 5CIUA 4BE2A 4NRAA 5LJ2A 5G4RA 4N4HA 5H85A 4QEWA 3UVDA 4QSQA 4YYKA 2OO1A 5CS8A 5LJ0A 2RNXA 4NYVA 4QYLA 4TTEA 4XY9A 5M9OA 3QIIA 2X4YA 5CQ5A 5FE4A 4QBMA 5I29A 2L89A 3OS1A 2EQUA 3FEOA 4A9JA 3GG3A 5I89A 3ZEHA 3OYHA 5L96A 3JVKA 5EPSA 5F63A 4BE0A 5FG5A 5BT4A 3DAIA 5C85A 5IGMA 4O7EA 5D6YA 5F25A 5A81A 4AKNA 2H60A 4PL6A 5AMEA 4IUQA 5D3NA 4HXNA 4YBSA 5G4SA 3OYLA 5L8UA 2XK0A 2RJCA 3P8HA 5KCHA 4LZSA 5EP7A 5FBXA 3OYBA 4E7JA 4PCEA 2WP1A 2KTBB 3ONIA 4UIWA 5CP5A 5EWVA 4UIUA 4A9IA 3CEYA 5C89A 5LUUA 5A83A 1WGSA 4CFLA 4NRBA 3OA6A 5FDZA 4IOQA 2RO1A 3META 2RHXA 3L2WA 5F62A 3MEWA 5IN1A 5D3TA
chains in the Genus database with same CATH superfamily
4J6XA 1VQNQ 2DVRA 1D1AA 1MV0B 3CCEA 1B3QA 4AKHA 5CK9A 3GP8A 2FL7A 1UGVA 2P84A 4C5HA 2RO0A 4C92C 1P92A 4TT6A 2DZCA 2HEQA 4OGEA 1TTHB 1X27A 3TLPA 5IGNA 2AZSA 5AT1B 1VQKT 2FG0A 5DLOA 5LJ5j 2KAFA 3UATA 2DVQA 4DBFA 1QVFA 5IGKA 1X75C 2DIGA 5ENFA 4M7DC 3JCMJ 2V1RA 2X3WD 5C7NA 4CUQA 4QYDA 4OMPA 4RCBA 1D0YA 5FH6A 3RERA 2KRNA 4B6MA 4C8QA 1QKXA 3S91A 2EYXA 4J9DA 2LDMA 2JXBA 1VQLT 5E9VA 3OYMA 3URGA 1M1KU 2YDLA 5CUDA 3BY7A 5GANj 4TT2A 4M75E 3GBQA 5I80A 4OGJA 2RJDA 4C8QG 4LR6A 2FB7A 5CUGA 4Z6IA 2I2LA 1X6BA 3ASKA 2D6FA 4LDWA 3I55A 2KVQG 2DIQA 1E6IA 5HEMA 4CUSA 2PZ1A 2CYZB 1BI1A 4ZGEB 5FH7A 1T0HA 4AI6A 1E6HA 4XTYA 1Y71A 2HKQB 3RMSA 3CC7T 2DD5A 3GIBA 5KYYA 3TEEA 2NUTA 2RNWA 3DKMA 2DFUA 4CURA 2EGAA 5D0CA 2MOXA 1TSFA 3TREA 1B34B 2YELA 2KXCA 5GAN6 1FMWA 3HRUA 1VQ6A 4OMMA 1I1JA 3T9NA 2CZ7B 4M7AB 3MULA 1MMNA 3HTRA 1W2BS 5CUEA 2R5MA 5IIDA 2EWNA 1IHWA 5CFWA 4O71A 3QUIA 2MCNA 3PIPA 3OS0A 5EWWA 4A9KA 3QHSA 1F1BB 5HQ6A 4L6V5 4LNPA 5KTUA 3JB9G 1YCSB 1C1AA 2ZPHB 3NTIA 3PMTA 4JZ3A 4XU1A 1M1KR 2QQAA 2NUPA 2RI3A 5D26A 5FFWA 4ELYC 2EIFA 1TUDA 2WSCE 4X1VA 5DFBA 1SSFA 4E96A 4BI3A 3EH2A 4Z02A 3O36A 2RK1A 2LCLA 4KH1B 5LJ5e 4JUVA 2CP2A 3CD6Q 1QCFA 3SVFA 3OMGA 2J6KA 3M53A 5GAOr 3SWNA 1TU0B 2EQMA 4O6JA 3EAEA 2AT1B 4YY4A 2RK2A 4DEYA 1Q81C 5GAN3 1G3YA 1WDXA 5GANe 3QO3A 3EFOA 1YHQT 1VQKQ 4LDXA 4C92A 2LRQA 4ALHA 1OEBA 1WQWA 5HENA 3RBBB 5KYUA 4UYDA 4WHUA 3UVWA 4E7ZA 5F61A 5GMKj 1MMAA 1KK7A 2FRYA 2BUDA 4C8QD 4C92G 4MMKA 1K8AC 4O72A 2KGTA 3M57A 1VQLQ 5FLXE 2VYTA 4NR5A 2QEXA 2F5KA 1TOVA 5LJ1A 3M55A 4QY4A 4M7DG 1MMGA 5ENEA 4OB3B 8ATCB 2FVUA 4M77B 4JRQA 2P0QA 4MEQA 4UIZA 1C0MA 2RJEA 3C0CA 2VXFA 5LJ5f 5EVAA 3U23A 4LD6A 3UDCA 1KC8C 1UJYA 4J9GA 5KU3A 2ABLA 3QJ6A 1SRLA 3EFRA 5JWMA 4MDWA 3I5RA 1IRXA 1NYGA 3NTKA 2KQWA 5GMKi 2HSPA 5E73A 1RAFB 5LJ5d 2FPEA 4LYIA 5ECAA 3OYEA 3D7CA 1MNDA 5GANf 2XKOC 3X24B 1OYXA 3JB9D 4YBTA 1I81A 4XU0A 3REBB 5LJ5g 1SRMA 1PKSA 1NEGA 5FFYA 5HY6A 3THKA 3JCMb 3NFCA 4JJNK 4M75B 9ATCB 4QQGA 1YNZA 5GANd 4RCCA 1QQJA 3ZL7C 5LJ3e 4CC2A 4HVWA 1SHGA 5CRMA 2RI5A 3OBYA 2YRDA 3TCJA 1WUMA 5DX4A 3EGDA 1K8AR 5GANg 1RAEB 3CCVT 1JEGA 2F5TX 1AWOA 1WQ7A 2M1HA 3E2UA 3CPWP 5D3PA 2Y90A 1AWWA 2C0IA 2GTJA 3CPWA 5J3BA 3A8HB 3S3MA 5GMKe 4NXJA 5F3AA 5C4QA 4FSSA 3MP8A 4O7CA 2RHYA 2YSQA 4KV1A 5C0MA 4O77A 3CBPA 1NPRA 2DL4A 4WCIA 4C92D 1N6AA 4LDYA 3CCMT 2RS9B 2DL8A 1YJNQ 4Z88A 1G8XA 2C06A 3INZA 2GBQA 1M3BA 5FE1A 4NR9A 1UHCA 1YJWT 2QASA 2KK4A 1Q95G 2V8KA 4J6WA 1M3CA 4F17A 4N4IA 4C0DC 4QEVA 4M78A 3GF5A 2NWMA 3QZSA 3VS5A 4HXRA 1GL5A 1Y0MA 5KH6A 1PHTA 3FJPA 1ZLMA 2KE9A 2PUOB 1VQ9A 3EFSA 2QQ9A 2CGHA 3JCMP 1CKBA 4HVVA 1YITT 5F1HA 5D3JA 5A0DA 2E6NA 3P8DA 4ORZA 2RHZA 4BE1A 1Y7XA 3DB4A 2GQIA 4NRCA 4EDUA 2EKOA 1VQ7T 2ED0A 4Q0NA 4PJMA 2VVKA 1K9MU 1WIEA 1CKAA 4ATOA 1V29B 3VYHB 1KIKA 3M58A 4ZTFA 1ZQ1A 1LCKA 4NOYA 5J0DA 2L84A 2HBPA 4EMGA 5KHMA 5CQAA 3IU6A 4QR4A 5A5NA 2DL5A 3QZTA 3TSWA 4Z6HA 5AMFA 2R0SA 1N27A 2FSAA 3MHXA 4IR6A 3PVQA 3RDVA 2YQDA 2K5FA 5A5PA 3PNWC 4IORA 5EU1A 2IPOB 3PTAA 4JRKA 5D3TA 4CLBA 1WJRA 4XTUA 2EPDA 5IHIA 2QTVA 4QVCA 4OMOA 5EGUA 3CPFA 4M4ZA 4HT9A 1Q86U 3LH0A 3SFMA 4C5GA 4YK0A 3U5OA 1QVPA 5A85A 4OUFA 5D24A 5F1LA 2DATA 4E7SA 4XUAA 5A0LA 2DXUA 3VYGA 3RCWA 5GAOp 3LYIA 3KBGA 3OYAA 4PJOA 4YH3A 5DY7A 3F70A 1N9RA 4QNSA 4J83A 4YBMA 3SDZA 3JB9H 2LJ1A 1Y07A 3C94A 3J81E 3OYKA 4QQ6A 1PUOA 4QSSA 2CP5A 2EQKA 2D9TA 2XU8A 3L2UA 1XTDA 2HBWA 3CCMQ 1U06A 1HXDA 2RQUA 2ZAEA 1X6GA 2GRCA 5IXFA 3O33A 3OYFA 3OSSC 3GPLA 4PJNA 4E2FB 3QDFA 3EG9B 2L8DA 2A3LA 1QWEA 2DLPA 4M78D 3OW2P 1F68A 5HFQA 3OW2A 3JVMA 2L3SA 5I22A 3FJ5A 2L3PA 4PLLA 3QG1A 3UA7A 5FU7C 5DW1A 2K6DA 3CCSQ 5CQ7A 1JRIA 2HL3A 1PD0A 2LQ8A 3C95A 1YITQ 2RB6A 1D1BA 2JM9A 3HSBA 5GAMh 1PSEA 3FIFA 3M0QA 3QZ9B 2L89A 2LQKA 5I89A 3ZEHA 1VQ7Q 3JVKA 2A7YA 4O7EA 2GNCA 5D6YA 5F25A 5A81A 4PL6A 1SG5A 1SSHA 1ZSZA 4IUQA 2CT3A 4HXNA 1YI2T 1JJ2S 2HZYA 2RJCA 3P8HA 2QA4A 3CMEA 4F7UE 3OYBA 4OMQA 5CP5A 1YIJA 5EWVA 2BZXA 1LVKA 3VKIA 1X2KA 2CREA 4R0KA 4CFLA 2K3BA 3OA6A 2ZPBB 1YJ9A 4E6RA 3L2WA 5KYXA 5IN1A 1JXOA 2EYYA 3OQ5A 2DKWA 2R5AA 1T3LA 2YT6A 4CC4B 2DWWA 1G3WA 1I5LA 2YHTA 5A7CA 4O7BA 2NYSA 3CCUT 4JS5A 1S72A 2AK5A 4XU2A 1VQ8Q 4TQNA 4PJOD 3OYIA 1G3TA 5DFDA 5GJWB 3UVYA 4YYJA 4A4KA 3DB3A 1OV3A 2DXBA 3PT9A 1I5OB 2EAYA 4YAXA 4C8QE 2JTMA 2YLBA 5D3LA 2DL3A 2YRVA 1NM7A 2QK0A 2H3EB 1NLOC 4GY5A 1QVGP 1OULA 2C0OA 3LLRA 5IGLA 2LT4A 3A8MB 1KG1A 3LQHA 2YUOA 5CUAA 2OX7A 4IR5A 2BZYA 4A4GA 5DFCA 1VQOQ 2DYIA 3G4SQ 4NR6A 1KQ2A 3UV4A 4XAXB 2YW5A 3M54A 2LCSA 2AKKA 2LX7A 1PRMC 3CCQT 2MJVB 3ZFJA 4Y91A 4F14A 2M0OA 3P1CA 1I07A 2OTLA 4FW1A 3BW1A 4A63B 4IR3A 4BW3A 2VGNA 2F6NA 5HLSA 4QB3A 3U5MA 3G6EA 4AT1B 1Q82C 4L59A 3CMAA 2N9GA 5CQ4A 3UF4A 5LL6S 3UV5A 1FMKA 5I21A 4FCYA 4AKGA 3HKSA 4LXCA 2J7IA 3LWHA 1N9SA 2JJ9A 3FRNA 3OY9A 5L99A 4FYVB 1WYXA 1TWBA 3ER0A 1IZ6A 2I8NA 4NS5A 2EQIA 4HBWA 3V8LA 4LUDA 1BI3A 4NQMA 4RG2A 4MZPA 1M90U 2CP6A 2DVVA 2FYKA 4FSXA 1RADB 4HXLA 3S92A 2MAMA 3LGLA 1WLPB 4YADA 1KHCA 2VWFA 4OMFB 2O4XB 3O5ZA 1AZEA 5FROA 1WJQA 5DYCA 1PNJA 4HBVA 3PVLA 4YY6A 4XTWA 4XTXA 5ENIA 1RLPC 1WFWA 2HKNA 2ZGWA 5AD2A 2JNGA 4BI4A 2E5KA 2RM4A 5KCOA 1IHVA 2L0AA 3NMZC 3G71A 5GAN7 1N5ZA 4C92E 3VRZA 1VQ6Q 4NYXA 3SWNC 4CUTA 3I56A 5HK3A 1WHGA 2K3YA 5LKUA 5K29A 1BIAA 2J06A 3X20B 4NL3A 4YH4A 4O5VA 4QR3A 4NUEA 2ZCFB 1BCOA 4M7DE 4OF1A 2HD0A 3CC2A 1AWJA 4F7UB 2RQWA 1Q82R 1NG2A 1EZZB 4YYIA 1X43A 1QVFP 1TS9A 4UYFB 5ENCA 1YFNA 1M1KC 1PM3A 2R58A 2ENMA 1M90R 3S3NA 4EMKA 1WHHA 4RUGA 2FPFA 4HXOA 5FU6B 4IKFA 4B9WA 4A9FA 1FXXA 3SVGA 1EIFA 4L5GA 8AT1B 2PVGB 2QDLA 1PKTA 2X4WA 5L8RE 5GAMj 3HPWA 4DBRA 1FX7A 2YRCA 3CCQQ 1GXIE 5BT3A 1OI1A 2L2PA 1GBRA 4XYAA 3CCJA 2K7AA 3M4YA 1VQ5A 4HCBA 5FH8A 2EFIA 3V7SA 4C8QB 4LD9K 5J26A 4IR4A 4TU6A 4O78A 2OSSA 5C87A 3A8OB 3HMEA 1WJSA 1UHFA 1QMCA 2LX9A 4UIYA 2BE7D 4AMCA 4KT0E 4M78F 2GF7A 2QEXQ 1ZUUA 4J0RA 1RAAB 2FO0A 5EWHA 5CQTA 2L3RA 4LZ2A 3HRSA 4A4FA 2DMOA 4Y28E 1YBYA 4KGVB 2M16A 4UIXA 2X35A 5KYYB 2NUTB 4E7KA 5GAOq 1J3TA 3P1DA 5EC7A 2F69A 1AD5A 2CP0A 3U5PA 1M5Q1 1JXMA 3J7AF 4MZTA 3VS7A 1ZUKA 3CC4T 5CCAA 2LT1A 2BKDN 3VRYA 2JS0A 1VQNA 1VQPA 1BYMA 3PE0A 1NPPA 4PFPA 4PCIA 4R55A 4FYYB 5KTWA 2JW4A 5DKHA 4A53A 3CBMA 6AT1B 3EG3A 3AHUA 2ED1A 5FE9A 5FW9A 4Z93A 2EJ9A 3FDRA 3NGPA 4JJBA 2EYZA 2QXFA 5DYXA 3LQJA 2FEIA 2XDDA 2CSQA 4BY6C 3V7RA 4YYDA 2HQXA 1N8RU 1BIBA 1I0CA 5GAMe 3J80E 4N4GA 4LDFA 2MWOA 4ELZC 1JU5C 3QSUA 3HMFA 3FB9A 5FB1A 1YJNT 4ZGDB 2KBTA 1K73U 1MHNA 4OGIA 2DNUA 3SEMA 1SF9A 2YEMA 1OU8A 4QR5A 4BUGA 4M78C 1CSKA 4FLPA 2DX1A 2DTHA 3SWNB 4WF2A 4IURA 4QSVA 4A54A 4LZRA 1VQ4T 2CSIA 4HA8A 2OTJT 2DKGA 1WI7A 5E9LA 4PJOF 3S3OA 2IVWA 4AFZC 3L2RA 4C92B 4HT8A 3HP9A 4J9BA 2MK5A 5E3GA 1MMDA 4QSTA 5HQ5A 1X69A 4NUCA 5CPEA 2LSPB 2NUZA 3JCMV 3S6WA 2JMAA 2EJNA 3KUFA 2FRWA 2R57A 4M7DB 4CC7A 3G7ZA 4KUIA 1JB0E 4CRIA 4J9HA 1B7TA 2D0NA 1WHKA 1N8RR 4FIBA 3CCLT 2V8IA 4JLIA 3LH5A 4Y92A 4LYSA 5GAMf 2DVEA 5GAN4 5D6WA 4MR6A 2DVSA 3OYCA 3UA6A 3LXJA 2LJ0A 1U5SA 1VQ9Q 1BBZA 4E47A 4MR5A 1WHJA 4JPBW 3Q2FA 1IGUA 3LX7A 3CXCS 5GAMd 5FG6A 3JCMQ 3JSCA 2CZ6B 5BT5A 3OYYA 2JOYA 1VQMT 3HFNA 5E9IA 4J9CA 4C66A 3SVHA 3CC4Q 5GAMg 3CD6A 4KGZB 3U5NA 5IAYA 4F16A 2BZ8A 2SEMA 4RVRA 4A4HA 3CCRA 2RI2A 4DEXA 3L2QA 4A9MA 4PJOC 1PG5B 2OI3A 2CS7A 3JB9I 4J9EA 5CQXA 3EGXB 3ME9A 5AD3A 1Z9ZA 2QI2A 1VQKA 5A5QA 4QUTA 3H41A 1VA7A 5DKCA 3EGDB 2R0YA 4YYMA 2DXTA 4TVRA 3OB9A 5DLQE 3GOXA 3G0JA 2ATCB 1D0XA 4D6WA 1UEBA 4UYGA 2XICA 2I7KA 4TZ2A 1M2VA 2ECZA 3NHNA 3TU4K 4NRAA 5LJ2A 3WVEB 2AIRB 1LPLA 2CP3A 4N4HA 4JJCA 2DRKA 4QEWA 3UVDA 2KMTA 1WX6A 4YYKA 1NJIU 1UB4A 2OO1A 5IXBA 5EG2A 4TTEA 1UJ0A 2X4YA 1VQ4Q 1Y96B 3GNFB 2OTJQ 2JTEA 2EQUA 3FEOA 2HCKA 4A9JA 3MKDA 3DAIA 3CCST 5C85A 4M78G 1RAGB 3CC7A 1KQSS 2HQHA 2DRMA 1K9MC 3NPFA 4YBSA 4D8DA 5G4SA 5L8UA 5FBXA 1D1CA 2QGFB 2EJFA 2WP1A 3JCMh 4UIWA 1KFZA 5IT9E 5C89A 5A83A 1WGSA 3CCLQ 4NRBA 1ZSZC 4BI8B 5GMKl 4IOQA 1EFNA 3D7SB 2COWA 1M1FA 5F62A 1KD1U 1HD3A 3H6ZA 2PQWA 4XU3A 3DWYA 5FE7A 4PKCC 2A36A 1SPKA 5KYNA 2A28A 1TG0A 4GPJA 3HHTB 2LVMA 2DL7A 4RKUE 5HCKA 1WUGA 4Q0OA 1AT1B 2VASA 4WIVA 5F60A 1NZ9A 3RKYA 3VJPA 2O31A 2VXEA 3L1AA 1Q86C 4KV4A 4QC1A 3P1EA 1VQMQ 5CUCA 2F2VA 2O9SA 5KYWA 3PGGA 4MMLA 4BHWA 2V8JA 1EX4A 1MUZA 2DK3A 3VS6A 4BACA 4JZ4A 3H0HA 3HRTA 5EICA 1VQ8T 1YCYA 5FG4A 4O76A 3EH1A 3TVTA 1YHQA 3SB2A 1JQQA 4C5EA 2QA4Q 4HXPA 3H0IA 1VIEA 2K4YA 1YIJQ 3VUBA 1K9MR 1UGSB 4IIMA 1BI0A 3AQAA 3JVLA 2DM1A 2ROLA 2QQSA 4PJOG 2WSFE 3VUZA 1UUEA 3EG1A 3VS1A 4LN2A 3HMHA 5EWDA 3O34A 4FYWB 3PMIA 3U5JA 1UG1A 2K5LA 4P5NA 1XNIA 2E7OA 5A82A 5DKDA 1G5VA 4AFQC 2GTOA 4VUBA 1S72Q 4A9NA 2RQRA 5C6SA 2KR3A 1W2BP 4Z1SA 2OJ2A 1K9AA 2V26A 3G4ST 1VQOT 1W2BA 4QC3A 2CKKA 1YWPA 3I9QA 2C0TA 2O88A 4K11A 2R0VA 3H0FA 1IGQA 2E5QA 4QSWA 5CQ3A 2CT4A 3CCET 3REAB 4MEPA 1Q86R 1BCMA 2A37A 1E6GA 2H8HA 2KEAA 2KRSA 1AHJB 3P1FA 5I88A 3OSVA 1AEYA 2K5IA 5GMKm 1TUCA 2E6ZA 5GAN2 3RKWA 4C0DB 5GJVB 5GAN5 4PNOA 4C67A 4FW2A 2EBPA 4OB1B 2KY9A 5D3HA 1XQHA 4A9LA 2DD4A 4B9XA 3FKMX 2J6OA 5FE5A 3I5SA 1UE9A 3CCVA 3L42A 3QJYA 1UECA 3I55T 1D09B 2QTXA 4D8KA 2AZVA 5FE6A 1ZBXA 2EVRA 2RA2A 5I2SA 2K2VA 5KE2A 3G6EQ 5IHKA 4KRTA 2O2OA 4A9EA 2BE9B 3CMAQ 3M59A 2LMJA 2QG9B 3X28B 4MDXA 4O7AA 2MMPA 4QUUA 2CUBA 2CZ0B 4J5YA 3RKXA 5TCMA 5IG6A 5EV9A 4RTYA 1D0ZA 1ZKRA 2RD1A 4YABA 2FHDA 4RTXA 3FLGA 1VYTA 4R56A 2O9VA 5HK0A 3M0RA 1H3ZA 5HRVA 3MJXA 1VQ6T 4M7AF 3CCMA 4YATA 3IQLA 1KQ1A 2JMCA 2QDYB 1ABQA 5KYXB 5HQ7A 2YDWA 1HYOA 1Z9QA 1AVZC 5F36A 3JVJA 5CO7A 1M1GA 2D9EA 3O35A 5EM3A 1RI0A 1YJWA 3E19A 1YWOA 3VS4A 4DA4A 2JZ2A 5L8TA 2JS2A 2K79A 2BTTA 1KHIA 2YYNA 5CU8A 2NLUA 1W1FA 1GBQA 2PUKB 4NR7A 1WHLA 2ZPGB 4FU6A 4OMLA 5J39A 4EMKC 4Q5WA 3ULRB 2DERA 4AG2C 2EJGA 4PJJA 2GCXA 5HJCA 1GFDA 3Q1JA 5EISA 2RFJA 7AT1B 3O37A 4II1A 2KRMA 2DBMA 2JN0A 5FRMA 1YITA 1GRIA 5L97A 2DA9A 2CP7A 1UGPB 2COYA 2RMOA 1UGQB 2ROTA 5LJ3h 3QPHA 2P0KA 5IHNA 3EHRA 3CCEQ 4HBXA 3LQIA 1AZGB 2YEKA 1X01A 2PU9B 1VQ7A 4BDYA 3DLMA 5A5SA 3V8KA 3CC2Q 5E9KA 3A98A 1BI2A 3VU3C 4DBHA 4QSRA 2EYWA 2FPDA 4FL6A 3L2VA 4HCCA 5KO4A 2DAQA 2DTOA 3CPWS 2KYBA 5E9YA 2A08A 2RPNA 4M7AC 2L5EA 2D1XA 2E41A 3R6OA 3M0TA 3QYHB 4EPCA 2EYQA 1M90C 2F2WA 4QW2A 2L85A 3EG0A 5GAN8 4XQ3A 5FU7B 2K2MA 3BDLA 2DO3A 2QEXT 2M02A 5FE0A 4LYWA 3OYJA 5HKCA 2CH4W 3QDRB 5D7UA 4M77F 1ZX6A 2K9GA 3I55Q 5CQ6A 1OZ3A 4JLGA 4MZMA 2R10A 1IREB 4UIVA 5L98A 1BKBA 1VQ5Q 2O4XA 2HQEA 1RL2A 3AADA 4PFZA 4KUDK 4QT7A 2RNAA 3MPUB 2J05A 3GLXA 3MO8A 3FC3A 1RAIB 4QSXA 5D25A 1VIFA 2FZKB 2K3XA 4AKIA 3QYGB 5A2QE 4NUDA 1PWTA 2B86A 2DBKA 2V1QA 4N0AA 4C0ZA 4N4FA 2E12A 4C0GA 1G2BA 5D6XA 4OVAA 4E7HA 2VV5A 1Y57A 1HJDA 1PSFA 4ZN3A 5E0RA 4F7UA 5DW2A 4M75F 4BJXA 5E74A 5ACYA 1LOJA 3GNGA 5EWCA 4UYFA 1D3BB 3JRZA 2DTIA 2E64A 2G3RA 4HBYA 3JCMe 1JM4B 2JM8A 3KXTA 4PS5A 1VQPQ 2PVOB 3CCRT 1VUBA 4X9DA 5HRWA 5CQ8A 1Q7YU 5F2PA 3M5AA 2LCCA 4XY8A 1E7OA 4M77C 2DYBA 1UDLA 4X34A 3UWNA 2RHUA 3MEVA 5GAOl 3I3JA 4QEUA 1OX8A 2Y4YA 2RHIA 3QZ5B 4RTTA 2LQNA 1QP3A 2RF0A 4DQ2A 4EMKB 2DF6A 4KH0B 4C5IA 1NE8A 1R8OB 1YI2A 2VC8A 1WZOA 2OAWA 5I11A 4YTLA 3P5OA 2YWWA 2HL5C 1I8FA 1B34A 2D0QB 1OQKA 2J6FA 4A9HA 4M7AA 5CKFA 4C0FA 5ETBA 4E7IA 4M75C 3D1DA 2WP2A 3JCMf 2M9UA 4ZC9A 5E9MA 3ZBDA 4KULA 1VQ9T 4M7AG 3PFSA 3OYGA 3M56A 3VKGA 1C6VX 4PLIA 1Q7YR 3CCUA 2GGRA 2KT8A 3JCMd 2LP5A 3OYDA 5E3DA 2E65A 3C12A 5LKZA 2RI7A 2IG0A 3OW2S 4QKUA 2GQVA 4Z89A 1TUGB 2VUBA 3A8LB 4A9OA 5ENJA 3JCMg 4NR8A 2DEUA 1ABOA 1T3SA 5FE8A 5CGPA 1N8RC 3X25B 4EMHA 4CI0C 2FZCB 5I2MA 3MXFA 2ZPEB 3D1BA 2HSEB 5DY9A 4RMOA 4QSQA 1K73C 1QLYA 5LJ0A 2VGMA 1M8MA 4NYVA 2NUPB 4LDUA 5M9OA 1BB9A 2DZ9A 1B07A 5I29A 1NEBA 1YN8A 4M78E 1QWFA 3OYHA 5L96A 1RAHB 3HFOA 4DOWA 5CR2A 2DJZA 5F63A 1I4K1 4BE0A 1RUWA 4XK8E 2LNVA 5BT4A 3JV3A 5IGMA 3EG2A 4AKNA 5LJ3j 4JJDA 2PNIA 1UTIA 5IH2A 5AMEA 2F1LA 3CCRQ 5D3NA 3CCQA 1XJWB 2AHJB 1JJ2P 1ZA2B 3OYLA 2XK0A 1O75A 1JJ2A 3OS5A 5KCHA 4LZSA 5EP7A 1XOVA 4E7JA 4PCEA 4F04B 4XTVA 2KTBB 3ONIA 4UIUA 5GAOm 4A9IA 3CEYA 1IO6A 5CVIA 3EFOB 4M77A 5FDZA 3M4GA 2RO1A 3META 3ERRA 2RHXA 2LNHB 3MEWA 5KYUB 1Q81U 4YYGA 5D7XA 2M51A 4IOOA 1O9SA 2RNYA 5CY9A 4M77G 4M7DA 1OZ2A 2ZPFB 3OS2A 3JCMX 5FB0A 4Z1QA 3MUKA 3QWXX 5TB6A 1UGRB 3N5BB 1M3AA 4M7AD 1K8AU 1PD1A 1T0JA 1IB8A 1WXTA 2PTKA 4HXJA 4XUBA 2MYSA 1OU9A 3I35A 5GAOn 4XTZA 2KNBB 2FZGB 2GFUA 1K73R 5EPBA 1K4US 2DPPB 2DJQA 2KT1A 2YLCA 1W6XA 4MR4A 4ZQLA 4RTUA 3RMQA 5CQYA 3CC7Q 4HXMA 2ESWA 4M75A 5EQ1A 2XMFA 3TQ7P 3P8BB 5I7XA 3CBOA 4ALGA 2WSEE 1OOTA 4JS4A 3BDUA 4YC9A 1QVGS 5LVQA 2LTOA 2XD0A 1G3SA 3DLLA 4JDSA 4PJOE 4AFUC 4M75G 1R0BG 1KC8U 5KE3A 4PK4A 1FYNA 1QKWA 1VOMA 2P4TA 2QYZA 5COIA 2E7NA 4X2IA 2D8JA 4X9CA 1Q81R 4GLMA 5I1QA 3U5LA 2E10A 2ZPIB 4QSPA 3EGXA 1AOJA 2VKNA 4O7FA 5D3RA 4IUPA 4ZN1A 1ACMB 2LZ6B 2CDTA 3KFVA 2QA4T 3CMET 2F2XA 1H92A 1EQFA 5CRZA 2KDSA 1YIJT 1R0CB 5A5RA 4PFOA 4J9IA 1NJIC 1WHMA 3H8ZA 3QKJA 1S1NA 2DILA 3LW5E 1N72A 2RQVA 4BDZA 1ZUYA 1YJ9T 4J3IA 2MF2A 3RR6A 4PKLA 5FWBA 5E7DA 1RACB 1VQLA 2VB6A 1KSWA 1SKUB 5FE2A 1S72T 3TSZA 1Y96A 2E3IA 2L3QA 2JTFA 2P0PA 1V76A 5CKHA 1YHQQ 3R6NA 1KC8R 4M77D 1ZHIA 5A5OA 2G6FX 5DYAA 5C8GA 5HM0A 2WACA 2LQWA 5HFRA 1DJ7B 4Z8AA 4BY6B 1JO8A 1MNEA 3OYNA 1ZA1B 4GLKA 5CTLA 1M2VB 3EGUA 4NQNA 4M7DD 5DYUA 5LKXA 3A1PA 1KD1C 4RTVA 2D82A 3V7CA 2X3XD 1OPLA 5LJ3f 1PCXA 4M78B 4ZTJA 4BW1A 1U1TA 3E9FA 1W4SA 4E7LA 2RQTA 4LUEA 4RTWA 2OUOA 2QQRA 5KTXA 2X4XA 2K57A 3A5ZB 3AT1B 1G83A 4FT2A 1U1SA 5LJ3d 4QZSA 4LC2A 3WXMB 2RH2A 2F6JA 2QQBA 1SEMA 4TS8A 3MEAA 4M75D 4DOVA 4CC3A 3VS0A 5JI8A 1NJIR 3MEUA 4PY6A 3VV0A 3CC4A 2KYMA 5LJ3g 3QBYA 4WHWA 2OTLT 1QVFS 1V1CA 2RJFA 3RESA 5EPRA 1VYVA 2Z0WA 3M0UA 3G6ET 5AYFA 2DETA 3MQMA 5LVRA 2SRCA 3CMAT 3E9GA 1FMVA 2XI9A 5DLXA 5FRNA 1TXQA 2EKHA 1TH7A 1ZS5A 3VS2A 1GCQC 4Y03A 4UYHA 3NXBA 2G4AA 5ENGA 2XDBA 3VKHA 1WPYA 3H9NA 2MPXC 3G1JA 3CMEQ 4HVUA 4QSUA 1YJNA 4AG1C 4OMNA 4ZGJB 5CZGA 2RN8A 5FFVA 2O01E 5CKBA 4KCXA 3CCVQ 5CKDA 4JRIA 1KD1R 1U3OA 1QP2A 5KYWB 4NYWA 5H1VA 2NXBA 1YJ9Q 3NTHA 2X4JA 1OX9A 1VQ4A 3A8GB 5DBMA 3EG9A 3MP1A 2OTJA 4LDVA 3LWIA 4N3WA 5I40A 4IUTA 1LNXA 4J6YA 4PJOB 4IUUA 4DBQA 4FT4A 5FE3A 2JVVA 5A0GA 2COZA 4ANJA 3G71T 3MB4A 2KI7A 3MP6A 1NBEB 2JT4A 5CKEA 3I56T 3UT1A 4LRGA 3UVXA 4NR4A 2E4HA 3SD4A 1VYUA 3Q2EA 3WVDB 2HDAA 5CUBA 1YJWQ 5ETDA 3RNJA 2MIOA 1NYFA 2DE0X 4IIOA 3CCLA 4F7UF 2CZ1B 3CC2T 3JCMW 4TT4A 4HXSA 5I7YA 2LC4A 5LJ5h 2HMAA 3JAME 2XIDA 2BIVA 4QVDA 1WNLA 4J0SA 3MB3A 1HK9A 3U5KA 3M0SA 4EIKA 1JBMA 4O70A 3BFMA 1LJOA 3X26B 4HKEA 4RTZA 3LJWA 1GCPA 5GANh 1VQMA 3JB9J 4YYNA 4DONA 3V8JA 2GFAA 2B8AA 2OTLQ 4PJLA 4TZ8A 2HAXA 1UFFA 4PTBA 2EGEA 4ESRA 4HXKA 1KJWA 3CCJT 4QVZA 1QW1A 1VQ5T 1X6OA 5HELA 5II1A 2OAUA 1A0NB 3RIRA 5FWCA 4C8QF 4J7FA 1GFCA 2A0FB 3UV2A 4FYXB 4QQDA 4UC4A 3QXEB 1ZSZB 2LJ3A 2CH4A 4N0AC 1QCNA 2E3KA 1MV3A 1H8KA 1FWZA 5CAIA 3L2ZA 1X0JA 4AFSC 5HCLA 3SHWA 4CL9A 1W70A 1M2OA 3HL8A 4NL2A 3OBWA 1GCQA 2YXYA 5EA1A 1JSPB 5DLZA 4IUVA 5ENBA 4FM4B 2YUPA 3IU5A 4J7IA 4MR3A 1HSQA 5F5ZA 2M0YA 1BK2A 4J8OA 5EK9A 1M4ZA 1BU1A 3QZVA 1H3HA 5FU6C 4YYHA 4CUPA 2YUQA 2I0NA 4O74A 4ZW1A 3RUXA 4ZNXA 4BW2A 3PIOA 3O8VA 1VQNT 1VQPT 3CCSA 4CFKA 3JB9F 5HRXA 2EQJA 1MGQA 3OMCA 3UW9A 3G71Q 1M9SA 4MEOA 4O75A 5D3SA 3LGFA 4V2SA 5H1UA 5I83A 2MI6A 3E1SA 5L23A 1WXBA 3I56Q 1NLPC 3CXCP 5ENHA 4ME7A 4JRPA 3CXCA 1M30A 4OB0B 5IBNA 2CUDA 2AKLA 1M8VA 4F3IA 1QVGA 2XDPA 4OGCA 4C8QC 1K0SA 4TU4A 5H1TA 5I86A 4M7AE 4LE9A 1R77A 3QWYA 3ZYUA 1M27C 3M0PA 4BW4A 1PRLC 2JUFA 3EHQA 3MCAB 2ZZDA 2QGGA 4J1PA 3UPUA 2QAZA 5GMKh 2EGCA 4UYEA 1OPKA 3M9QA 2DXCA 3G0LA 5II2A 4HCZA 1WA7A 5EI4A 1QCOA 2D8HA 5LKTA 2HNIA 4OB2B 2X51A 2IIMA 1K76A 3C4SA 4TYLA 1ARKA 1RLQC 2MWPA 4C92F 1K1ZA 4MENA 3K2JA 4OP0A 2KROA 2W0ZA 4UITA 1YP5A 4BD3A 1ZSGA 3CCJQ 4BE2A 4CUUA 1K0XA 5CIUA 5G4RA 1X2QA 5H85A 2XHCA 1VQ8A 4M7DF 1RABB 5CS8A 1YI2Q 2KXDA 2RNXA 2E1HA 1Q82U 2EW3A 4QYLA 1IXDA 4GBQA 4XY9A 1ZBJA 4BB7A 2DEQA 3QIIA 5CQ5A 5FE4A 4QBMA 1WXUA 4KGXB 3BE3A 3OS1A 2H3JA 3GG3A 3CQTA 5EPSA 1RI9A 5FG5A 4HCKA 1PC0A 1U8RA 4KBMB 1H641 5DM7R 1KQSP 2L5QA 4RG8A 2H60A 3JCMc 1KQSA 1SHFA 2X9HA 2PVDB 4J9FA 4WTOB 1D3BA 2W10A 3CCUQ 2Y4XA 2E3HA 5LUUA 1AWXA 2KSSA 1Q7YC 1VQOA 2YUNA 3G4SA 3VS3A 4F7UG 2P4RA 3CD6T 4M77E 2DVJA 2XG8D 4A4EA 2E70A
chains in the Genus database with same CATH topology
4J6XA 2DVRA 3CCEA 5CK9A 3GP8A 2FL7A 4C5HA 2RO0A 4C92C 1P92A 4TT6A 2DZCA 4OGEA 3TLPA 5IGNA 1VQKT 5DLOA 5LJ5j 2KAFA 1QVFA 2DVQA 5IGKA 1X75C 2DIGA 5ENFA 4M7DC 3JCMJ 5C7NA 4CUQA 4QYDA 4RCBA 5FH6A 3RERA 4C8QA 3S91A 2LDMA 1VQLT 5E9VA 3OYMA 3URGA 1M1KU 5CUDA 3BY7A 5GANj 4TT2A 4M75E 5I80A 4OGJA 2RJDA 4C8QG 4LR6A 2FB7A 5CUGA 4Z6IA 2I2LA 3ASKA 2D6FA 4LDWA 3I55A 2KVQG 2DIQA 1E6IA 5HEMA 4CUSA 2CYZB 1BI1A 4ZGEB 5FH7A 4XTYA 1Y71A 3RMSA 3CC7T 2DD5A 3GIBA 3TEEA 2RNWA 3DKMA 4CURA 5D0CA 3TREA 1B34B 2YELA 5GAN6 3HRUA 1VQ6A 3T9NA 2CZ7B 4M7AB 3MULA 1W2BS 5CUEA 2R5MA 5IIDA 2EWNA 5CFWA 4O71A 3QUIA 3PIPA 3OS0A 5EWWA 4A9KA 3QHSA 5HQ6A 4L6V5 5KTUA 3JB9G 4XU1A 2ZPHB 3NTIA 3PMTA 2QQAA 2RI3A 5D26A 5FFWA 4ELYC 2EIFA 2WSCE 5DFBA 1SSFA 4E96A 4BI3A 4Z02A 3O36A 2RK1A 2LCLA 5LJ5e 4JUVA 3SVFA 3OMGA 3M53A 5GAOr 3SWNA 2EQMA 4O6JA 3EAEA 4YY4A 2RK2A 1Q81C 5GAN3 1G3YA 5GANe 3QO3A 1YHQT 4LDXA 4C92A 2LRQA 4ALHA 1WQWA 5HENA 4UYDA 4WHUA 3UVWA 5F61A 5GMKj 2BUDA 4C8QD 4C92G 4MMKA 1K8AC 4O72A 3M57A 5FLXE 2VYTA 4NR5A 2QEXA 2F5KA 5LJ1A 3M55A 4QY4A 4M7DG 5ENEA 4OB3B 4JRQA 2FVUA 4M77B 2P0QA 4MEQA 4UIZA 2RJEA 2VXFA 5LJ5f 5EVAA 4LD6A 3UDCA 1KC8C 5KU3A 3QJ6A 3EFRA 5JWMA 4MDWA 3NTKA 2KQWA 5GMKi 5E73A 5LJ5d 4LYIA 3OYEA 3D7CA 5GANf 2XKOC 3X24B 1OYXA 3JB9D 4YBTA 1I81A 4XU0A 5LJ5g 5FFYA 5HY6A 3JCMb 3NFCA 4JJNK 4M75B 4QQGA 5GANd 4RCCA 5LJ3e 5CRMA 2RI5A 3OBYA 3TCJA 1WUMA 5DX4A 5GANg 3CCVT 2F5TX 1WQ7A 2M1HA 5D3PA 2Y90A 3CPWA 5J3BA 3A8HB 3S3MA 5GMKe 4NXJA 5F3AA 5C4QA 3MP8A 4O7CA 2RHYA 4KV1A 5C0MA 4O77A 3CBPA 1NPRA 4C92D 1N6AA 4LDYA 3CCMT 2RS9B 2C06A 3INZA 5FE1A 4NR9A 1YJWT 2KK4A 2V8KA 4J6WA 4N4IA 4C0DC 4QEVA 4M78A 3GF5A 3QZSA 4HXRA 5KH6A 3FJPA 1VQ9A 2PUOB 3EFSA 2QQ9A 2CGHA 3JCMP 1YITT 5F1HA 5D3JA 5A0DA 2E6NA 3P8DA 2RHZA 4BE1A 1Y7XA 3DB4A 4NRCA 4EDUA 2EKOA 1VQ7T 4Q0NA 1K9MU 4ATOA 1V29B 3VYHB 3M58A 4ZTFA 1ZQ1A 4NOYA 5J0DA 2L84A 2HBPA 4EMGA 5KHMA 5CQAA 3IU6A 4QR4A 5A5NA 3QZTA 4Z6HA 5AMFA 2R0SA 1N27A 2FSAA 3MHXA 4IR6A 2YQDA 2K5FA 5A5PA 3PNWC 4IORA 5EU1A 3PTAA 4JRKA 5D3TA 4CLBA 1WJRA 4XTUA 4QVCA 5EGUA 3CPFA 4HT9A 1Q86U 3LH0A 3SFMA 4C5GA 4YK0A 3U5OA 1QVPA 5A85A 4OUFA 5D24A 5F1LA 2DATA 5A0LA 4XUAA 5GAOp 2DXUA 3VYGA 3RCWA 4PJOA 3LYIA 3KBGA 3OYAA 4YH3A 5DY7A 3F70A 1N9RA 4QNSA 4J83A 4YBMA 3SDZA 3JB9H 1Y07A 3C94A 3J81E 3OYKA 4QQ6A 4QSSA 2EQKA 2D9TA 2XU8A 3L2UA 1XTDA 1HXDA 2GRCA 3O33A 3OYFA 3OSSC 3GPLA 2L8DA 2A3LA 4M78D 1F68A 5HFQA 3OW2A 3JVMA 4PLLA 3QG1A 5FU7C 5DW1A 5CQ7A 1JRIA 2LQ8A 3C95A 2RB6A 3HSBA 5GAMh 1PSEA 3FIFA 3QZ9B 2L89A 2LQKA 5I89A 3ZEHA 3JVKA 2A7YA 4O7EA 5D6YA 5F25A 5A81A 4PL6A 4IUQA 4HXNA 1YI2T 1JJ2S 2RJCA 3P8HA 2QA4A 3CMEA 4F7UE 3OYBA 5CP5A 1YIJA 5EWVA 3VKIA 4CFLA 3OA6A 2ZPBB 1YJ9A 3L2WA 5IN1A 3OQ5A 2DKWA 2R5AA 2DWWA 1G3WA 1I5LA 2YHTA 5A7CA 4O7BA 3CCUT 4JS5A 1S72A 4XU2A 4TQNA 4PJOD 3OYIA 1G3TA 5DFDA 3UVYA 4YYJA 4A4KA 3DB3A 2DXBA 3PT9A 2EAYA 4YAXA 4C8QE 2JTMA 2YLBA 5D3LA 2YRVA 4GY5A 3LLRA 5IGLA 2LT4A 3A8MB 1KG1A 3LQHA 5CUAA 4IR5A 4A4GA 5DFCA 4NR6A 1KQ2A 3UV4A 4XAXB 2YW5A 3M54A 3CCQT 2MJVB 3ZFJA 4Y91A 2M0OA 3P1CA 2OTLA 3BW1A 4IR3A 4BW3A 2VGNA 2F6NA 5HLSA 4QB3A 3U5MA 3G6EA 1Q82C 4L59A 3CMAA 2N9GA 5CQ4A 5LL6S 3UV5A 5I21A 3HKSA 3LWHA 1N9SA 3FRNA 3OY9A 5L99A 3ER0A 1IZ6A 2I8NA 4NS5A 4HBWA 3V8LA 1BI3A 4NQMA 4RG2A 4MZPA 1M90U 2DVVA 2FYKA 4FSXA 4HXLA 3S92A 2MAMA 3LGLA 4YADA 1KHCA 4OMFB 2O4XB 5FROA 1WJQA 5DYCA 4HBVA 4YY6A 4XTWA 4XTXA 5ENIA 2ZGWA 5AD2A 2JNGA 4BI4A 2RM4A 5KCOA 3G71A 5GAN7 4C92E 4NYXA 3SWNC 4CUTA 3I56A 5HK3A 2K3YA 5LKUA 5K29A 1BIAA 3X20B 4NL3A 4YH4A 4O5VA 4QR3A 4NUEA 2ZCFB 4M7DE 4OF1A 2HD0A 3CC2A 4F7UB 4YYIA 4UYFB 5ENCA 1M1KC 2R58A 3S3NA 4EMKA 4HXOA 5FU6B 4IKFA 4B9WA 4A9FA 1FXXA 3SVGA 1EIFA 4L5GA 2PVGB 2X4WA 5L8RE 5GAMj 3HPWA 1FX7A 1GXIE 5BT3A 1OI1A 4XYAA 3CCJA 3M4YA 1VQ5A 4HCBA 5FH8A 2EFIA 3V7SA 4C8QB 4LD9K 5J26A 4IR4A 4TU6A 4O78A 2OSSA 5C87A 3A8OB 3HMEA 1WJSA 2LX9A 4UIYA 4KT0E 4M78F 2GF7A 4J0RA 5EWHA 5CQTA 2L3RA 4LZ2A 3HRSA 4A4FA 4Y28E 1YBYA 2M16A 4UIXA 2X35A 4E7KA 5GAOq 3P1DA 2F69A 3U5PA 1M5Q1 3J7AF 4MZTA 3CC4T 5CCAA 2LT1A 2BKDN 1VQNA 1VQPA 1BYMA 1NPPA 4PCIA 4R55A 5KTWA 5DKHA 4A53A 3CBMA 3AHUA 5FE9A 4Z93A 2EJ9A 3FDRA 2QXFA 5DYXA 3LQJA 2XDDA 4BY6C 3V7RA 4YYDA 2HQXA 1N8RU 1BIBA 5GAMe 3J80E 4N4GA 4LDFA 2MWOA 4ELZC 3QSUA 3HMFA 3FB9A 5FB1A 1YJNT 4ZGDB 1K73U 1MHNA 4OGIA 2YEMA 4QR5A 4BUGA 4M78C 4FLPA 2DTHA 3SWNB 4WF2A 4IURA 4QSVA 4A54A 4LZRA 1VQ4T 4HA8A 2OTJT 2DKGA 5E9LA 4PJOF 3S3OA 2IVWA 3L2RA 4C92B 4HT8A 3HP9A 5E3GA 4QSTA 5HQ5A 4NUCA 5CPEA 2LSPB 3JCMV 3S6WA 3KUFA 2R57A 4M7DB 3G7ZA 4KUIA 1JB0E 4CRIA 4FIBA 3CCLT 2V8IA 4JLIA 4LYSA 5GAMf 2DVEA 5GAN4 5D6WA 4MR6A 2DVSA 3OYCA 3LXJA 4E47A 4MR5A 3Q2FA 3LX7A 3CXCS 5GAMd 5FG6A 3JCMQ 3JSCA 2CZ6B 5BT5A 3OYYA 2JOYA 1VQMT 3HFNA 5E9IA 3CD6A 4C66A 3SVHA 5GAMg 3U5NA 5IAYA 4RVRA 4A4HA 3CCRA 2RI2A 3L2QA 4A9MA 4PJOC 2CS7A 3JB9I 5CQXA 3ME9A 5AD3A 2QI2A 1VQKA 5A5QA 4QUTA 5DKCA 2R0YA 4YYMA 2DXTA 4TVRA 3OB9A 5DLQE 3GOXA 3G0JA 4D6WA 1UEBA 4UYGA 2XICA 2I7KA 4TZ2A 3TU4K 4NRAA 5LJ2A 3WVEB 4N4HA 4QEWA 3UVDA 2KMTA 4YYKA 1NJIU 1UB4A 2OO1A 5EG2A 4TTEA 2X4YA 1Y96B 3GNFB 2EQUA 3FEOA 4A9JA 3DAIA 3CCST 5C85A 4M78G 3CC7A 1KQSS 1K9MC 4YBSA 5G4SA 5L8UA 5FBXA 3JCMh 2EJFA 2WP1A 4UIWA 5IT9E 5C89A 5A83A 1WGSA 4NRBA 4BI8B 5GMKl 4IOQA 1M1FA 5F62A 1KD1U 3H6ZA 2PQWA 4XU3A 3DWYA 5FE7A 4PKCC 4GPJA 3HHTB 2LVMA 4RKUE 1WUGA 4Q0OA 4WIVA 5F60A 1NZ9A 3RKYA 3VJPA 2VXEA 3L1AA 1Q86C 4KV4A 4QC1A 3P1EA 5CUCA 3PGGA 4MMLA 4BHWA 2V8JA 2DK3A 4BACA 3HRTA 5EICA 1VQ8T 1YCYA 5FG4A 4O76A 1YHQA 3SB2A 4C5EA 4HXPA 1VIEA 2K4YA 3VUBA 1UGSB 1BI0A 3AQAA 3JVLA 2QQSA 4PJOG 2WSFE 3VUZA 3HMHA 5EWDA 3O34A 3PMIA 3U5JA 2K5LA 4P5NA 1XNIA 2E7OA 5A82A 5DKDA 1G5VA 4VUBA 4A9NA 5C6SA 4Z1SA 1VQOT 3G4ST 1W2BA 4QC3A 2CKKA 2R0VA 2E5QA 4QSWA 5CQ3A 3CCET 4MEPA 1AHJB 3P1FA 5I88A 3OSVA 2K5IA 5GMKm 2E6ZA 5GAN2 3RKWA 4C0DB 5GAN5 4PNOA 4C67A 4OB1B 2KY9A 5D3HA 1XQHA 4A9LA 2DD4A 4B9XA 3FKMX 5FE5A 3CCVA 3L42A 3QJYA 3I55T 2QTXA 5FE6A 1ZBXA 2RA2A 5I2SA 2K2VA 5KE2A 4A9EA 3M59A 3X28B 4MDXA 4O7AA 2MMPA 4QUUA 2CZ0B 4J5YA 3RKXA 5TCMA 5IG6A 5EV9A 2RD1A 4YABA 2FHDA 4R56A 3FLGA 5HK0A 1H3ZA 5HRVA 1VQ6T 4M7AF 3CCMA 4YATA 1KQ1A 2QDYB 5HQ7A 2YDWA 5F36A 3JVJA 5CO7A 1M1GA 2D9EA 3O35A 5EM3A 1RI0A 1YJWA 3E19A 4DA4A 2JZ2A 5L8TA 1KHIA 2YYNA 5CU8A 2NLUA 2PUKB 2ZPGB 4FU6A 4NR7A 5J39A 4EMKC 4Q5WA 2EJGA 2GCXA 5HJCA 3Q1JA 5EISA 2RFJA 3O37A 4II1A 2JN0A 5FRMA 1YITA 5L97A 1UGPB 1UGQB 5LJ3h 3QPHA 2P0KA 4HBXA 3LQIA 2YEKA 1X01A 2PU9B 1VQ7A 4BDYA 3DLMA 5A5SA 3V8KA 5E9KA 1BI2A 3VU3C 4QSRA 4FL6A 4HCCA 3L2VA 5KO4A 2DAQA 2DTOA 3CPWS 5E9YA 4M7AC 2L5EA 2E41A 3R6OA 3QYHB 4EPCA 2EYQA 1M90C 4QW2A 2L85A 5GAN8 4XQ3A 5FU7B 3BDLA 2DO3A 2QEXT 5FE0A 4LYWA 3OYJA 5HKCA 3QDRB 4M77F 5CQ6A 1OZ3A 4JLGA 4MZMA 2R10A 1IREB 4UIVA 5L98A 1BKBA 2O4XA 2HQEA 1RL2A 3AADA 4KUDK 3GLXA 3MO8A 3FC3A 4QSXA 5D25A 1VIFA 2K3XA 3QYGB 5A2QE 4NUDA 4N0AA 4C0ZA 4N4FA 2E12A 4C0GA 5D6XA 4OVAA 4E7HA 2VV5A 1PSFA 4ZN3A 5E0RA 4F7UA 5DW2A 4M75F 4BJXA 5E74A 5ACYA 1LOJA 3GNGA 5EWCA 4UYFA 1D3BB 3JRZA 2DTIA 2E64A 2G3RA 4HBYA 3JCMe 1JM4B 3KXTA 4PS5A 2PVOB 3CCRT 1VUBA 4X9DA 5HRWA 5CQ8A 1Q7YU 5F2PA 3M5AA 2LCCA 4XY8A 4M77C 4X34A 3UWNA 2RHUA 3MEVA 5GAOl 3I3JA 4QEUA 2Y4YA 2RHIA 3QZ5B 1QP3A 4DQ2A 4EMKB 4C5IA 1NE8A 1R8OB 1YI2A 2VC8A 4YTLA 3P5OA 1I8FA 1B34A 2D0QB 4A9HA 4M7AA 5CKFA 4C0FA 5ETBA 4E7IA 4M75C 3JCMf 2WP2A 2M9UA 4ZC9A 5E9MA 3ZBDA 4KULA 1VQ9T 4M7AG 3PFSA 3OYGA 3M56A 4PLIA 3CCUA 3JCMd 3OYDA 5E3DA 2E65A 3C12A 5LKZA 2RI7A 2IG0A 3OW2S 2GQVA 2VUBA 3A8LB 4A9OA 5ENJA 3JCMg 4NR8A 5FE8A 5CGPA 1N8RC 3X25B 4EMHA 4CI0C 5I2MA 3MXFA 2ZPEB 5DY9A 4RMOA 4QSQA 1K73C 5LJ0A 2VGMA 4NYVA 4LDUA 5M9OA 2DZ9A 5I29A 4M78E 3OYHA 5L96A 3HFOA 4DOWA 5CR2A 2DJZA 5F63A 1I4K1 4BE0A 4XK8E 2LNVA 5BT4A 5IGMA 4AKNA 5LJ3j 5AMEA 5D3NA 3CCQA 2AHJB 3OYLA 2XK0A 1O75A 1JJ2A 3OS5A 5KCHA 4LZSA 5EP7A 1XOVA 4E7JA 4PCEA 4XTVA 2KTBB 3ONIA 4UIUA 5GAOm 4A9IA 3CEYA 5CVIA 4M77A 5FDZA 3M4GA 2RO1A 3META 2RHXA 3MEWA 1Q81U 4YYGA 5D7XA 4IOOA 1O9SA 2RNYA 5CY9A 4M77G 4M7DA 1OZ2A 2ZPFB 3OS2A 3JCMX 5FB0A 4Z1QA 3MUKA 5TB6A 1UGRB 3N5BB 4M7AD 1K8AU 4XUBA 5GAOn 4XTZA 2GFUA 5EPBA 2DPPB 2YLCA 4MR4A 4ZQLA 3RMQA 5CQYA 4HXMA 4M75A 5EQ1A 3P8BB 5I7XA 3CBOA 4ALGA 2WSEE 4JS4A 3BDUA 4YC9A 1QVGS 5LVQA 2LTOA 2XD0A 1G3SA 3DLLA 4JDSA 4PJOE 4M75G 1KC8U 5KE3A 2P4TA 5COIA 2E7NA 4X2IA 4X9CA 5I1QA 3U5LA 2E10A 2ZPIB 4QSPA 4O7FA 5D3RA 4IUPA 4ZN1A 2QA4T 3CMET 1EQFA 5CRZA 2KDSA 1YIJT 5A5RA 1NJIC 3QKJA 3H8ZA 3LW5E 1N72A 4BDZA 1YJ9T 4J3IA 2MF2A 4PKLA 5E7DA 1VQLA 5FE2A 1S72T 1Y96A 2JTFA 2P0PA 5CKHA 4M77D 1ZHIA 5A5OA 5DYAA 5C8GA 5HM0A 2WACA 4BY6B 5HFRA 1DJ7B 3OYNA 4GLKA 5CTLA 4NQNA 4M7DD 5DYUA 5LKXA 1KD1C 2D82A 3V7CA 5LJ3f 4M78B 4ZTJA 4BW1A 1U1TA 3E9FA 1W4SA 4E7LA 2OUOA 2QQRA 5KTXA 2X4XA 2K57A 3A5ZB 4FT2A 1U1SA 5LJ3d 4QZSA 4LC2A 3WXMB 2RH2A 2F6JA 2QQBA 4TS8A 3MEAA 4M75D 4DOVA 5JI8A 3MEUA 4PY6A 3VV0A 3CC4A 5LJ3g 3QBYA 4WHWA 2OTLT 1QVFS 3RESA 2RJFA 5EPRA 3G6ET 5AYFA 3MQMA 5LVRA 3CMAT 3E9GA 2XI9A 5DLXA 5FRNA 1TH7A 1ZS5A 4Y03A 4UYHA 3NXBA 2G4AA 5ENGA 2XDBA 1WPYA 4QSUA 1YJNA 4ZGJB 5CZGA 5FFVA 2O01E 5CKBA 4KCXA 5CKDA 4JRIA 1QP2A 4NYWA 5H1VA 2NXBA 3NTHA 2X4JA 1VQ4A 3A8GB 5DBMA 2OTJA 3MP1A 4LDVA 3LWIA 4N3WA 5I40A 4IUTA 1LNXA 4J6YA 4PJOB 4IUUA 4FT4A 5FE3A 2JVVA 5A0GA 3G71T 3MB4A 3MP6A 5CKEA 3I56T 3UT1A 4LRGA 3UVXA 4NR4A 3SD4A 3Q2EA 3WVDB 5CUBA 5ETDA 3CCLA 4F7UF 2CZ1B 3CC2T 3JCMW 4TT4A 4HXSA 5I7YA 2LC4A 5LJ5h 3JAME 2XIDA 2BIVA 4QVDA 1WNLA 4J0SA 3MB3A 1HK9A 3U5KA 1JBMA 4O70A 3BFMA 1LJOA 3X26B 4HKEA 3LJWA 5GANh 1VQMA 3JB9J 4YYNA 4DONA 3V8JA 2GFAA 2B8AA 4TZ8A 2HAXA 4PTBA 4HXKA 3CCJT 4QVZA 1QW1A 1VQ5T 1X6OA 5HELA 5II1A 2OAUA 3RIRA 4C8QF 4J7FA 3UV2A 4UC4A 4QQDA 3QXEB 4N0AC 2E3KA 1FWZA 5CAIA 3L2ZA 1X0JA 5HCLA 4CL9A 3HL8A 4NL2A 3OBWA 5EA1A 1JSPB 5DLZA 4IUVA 5ENBA 4FM4B 3IU5A 4J7IA 4MR3A 5F5ZA 4J8OA 5EK9A 1M4ZA 3QZVA 5FU6C 4YYHA 4CUPA 4O74A 4ZW1A 3RUXA 4BW2A 3PIOA 3O8VA 1VQNT 1VQPT 3CCSA 4CFKA 3JB9F 5HRXA 2EQJA 1MGQA 3OMCA 3UW9A 1M9SA 4MEOA 4O75A 5D3SA 3LGFA 4V2SA 5H1UA 5I83A 2MI6A 3E1SA 5ENHA 4ME7A 4JRPA 3CXCA 4OB0B 5IBNA 1M8VA 4F3IA 1QVGA 2XDPA 4OGCA 4C8QC 4TU4A 5H1TA 5I86A 4M7AE 3ZYUA 4BW4A 2JUFA 3MCAB 2ZZDA 4J1PA 3UPUA 5GMKh 4UYEA 3M9QA 2DXCA 3G0LA 5II2A 4HCZA 5EI4A 5LKTA 2HNIA 4OB2B 3C4SA 4TYLA 2MWPA 4C92F 4MENA 3K2JA 4OP0A 4UITA 4BD3A 4BE2A 4CUUA 5CIUA 5G4RA 5H85A 2XHCA 1VQ8A 4M7DF 5CS8A 2RNXA 2E1HA 1Q82U 4QYLA 4XY9A 4BB7A 2DEQA 3QIIA 5CQ5A 5FE4A 4QBMA 3OS1A 2H3JA 3GG3A 5EPSA 5FG5A 1U8RA 4KBMB 1H641 5DM7R 2L5QA 4RG8A 2H60A 3JCMc 1KQSA 2PVDB 1D3BA 2Y4XA 2KSSA 5LUUA 1Q7YC 1VQOA 3G4SA 4F7UG 3CD6T 4M77E 2XG8D 4A4EA 2E70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6Z A;  2PQW A;  2DVR A;  3OQ5 A;  3DWY A;  2DKW A;  4YYG A;  5FE7 A;  5D7X A;  2R5A A;  4IOO A;  2RNY A;  5CY9 A;  1OZ2 A;  4GPJ A;  3OS2 A;  4C5H A;  5FB0 A;  2LVM A;  2RO0 A;  2DWW A;  4Z1Q A;  4TT6 A;  3MUK A;  1WUG A;  4O7B A;  5A7C A;  4Q0O A;  3TLP A;  5IGN A;  4WIV A;  5F60 A;  4TQN A;  5TB6 A;  3OYI A;  4KV4 A;  2DVQ A;  4QC1 A;  3P1E A;  5IGK A;  2DIG A;  5DFD A;  5ENF A;  3UVY A;  4XUB A;  5CUC A;  4YYJ A;  5C7N A;  4CUQ A;  4QYD A;  3DB3 A;  2GFU A;  5EPB A;  5FH6 A;  4BHW A;  4YAX A;  3S91 A;  2LDM A;  5D3L A;  4MR4 A;  4ZQL A;  2YRV A;  5E9V A;  3OYM A;  4BAC A;  4HXM A;  5CUD A;  5EQ1 A;  4TT2 A;  5I7X A;  4ALG A;  5EIC A;  5I80 A;  4OGJ A;  2RJD A;  5FG4 A;  4GY5 A;  4LR6 A;  4YC9 A;  4O76 A;  5CUG A;  4Z6I A;  5IGL A;  5LVQ A;  2LTO A;  3ASK A;  3LLR A;  3LQH A;  4C5E A;  4HXP A;  2DIQ A;  1E6I A;  5CUA A;  5HEM A;  4CUS A;  4IR5 A;  4A4E A;  4A4G A;  3AQA A;  3JVL A;  5DFC A;  5KE3 A;  5FH7 A;  2QQS A;  4NR6 A;  5COI A;  2E7N A;  4X2I A;  3UV4 A;  5I1Q A;  3HMH A;  2YW5 A;  5EWD A;  3O34 A;  3U5L A;  4QSP A;  2RNW A;  3PMI A;  3U5J A;  4CUR A;  2MJV B;  4O7F A;  5D0C A;  5D3R A;  4IUP A;  1XNI A;  2M0O A;  2E7O A;  3P1C A;  5A82 A;  5DKD A;  2YEL A;  1G5V A;  4A9N A;  1EQF A;  4IR3 A;  5CRZ A;  4BW3 A;  3MUL A;  5A5R A;  2F6N A;  5C6S A;  5HLS A;  4Z1S A;  4QB3 A;  5CUE A;  3U5M A;  2R5M A;  3H8Z A;  3QKJ A;  5IID A;  4QC3 A;  2CKK A;  4L59 A;  1N72 A;  4BDZ A;  5CFW A;  2N9G A;  4J3I A;  4O71 A;  5CQ4 A;  2R0V A;  4PKL A;  3UV5 A;  2E5Q A;  3OS0 A;  5EWW A;  4A9K A;  4QSW A;  5E7D A;  5HQ6 A;  5KTU A;  5CQ3 A;  4MEP A;  3NTI A;  3PMT A;  3OY9 A;  2RI3 A;  5FE2 A;  5D26 A;  5FFW A;  5L99 A;  3P1F A;  5I88 A;  2JTF A;  2I8N A;  4NS5 A;  4HBW A;  5DFB A;  1SSF A;  4E96 A;  4Z02 A;  3O36 A;  4NQM A;  4RG2 A;  5A5O A;  5DYA A;  5C8G A;  5HM0 A;  2WAC A;  2DVV A;  5HFR A;  4HXL A;  3S92 A;  3OYN A;  3SVF A;  3OMG A;  3LGL A;  5CTL A;  4YAD A;  4C67 A;  4NQN A;  1KHC A;  5DYU A;  2O4X B;  5FRO A;  1WJQ A;  5LKX A;  5D3H A;  5DYC A;  4HBV A;  2EQM A;  4YY6 A;  3EAE A;  4A9L A;  2D82 A;  4YY4 A;  5ENI A;  4B9X A;  5AD2 A;  3FKM X;  5FE5 A;  4ZTJ A;  4BW1 A;  3E9F A;  5KCO A;  3L42 A;  4E7L A;  2LRQ A;  5FE6 A;  4ALH A;  2OUO A;  4NYX A;  5HEN A;  4CUT A;  2QQR A;  5KTX A;  4UYD A;  4WHU A;  2X4X A;  2K3Y A;  3UVW A;  5LKU A;  5KE2 A;  5F61 A;  4QZS A;  4A9E A;  5K29 A;  4LC2 A;  2BUD A;  4YH4 A;  4O72 A;  4QR3 A;  2F6J A;  4NUE A;  4O7A A;  4QUU A;  4TS8 A;  3MEA A;  5TCM A;  5JI8 A;  5IG6 A;  4PY6 A;  5EV9 A;  2VYT A;  3MEU A;  4NR5 A;  2F5K A;  3QBY A;  4WHW A;  5LJ1 A;  4YAB A;  4YYI A;  2FHD A;  3FLG A;  4QY4 A;  4UYF B;  5ENC A;  1H3Z A;  5HRV A;  2R58 A;  2RJF A;  5EPR A;  5ENE A;  4YAT A;  3S3N A;  4MEQ A;  4UIZ A;  5HQ7 A;  2RJE A;  3MQM A;  2YDW A;  5LVR A;  5F36 A;  3JVJ A;  4HXO A;  3E9G A;  2D9E A;  3O35 A;  5EM3 A;  1RI0 A;  4IKF A;  5EVA A;  4B9W A;  4A9F A;  4LD6 A;  3SVG A;  5DLX A;  5FRN A;  2JZ2 A;  5L8T A;  2X4W A;  5KU3 A;  1ZS5 A;  3QJ6 A;  5JWM A;  2YYN A;  5CU8 A;  2NLU A;  3NTK A;  4FU6 A;  4Y03 A;  4NR7 A;  5J39 A;  4UYH A;  5BT3 A;  1OI1 A;  5E73 A;  3NXB A;  4Q5W A;  2G4A A;  5ENG A;  4LYI A;  4QSU A;  3OYE A;  5HJC A;  3D7C A;  4XYA A;  3Q1J A;  5EIS A;  5CZG A;  2RFJ A;  5FFV A;  3O37 A;  1OYX A;  4KCX A;  4II1 A;  4YBT A;  5FRM A;  5FH8 A;  5L97 A;  4NYW A;  5H1V A;  2EFI A;  2NXB A;  3NTH A;  5J26 A;  5FFY A;  4IR4 A;  4TU6 A;  4O78 A;  2OSS A;  5C87 A;  2P0K A;  3HME A;  1WJS A;  4QQG A;  5DBM A;  4HBX A;  3LQI A;  3MP1 A;  2YEK A;  4N3W A;  5I40 A;  4UIY A;  5CRM A;  4IUT A;  2RI5 A;  4BDY A;  3DLM A;  5A5S A;  4IUU A;  5E9K A;  5FE3 A;  2GF7 A;  1WUM A;  5DX4 A;  4J0R A;  5EWH A;  5CQT A;  2L3R A;  4LZ2 A;  3MB4 A;  4A4F A;  3MP6 A;  4QSR A;  4FL6 A;  3L2V A;  2M1H A;  5KO4 A;  2M16 A;  4UIX A;  3UT1 A;  4LRG A;  5D3P A;  3UVX A;  2DAQ A;  2X35 A;  4NR4 A;  5E9Y A;  3SD4 A;  2L5E A;  4E7K A;  3Q2E A;  3S3M A;  5CUB A;  5ETD A;  4NXJ A;  3P1D A;  5F3A A;  4QW2 A;  2L85 A;  5C4Q A;  3MP8 A;  3U5P A;  4O7C A;  2RHY A;  3BDL A;  4KV1 A;  5C0M A;  4TT4 A;  4O77 A;  5FE0 A;  2BKD N;  4HXS A;  5I7Y A;  4LYW A;  3OYJ A;  4PCI A;  2BIV A;  5CQ6 A;  1OZ3 A;  2RS9 B;  4J0S A;  5KTW A;  2R10 A;  5DKH A;  3MB3 A;  4UIV A;  3U5K A;  5L98 A;  2O4X A;  2HQE A;  5FE1 A;  4O70 A;  4NR9 A;  3AAD A;  5FE9 A;  4Z93 A;  3FDR A;  5DYX A;  3LQJ A;  3LJW A;  4N4I A;  4YYD A;  4DON A;  4YYN A;  3MO8 A;  2HQX A;  4QEV A;  3FC3 A;  4QSX A;  5D25 A;  2GFA A;  2K3X A;  4N4G A;  3QZS A;  4LDF A;  4HXR A;  2MWO A;  4NUD A;  2B8A A;  3HMF A;  5FB1 A;  4TZ8 A;  5KH6 A;  4PTB A;  4N4F A;  4HXK A;  1MHN A;  4OGI A;  4QVZ A;  2YEM A;  5HEL A;  5II1 A;  4QR5 A;  5D6X A;  5F1H A;  5D3J A;  4OVA A;  4E7H A;  4FLP A;  3UV2 A;  4QQD A;  4UC4 A;  2E6N A;  3P8D A;  5E0R A;  2RHZ A;  5DW2 A;  4BE1 A;  4IUR A;  4QSV A;  4BJX A;  4LZR A;  3DB4 A;  5E74 A;  4NRC A;  4EDU A;  5ACY A;  2E3K A;  2EKO A;  5EWC A;  4UYF A;  5E9L A;  4Q0N A;  2G3R A;  4HBY A;  1JM4 B;  1X0J A;  3S3O A;  5HCL A;  4CL9 A;  3L2R A;  4PS5 A;  5E3G A;  4QST A;  5HQ5 A;  4NUC A;  5CPE A;  5EA1 A;  1JSP B;  2LSP B;  5DLZ A;  4IUV A;  4ZTF A;  5J0D A;  5HRW A;  3S6W A;  5ENB A;  2L84 A;  5KHM A;  5CQA A;  3IU5 A;  3IU6 A;  4QR4 A;  5CQ8 A;  5A5N A;  2R57 A;  3KUF A;  5F2P A;  3QZT A;  4MR3 A;  2LCC A;  4XY8 A;  4Z6H A;  5AMF A;  2R0S A;  5F5Z A;  1N27 A;  4CRI A;  4X34 A;  3UWN A;  5EK9 A;  2FSA A;  2RHU A;  3QZV A;  3MEV A;  4IR6 A;  3I3J A;  4QEU A;  2RHI A;  4YYH A;  4CUP A;  2YQD A;  4O74 A;  4ZW1 A;  4BW2 A;  4LYS A;  4IOR A;  5EU1 A;  5A5P A;  3O8V A;  3PNW C;  5D6W A;  4CLB A;  4CFK A;  4MR6 A;  2DVS A;  1WJR A;  3OYC A;  5HRX A;  2EQJ A;  3LXJ A;  3OMC A;  3UW9 A;  4C5I A;  4MEO A;  4O75 A;  5D3S A;  3LGF A;  5H1U A;  5I83 A;  5EGU A;  4MR5 A;  3Q2F A;  3LX7 A;  3LH0 A;  5ENH A;  3P5O A;  4C5G A;  4YK0 A;  3U5O A;  5FG6 A;  5A85 A;  4OUF A;  5D24 A;  5IBN A;  2DAT A;  5BT5 A;  4XUA A;  5F1L A;  3RCW A;  4F3I A;  3LYI A;  3OYA A;  2XDP A;  4YH3 A;  5DY7 A;  3F70 A;  4TU4 A;  4A9H A;  4QNS A;  5H1T A;  4YBM A;  5I86 A;  5E9I A;  4C66 A;  3SVH A;  5ETB A;  4E7I A;  3U5N A;  3OYK A;  2WP2 A;  3ZYU A;  4QQ6 A;  5IAY A;  4RVR A;  4ZC9 A;  5E9M A;  4QSS A;  4BW4 A;  2RI2 A;  4A4H A;  3L2Q A;  2EQK A;  2D9T A;  3L2U A;  4J1P A;  4A9M A;  3PFS A;  3OYG A;  4PLI A;  2GRC A;  3O33 A;  4UYE A;  3OYF A;  3M9Q A;  3ME9 A;  5AD3 A;  3OYD A;  5E3D A;  5A5Q A;  2L8D A;  3G0L A;  5II2 A;  4QUT A;  5LKZ A;  4HCZ A;  5EI4 A;  2RI7 A;  2IG0 A;  5LKT A;  1F68 A;  5DKC A;  3C4S A;  5HFQ A;  4TYL A;  4A9O A;  3JVM A;  5ENJ A;  2R0Y A;  4YYM A;  2MWP A;  4NR8 A;  3OB9 A;  3GOX A;  4MEN A;  3K2J A;  5FE8 A;  5CGP A;  3G0J A;  4PLL A;  4UIT A;  4BD3 A;  5DW1 A;  5CQ7 A;  4UYG A;  2I7K A;  4TZ2 A;  4CUU A;  3MXF A;  5CIU A;  4BE2 A;  4NRA A;  5LJ2 A;  5G4R A;  4N4H A;  5H85 A;  4QEW A;  3UVD A;  4QSQ A;  4YYK A;  2OO1 A;  5CS8 A;  5LJ0 A;  2RNX A;  4NYV A;  4QYL A;  4TTE A;  4XY9 A;  5M9O A;  3QII A;  2X4Y A;  5CQ5 A;  5FE4 A;  4QBM A;  5I29 A;  2L89 A;  3OS1 A;  2EQU A;  3FEO A;  4A9J A;  3GG3 A;  5I89 A;  3ZEH A;  3OYH A;  5L96 A;  3JVK A;  5EPS A;  5F63 A;  4BE0 A;  5FG5 A;  5BT4 A;  3DAI A;  5C85 A;  5IGM A;  4O7E A;  5D6Y A;  5F25 A;  5A81 A;  4AKN A;  2H60 A;  4PL6 A;  5AME A;  4IUQ A;  5D3N A;  4HXN A;  4YBS A;  5G4S A;  3OYL A;  5L8U A;  2XK0 A;  2RJC A;  3P8H A;  5KCH A;  4LZS A;  5EP7 A;  5FBX A;  3OYB A;  4E7J A;  4PCE A;  2WP1 A;  2KTB B;  3ONI A;  4UIW A;  5CP5 A;  5EWV A;  4UIU A;  4A9I A;  3CEY A;  5C89 A;  5LUU A;  5A83 A;  1WGS A;  4CFL A;  4NRB A;  3OA6 A;  5FDZ A;  4IOQ A;  2RO1 A;  3MET A;  2RHX A;  3L2W A;  5F62 A;  3MEW A;  5IN1 A;  5D3T A; 
#chains in the Genus database with same CATH topology
 4J6X A;  1VQN Q;  2DVR A;  1D1A A;  1MV0 B;  3CCE A;  1B3Q A;  4AKH A;  5CK9 A;  3GP8 A;  2FL7 A;  1UGV A;  2P84 A;  4C5H A;  2RO0 A;  4C92 C;  1P92 A;  4TT6 A;  2DZC A;  2HEQ A;  4OGE A;  1TTH B;  1X27 A;  3TLP A;  5IGN A;  2AZS A;  5AT1 B;  1VQK T;  2FG0 A;  5DLO A;  5LJ5 j;  2KAF A;  3UAT A;  2DVQ A;  4DBF A;  1QVF A;  5IGK A;  1X75 C;  2DIG A;  5ENF A;  4M7D C;  3JCM J;  2V1R A;  2X3W D;  5C7N A;  4CUQ A;  4QYD A;  4OMP A;  4RCB A;  1D0Y A;  5FH6 A;  3RER A;  2KRN A;  4B6M A;  4C8Q A;  1QKX A;  3S91 A;  2EYX A;  4J9D A;  2LDM A;  2JXB A;  1VQL T;  5E9V A;  3OYM A;  3URG A;  1M1K U;  2YDL A;  5CUD A;  3BY7 A;  5GAN j;  4TT2 A;  4M75 E;  3GBQ A;  5I80 A;  4OGJ A;  2RJD A;  4C8Q G;  4LR6 A;  2FB7 A;  5CUG A;  4Z6I A;  2I2L A;  1X6B A;  3ASK A;  2D6F A;  4LDW A;  3I55 A;  2KVQ G;  2DIQ A;  1E6I A;  5HEM A;  4CUS A;  2PZ1 A;  2CYZ B;  1BI1 A;  4ZGE B;  5FH7 A;  1T0H A;  4AI6 A;  1E6H A;  4XTY A;  1Y71 A;  2HKQ B;  3RMS A;  3CC7 T;  2DD5 A;  3GIB A;  5KYY A;  3TEE A;  2NUT A;  2RNW A;  3DKM A;  2DFU A;  4CUR A;  2EGA A;  5D0C A;  2MOX A;  1TSF A;  3TRE A;  1B34 B;  2YEL A;  2KXC A;  5GAN 6;  1FMW A;  3HRU A;  1VQ6 A;  4OMM A;  1I1J A;  3T9N A;  2CZ7 B;  4M7A B;  3MUL A;  1MMN A;  3HTR A;  1W2B S;  5CUE A;  2R5M A;  5IID A;  2EWN A;  1IHW A;  5CFW A;  4O71 A;  3QUI A;  2MCN A;  3PIP A;  3OS0 A;  5EWW A;  4A9K A;  3QHS A;  1F1B B;  5HQ6 A;  4L6V 5;  4LNP A;  5KTU A;  3JB9 G;  1YCS B;  1C1A A;  2ZPH B;  3NTI A;  3PMT A;  4JZ3 A;  4XU1 A;  1M1K R;  2QQA A;  2NUP A;  2RI3 A;  5D26 A;  5FFW A;  4ELY C;  2EIF A;  1TUD A;  2WSC E;  4X1V A;  5DFB A;  1SSF A;  4E96 A;  4BI3 A;  3EH2 A;  4Z02 A;  3O36 A;  2RK1 A;  2LCL A;  4KH1 B;  5LJ5 e;  4JUV A;  2CP2 A;  3CD6 Q;  1QCF A;  3SVF A;  3OMG A;  2J6K A;  3M53 A;  5GAO r;  3SWN A;  1TU0 B;  2EQM A;  4O6J A;  3EAE A;  2AT1 B;  4YY4 A;  2RK2 A;  4DEY A;  1Q81 C;  5GAN 3;  1G3Y A;  1WDX A;  5GAN e;  3QO3 A;  3EFO A;  1YHQ T;  1VQK Q;  4LDX A;  4C92 A;  2LRQ A;  4ALH A;  1OEB A;  1WQW A;  5HEN A;  3RBB B;  5KYU A;  4UYD A;  4WHU A;  3UVW A;  4E7Z A;  5F61 A;  5GMK j;  1MMA A;  1KK7 A;  2FRY A;  2BUD A;  4C8Q D;  4C92 G;  4MMK A;  1K8A C;  4O72 A;  2KGT A;  3M57 A;  1VQL Q;  5FLX E;  2VYT A;  4NR5 A;  2QEX A;  2F5K A;  1TOV A;  5LJ1 A;  3M55 A;  4QY4 A;  4M7D G;  1MMG A;  5ENE A;  4OB3 B;  8ATC B;  2FVU A;  4M77 B;  4JRQ A;  2P0Q A;  4MEQ A;  4UIZ A;  1C0M A;  2RJE A;  3C0C A;  2VXF A;  5LJ5 f;  5EVA A;  3U23 A;  4LD6 A;  3UDC A;  1KC8 C;  1UJY A;  4J9G A;  5KU3 A;  2ABL A;  3QJ6 A;  1SRL A;  3EFR A;  5JWM A;  4MDW A;  3I5R A;  1IRX A;  1NYG A;  3NTK A;  2KQW A;  5GMK i;  2HSP A;  5E73 A;  1RAF B;  5LJ5 d;  2FPE A;  4LYI A;  5ECA A;  3OYE A;  3D7C A;  1MND A;  5GAN f;  2XKO C;  3X24 B;  1OYX A;  3JB9 D;  4YBT A;  1I81 A;  4XU0 A;  3REB B;  5LJ5 g;  1SRM A;  1PKS A;  1NEG A;  5FFY A;  5HY6 A;  3THK A;  3JCM b;  3NFC A;  4JJN K;  4M75 B;  9ATC B;  4QQG A;  1YNZ A;  5GAN d;  4RCC A;  1QQJ A;  3ZL7 C;  5LJ3 e;  4CC2 A;  4HVW A;  1SHG A;  5CRM A;  2RI5 A;  3OBY A;  2YRD A;  3TCJ A;  1WUM A;  5DX4 A;  3EGD A;  1K8A R;  5GAN g;  1RAE B;  3CCV T;  1JEG A;  2F5T X;  1AWO A;  1WQ7 A;  2M1H A;  3E2U A;  3CPW P;  5D3P A;  2Y90 A;  1AWW A;  2C0I A;  2GTJ A;  3CPW A;  5J3B A;  3A8H B;  3S3M A;  5GMK e;  4NXJ A;  5F3A A;  5C4Q A;  4FSS A;  3MP8 A;  4O7C A;  2RHY A;  2YSQ A;  4KV1 A;  5C0M A;  4O77 A;  3CBP A;  1NPR A;  2DL4 A;  4WCI A;  4C92 D;  1N6A A;  4LDY A;  3CCM T;  2RS9 B;  2DL8 A;  1YJN Q;  4Z88 A;  1G8X A;  2C06 A;  3INZ A;  2GBQ A;  1M3B A;  5FE1 A;  4NR9 A;  1UHC A;  1YJW T;  2QAS A;  2KK4 A;  1Q95 G;  2V8K A;  4J6W A;  1M3C A;  4F17 A;  4N4I A;  4C0D C;  4QEV A;  4M78 A;  3GF5 A;  2NWM A;  3QZS A;  3VS5 A;  4HXR A;  1GL5 A;  1Y0M A;  5KH6 A;  1PHT A;  3FJP A;  1ZLM A;  2KE9 A;  2PUO B;  1VQ9 A;  3EFS A;  2QQ9 A;  2CGH A;  3JCM P;  1CKB A;  4HVV A;  1YIT T;  5F1H A;  5D3J A;  5A0D A;  2E6N A;  3P8D A;  4ORZ A;  2RHZ A;  4BE1 A;  1Y7X A;  3DB4 A;  2GQI A;  4NRC A;  4EDU A;  2EKO A;  1VQ7 T;  2ED0 A;  4Q0N A;  4PJM A;  2VVK A;  1K9M U;  1WIE A;  1CKA A;  4ATO A;  1V29 B;  3VYH B;  1KIK A;  3M58 A;  4ZTF A;  1ZQ1 A;  1LCK A;  4NOY A;  5J0D A;  2L84 A;  2HBP A;  4EMG A;  5KHM A;  5CQA A;  3IU6 A;  4QR4 A;  5A5N A;  2DL5 A;  3QZT A;  3TSW A;  4Z6H A;  5AMF A;  2R0S A;  1N27 A;  2FSA A;  3MHX A;  4IR6 A;  3PVQ A;  3RDV A;  2YQD A;  2K5F A;  5A5P A;  3PNW C;  4IOR A;  5EU1 A;  2IPO B;  3PTA A;  4JRK A;  5D3T A;  4CLB A;  1WJR A;  4XTU A;  2EPD A;  5IHI A;  2QTV A;  4QVC A;  4OMO A;  5EGU A;  3CPF A;  4M4Z A;  4HT9 A;  1Q86 U;  3LH0 A;  3SFM A;  4C5G A;  4YK0 A;  3U5O A;  1QVP A;  5A85 A;  4OUF A;  5D24 A;  5F1L A;  2DAT A;  4E7S A;  4XUA A;  5A0L A;  2DXU A;  3VYG A;  3RCW A;  5GAO p;  3LYI A;  3KBG A;  3OYA A;  4PJO A;  4YH3 A;  5DY7 A;  3F70 A;  1N9R A;  4QNS A;  4J83 A;  4YBM A;  3SDZ A;  3JB9 H;  2LJ1 A;  1Y07 A;  3C94 A;  3J81 E;  3OYK A;  4QQ6 A;  1PUO A;  4QSS A;  2CP5 A;  2EQK A;  2D9T A;  2XU8 A;  3L2U A;  1XTD A;  2HBW A;  3CCM Q;  1U06 A;  1HXD A;  2RQU A;  2ZAE A;  1X6G A;  2GRC A;  5IXF A;  3O33 A;  3OYF A;  3OSS C;  3GPL A;  4PJN A;  4E2F B;  3QDF A;  3EG9 B;  2L8D A;  2A3L A;  1QWE A;  2DLP A;  4M78 D;  3OW2 P;  1F68 A;  5HFQ A;  3OW2 A;  3JVM A;  2L3S A;  5I22 A;  3FJ5 A;  2L3P A;  4PLL A;  3QG1 A;  3UA7 A;  5FU7 C;  5DW1 A;  2K6D A;  3CCS Q;  5CQ7 A;  1JRI A;  2HL3 A;  1PD0 A;  2LQ8 A;  3C95 A;  1YIT Q;  2RB6 A;  1D1B A;  2JM9 A;  3HSB A;  5GAM h;  1PSE A;  3FIF A;  3M0Q A;  3QZ9 B;  2L89 A;  2LQK A;  5I89 A;  3ZEH A;  1VQ7 Q;  3JVK A;  2A7Y A;  4O7E A;  2GNC A;  5D6Y A;  5F25 A;  5A81 A;  4PL6 A;  1SG5 A;  1SSH A;  1ZSZ A;  4IUQ A;  2CT3 A;  4HXN A;  1YI2 T;  1JJ2 S;  2HZY A;  2RJC A;  3P8H A;  2QA4 A;  3CME A;  4F7U E;  3OYB A;  4OMQ A;  5CP5 A;  1YIJ A;  5EWV A;  2BZX A;  1LVK A;  3VKI A;  1X2K A;  2CRE A;  4R0K A;  4CFL A;  2K3B A;  3OA6 A;  2ZPB B;  1YJ9 A;  4E6R A;  3L2W A;  5KYX A;  5IN1 A;  1JXO A;  2EYY A;  3OQ5 A;  2DKW A;  2R5A A;  1T3L A;  2YT6 A;  4CC4 B;  2DWW A;  1G3W A;  1I5L A;  2YHT A;  5A7C A;  4O7B A;  2NYS A;  3CCU T;  4JS5 A;  1S72 A;  2AK5 A;  4XU2 A;  1VQ8 Q;  4TQN A;  4PJO D;  3OYI A;  1G3T A;  5DFD A;  5GJW B;  3UVY A;  4YYJ A;  4A4K A;  3DB3 A;  1OV3 A;  2DXB A;  3PT9 A;  1I5O B;  2EAY A;  4YAX A;  4C8Q E;  2JTM A;  2YLB A;  5D3L A;  2DL3 A;  2YRV A;  1NM7 A;  2QK0 A;  2H3E B;  1NLO C;  4GY5 A;  1QVG P;  1OUL A;  2C0O A;  3LLR A;  5IGL A;  2LT4 A;  3A8M B;  1KG1 A;  3LQH A;  2YUO A;  5CUA A;  2OX7 A;  4IR5 A;  2BZY A;  4A4G A;  5DFC A;  1VQO Q;  2DYI A;  3G4S Q;  4NR6 A;  1KQ2 A;  3UV4 A;  4XAX B;  2YW5 A;  3M54 A;  2LCS A;  2AKK A;  2LX7 A;  1PRM C;  3CCQ T;  2MJV B;  3ZFJ A;  4Y91 A;  4F14 A;  2M0O A;  3P1C A;  1I07 A;  2OTL A;  4FW1 A;  3BW1 A;  4A63 B;  4IR3 A;  4BW3 A;  2VGN A;  2F6N A;  5HLS A;  4QB3 A;  3U5M A;  3G6E A;  4AT1 B;  1Q82 C;  4L59 A;  3CMA A;  2N9G A;  5CQ4 A;  3UF4 A;  5LL6 S;  3UV5 A;  1FMK A;  5I21 A;  4FCY A;  4AKG A;  3HKS A;  4LXC A;  2J7I A;  3LWH A;  1N9S A;  2JJ9 A;  3FRN A;  3OY9 A;  5L99 A;  4FYV B;  1WYX A;  1TWB A;  3ER0 A;  1IZ6 A;  2I8N A;  4NS5 A;  2EQI A;  4HBW A;  3V8L A;  4LUD A;  1BI3 A;  4NQM A;  4RG2 A;  4MZP A;  1M90 U;  2CP6 A;  2DVV A;  2FYK A;  4FSX A;  1RAD B;  4HXL A;  3S92 A;  2MAM A;  3LGL A;  1WLP B;  4YAD A;  1KHC A;  2VWF A;  4OMF B;  2O4X B;  3O5Z A;  1AZE A;  5FRO A;  1WJQ A;  5DYC A;  1PNJ A;  4HBV A;  3PVL A;  4YY6 A;  4XTW A;  4XTX A;  5ENI A;  1RLP C;  1WFW A;  2HKN A;  2ZGW A;  5AD2 A;  2JNG A;  4BI4 A;  2E5K A;  2RM4 A;  5KCO A;  1IHV A;  2L0A A;  3NMZ C;  3G71 A;  5GAN 7;  1N5Z A;  4C92 E;  3VRZ A;  1VQ6 Q;  4NYX A;  3SWN C;  4CUT A;  3I56 A;  5HK3 A;  1WHG A;  2K3Y A;  5LKU A;  5K29 A;  1BIA A;  2J06 A;  3X20 B;  4NL3 A;  4YH4 A;  4O5V A;  4QR3 A;  4NUE A;  2ZCF B;  1BCO A;  4M7D E;  4OF1 A;  2HD0 A;  3CC2 A;  1AWJ A;  4F7U B;  2RQW A;  1Q82 R;  1NG2 A;  1EZZ B;  4YYI A;  1X43 A;  1QVF P;  1TS9 A;  4UYF B;  5ENC A;  1YFN A;  1M1K C;  1PM3 A;  2R58 A;  2ENM A;  1M90 R;  3S3N A;  4EMK A;  1WHH A;  4RUG A;  2FPF A;  4HXO A;  5FU6 B;  4IKF A;  4B9W A;  4A9F A;  1FXX A;  3SVG A;  1EIF A;  4L5G A;  8AT1 B;  2PVG B;  2QDL A;  1PKT A;  2X4W A;  5L8R E;  5GAM j;  3HPW A;  4DBR A;  1FX7 A;  2YRC A;  3CCQ Q;  1GXI E;  5BT3 A;  1OI1 A;  2L2P A;  1GBR A;  4XYA A;  3CCJ A;  2K7A A;  3M4Y A;  1VQ5 A;  4HCB A;  5FH8 A;  2EFI A;  3V7S A;  4C8Q B;  4LD9 K;  5J26 A;  4IR4 A;  4TU6 A;  4O78 A;  2OSS A;  5C87 A;  3A8O B;  3HME A;  1WJS A;  1UHF A;  1QMC A;  2LX9 A;  4UIY A;  2BE7 D;  4AMC A;  4KT0 E;  4M78 F;  2GF7 A;  2QEX Q;  1ZUU A;  4J0R A;  1RAA B;  2FO0 A;  5EWH A;  5CQT A;  2L3R A;  4LZ2 A;  3HRS A;  4A4F A;  2DMO A;  4Y28 E;  1YBY A;  4KGV B;  2M16 A;  4UIX A;  2X35 A;  5KYY B;  2NUT B;  4E7K A;  5GAO q;  1J3T A;  3P1D A;  5EC7 A;  2F69 A;  1AD5 A;  2CP0 A;  3U5P A;  1M5Q 1;  1JXM A;  3J7A F;  4MZT A;  3VS7 A;  1ZUK A;  3CC4 T;  5CCA A;  2LT1 A;  2BKD N;  3VRY A;  2JS0 A;  1VQN A;  1VQP A;  1BYM A;  3PE0 A;  1NPP A;  4PFP A;  4PCI A;  4R55 A;  4FYY B;  5KTW A;  2JW4 A;  5DKH A;  4A53 A;  3CBM A;  6AT1 B;  3EG3 A;  3AHU A;  2ED1 A;  5FE9 A;  5FW9 A;  4Z93 A;  2EJ9 A;  3FDR A;  3NGP A;  4JJB A;  2EYZ A;  2QXF A;  5DYX A;  3LQJ A;  2FEI A;  2XDD A;  2CSQ A;  4BY6 C;  3V7R A;  4YYD A;  2HQX A;  1N8R U;  1BIB A;  1I0C A;  5GAM e;  3J80 E;  4N4G A;  4LDF A;  2MWO A;  4ELZ C;  1JU5 C;  3QSU A;  3HMF A;  3FB9 A;  5FB1 A;  1YJN T;  4ZGD B;  2KBT A;  1K73 U;  1MHN A;  4OGI A;  2DNU A;  3SEM A;  1SF9 A;  2YEM A;  1OU8 A;  4QR5 A;  4BUG A;  4M78 C;  1CSK A;  4FLP A;  2DX1 A;  2DTH A;  3SWN B;  4WF2 A;  4IUR A;  4QSV A;  4A54 A;  4LZR A;  1VQ4 T;  2CSI A;  4HA8 A;  2OTJ T;  2DKG A;  1WI7 A;  5E9L A;  4PJO F;  3S3O A;  2IVW A;  4AFZ C;  3L2R A;  4C92 B;  4HT8 A;  3HP9 A;  4J9B A;  2MK5 A;  5E3G A;  1MMD A;  4QST A;  5HQ5 A;  1X69 A;  4NUC A;  5CPE A;  2LSP B;  2NUZ A;  3JCM V;  3S6W A;  2JMA A;  2EJN A;  3KUF A;  2FRW A;  2R57 A;  4M7D B;  4CC7 A;  3G7Z A;  4KUI A;  1JB0 E;  4CRI A;  4J9H A;  1B7T A;  2D0N A;  1WHK A;  1N8R R;  4FIB A;  3CCL T;  2V8I A;  4JLI A;  3LH5 A;  4Y92 A;  4LYS A;  5GAM f;  2DVE A;  5GAN 4;  5D6W A;  4MR6 A;  2DVS A;  3OYC A;  3UA6 A;  3LXJ A;  2LJ0 A;  1U5S A;  1VQ9 Q;  1BBZ A;  4E47 A;  4MR5 A;  1WHJ A;  4JPB W;  3Q2F A;  1IGU A;  3LX7 A;  3CXC S;  5GAM d;  5FG6 A;  3JCM Q;  3JSC A;  2CZ6 B;  5BT5 A;  3OYY A;  2JOY A;  1VQM T;  3HFN A;  5E9I A;  4J9C A;  4C66 A;  3SVH A;  3CC4 Q;  5GAM g;  3CD6 A;  4KGZ B;  3U5N A;  5IAY A;  4F16 A;  2BZ8 A;  2SEM A;  4RVR A;  4A4H A;  3CCR A;  2RI2 A;  4DEX A;  3L2Q A;  4A9M A;  4PJO C;  1PG5 B;  2OI3 A;  2CS7 A;  3JB9 I;  4J9E A;  5CQX A;  3EGX B;  3ME9 A;  5AD3 A;  1Z9Z A;  2QI2 A;  1VQK A;  5A5Q A;  4QUT A;  3H41 A;  1VA7 A;  5DKC A;  3EGD B;  2R0Y A;  4YYM A;  2DXT A;  4TVR A;  3OB9 A;  5DLQ E;  3GOX A;  3G0J A;  2ATC B;  1D0X A;  4D6W A;  1UEB A;  4UYG A;  2XIC A;  2I7K A;  4TZ2 A;  1M2V A;  2ECZ A;  3NHN A;  3TU4 K;  4NRA A;  5LJ2 A;  3WVE B;  2AIR B;  1LPL A;  2CP3 A;  4N4H A;  4JJC A;  2DRK A;  4QEW A;  3UVD A;  2KMT A;  1WX6 A;  4YYK A;  1NJI U;  1UB4 A;  2OO1 A;  5IXB A;  5EG2 A;  4TTE A;  1UJ0 A;  2X4Y A;  1VQ4 Q;  1Y96 B;  3GNF B;  2OTJ Q;  2JTE A;  2EQU A;  3FEO A;  2HCK A;  4A9J A;  3MKD A;  3DAI A;  3CCS T;  5C85 A;  4M78 G;  1RAG B;  3CC7 A;  1KQS S;  2HQH A;  2DRM A;  1K9M C;  3NPF A;  4YBS A;  4D8D A;  5G4S A;  5L8U A;  5FBX A;  1D1C A;  2QGF B;  2EJF A;  2WP1 A;  3JCM h;  4UIW A;  1KFZ A;  5IT9 E;  5C89 A;  5A83 A;  1WGS A;  3CCL Q;  4NRB A;  1ZSZ C;  4BI8 B;  5GMK l;  4IOQ A;  1EFN A;  3D7S B;  2COW A;  1M1F A;  5F62 A;  1KD1 U;  1HD3 A;  3H6Z A;  2PQW A;  4XU3 A;  3DWY A;  5FE7 A;  4PKC C;  2A36 A;  1SPK A;  5KYN A;  2A28 A;  1TG0 A;  4GPJ A;  3HHT B;  2LVM A;  2DL7 A;  4RKU E;  5HCK A;  1WUG A;  4Q0O A;  1AT1 B;  2VAS A;  4WIV A;  5F60 A;  1NZ9 A;  3RKY A;  3VJP A;  2O31 A;  2VXE A;  3L1A A;  1Q86 C;  4KV4 A;  4QC1 A;  3P1E A;  1VQM Q;  5CUC A;  2F2V A;  2O9S A;  5KYW A;  3PGG A;  4MML A;  4BHW A;  2V8J A;  1EX4 A;  1MUZ A;  2DK3 A;  3VS6 A;  4BAC A;  4JZ4 A;  3H0H A;  3HRT A;  5EIC A;  1VQ8 T;  1YCY A;  5FG4 A;  4O76 A;  3EH1 A;  3TVT A;  1YHQ A;  3SB2 A;  1JQQ A;  4C5E A;  2QA4 Q;  4HXP A;  3H0I A;  1VIE A;  2K4Y A;  1YIJ Q;  3VUB A;  1K9M R;  1UGS B;  4IIM A;  1BI0 A;  3AQA A;  3JVL A;  2DM1 A;  2ROL A;  2QQS A;  4PJO G;  2WSF E;  3VUZ A;  1UUE A;  3EG1 A;  3VS1 A;  4LN2 A;  3HMH A;  5EWD A;  3O34 A;  4FYW B;  3PMI A;  3U5J A;  1UG1 A;  2K5L A;  4P5N A;  1XNI A;  2E7O A;  5A82 A;  5DKD A;  1G5V A;  4AFQ C;  2GTO A;  4VUB A;  1S72 Q;  4A9N A;  2RQR A;  5C6S A;  2KR3 A;  1W2B P;  4Z1S A;  2OJ2 A;  1K9A A;  2V26 A;  3G4S T;  1VQO T;  1W2B A;  4QC3 A;  2CKK A;  1YWP A;  3I9Q A;  2C0T A;  2O88 A;  4K11 A;  2R0V A;  3H0F A;  1IGQ A;  2E5Q A;  4QSW A;  5CQ3 A;  2CT4 A;  3CCE T;  3REA B;  4MEP A;  1Q86 R;  1BCM A;  2A37 A;  1E6G A;  2H8H A;  2KEA A;  2KRS A;  1AHJ B;  3P1F A;  5I88 A;  3OSV A;  1AEY A;  2K5I A;  5GMK m;  1TUC A;  2E6Z A;  5GAN 2;  3RKW A;  4C0D B;  5GJV B;  5GAN 5;  4PNO A;  4C67 A;  4FW2 A;  2EBP A;  4OB1 B;  2KY9 A;  5D3H A;  1XQH A;  4A9L A;  2DD4 A;  4B9X A;  3FKM X;  2J6O A;  5FE5 A;  3I5S A;  1UE9 A;  3CCV A;  3L42 A;  3QJY A;  1UEC A;  3I55 T;  1D09 B;  2QTX A;  4D8K A;  2AZV A;  5FE6 A;  1ZBX A;  2EVR A;  2RA2 A;  5I2S A;  2K2V A;  5KE2 A;  3G6E Q;  5IHK A;  4KRT A;  2O2O A;  4A9E A;  2BE9 B;  3CMA Q;  3M59 A;  2LMJ A;  2QG9 B;  3X28 B;  4MDX A;  4O7A A;  2MMP A;  4QUU A;  2CUB A;  2CZ0 B;  4J5Y A;  3RKX A;  5TCM A;  5IG6 A;  5EV9 A;  4RTY A;  1D0Z A;  1ZKR A;  2RD1 A;  4YAB A;  2FHD A;  4RTX A;  3FLG A;  1VYT A;  4R56 A;  2O9V A;  5HK0 A;  3M0R A;  1H3Z A;  5HRV A;  3MJX A;  1VQ6 T;  4M7A F;  3CCM A;  4YAT A;  3IQL A;  1KQ1 A;  2JMC A;  2QDY B;  1ABQ A;  5KYX B;  5HQ7 A;  2YDW A;  1HYO A;  1Z9Q A;  1AVZ C;  5F36 A;  3JVJ A;  5CO7 A;  1M1G A;  2D9E A;  3O35 A;  5EM3 A;  1RI0 A;  1YJW A;  3E19 A;  1YWO A;  3VS4 A;  4DA4 A;  2JZ2 A;  5L8T A;  2JS2 A;  2K79 A;  2BTT A;  1KHI A;  2YYN A;  5CU8 A;  2NLU A;  1W1F A;  1GBQ A;  2PUK B;  4NR7 A;  1WHL A;  2ZPG B;  4FU6 A;  4OML A;  5J39 A;  4EMK C;  4Q5W A;  3ULR B;  2DER A;  4AG2 C;  2EJG A;  4PJJ A;  2GCX A;  5HJC A;  1GFD A;  3Q1J A;  5EIS A;  2RFJ A;  7AT1 B;  3O37 A;  4II1 A;  2KRM A;  2DBM A;  2JN0 A;  5FRM A;  1YIT A;  1GRI A;  5L97 A;  2DA9 A;  2CP7 A;  1UGP B;  2COY A;  2RMO A;  1UGQ B;  2ROT A;  5LJ3 h;  3QPH A;  2P0K A;  5IHN A;  3EHR A;  3CCE Q;  4HBX A;  3LQI A;  1AZG B;  2YEK A;  1X01 A;  2PU9 B;  1VQ7 A;  4BDY A;  3DLM A;  5A5S A;  3V8K A;  3CC2 Q;  5E9K A;  3A98 A;  1BI2 A;  3VU3 C;  4DBH A;  4QSR A;  2EYW A;  2FPD A;  4FL6 A;  3L2V A;  4HCC A;  5KO4 A;  2DAQ A;  2DTO A;  3CPW S;  2KYB A;  5E9Y A;  2A08 A;  2RPN A;  4M7A C;  2L5E A;  2D1X A;  2E41 A;  3R6O A;  3M0T A;  3QYH B;  4EPC A;  2EYQ A;  1M90 C;  2F2W A;  4QW2 A;  2L85 A;  3EG0 A;  5GAN 8;  4XQ3 A;  5FU7 B;  2K2M A;  3BDL A;  2DO3 A;  2QEX T;  2M02 A;  5FE0 A;  4LYW A;  3OYJ A;  5HKC A;  2CH4 W;  3QDR B;  5D7U A;  4M77 F;  1ZX6 A;  2K9G A;  3I55 Q;  5CQ6 A;  1OZ3 A;  4JLG A;  4MZM A;  2R10 A;  1IRE B;  4UIV A;  5L98 A;  1BKB A;  1VQ5 Q;  2O4X A;  2HQE A;  1RL2 A;  3AAD A;  4PFZ A;  4KUD K;  4QT7 A;  2RNA A;  3MPU B;  2J05 A;  3GLX A;  3MO8 A;  3FC3 A;  1RAI B;  4QSX A;  5D25 A;  1VIF A;  2FZK B;  2K3X A;  4AKI A;  3QYG B;  5A2Q E;  4NUD A;  1PWT A;  2B86 A;  2DBK A;  2V1Q A;  4N0A A;  4C0Z A;  4N4F A;  2E12 A;  4C0G A;  1G2B A;  5D6X A;  4OVA A;  4E7H A;  2VV5 A;  1Y57 A;  1HJD A;  1PSF A;  4ZN3 A;  5E0R A;  4F7U A;  5DW2 A;  4M75 F;  4BJX A;  5E74 A;  5ACY A;  1LOJ A;  3GNG A;  5EWC A;  4UYF A;  1D3B B;  3JRZ A;  2DTI A;  2E64 A;  2G3R A;  4HBY A;  3JCM e;  1JM4 B;  2JM8 A;  3KXT A;  4PS5 A;  1VQP Q;  2PVO B;  3CCR T;  1VUB A;  4X9D A;  5HRW A;  5CQ8 A;  1Q7Y U;  5F2P A;  3M5A A;  2LCC A;  4XY8 A;  1E7O A;  4M77 C;  2DYB A;  1UDL A;  4X34 A;  3UWN A;  2RHU A;  3MEV A;  5GAO l;  3I3J A;  4QEU A;  1OX8 A;  2Y4Y A;  2RHI A;  3QZ5 B;  4RTT A;  2LQN A;  1QP3 A;  2RF0 A;  4DQ2 A;  4EMK B;  2DF6 A;  4KH0 B;  4C5I A;  1NE8 A;  1R8O B;  1YI2 A;  2VC8 A;  1WZO A;  2OAW A;  5I11 A;  4YTL A;  3P5O A;  2YWW A;  2HL5 C;  1I8F A;  1B34 A;  2D0Q B;  1OQK A;  2J6F A;  4A9H A;  4M7A A;  5CKF A;  4C0F A;  5ETB A;  4E7I A;  4M75 C;  3D1D A;  2WP2 A;  3JCM f;  2M9U A;  4ZC9 A;  5E9M A;  3ZBD A;  4KUL A;  1VQ9 T;  4M7A G;  3PFS A;  3OYG A;  3M56 A;  3VKG A;  1C6V X;  4PLI A;  1Q7Y R;  3CCU A;  2GGR A;  2KT8 A;  3JCM d;  2LP5 A;  3OYD A;  5E3D A;  2E65 A;  3C12 A;  5LKZ A;  2RI7 A;  2IG0 A;  3OW2 S;  4QKU A;  2GQV A;  4Z89 A;  1TUG B;  2VUB A;  3A8L B;  4A9O A;  5ENJ A;  3JCM g;  4NR8 A;  2DEU A;  1ABO A;  1T3S A;  5FE8 A;  5CGP A;  1N8R C;  3X25 B;  4EMH A;  4CI0 C;  2FZC B;  5I2M A;  3MXF A;  2ZPE B;  3D1B A;  2HSE B;  5DY9 A;  4RMO A;  4QSQ A;  1K73 C;  1QLY A;  5LJ0 A;  2VGM A;  1M8M A;  4NYV A;  2NUP B;  4LDU A;  5M9O A;  1BB9 A;  2DZ9 A;  1B07 A;  5I29 A;  1NEB A;  1YN8 A;  4M78 E;  1QWF A;  3OYH A;  5L96 A;  1RAH B;  3HFO A;  4DOW A;  5CR2 A;  2DJZ A;  5F63 A;  1I4K 1;  4BE0 A;  1RUW A;  4XK8 E;  2LNV A;  5BT4 A;  3JV3 A;  5IGM A;  3EG2 A;  4AKN A;  5LJ3 j;  4JJD A;  2PNI A;  1UTI A;  5IH2 A;  5AME A;  2F1L A;  3CCR Q;  5D3N A;  3CCQ A;  1XJW B;  2AHJ B;  1JJ2 P;  1ZA2 B;  3OYL A;  2XK0 A;  1O75 A;  1JJ2 A;  3OS5 A;  5KCH A;  4LZS A;  5EP7 A;  1XOV A;  4E7J A;  4PCE A;  4F04 B;  4XTV A;  2KTB B;  3ONI A;  4UIU A;  5GAO m;  4A9I A;  3CEY A;  1IO6 A;  5CVI A;  3EFO B;  4M77 A;  5FDZ A;  3M4G A;  2RO1 A;  3MET A;  3ERR A;  2RHX A;  2LNH B;  3MEW A;  5KYU B;  1Q81 U;  4YYG A;  5D7X A;  2M51 A;  4IOO A;  1O9S A;  2RNY A;  5CY9 A;  4M77 G;  4M7D A;  1OZ2 A;  2ZPF B;  3OS2 A;  3JCM X;  5FB0 A;  4Z1Q A;  3MUK A;  3QWX X;  5TB6 A;  1UGR B;  3N5B B;  1M3A A;  4M7A D;  1K8A U;  1PD1 A;  1T0J A;  1IB8 A;  1WXT A;  2PTK A;  4HXJ A;  4XUB A;  2MYS A;  1OU9 A;  3I35 A;  5GAO n;  4XTZ A;  2KNB B;  2FZG B;  2GFU A;  1K73 R;  5EPB A;  1K4U S;  2DPP B;  2DJQ A;  2KT1 A;  2YLC A;  1W6X A;  4MR4 A;  4ZQL A;  4RTU A;  3RMQ A;  5CQY A;  3CC7 Q;  4HXM A;  2ESW A;  4M75 A;  5EQ1 A;  2XMF A;  3TQ7 P;  3P8B B;  5I7X A;  3CBO A;  4ALG A;  2WSE E;  1OOT A;  4JS4 A;  3BDU A;  4YC9 A;  1QVG S;  5LVQ A;  2LTO A;  2XD0 A;  1G3S A;  3DLL A;  4JDS A;  4PJO E;  4AFU C;  4M75 G;  1R0B G;  1KC8 U;  5KE3 A;  4PK4 A;  1FYN A;  1QKW A;  1VOM A;  2P4T A;  2QYZ A;  5COI A;  2E7N A;  4X2I A;  2D8J A;  4X9C A;  1Q81 R;  4GLM A;  5I1Q A;  3U5L A;  2E10 A;  2ZPI B;  4QSP A;  3EGX A;  1AOJ A;  2VKN A;  4O7F A;  5D3R A;  4IUP A;  4ZN1 A;  1ACM B;  2LZ6 B;  2CDT A;  3KFV A;  2QA4 T;  3CME T;  2F2X A;  1H92 A;  1EQF A;  5CRZ A;  2KDS A;  1YIJ T;  1R0C B;  5A5R A;  4PFO A;  4J9I A;  1NJI C;  1WHM A;  3H8Z A;  3QKJ A;  1S1N A;  2DIL A;  3LW5 E;  1N72 A;  2RQV A;  4BDZ A;  1ZUY A;  1YJ9 T;  4J3I A;  2MF2 A;  3RR6 A;  4PKL A;  5FWB A;  5E7D A;  1RAC B;  1VQL A;  2VB6 A;  1KSW A;  1SKU B;  5FE2 A;  1S72 T;  3TSZ A;  1Y96 A;  2E3I A;  2L3Q A;  2JTF A;  2P0P A;  1V76 A;  5CKH A;  1YHQ Q;  3R6N A;  1KC8 R;  4M77 D;  1ZHI A;  5A5O A;  2G6F X;  5DYA A;  5C8G A;  5HM0 A;  2WAC A;  2LQW A;  5HFR A;  1DJ7 B;  4Z8A A;  4BY6 B;  1JO8 A;  1MNE A;  3OYN A;  1ZA1 B;  4GLK A;  5CTL A;  1M2V B;  3EGU A;  4NQN A;  4M7D D;  5DYU A;  5LKX A;  3A1P A;  1KD1 C;  4RTV A;  2D82 A;  3V7C A;  2X3X D;  1OPL A;  5LJ3 f;  1PCX A;  4M78 B;  4ZTJ A;  4BW1 A;  1U1T A;  3E9F A;  1W4S A;  4E7L A;  2RQT A;  4LUE A;  4RTW A;  2OUO A;  2QQR A;  5KTX A;  2X4X A;  2K57 A;  3A5Z B;  3AT1 B;  1G83 A;  4FT2 A;  1U1S A;  5LJ3 d;  4QZS A;  4LC2 A;  3WXM B;  2RH2 A;  2F6J A;  2QQB A;  1SEM A;  4TS8 A;  3MEA A;  4M75 D;  4DOV A;  4CC3 A;  3VS0 A;  5JI8 A;  1NJI R;  3MEU A;  4PY6 A;  3VV0 A;  3CC4 A;  2KYM A;  5LJ3 g;  3QBY A;  4WHW A;  2OTL T;  1QVF S;  1V1C A;  2RJF A;  3RES A;  5EPR A;  1VYV A;  2Z0W A;  3M0U A;  3G6E T;  5AYF A;  2DET A;  3MQM A;  5LVR A;  2SRC A;  3CMA T;  3E9G A;  1FMV A;  2XI9 A;  5DLX A;  5FRN A;  1TXQ A;  2EKH A;  1TH7 A;  1ZS5 A;  3VS2 A;  1GCQ C;  4Y03 A;  4UYH A;  3NXB A;  2G4A A;  5ENG A;  2XDB A;  3VKH A;  1WPY A;  3H9N A;  2MPX C;  3G1J A;  3CME Q;  4HVU A;  4QSU A;  1YJN A;  4AG1 C;  4OMN A;  4ZGJ B;  5CZG A;  2RN8 A;  5FFV A;  2O01 E;  5CKB A;  4KCX A;  3CCV Q;  5CKD A;  4JRI A;  1KD1 R;  1U3O A;  1QP2 A;  5KYW B;  4NYW A;  5H1V A;  2NXB A;  1YJ9 Q;  3NTH A;  2X4J A;  1OX9 A;  1VQ4 A;  3A8G B;  5DBM A;  3EG9 A;  3MP1 A;  2OTJ A;  4LDV A;  3LWI A;  4N3W A;  5I40 A;  4IUT A;  1LNX A;  4J6Y A;  4PJO B;  4IUU A;  4DBQ A;  4FT4 A;  5FE3 A;  2JVV A;  5A0G A;  2COZ A;  4ANJ A;  3G71 T;  3MB4 A;  2KI7 A;  3MP6 A;  1NBE B;  2JT4 A;  5CKE A;  3I56 T;  3UT1 A;  4LRG A;  3UVX A;  4NR4 A;  2E4H A;  3SD4 A;  1VYU A;  3Q2E A;  3WVD B;  2HDA A;  5CUB A;  1YJW Q;  5ETD A;  3RNJ A;  2MIO A;  1NYF A;  2DE0 X;  4IIO A;  3CCL A;  4F7U F;  2CZ1 B;  3CC2 T;  3JCM W;  4TT4 A;  4HXS A;  5I7Y A;  2LC4 A;  5LJ5 h;  2HMA A;  3JAM E;  2XID A;  2BIV A;  4QVD A;  1WNL A;  4J0S A;  3MB3 A;  1HK9 A;  3U5K A;  3M0S A;  4EIK A;  1JBM A;  4O70 A;  3BFM A;  1LJO A;  3X26 B;  4HKE A;  4RTZ A;  3LJW A;  1GCP A;  5GAN h;  1VQM A;  3JB9 J;  4YYN A;  4DON A;  3V8J A;  2GFA A;  2B8A A;  2OTL Q;  4PJL A;  4TZ8 A;  2HAX A;  1UFF A;  4PTB A;  2EGE A;  4ESR A;  4HXK A;  1KJW A;  3CCJ T;  4QVZ A;  1QW1 A;  1VQ5 T;  1X6O A;  5HEL A;  5II1 A;  2OAU A;  1A0N B;  3RIR A;  5FWC A;  4C8Q F;  4J7F A;  1GFC A;  2A0F B;  3UV2 A;  4FYX B;  4QQD A;  4UC4 A;  3QXE B;  1ZSZ B;  2LJ3 A;  2CH4 A;  4N0A C;  1QCN A;  2E3K A;  1MV3 A;  1H8K A;  1FWZ A;  5CAI A;  3L2Z A;  1X0J A;  4AFS C;  5HCL A;  3SHW A;  4CL9 A;  1W70 A;  1M2O A;  3HL8 A;  4NL2 A;  3OBW A;  1GCQ A;  2YXY A;  5EA1 A;  1JSP B;  5DLZ A;  4IUV A;  5ENB A;  4FM4 B;  2YUP A;  3IU5 A;  4J7I A;  4MR3 A;  1HSQ A;  5F5Z A;  2M0Y A;  1BK2 A;  4J8O A;  5EK9 A;  1M4Z A;  1BU1 A;  3QZV A;  1H3H A;  5FU6 C;  4YYH A;  4CUP A;  2YUQ A;  2I0N A;  4O74 A;  4ZW1 A;  3RUX A;  4ZNX A;  4BW2 A;  3PIO A;  3O8V A;  1VQN T;  1VQP T;  3CCS A;  4CFK A;  3JB9 F;  5HRX A;  2EQJ A;  1MGQ A;  3OMC A;  3UW9 A;  3G71 Q;  1M9S A;  4MEO A;  4O75 A;  5D3S A;  3LGF A;  4V2S A;  5H1U A;  5I83 A;  2MI6 A;  3E1S A;  5L23 A;  1WXB A;  3I56 Q;  1NLP C;  3CXC P;  5ENH A;  4ME7 A;  4JRP A;  3CXC A;  1M30 A;  4OB0 B;  5IBN A;  2CUD A;  2AKL A;  1M8V A;  4F3I A;  1QVG A;  2XDP A;  4OGC A;  4C8Q C;  1K0S A;  4TU4 A;  5H1T A;  5I86 A;  4M7A E;  4LE9 A;  1R77 A;  3QWY A;  3ZYU A;  1M27 C;  3M0P A;  4BW4 A;  1PRL C;  2JUF A;  3EHQ A;  3MCA B;  2ZZD A;  2QGG A;  4J1P A;  3UPU A;  2QAZ A;  5GMK h;  2EGC A;  4UYE A;  1OPK A;  3M9Q A;  2DXC A;  3G0L A;  5II2 A;  4HCZ A;  1WA7 A;  5EI4 A;  1QCO A;  2D8H A;  5LKT A;  2HNI A;  4OB2 B;  2X51 A;  2IIM A;  1K76 A;  3C4S A;  4TYL A;  1ARK A;  1RLQ C;  2MWP A;  4C92 F;  1K1Z A;  4MEN A;  3K2J A;  4OP0 A;  2KRO A;  2W0Z A;  4UIT A;  1YP5 A;  4BD3 A;  1ZSG A;  3CCJ Q;  4BE2 A;  4CUU A;  1K0X A;  5CIU A;  5G4R A;  1X2Q A;  5H85 A;  2XHC A;  1VQ8 A;  4M7D F;  1RAB B;  5CS8 A;  1YI2 Q;  2KXD A;  2RNX A;  2E1H A;  1Q82 U;  2EW3 A;  4QYL A;  1IXD A;  4GBQ A;  4XY9 A;  1ZBJ A;  4BB7 A;  2DEQ A;  3QII A;  5CQ5 A;  5FE4 A;  4QBM A;  1WXU A;  4KGX B;  3BE3 A;  3OS1 A;  2H3J A;  3GG3 A;  3CQT A;  5EPS A;  1RI9 A;  5FG5 A;  4HCK A;  1PC0 A;  1U8R A;  4KBM B;  1H64 1;  5DM7 R;  1KQS P;  2L5Q A;  4RG8 A;  2H60 A;  3JCM c;  1KQS A;  1SHF A;  2X9H A;  2PVD B;  4J9F A;  4WTO B;  1D3B A;  2W10 A;  3CCU Q;  2Y4X A;  2E3H A;  5LUU A;  1AWX A;  2KSS A;  1Q7Y C;  1VQO A;  2YUN A;  3G4S A;  3VS3 A;  4F7U G;  2P4R A;  3CD6 T;  4M77 E;  2DVJ A;  2XG8 D;  4A4E A;  2E70 A; 
#chains in the Genus database with same CATH homology
 4J6X A;  2DVR A;  3CCE A;  5CK9 A;  3GP8 A;  2FL7 A;  4C5H A;  2RO0 A;  4C92 C;  1P92 A;  4TT6 A;  2DZC A;  4OGE A;  3TLP A;  5IGN A;  1VQK T;  5DLO A;  5LJ5 j;  2KAF A;  1QVF A;  2DVQ A;  5IGK A;  1X75 C;  2DIG A;  5ENF A;  4M7D C;  3JCM J;  5C7N A;  4CUQ A;  4QYD A;  4RCB A;  5FH6 A;  3RER A;  4C8Q A;  3S91 A;  2LDM A;  1VQL T;  5E9V A;  3OYM A;  3URG A;  1M1K U;  5CUD A;  3BY7 A;  5GAN j;  4TT2 A;  4M75 E;  5I80 A;  4OGJ A;  2RJD A;  4C8Q G;  4LR6 A;  2FB7 A;  5CUG A;  4Z6I A;  2I2L A;  3ASK A;  2D6F A;  4LDW A;  3I55 A;  2KVQ G;  2DIQ A;  1E6I A;  5HEM A;  4CUS A;  2CYZ B;  1BI1 A;  4ZGE B;  5FH7 A;  4XTY A;  1Y71 A;  3RMS A;  3CC7 T;  2DD5 A;  3GIB A;  3TEE A;  2RNW A;  3DKM A;  4CUR A;  5D0C A;  3TRE A;  1B34 B;  2YEL A;  5GAN 6;  3HRU A;  1VQ6 A;  3T9N A;  2CZ7 B;  4M7A B;  3MUL A;  1W2B S;  5CUE A;  2R5M A;  5IID A;  2EWN A;  5CFW A;  4O71 A;  3QUI A;  3PIP A;  3OS0 A;  5EWW A;  4A9K A;  3QHS A;  5HQ6 A;  4L6V 5;  5KTU A;  3JB9 G;  4XU1 A;  2ZPH B;  3NTI A;  3PMT A;  2QQA A;  2RI3 A;  5D26 A;  5FFW A;  4ELY C;  2EIF A;  2WSC E;  5DFB A;  1SSF A;  4E96 A;  4BI3 A;  4Z02 A;  3O36 A;  2RK1 A;  2LCL A;  5LJ5 e;  4JUV A;  3SVF A;  3OMG A;  3M53 A;  5GAO r;  3SWN A;  2EQM A;  4O6J A;  3EAE A;  4YY4 A;  2RK2 A;  1Q81 C;  5GAN 3;  1G3Y A;  5GAN e;  3QO3 A;  1YHQ T;  4LDX A;  4C92 A;  2LRQ A;  4ALH A;  1WQW A;  5HEN A;  4UYD A;  4WHU A;  3UVW A;  5F61 A;  5GMK j;  2BUD A;  4C8Q D;  4C92 G;  4MMK A;  1K8A C;  4O72 A;  3M57 A;  5FLX E;  2VYT A;  4NR5 A;  2QEX A;  2F5K A;  5LJ1 A;  3M55 A;  4QY4 A;  4M7D G;  5ENE A;  4OB3 B;  4JRQ A;  2FVU A;  4M77 B;  2P0Q A;  4MEQ A;  4UIZ A;  2RJE A;  2VXF A;  5LJ5 f;  5EVA A;  4LD6 A;  3UDC A;  1KC8 C;  5KU3 A;  3QJ6 A;  3EFR A;  5JWM A;  4MDW A;  3NTK A;  2KQW A;  5GMK i;  5E73 A;  5LJ5 d;  4LYI A;  3OYE A;  3D7C A;  5GAN f;  2XKO C;  3X24 B;  1OYX A;  3JB9 D;  4YBT A;  1I81 A;  4XU0 A;  5LJ5 g;  5FFY A;  5HY6 A;  3JCM b;  3NFC A;  4JJN K;  4M75 B;  4QQG A;  5GAN d;  4RCC A;  5LJ3 e;  5CRM A;  2RI5 A;  3OBY A;  3TCJ A;  1WUM A;  5DX4 A;  5GAN g;  3CCV T;  2F5T X;  1WQ7 A;  2M1H A;  5D3P A;  2Y90 A;  3CPW A;  5J3B A;  3A8H B;  3S3M A;  5GMK e;  4NXJ A;  5F3A A;  5C4Q A;  3MP8 A;  4O7C A;  2RHY A;  4KV1 A;  5C0M A;  4O77 A;  3CBP A;  1NPR A;  4C92 D;  1N6A A;  4LDY A;  3CCM T;  2RS9 B;  2C06 A;  3INZ A;  5FE1 A;  4NR9 A;  1YJW T;  2KK4 A;  2V8K A;  4J6W A;  4N4I A;  4C0D C;  4QEV A;  4M78 A;  3GF5 A;  3QZS A;  4HXR A;  5KH6 A;  3FJP A;  1VQ9 A;  2PUO B;  3EFS A;  2QQ9 A;  2CGH A;  3JCM P;  1YIT T;  5F1H A;  5D3J A;  5A0D A;  2E6N A;  3P8D A;  2RHZ A;  4BE1 A;  1Y7X A;  3DB4 A;  4NRC A;  4EDU A;  2EKO A;  1VQ7 T;  4Q0N A;  1K9M U;  4ATO A;  1V29 B;  3VYH B;  3M58 A;  4ZTF A;  1ZQ1 A;  4NOY A;  5J0D A;  2L84 A;  2HBP A;  4EMG A;  5KHM A;  5CQA A;  3IU6 A;  4QR4 A;  5A5N A;  3QZT A;  4Z6H A;  5AMF A;  2R0S A;  1N27 A;  2FSA A;  3MHX A;  4IR6 A;  2YQD A;  2K5F A;  5A5P A;  3PNW C;  4IOR A;  5EU1 A;  3PTA A;  4JRK A;  5D3T A;  4CLB A;  1WJR A;  4XTU A;  4QVC A;  5EGU A;  3CPF A;  4HT9 A;  1Q86 U;  3LH0 A;  3SFM A;  4C5G A;  4YK0 A;  3U5O A;  1QVP A;  5A85 A;  4OUF A;  5D24 A;  5F1L A;  2DAT A;  5A0L A;  4XUA A;  5GAO p;  2DXU A;  3VYG A;  3RCW A;  4PJO A;  3LYI A;  3KBG A;  3OYA A;  4YH3 A;  5DY7 A;  3F70 A;  1N9R A;  4QNS A;  4J83 A;  4YBM A;  3SDZ A;  3JB9 H;  1Y07 A;  3C94 A;  3J81 E;  3OYK A;  4QQ6 A;  4QSS A;  2EQK A;  2D9T A;  2XU8 A;  3L2U A;  1XTD A;  1HXD A;  2GRC A;  3O33 A;  3OYF A;  3OSS C;  3GPL A;  2L8D A;  2A3L A;  4M78 D;  1F68 A;  5HFQ A;  3OW2 A;  3JVM A;  4PLL A;  3QG1 A;  5FU7 C;  5DW1 A;  5CQ7 A;  1JRI A;  2LQ8 A;  3C95 A;  2RB6 A;  3HSB A;  5GAM h;  1PSE A;  3FIF A;  3QZ9 B;  2L89 A;  2LQK A;  5I89 A;  3ZEH A;  3JVK A;  2A7Y A;  4O7E A;  5D6Y A;  5F25 A;  5A81 A;  4PL6 A;  4IUQ A;  4HXN A;  1YI2 T;  1JJ2 S;  2RJC A;  3P8H A;  2QA4 A;  3CME A;  4F7U E;  3OYB A;  5CP5 A;  1YIJ A;  5EWV A;  3VKI A;  4CFL A;  3OA6 A;  2ZPB B;  1YJ9 A;  3L2W A;  5IN1 A;  3OQ5 A;  2DKW A;  2R5A A;  2DWW A;  1G3W A;  1I5L A;  2YHT A;  5A7C A;  4O7B A;  3CCU T;  4JS5 A;  1S72 A;  4XU2 A;  4TQN A;  4PJO D;  3OYI A;  1G3T A;  5DFD A;  3UVY A;  4YYJ A;  4A4K A;  3DB3 A;  2DXB A;  3PT9 A;  2EAY A;  4YAX A;  4C8Q E;  2JTM A;  2YLB A;  5D3L A;  2YRV A;  4GY5 A;  3LLR A;  5IGL A;  2LT4 A;  3A8M B;  1KG1 A;  3LQH A;  5CUA A;  4IR5 A;  4A4G A;  5DFC A;  4NR6 A;  1KQ2 A;  3UV4 A;  4XAX B;  2YW5 A;  3M54 A;  3CCQ T;  2MJV B;  3ZFJ A;  4Y91 A;  2M0O A;  3P1C A;  2OTL A;  3BW1 A;  4IR3 A;  4BW3 A;  2VGN A;  2F6N A;  5HLS A;  4QB3 A;  3U5M A;  3G6E A;  1Q82 C;  4L59 A;  3CMA A;  2N9G A;  5CQ4 A;  5LL6 S;  3UV5 A;  5I21 A;  3HKS A;  3LWH A;  1N9S A;  3FRN A;  3OY9 A;  5L99 A;  3ER0 A;  1IZ6 A;  2I8N A;  4NS5 A;  4HBW A;  3V8L A;  1BI3 A;  4NQM A;  4RG2 A;  4MZP A;  1M90 U;  2DVV A;  2FYK A;  4FSX A;  4HXL A;  3S92 A;  2MAM A;  3LGL A;  4YAD A;  1KHC A;  4OMF B;  2O4X B;  5FRO A;  1WJQ A;  5DYC A;  4HBV A;  4YY6 A;  4XTW A;  4XTX A;  5ENI A;  2ZGW A;  5AD2 A;  2JNG A;  4BI4 A;  2RM4 A;  5KCO A;  3G71 A;  5GAN 7;  4C92 E;  4NYX A;  3SWN C;  4CUT A;  3I56 A;  5HK3 A;  2K3Y A;  5LKU A;  5K29 A;  1BIA A;  3X20 B;  4NL3 A;  4YH4 A;  4O5V A;  4QR3 A;  4NUE A;  2ZCF B;  4M7D E;  4OF1 A;  2HD0 A;  3CC2 A;  4F7U B;  4YYI A;  4UYF B;  5ENC A;  1M1K C;  2R58 A;  3S3N A;  4EMK A;  4HXO A;  5FU6 B;  4IKF A;  4B9W A;  4A9F A;  1FXX A;  3SVG A;  1EIF A;  4L5G A;  2PVG B;  2X4W A;  5L8R E;  5GAM j;  3HPW A;  1FX7 A;  1GXI E;  5BT3 A;  1OI1 A;  4XYA A;  3CCJ A;  3M4Y A;  1VQ5 A;  4HCB A;  5FH8 A;  2EFI A;  3V7S A;  4C8Q B;  4LD9 K;  5J26 A;  4IR4 A;  4TU6 A;  4O78 A;  2OSS A;  5C87 A;  3A8O B;  3HME A;  1WJS A;  2LX9 A;  4UIY A;  4KT0 E;  4M78 F;  2GF7 A;  4J0R A;  5EWH A;  5CQT A;  2L3R A;  4LZ2 A;  3HRS A;  4A4F A;  4Y28 E;  1YBY A;  2M16 A;  4UIX A;  2X35 A;  4E7K A;  5GAO q;  3P1D A;  2F69 A;  3U5P A;  1M5Q 1;  3J7A F;  4MZT A;  3CC4 T;  5CCA A;  2LT1 A;  2BKD N;  1VQN A;  1VQP A;  1BYM A;  1NPP A;  4PCI A;  4R55 A;  5KTW A;  5DKH A;  4A53 A;  3CBM A;  3AHU A;  5FE9 A;  4Z93 A;  2EJ9 A;  3FDR A;  2QXF A;  5DYX A;  3LQJ A;  2XDD A;  4BY6 C;  3V7R A;  4YYD A;  2HQX A;  1N8R U;  1BIB A;  5GAM e;  3J80 E;  4N4G A;  4LDF A;  2MWO A;  4ELZ C;  3QSU A;  3HMF A;  3FB9 A;  5FB1 A;  1YJN T;  4ZGD B;  1K73 U;  1MHN A;  4OGI A;  2YEM A;  4QR5 A;  4BUG A;  4M78 C;  4FLP A;  2DTH A;  3SWN B;  4WF2 A;  4IUR A;  4QSV A;  4A54 A;  4LZR A;  1VQ4 T;  4HA8 A;  2OTJ T;  2DKG A;  5E9L A;  4PJO F;  3S3O A;  2IVW A;  3L2R A;  4C92 B;  4HT8 A;  3HP9 A;  5E3G A;  4QST A;  5HQ5 A;  4NUC A;  5CPE A;  2LSP B;  3JCM V;  3S6W A;  3KUF A;  2R57 A;  4M7D B;  3G7Z A;  4KUI A;  1JB0 E;  4CRI A;  4FIB A;  3CCL T;  2V8I A;  4JLI A;  4LYS A;  5GAM f;  2DVE A;  5GAN 4;  5D6W A;  4MR6 A;  2DVS A;  3OYC A;  3LXJ A;  4E47 A;  4MR5 A;  3Q2F A;  3LX7 A;  3CXC S;  5GAM d;  5FG6 A;  3JCM Q;  3JSC A;  2CZ6 B;  5BT5 A;  3OYY A;  2JOY A;  1VQM T;  3HFN A;  5E9I A;  3CD6 A;  4C66 A;  3SVH A;  5GAM g;  3U5N A;  5IAY A;  4RVR A;  4A4H A;  3CCR A;  2RI2 A;  3L2Q A;  4A9M A;  4PJO C;  2CS7 A;  3JB9 I;  5CQX A;  3ME9 A;  5AD3 A;  2QI2 A;  1VQK A;  5A5Q A;  4QUT A;  5DKC A;  2R0Y A;  4YYM A;  2DXT A;  4TVR A;  3OB9 A;  5DLQ E;  3GOX A;  3G0J A;  4D6W A;  1UEB A;  4UYG A;  2XIC A;  2I7K A;  4TZ2 A;  3TU4 K;  4NRA A;  5LJ2 A;  3WVE B;  4N4H A;  4QEW A;  3UVD A;  2KMT A;  4YYK A;  1NJI U;  1UB4 A;  2OO1 A;  5EG2 A;  4TTE A;  2X4Y A;  1Y96 B;  3GNF B;  2EQU A;  3FEO A;  4A9J A;  3DAI A;  3CCS T;  5C85 A;  4M78 G;  3CC7 A;  1KQS S;  1K9M C;  4YBS A;  5G4S A;  5L8U A;  5FBX A;  3JCM h;  2EJF A;  2WP1 A;  4UIW A;  5IT9 E;  5C89 A;  5A83 A;  1WGS A;  4NRB A;  4BI8 B;  5GMK l;  4IOQ A;  1M1F A;  5F62 A;  1KD1 U;  3H6Z A;  2PQW A;  4XU3 A;  3DWY A;  5FE7 A;  4PKC C;  4GPJ A;  3HHT B;  2LVM A;  4RKU E;  1WUG A;  4Q0O A;  4WIV A;  5F60 A;  1NZ9 A;  3RKY A;  3VJP A;  2VXE A;  3L1A A;  1Q86 C;  4KV4 A;  4QC1 A;  3P1E A;  5CUC A;  3PGG A;  4MML A;  4BHW A;  2V8J A;  2DK3 A;  4BAC A;  3HRT A;  5EIC A;  1VQ8 T;  1YCY A;  5FG4 A;  4O76 A;  1YHQ A;  3SB2 A;  4C5E A;  4HXP A;  1VIE A;  2K4Y A;  3VUB A;  1UGS B;  1BI0 A;  3AQA A;  3JVL A;  2QQS A;  4PJO G;  2WSF E;  3VUZ A;  3HMH A;  5EWD A;  3O34 A;  3PMI A;  3U5J A;  2K5L A;  4P5N A;  1XNI A;  2E7O A;  5A82 A;  5DKD A;  1G5V A;  4VUB A;  4A9N A;  5C6S A;  4Z1S A;  1VQO T;  3G4S T;  1W2B A;  4QC3 A;  2CKK A;  2R0V A;  2E5Q A;  4QSW A;  5CQ3 A;  3CCE T;  4MEP A;  1AHJ B;  3P1F A;  5I88 A;  3OSV A;  2K5I A;  5GMK m;  2E6Z A;  5GAN 2;  3RKW A;  4C0D B;  5GAN 5;  4PNO A;  4C67 A;  4OB1 B;  2KY9 A;  5D3H A;  1XQH A;  4A9L A;  2DD4 A;  4B9X A;  3FKM X;  5FE5 A;  3CCV A;  3L42 A;  3QJY A;  3I55 T;  2QTX A;  5FE6 A;  1ZBX A;  2RA2 A;  5I2S A;  2K2V A;  5KE2 A;  4A9E A;  3M59 A;  3X28 B;  4MDX A;  4O7A A;  2MMP A;  4QUU A;  2CZ0 B;  4J5Y A;  3RKX A;  5TCM A;  5IG6 A;  5EV9 A;  2RD1 A;  4YAB A;  2FHD A;  4R56 A;  3FLG A;  5HK0 A;  1H3Z A;  5HRV A;  1VQ6 T;  4M7A F;  3CCM A;  4YAT A;  1KQ1 A;  2QDY B;  5HQ7 A;  2YDW A;  5F36 A;  3JVJ A;  5CO7 A;  1M1G A;  2D9E A;  3O35 A;  5EM3 A;  1RI0 A;  1YJW A;  3E19 A;  4DA4 A;  2JZ2 A;  5L8T A;  1KHI A;  2YYN A;  5CU8 A;  2NLU A;  2PUK B;  2ZPG B;  4FU6 A;  4NR7 A;  5J39 A;  4EMK C;  4Q5W A;  2EJG A;  2GCX A;  5HJC A;  3Q1J A;  5EIS A;  2RFJ A;  3O37 A;  4II1 A;  2JN0 A;  5FRM A;  1YIT A;  5L97 A;  1UGP B;  1UGQ B;  5LJ3 h;  3QPH A;  2P0K A;  4HBX A;  3LQI A;  2YEK A;  1X01 A;  2PU9 B;  1VQ7 A;  4BDY A;  3DLM A;  5A5S A;  3V8K A;  5E9K A;  1BI2 A;  3VU3 C;  4QSR A;  4FL6 A;  4HCC A;  3L2V A;  5KO4 A;  2DAQ A;  2DTO A;  3CPW S;  5E9Y A;  4M7A C;  2L5E A;  2E41 A;  3R6O A;  3QYH B;  4EPC A;  2EYQ A;  1M90 C;  4QW2 A;  2L85 A;  5GAN 8;  4XQ3 A;  5FU7 B;  3BDL A;  2DO3 A;  2QEX T;  5FE0 A;  4LYW A;  3OYJ A;  5HKC A;  3QDR B;  4M77 F;  5CQ6 A;  1OZ3 A;  4JLG A;  4MZM A;  2R10 A;  1IRE B;  4UIV A;  5L98 A;  1BKB A;  2O4X A;  2HQE A;  1RL2 A;  3AAD A;  4KUD K;  3GLX A;  3MO8 A;  3FC3 A;  4QSX A;  5D25 A;  1VIF A;  2K3X A;  3QYG B;  5A2Q E;  4NUD A;  4N0A A;  4C0Z A;  4N4F A;  2E12 A;  4C0G A;  5D6X A;  4OVA A;  4E7H A;  2VV5 A;  1PSF A;  4ZN3 A;  5E0R A;  4F7U A;  5DW2 A;  4M75 F;  4BJX A;  5E74 A;  5ACY A;  1LOJ A;  3GNG A;  5EWC A;  4UYF A;  1D3B B;  3JRZ A;  2DTI A;  2E64 A;  2G3R A;  4HBY A;  3JCM e;  1JM4 B;  3KXT A;  4PS5 A;  2PVO B;  3CCR T;  1VUB A;  4X9D A;  5HRW A;  5CQ8 A;  1Q7Y U;  5F2P A;  3M5A A;  2LCC A;  4XY8 A;  4M77 C;  4X34 A;  3UWN A;  2RHU A;  3MEV A;  5GAO l;  3I3J A;  4QEU A;  2Y4Y A;  2RHI A;  3QZ5 B;  1QP3 A;  4DQ2 A;  4EMK B;  4C5I A;  1NE8 A;  1R8O B;  1YI2 A;  2VC8 A;  4YTL A;  3P5O A;  1I8F A;  1B34 A;  2D0Q B;  4A9H A;  4M7A A;  5CKF A;  4C0F A;  5ETB A;  4E7I A;  4M75 C;  3JCM f;  2WP2 A;  2M9U A;  4ZC9 A;  5E9M A;  3ZBD A;  4KUL A;  1VQ9 T;  4M7A G;  3PFS A;  3OYG A;  3M56 A;  4PLI A;  3CCU A;  3JCM d;  3OYD A;  5E3D A;  2E65 A;  3C12 A;  5LKZ A;  2RI7 A;  2IG0 A;  3OW2 S;  2GQV A;  2VUB A;  3A8L B;  4A9O A;  5ENJ A;  3JCM g;  4NR8 A;  5FE8 A;  5CGP A;  1N8R C;  3X25 B;  4EMH A;  4CI0 C;  5I2M A;  3MXF A;  2ZPE B;  5DY9 A;  4RMO A;  4QSQ A;  1K73 C;  5LJ0 A;  2VGM A;  4NYV A;  4LDU A;  5M9O A;  2DZ9 A;  5I29 A;  4M78 E;  3OYH A;  5L96 A;  3HFO A;  4DOW A;  5CR2 A;  2DJZ A;  5F63 A;  1I4K 1;  4BE0 A;  4XK8 E;  2LNV A;  5BT4 A;  5IGM A;  4AKN A;  5LJ3 j;  5AME A;  5D3N A;  3CCQ A;  2AHJ B;  3OYL A;  2XK0 A;  1O75 A;  1JJ2 A;  3OS5 A;  5KCH A;  4LZS A;  5EP7 A;  1XOV A;  4E7J A;  4PCE A;  4XTV A;  2KTB B;  3ONI A;  4UIU A;  5GAO m;  4A9I A;  3CEY A;  5CVI A;  4M77 A;  5FDZ A;  3M4G A;  2RO1 A;  3MET A;  2RHX A;  3MEW A;  1Q81 U;  4YYG A;  5D7X A;  4IOO A;  1O9S A;  2RNY A;  5CY9 A;  4M77 G;  4M7D A;  1OZ2 A;  2ZPF B;  3OS2 A;  3JCM X;  5FB0 A;  4Z1Q A;  3MUK A;  5TB6 A;  1UGR B;  3N5B B;  4M7A D;  1K8A U;  4XUB A;  5GAO n;  4XTZ A;  2GFU A;  5EPB A;  2DPP B;  2YLC A;  4MR4 A;  4ZQL A;  3RMQ A;  5CQY A;  4HXM A;  4M75 A;  5EQ1 A;  3P8B B;  5I7X A;  3CBO A;  4ALG A;  2WSE E;  4JS4 A;  3BDU A;  4YC9 A;  1QVG S;  5LVQ A;  2LTO A;  2XD0 A;  1G3S A;  3DLL A;  4JDS A;  4PJO E;  4M75 G;  1KC8 U;  5KE3 A;  2P4T A;  5COI A;  2E7N A;  4X2I A;  4X9C A;  5I1Q A;  3U5L A;  2E10 A;  2ZPI B;  4QSP A;  4O7F A;  5D3R A;  4IUP A;  4ZN1 A;  2QA4 T;  3CME T;  1EQF A;  5CRZ A;  2KDS A;  1YIJ T;  5A5R A;  1NJI C;  3QKJ A;  3H8Z A;  3LW5 E;  1N72 A;  4BDZ A;  1YJ9 T;  4J3I A;  2MF2 A;  4PKL A;  5E7D A;  1VQL A;  5FE2 A;  1S72 T;  1Y96 A;  2JTF A;  2P0P A;  5CKH A;  4M77 D;  1ZHI A;  5A5O A;  5DYA A;  5C8G A;  5HM0 A;  2WAC A;  4BY6 B;  5HFR A;  1DJ7 B;  3OYN A;  4GLK A;  5CTL A;  4NQN A;  4M7D D;  5DYU A;  5LKX A;  1KD1 C;  2D82 A;  3V7C A;  5LJ3 f;  4M78 B;  4ZTJ A;  4BW1 A;  1U1T A;  3E9F A;  1W4S A;  4E7L A;  2OUO A;  2QQR A;  5KTX A;  2X4X A;  2K57 A;  3A5Z B;  4FT2 A;  1U1S A;  5LJ3 d;  4QZS A;  4LC2 A;  3WXM B;  2RH2 A;  2F6J A;  2QQB A;  4TS8 A;  3MEA A;  4M75 D;  4DOV A;  5JI8 A;  3MEU A;  4PY6 A;  3VV0 A;  3CC4 A;  5LJ3 g;  3QBY A;  4WHW A;  2OTL T;  1QVF S;  3RES A;  2RJF A;  5EPR A;  3G6E T;  5AYF A;  3MQM A;  5LVR A;  3CMA T;  3E9G A;  2XI9 A;  5DLX A;  5FRN A;  1TH7 A;  1ZS5 A;  4Y03 A;  4UYH A;  3NXB A;  2G4A A;  5ENG A;  2XDB A;  1WPY A;  4QSU A;  1YJN A;  4ZGJ B;  5CZG A;  5FFV A;  2O01 E;  5CKB A;  4KCX A;  5CKD A;  4JRI A;  1QP2 A;  4NYW A;  5H1V A;  2NXB A;  3NTH A;  2X4J A;  1VQ4 A;  3A8G B;  5DBM A;  2OTJ A;  3MP1 A;  4LDV A;  3LWI A;  4N3W A;  5I40 A;  4IUT A;  1LNX A;  4J6Y A;  4PJO B;  4IUU A;  4FT4 A;  5FE3 A;  2JVV A;  5A0G A;  3G71 T;  3MB4 A;  3MP6 A;  5CKE A;  3I56 T;  3UT1 A;  4LRG A;  3UVX A;  4NR4 A;  3SD4 A;  3Q2E A;  3WVD B;  5CUB A;  5ETD A;  3CCL A;  4F7U F;  2CZ1 B;  3CC2 T;  3JCM W;  4TT4 A;  4HXS A;  5I7Y A;  2LC4 A;  5LJ5 h;  3JAM E;  2XID A;  2BIV A;  4QVD A;  1WNL A;  4J0S A;  3MB3 A;  1HK9 A;  3U5K A;  1JBM A;  4O70 A;  3BFM A;  1LJO A;  3X26 B;  4HKE A;  3LJW A;  5GAN h;  1VQM A;  3JB9 J;  4YYN A;  4DON A;  3V8J A;  2GFA A;  2B8A A;  4TZ8 A;  2HAX A;  4PTB A;  4HXK A;  3CCJ T;  4QVZ A;  1QW1 A;  1VQ5 T;  1X6O A;  5HEL A;  5II1 A;  2OAU A;  3RIR A;  4C8Q F;  4J7F A;  3UV2 A;  4UC4 A;  4QQD A;  3QXE B;  4N0A C;  2E3K A;  1FWZ A;  5CAI A;  3L2Z A;  1X0J A;  5HCL A;  4CL9 A;  3HL8 A;  4NL2 A;  3OBW A;  5EA1 A;  1JSP B;  5DLZ A;  4IUV A;  5ENB A;  4FM4 B;  3IU5 A;  4J7I A;  4MR3 A;  5F5Z A;  4J8O A;  5EK9 A;  1M4Z A;  3QZV A;  5FU6 C;  4YYH A;  4CUP A;  4O74 A;  4ZW1 A;  3RUX A;  4BW2 A;  3PIO A;  3O8V A;  1VQN T;  1VQP T;  3CCS A;  4CFK A;  3JB9 F;  5HRX A;  2EQJ A;  1MGQ A;  3OMC A;  3UW9 A;  1M9S A;  4MEO A;  4O75 A;  5D3S A;  3LGF A;  4V2S A;  5H1U A;  5I83 A;  2MI6 A;  3E1S A;  5ENH A;  4ME7 A;  4JRP A;  3CXC A;  4OB0 B;  5IBN A;  1M8V A;  4F3I A;  1QVG A;  2XDP A;  4OGC A;  4C8Q C;  4TU4 A;  5H1T A;  5I86 A;  4M7A E;  3ZYU A;  4BW4 A;  2JUF A;  3MCA B;  2ZZD A;  4J1P A;  3UPU A;  5GMK h;  4UYE A;  3M9Q A;  2DXC A;  3G0L A;  5II2 A;  4HCZ A;  5EI4 A;  5LKT A;  2HNI A;  4OB2 B;  3C4S A;  4TYL A;  2MWP A;  4C92 F;  4MEN A;  3K2J A;  4OP0 A;  4UIT A;  4BD3 A;  4BE2 A;  4CUU A;  5CIU A;  5G4R A;  5H85 A;  2XHC A;  1VQ8 A;  4M7D F;  5CS8 A;  2RNX A;  2E1H A;  1Q82 U;  4QYL A;  4XY9 A;  4BB7 A;  2DEQ A;  3QII A;  5CQ5 A;  5FE4 A;  4QBM A;  3OS1 A;  2H3J A;  3GG3 A;  5EPS A;  5FG5 A;  1U8R A;  4KBM B;  1H64 1;  5DM7 R;  2L5Q A;  4RG8 A;  2H60 A;  3JCM c;  1KQS A;  2PVD B;  1D3B A;  2Y4X A;  2KSS A;  5LUU A;  1Q7Y C;  1VQO A;  3G4S A;  4F7U G;  3CD6 T;  4M77 E;  2XG8 D;  4A4E A;  2E70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...