4N4IA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.3k36me3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
192
Chain Sequence
b'NKQEMGTYLRFIVSRMKERAIDLVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
molecule tags Transcription
source organism Mus musculus
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
total genus 65
structure length 192
sequence length 211
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4iA02
4N4IA 4XYAA 5DW1A 5IAYA 3L2RA 2MJVB 2K3YA 5CQ5A 3RCWA 5FBXA 4QVZA 2YQDA 3OS0A 5ENEA 5HELA 2PQWA 4TU6A 4UYEA 4Z6HA 3DB4A 3NXBA 5KE3A 4MR3A 4CURA 2X4XA 4O7BA 3JVMA 4CRIA 3ONIA 4O74A 2RHXA 5FE8A 4X2IA 5CUBA 4A4HA 4BE1A 4CFLA 5FRNA 4A9IA 3JVLA 4NR8A 5I7XA 5ENFA 5IGMA 4XUAA 5HFRA 2L84A 4YY6A 3KUFA 2RJFA 4J0RA 4TT4A 5E9MA 4IURA 4UYGA 2DIGA 3O37A 2IG0A 3L2WA 4BW3A 5EGUA 4WHWA 5EWCA 4NR6A 4QYLA 4N4GA 3MEWA 4Z93A 1OI1A 3OYCA 3OYGA 5EP7A 5F5ZA 4LYWA 5K29A 2RI3A 4IOOA 5FE0A 2N9GA 5HQ6A 2GF7A 3E9GA 5I29A 5CS8A 5E7DA 4A4FA 4A9HA 3LYIA 5D6XA 4BHWA 2EKOA 4FU6A 3OB9A 2OUOA 2M0OA 3LXJA 1OYXA 3LGLA 5A82A 2XK0A 5DKDA 5BT5A 2WP2A 5CQ7A 4UIZA 5CUEA 2DATA 4HXKA 5EPRA 4QEUA 5DW2A 1G5VA 4HBWA 5E3GA 5D3LA 5ENHA 4B9WA 5FE5A 2G3RA 4X34A 5DYCA 3MXFA 5KH6A 4C5GA 4LRGA 4NUEA 5I83A 1F68A 5DFBA 5FE7A 5I1QA 4E7LA 5C85A 2YRVA 5EWVA 5ENCA 1X0JA 3NTHA 2OSSA 4LZSA 4QUTA 5L8UA 5HJCA 3P5OA 1WJQA 2GFAA 4YYIA 5CUDA 3F70A 3UT1A 5CUAA 2JZ2A 5HM0A 4O76A 4QR3A 5A81A 4E7JA 4LZ2A 1EQFA 3AADA 5IBNA 4C5IA 4MR5A 5L96A 3P1EA 5A5PA 5LKZA 5C7NA 2I7KA 4IUVA 3MEVA 2KTBB 4A9KA 1WJSA 4BDZA 4IR3A 4QC3A 5DKCA 3P1FA 3PMIA 5FH8A 3D7CA 4A9FA 4NYVA 3H6ZA 5F25A 5D3PA 4ZC9A 1SSFA 4NR4A 2QQSA 5G4SA 2YDWA 4NRAA 2JTFA 1N72A 4PL6A 5E73A 4CUUA 2D9EA 5E9VA 3UVYA 3IU5A 4J3IA 3P1DA 2RFJA 4O75A 5F2PA 4WIVA 2BIVA 3LLRA 4AKNA 5EVAA 5FG5A 5D6WA 4YYNA 4NYXA 4YYGA 5ETBA 3UW9A 3ZYUA 3U5NA 2L89A 2WP1A 3AQAA 2LRQA 4PKLA 2XDPA 4MR4A 2DVSA 4XY9A 5DBMA 3S6WA 4IOQA 5FG6A 5L98A 5A85A 3L42A 4E7IA 4A4GA 4HBVA 4OUFA 2R10A 4MR6A 4LDFA 4EDUA 4YABA 5CQ4A 4QR4A 5E0RA 4IUUA 2YYNA 3OYLA 4YATA 4NQMA 5D3NA 2MWPA 5AD3A 4UYHA 5D6YA 3H8ZA 5E9KA 3OYBA 5FG4A 5J0DA 5CP5A 5A5OA 5CUCA 3QZSA 4ZW1A 4UIXA 2LTOA 4LYSA 3S92A 4BD3A 5TB6A 2RI7A 5H1UA 5KCOA 4HXOA 5JI8A 4Q0NA 3OYMA 4XUBA 2EFIA 3S3MA 4LYIA 5DYAA 4CLBA 2K3XA 3JVKA 4QSPA 5HCLA 5I89A 3LH0A 4QUUA 4UC4A 2G4AA 5HFQA 5KTWA 4A9NA 5D24A 2H60A 1OZ3A 5LKXA 2FSAA 4OGJA 4TYLA 3I3JA 2EQUA 3MULA 3MP1A 3HMHA 5HQ7A 5II1A 3OYDA 4A9EA 5KTXA 3LJWA 3OA6A 5J26A 3ASKA 4QSQA 5CPEA 3OYAA 4F3IA 4GY5A 5ENIA 4LC2A 4PY6A 5ETDA 3SVFA 4TTEA 3BDLA 5IGNA 5DLXA 5AMFA 3UWNA 4QC1A 2QQRA 3U5MA 3S3NA 2L5EA 4N3WA 5CUGA 4C67A 4O7AA 5M9OA 4QSTA 5EWDA 4DONA 5EWWA 5D25A 4QSVA 3O36A 4KV1A 5D3JA 2RHIA 3UV5A 4Z1QA 1JSPB 5D3SA 3P8DA 4A9LA 4CUQA 3Q1JA 3M9QA 4IUTA 2D9TA 4ZTFA 2RNWA 5BT3A 4Z02A 4NS5A 2L8DA 5LVQA 4QQDA 4QEWA 4BE0A 2DVVA 4ALGA 3Q2FA 3C4SA 3O34A 4CUPA 1N27A 4RG2A 1ZS5A 4HXMA 4IUPA 4TT2A 3HMEA 5KU3A 4QSRA 2MWOA 5IGLA 5EPSA 4PTBA 4UIUA 1KHCA 4E7KA 4XY8A 5CZGA 5ENJA 3FEOA 4ZTJA 4IKFA 4A9OA 5A5SA 4MENA 4YBSA 2BKDN 3SVGA 5COIA 5L8TA 4Q5WA 4YYMA 3G0LA 5C0MA 4Q0OA 4YBMA 3JVJA 2RNXA 5FE9A 3OYKA 1RI0A 3QBYA 5CQ3A 4NR7A 2RHYA 4N4HA 4O7CA 5C6SA 4RVRA 3UVWA 5FH7A 5LJ0A 4CL9A 5LVRA 2E5QA 4O7EA 4YAXA 2OO1A 4YY4A 3TLPA 3MQMA 3U5KA 4QEVA 5EU1A 3S91A 4TZ2A 4CUTA 4O70A 4QR5A 5LKTA 4ALHA 4YYJA 5E9IA 3OYHA 4E96A 5ENBA 5CQ8A 2M1HA 5KCHA 4HXRA 4HBXA 5FE6A 5A5NA 5L99A 3LQJA 2F5KA 5AMEA 2L85A 3META 2X35A 5CIUA 5DYUA 3MUKA 2R5MA 4NRBA 3FLGA 5FB1A 5G4RA 1WUMA 5CTLA 5CU8A 3S3OA 2DWWA 2GRCA 2NXBA 5F36A 4QZSA 5E9YA 2LDMA 2RI5A 5HEMA 4C5HA 4IR6A 4YK0A 4Y03A 5ENGA 4QBMA 5FDZA 2GFUA 4O77A 5FFYA 2DKWA 3EAEA 2E7NA 4GPJA 5EWHA 3UV4A 4UYFB 5I86A 2RS9B 2P0KA 4BW4A 5D3RA 5I7YA 1JM4B 2LVMA 4NR9A 4WHUA 2E6NA 2EQJA 2RJDA 5EPBA 3CEYA 3PFSA 4UIWA 5DFDA 4QSUA 3O8VA 2L3RA 2E7OA 3DWYA 4NR5A 5A83A 3UVXA 3GG3A 4NUCA 4QNSA 5FE1A 2LCCA 2YEKA 4NUDA 5DKHA 5H1TA 3U5OA 5LJ2A 4QB3A 5KE2A 2R5AA 2R0YA 5II2A 5EV9A 2F6JA 2RO0A 3OQ5A 3P8HA 5ACYA 3O33A 4TT6A 5EQ1A 5J39A 4HBYA 3K2JA 2CKKA 3LX7A 5DLZA 4N4FA 4A9MA 2RJEA 5F61A 3OS2A 4O71A 5D7XA 5AD2A 3U5LA 4QSXA 3OS1A 4QSSA 2B8AA 4O72A 1WJRA 4PCIA 3DAIA 5IN1A 4MEOA 3DLMA 5DYXA 5I40A 4PLIA 4NYWA 4NRCA 2E3KA 3ME9A 4A4EA 4LZRA 2HQXA 4MEQA 1E6IA 5F1HA 3MP8A 5HRWA 4NQNA 4QQGA 3OYEA 3PMTA 3P1CA 4CFKA 4BE2A 5FFWA 5KTUA 3IU6A 2FHDA 2WACA 3L2QA 5CRMA 2LSPB 5I80A 3OYIA 4Z6IA 1OZ2A 3QIIA 3LQIA 5C8GA 4UYFA 4C66A 5HRVA 4E7HA 3SVHA 2RHUA 3U5JA 2R58A 5A5QA 3LQHA 4L59A 4IORA 5A5RA 3MEAA 4ZQLA 4TU4A 4TZ8A 5DX4A 4Z1SA 3MB4A 3PNWC 2HQEA 4OVAA 2VYTA 1MHNA 4OGIA 4PCEA 5LKUA 3HMFA 2YEMA 2I8NA 4IUQA 3OYFA 4UIYA 5TCMA 5CRZA 3ZEHA 4HXPA 4J1PA 3QZVA 3QZTA 4O78A 4YC9A 5F3AA 3UV2A 3OMGA 3OYJA 5EA1A 2DVQA 5JWMA 4II1A 2R0SA 5FE3A 5DFCA 4YH3A 4YYKA 5FE4A 3OY9A 4HXLA 2NLUA 4YYHA 5EK9A 4O7FA 5H1VA 5E3DA 4BW1A 4BW2A 4FL6A 4LR6A 5EICA 2M16A 4UYDA 3MO8A 3NTIA 5HRXA 5F1LA 5EI4A 4FLPA 5C4QA 2X4WA 2YW5A 5LUUA 2RHZA 3L2VA 4MEPA 5E74A 4KCXA 5H85A 2RNYA 2R0VA 5CY9A 4BDYA 1WUGA 4PS5A 5KHMA 5IGKA 5HLSA 5CFWA 5IIDA 4BACA 3Q2EA 5HQ5A 5F62A 3LGFA 5L97A 4QQ6A 3UVDA 3QKJA 4PLLA 4TS8A 5E9LA 4QYDA 5C89A 4KV4A 2YELA 3FKMX 5FRMA 5HENA 4TQNA 5DY7A 2EQMA 3G0JA 5EM3A 4YBTA 5FE2A 5D3HA 5EISA 4J0SA 2RO1A 2R57A 5C87A 4A9JA 5CQAA 4LD6A 5FROA 2O4XB 4YYDA 3NTKA 3QJ6A 5CGPA 2EQKA 5LJ1A 5D26A 2F6NA 4QY4A 4YH4A 2D82A 4B9XA 4IR5A 4YADA 3SD4A 4BJXA 5FB0A 3OYNA 5F63A 5FH6A 5I88A 4HXNA 5F60A 4C5EA 2O4XA 5BT4A 3FDRA 2RJCA 5IG6A 4HCZA 4QW2A 5A7CA 3MB3A 5CQTA 1WGSA 1H3ZA 2RI2A 2X4YA 4UITA 2DVRA 3GOXA 4QSWA 3MP6A 2BUDA 3FC3A 5KO4A 3U5PA 3MEUA 4IR4A 5CQ6A 1XNIA 2DIQA 3E9FA 4NXJA 5FFVA 4HXSA 5D3TA 4CUSA 3DB3A 4UIVA 3OMCA 3L2UA 2DAQA 5D0CA 3O35A
chains in the Genus database with same CATH superfamily
5LJ5j 1VQOA 2DETA 4N4IA 4XYAA 5IAYA 3CCST 2V8JA 2KDSA 5LJ3e 5GAMf 4XTXA 5CKHA 5ENEA 5HELA 4Z6HA 1WZOA 1Q7YU 3A5ZB 2C0OA 2EWNA 1Q95G 2F2XA 2RQUA 4O74A 1NJIR 2XDDA 4X2IA 2KRMA 1YWOA 2JOYA 4BE1A 1YNZA 2W0ZA 1Q81R 2OTJA 1JJ2S 2QK0A 4NR8A 3SDZA 3GBQA 3G4ST 2DLPA 3L1AA 1VQKT 1B7TA 2CP5A 4YY6A 2HDAA 3HRUA 4KT0E 2XD0A 3HPWA 4BW3A 5KYYB 3OW2P 5EGUA 4PFOA 4QYLA 4N4GA 5CR2A 4Z93A 2O01E 1WXUA 3RKYA 1S72Q 1G3WA 2N9GA 5HQ6A 2GF7A 5I29A 2HCKA 4A4FA 1T3SA 4PK4A 4A9HA 3LYIA 4JS4A 1EX4A 3LXJA 2RH2A 3LGLA 1R77A 2E70A 2FB7A 3M54A 4RTTA 3HSBA 3UA7A 4C92G 2DO3A 2FG0A 2CDTA 1N6AA 2CZ6B 2DNUA 3L2ZA 2DYIA 2E3HA 3VYGA 1V29B 4RKUE 4JLGA 3RKWA 4B9WA 2G3RA 1XOVA 3MXFA 4LRGA 2VASA 5FE7A 3JSCA 5I1QA 3I56A 2HKNA 1QKXA 2LT4A 5HK0A 3NTHA 2OSSA 4QUTA 2GFAA 3P5OA 4YYIA 3UT1A 5I21A 5LJ5e 2JZ2A 4JPBW 2Y90A 4O76A 5A81A 2LZ6B 1EQFA 3AADA 3HFNA 5IBNA 3NGPA 5LJ3j 5L96A 4GLKA 5LKZA 1K8AC 1WQ7A 3H0HA 2C06A 2NYSA 1WJSA 2AIRB 2V26A 2DXUA 2DL3A 4QC3A 5DKCA 3PVLA 5FH8A 1FMVA 1K73C 2BE7D 3FJ5A 2DA9A 5F25A 2YLBA 5G4SA 2FRYA 2JTFA 1QKWA 4Y28E 2L0AA 3UVYA 3P1DA 1ABOA 5F2PA 1YJWT 1M90C 4AKNA 4DOVA 1VQNA 4M7DC 4YYNA 3UW9A 1H92A 1SEMA 3AQAA 1YITA 2DMOA 2FRWA 1U1TA 1M9SA 1SHGA 4E7IA 3NFCA 5AYFA 2P0PA 4ZGJB 1OOTA 4MR6A 4EDUA 5GAOr 1W1FA 1R0BG 4IUUA 2FL7A 1M8VA 5D6YA 5J0DA 1Y0MA 1GBRA 1HXDA 3S92A 7AT1B 1JU5C 5H1UA 1K9AA 3PE0A 5KCOA 3CCJA 3OYMA 5GAN4 2A7YA 2YXYA 4J7FA 4CLBA 2K3XA 3HTRA 3JVKA 5GMKl 5KYWA 4M7AA 3LH0A 5HFQA 2QQ9A 5GAOn 3EGXB 4FM4B 2E10A 4EMKB 4NOYA 2L5QA 5II1A 4CI0C 3OYDA 1KHIA 5GAOp 1Z9QA 3G1JA 2QDLA 4DBHA 3OYAA 1M4ZA 4LC2A 4PY6A 4TTEA 3EG3A 3CCET 2QYZA 5DLXA 4PJOB 3S3NA 2L5EA 4C92F 2VXFA 1VQ4A 4QSTA 5GJWB 4N0AA 1VQKA 5EWWA 4HVWA 5D25A 1G3TA 4F7UE 4KV1A 4D6WA 1TOVA 4A9LA 4M4ZA 1M3CA 3Q1JA 3OW2S 3M9QA 4ZTFA 5IHIA 2RNWA 5BT3A 2MMPA 1IXDA 3JB9J 2KAFA 5LVQA 4QQDA 4XU2A 2PVDB 2M9UA 4ALGA 3C4SA 3O34A 4CUPA 4HXMA 2GTOA 1GFDA 5IGLA 1PHTA 4MDWA 4X9DA 4E7KA 1N9SA 3FEOA 4ZTJA 5A5SA 4MENA 2FZGB 1RAIB 2QQBA 3CCRT 1PUOA 5KYXA 2ZCFB 3ZFJA 4J9DA 1OULA 4Q0OA 2CGHA 1M30A 5FU7C 1S1NA 1RI0A 4HVVA 4A4KA 4NR7A 2RHYA 1KC8R 5KYXB 4N4HA 1IZ6A 5LJ5f 4RVRA 4M78A 1U06A 2RK1A 2EBPA 4O7EA 1NG2A 3JCMg 4YY4A 3TLPA 3U5KA 4QEVA 2F69A 4TZ2A 4QR5A 5FU6B 5E9IA 2FO0A 2VUBA 2M1HA 4J9CA 2V1QA 4M7AB 4IIMA 3M55A 1VQ6Q 3LQJA 5AMEA 2RN8A 4AKGA 2X35A 1VQPT 2QGGA 2K2MA 4M77D 5CKDA 3VYHB 1WUMA 5CTLA 2Y4YA 4CC7A 2DWWA 4PJNA 2MPXC 3V8KA 4ESRA 2NXBA 2LDMA 1VQPQ 4C92C 4YK0A 1Q82U 1UGRB 2JS2A 4Y03A 4QBMA 3CCUA 5GMKe 2HEQA 2GFUA 4AKIA 5FFYA 2DL7A 3EAEA 3MPUB 1K9MR 3QYGB 2KSSA 1UGPB 2PU9B 1JM4B 4O6JA 5EPBA 5DFDA 3O8VA 1M90R 2L3RA 3UA6A 5A83A 3UVXA 5J3BA 3GG3A 2KYMA 2LCCA 1FMWA 4J9GA 2GNCA 3VS7A 2R5AA 4QVCA 5EV9A 2RO0A 3OQ5A 3C12A 4JRKA 5DLZA 1MUZA 3KXTA 2RJEA 3OS2A 5D7XA 4FW1A 1UUEA 1H641 2JTMA 3JB9I 3OS1A 4QSSA 2DL8A 3BE3A 4M75G 5LJ3g 3DAIA 4MMLA 3DLMA 5DYXA 5I40A 3ME9A 4LZRA 1Z9ZA 3VRYA 2I0NA 2ED0A 5CCAA 1AHJB 1UDLA 1Q86R 3LH5A 4CFKA 4BE2A 2WACA 3OYIA 1RUWA 3RESA 1VQ7A 3CCEQ 2XMFA 2RNAA 3AT1B 2QA4A 3U5JA 2A3LA 3H41A 3X20B 2R58A 5A5QA 1ZX6A 4P5NA 2QA4Q 4KH1B 3E19A 4ZQLA 1QVFP 2ENMA 3MB4A 4HKEA 4OVAA 3JCMQ 4IUQA 4RTYA 1Q82R 3OYFA 2FPEA 5CRZA 3A8HB 3CMET 5IXFA 1IB8A 1W70A 4C0GA 4YC9A 3UV2A 2DYBA 3DLLA 5JWMA 2KXCA 4YTLA 2L3QA 1H8KA 1VQNT 4RG8A 2RMOA 5CQXA 1YHQA 1FWZA 4TVRA 2YUQA 1Y7XA 4UYDA 4C8QA 2KI7A 1OPKA 3ZL7C 1VQ4T 2NWMA 2X4WA 3HHTB 2D1XA 2A0FB 4AFZC 4KCXA 1BI3A 1NLOC 1OU9A 4RCCA 4BUGA 3QXEB 2CUDA 1YN8A 3JCMb 1I5OB 5IIDA 3Q2EA 2DL5A 5HQ5A 3SHWA 4QQ6A 1YIJT 3UVDA 1M1FA 3QKJA 5GAN8 4PLLA 4BB7A 2MF2A 2EQMA 3G0JA 3M4YA 1K0SA 1FXXA 1KK7A 1CKAA 1YIJQ 2RO1A 2R57A 5C87A 4YYDA 1RLQC 1AWWA 2H8HA 2D82A 5LJ5g 1W4SA 4E47A 5I88A 2K5FA 5F60A 2ZPGB 4RTVA 4AG1C 4EMHA 2LJ0A 3TCJA 5GMKh 4M7AD 2RD1A 1S72A 3VS4A 5HY6A 1E6HA 4KGZB 1X27A 1UGQB 2RI2A 4J6WA 2X4YA 2FZCB 3BDUA 4UITA 2DVRA 1SPKA 2QDYB 3CPWP 4FT2A 4DA4A 5A0DA 4EIKA 3U5PA 4CC3A 1M1KR 5D3TA 1YBYA 1I8FA 2E64A 3GNGA 2DAQA 4QVDA 2HSPA 2O9VA 2IIMA 3L2RA 4C8QE 1Q7YC 2K3YA 2JMCA 2OAWA 1UEBA 3OS0A 4TU6A 4UYEA 1ABQA 3G71T 4MR3A 2X4XA 4CRIA 3QPHA 5FE8A 5CUBA 3CMEA 2LNVA 4HCKA 4DOWA 2XIDA 4A9IA 5DLOA 3JVLA 3X24B 3QDFA 1D0YA 5ENFA 5IGMA 4XUAA 3BFMA 1BI2A 4NL3A 1D1AA 5DLQE 2IG0A 3L2WA 3CD6Q 2YUOA 5LJ3h 4WHWA 5EWCA 1OI1A 3CCUQ 3QDRB 1WLPB 3OYCA 3OYGA 5EP7A 1WA7A 1KQ1A 3U23A 3CCVA 5IHKA 1AVZC 2ATCB 3X28B 5D6XA 2KVQG 4BHWA 2RQRA 1AWJA 1HSQA 1LCKA 2M0OA 1QVFS 1UB4A 1OQKA 2XK0A 5DKDA 1U8RA 2WP2A 5CQ7A 4UIZA 2DATA 2KR3A 4HXKA 2DTOA 1A0NB 2CSQA 2BTTA 4HBWA 2YHTA 5E3GA 4WTOB 2XI9A 1M2VA 4X34A 5DYCA 1I81A 2AKLA 4OB0B 1BKBA 4NUEA 5GAN3 2CT4A 4E7LA 1WHKA 4F04B 5C85A 1WFWA 2AZVA 4F7UF 1SKUB 4A53A 4LZSA 2GBQA 5L8UA 1PKTA 1N8RR 3EG9A 5CUDA 3G6EA 5CUAA 2KNBB 5HM0A 3ER0A 4C5IA 3TSWA 2RPNA 1YHQT 3RKXA 5L23A 5A0GA 3RBBB 1AWXA 5GAMe 2DTIA 3D7CA 4A9FA 4PJOC 4NYVA 3H6ZA 2GGRA 3RR6A 4WF2A 1T0HA 1P92A 1SSFA 2QQSA 4NR4A 3RDVA 4NRAA 3EH2A 4PL6A 5E9VA 1MNEA 1QMCA 4J3IA 4O75A 2P4RA 1NYFA 3P8BB 3LLRA 2J6OA 3CCSA 4PJMA 1HD3A 3A8LB 1I0CA 4M7DE 5D6WA 2K3BA 3U5NA 2L89A 3NHNA 4JLIA 3SWNA 4C8QC 1N8RU 3C94A 1WHJA 2LRQA 2OI3A 2XDPA 4C0ZA 2JM8A 4XY9A 5DBMA 4AFSC 4IOQA 2CT3A 2OTLQ 1MGQA 5CAIA 3CMEQ 4OUFA 1PRLC 1NLPC 2EGCA 3OYLA 4JJNK 1W2BS 4NQMA 3G7ZA 3H8ZA 5FG4A 3CBOA 4PFZA 4BD3A 3CCRA 2HSEB 1LVKA 1QW1A 4HXOA 2KY9A 1ZSZB 3A8MB 5DYAA 4LDYA 2CREA 4PJOD 3GPLA 2D8JA 4ZN3A 2LQWA 3QWYA 2KE9A 1N9RA 5HCLA 5I89A 5EC7A 4A63B 5KTWA 1WHHA 1QP2A 4FT4A 4OF1A 4M7DB 4A54A 4TYLA 4LNPA 3MULA 3OYYA 1AT1B 4KGXB 4M75F 4ORZA 2XU8A 5GANh 5CPEA 5LJ3d 4GY5A 5GANd 2O9SA 2K2VA 3EGDB 3QZ9B 2K4YA 5ECAA 1JB0E 2AZSA 5HCKA 5CUGA 4C67A 4O7AA 5EWDA 2DEQA 1TG0A 3EHRA 3O36A 2M02A 2MAMA 1YP5A 1K8AR 2E6ZA 1RAGB 4J8OA 5CKFA 2EYYA 1D3BB 2OJ2A 1EFNA 3PVQA 4NL2A 3CMAA 5GAOl 1XQHA 1ZSZC 2XKOC 4RG2A 4TT2A 1X01A 1KJWA 2MWOA 4OP0A 2LJ3A 4IKFA 1TXQA 1WNLA 4YBSA 2PUKB 3SVGA 1AD5A 4LDVA 4Q5WA 1K73U 2ROLA 4N0AC 4YYMA 3G0LA 4M7AF 3QJYA 4YBMA 3JVJA 4M77B 3GLXA 4FYVB 2RNXA 4XTUA 5GAMd 2DXTA 3I55T 4J9IA 1Y96B 3QBYA 5CQ3A 5KYUA 4O7CA 1PSEA 4PJOE 2EW3A 2DF6A 4YAXA 2OO1A 1U1SA 1UG1A 3S91A 4CUTA 4O70A 3G6EQ 5KYUB 2V8IA 4DBRA 4E96A 4DQ2A 4HXRA 4B6MA 2ABLA 2L85A 1VQOT 4KRTA 2DKGA 3CCEA 5DYUA 4CC4B 5GANj 1NM7A 3G6ET 4MDXA 5FB1A 1QQJA 1YJNA 2DM1A 4M7AG 5CU8A 1HJDA 3MHXA 1R0CB 1ZUYA 1M3BA 4QZSA 2LQKA 5HEMA 1RL2A 4XQ3A 3UPUA 2E41A 4J7IA 2ECZA 4M77E 5LJ5h 4GPJA 4LE9A 4JJBA 2RS9B 1GRIA 2PVOB 2P0KA 4JUVA 4XK8E 2LVMA 1FMKA 4F16A 2EQJA 3I5SA 3CEYA 3PGGA 2Y4XA 3QUIA 4QSUA 2E7OA 3DWYA 2C0IA 4DBQA 1FX7A 4NUCA 2VVKA 3GF5A 1KG1A 2ZGWA 2E3IA 5KYWB 2O31A 8AT1B 5H1TA 2F1LA 3U5OA 5GANf 2GTJA 3TU4K 2R0YA 5II2A 1NJIU 1VQ7Q 3P8HA 4JZ3A 1YCYA 3TSZA 1K73R 5J39A 1KQSA 2YT6A 3K2JA 3LX7A 1YI2A 4N4FA 1UHCA 1PSFA 1VQNQ 2F2VA 3U5LA 4QSXA 5IT9E 2DE0X 1MNDA 2B8AA 4WCIA 4X1VA 2SRCA 1V1CA 4M77G 1F1BB 2HBPA 4NYWA 2E3KA 4M78F 2OTLA 3CD6T 3MP8A 1E6IA 5F1HA 3CCVT 1PG5B 4QQGA 3P1CA 1G8XA 5FFWA 5KTUA 3IU6A 2GQVA 1PRMC 1TH7A 5C8GA 4UYFA 4LDXA 1M90U 4C66A 5HRVA 1HYOA 1OV3A 2RHUA 2FPFA 4HCBA 1QVFA 5A5RA 2QTVA 3MEAA 2ZZDA 4J9HA 3PNWC 1LPLA 4PCEA 3EH1A 3EG0A 4XTYA 2V1RA 1I5LA 3ZEHA 4HXPA 4J1PA 3QZVA 3QZTA 4O78A 4RTXA 3CPWA 4FSSA 2MK5A 3OMGA 3OYJA 1TWBA 1VQKQ 1WYXA 2R0SA 4Z8AA 1VQMA 2NLUA 4YYHA 5DY9A 5GAOm 4F7UA 5L8RE 4O7FA 4BW1A 3CCVQ 4FL6A 4HCCA 2M16A 2PUOB 5HRXA 3OSVA 4M78C 3V7CA 1B3QA 1K4US 5C4QA 1LNXA 5IHNA 2QTXA 2RHZA 3L2VA 4E7ZA 2DZ9A 2DD4A 2RNYA 4PS5A 5KHMA 1X2KA 3EG9B 5HLSA 5CFWA 1E7OA 1OPLA 5F62A 5L97A 1TS9A 2NUPB 4TS8A 3RMSA 5D7UA 5E9LA 4QYDA 4KV4A 2YELA 5CK9A 1KC8U 1Y57A 3CC7T 2RF0A 4MZPA 5D3HA 2VXEA 5FROA 2ZPBB 3NTKA 1ZSGA 3HFOA 1ZQ1A 5LJ1A 2QG9B 1RI9A 4FIBA 4YH4A 2DJQA 4B9XA 3HRTA 1RACB 4Z88A 2LNHB 4YADA 3OYNA 4ELYC 5FH6A 4QKUA 3JCMd 5GMKj 4C5EA 5BT4A 4HT8A 4OB2B 4HCZA 2JUFA 3UATA 3MB3A 2KEAA 1K76A 1WGSA 3SWNB 3EFOA 3FRNA 1H3ZA 4OMNA 2DBMA 3VJPA 2F5TX 3GOXA 4PKCC 3FC3A 5KO4A 2DIQA 1KQSP 1VQLQ 2COYA 5FFVA 3DB3A 3WXMB 1B34B 3L2UA 2YDLA 1GBQA 3VRZA 1I4K1 3A98A 3CPFA 1WHLA 5GANe 2YLCA 5FBXA 4AKHA 2HD0A 3CC2A 4QVZA 2EPDA 3M0PA 2K9GA 2PQWA 4FSXA 4CURA 1ZA2B 3E1SA 2CZ1B 2X3XD 4CFLA 2RQTA 5FRNA 1D1CA 1UGVA 1YJ9A 5I7XA 3D7SB 1BCOA 2KGTA 3M4GA 4PJOG 3INZA 2QQAA 1UJYA 3M58A 1VQ5Q 3KUFA 3VUBA 2RJFA 2EVRA 2RQWA 1JEGA 1OX9A 1IGUA 3CCLQ 5I22A 4TT4A 3LW5E 5E9MA 4IURA 4UYGA 3ZBDA 2DIGA 5GANg 3J80E 1YJ9T 1VQ6T 1AEYA 4F7UG 4OMMA 1VIFA 1QCNA 2DL4A 2MYSA 3MEWA 3CCJT 5K29A 4JZ4A 2RI3A 3CCLT 2DXBA 4IOOA 2CP3A 2LP5A 5LL6S 3E9GA 1MMNA 3OB9A 2VC8A 5LJ3f 4M7DA 5I2MA 5A82A 5BT5A 4Z89A 5CUEA 4J9BA 2HL5C 5EPRA 2JN0A 3M57A 1K9MC 4PNOA 1VQ5A 4E6RA 3JB9F 2LCSA 4Y92A 1K8AU 4M7AE 3BY7A 5FE5A 5KH6A 1F68A 5DFBA 4AFQC 2YRVA 2XG8D 4IIOA 4C92D 3EGUA 4KULA 1LJOA 5HJCA 1WJQA 3J7AF 2H3EB 1RABB 4QR3A 4M75C 4LZ2A 1I1JA 4C0DB 1LOJA 2IVWA 4MR5A 3P1EA 5A5PA 2NUTB 4M77C 1RAHB 2I7KA 1RLPC 4DEYA 1DJ7B 2CP6A 4BDZA 4OB3B 1PD1A 2KT8A 3CCUT 2D8HA 4EMKA 1Q86C 1VYTA 1M2VB 3PMIA 3A1PA 2F2WA 1M27C 1ZBXA 2BZYA 5D3PA 1D09B 4FYXB 2P0QA 1N72A 5E73A 4CUUA 2D9EA 2RK2A 2GQIA 1UJ0A 1QCFA 4WIVA 2BIVA 3CC7Q 3H0FA 1AZGB 3HRSA 2E4HA 3CXCA 5EVAA 2PVGB 3X26B 5FG5A 1KD1U 3ZYUA 3GNFB 1T0JA 4PKLA 3I35A 3J81E 5FG6A 5L98A 3L42A 2VGMA 4HBVA 1YHQQ 2LQ8A 4M7DD 4JRQA 4YABA 1CSKA 2FPDA 4QR4A 2ZAEA 4OMLA 2YYNA 4EMGA 4YATA 1WIEA 1QVPA 2MWPA 4UYHA 3OYBA 4HXJA 1Q81U 5A5OA 5AT1B 4ZW1A 2LTOA 4LYSA 2RI7A 4AFUC 2FYKA 2K6DA 1YJNT 3R6NA 3CC4T 2EFIA 3QSUA 3S3MA 4LYIA 2E12A 4QSPA 4PJOF 1PD0A 1ZKRA 4QUUA 2G4AA 1D0ZA 1WQWA 3D1BA 4A9NA 3JRZA 4OGJA 2E65A 2RB6A 2EQUA 3MP1A 3HMHA 4M75A 5HQ7A 2M51A 5CKBA 1Q7YR 5J26A 3ASKA 4QSQA 3M0TA 3VS1A 4F3IA 5ENIA 2O2OA 4HT9A 3SVFA 2KXDA 3BDLA 3KFVA 5IGNA 4FCYA 1PC0A 2P84A 4QC1A 4FW2A 4OMFB 3TQ7P 3U5MA 1VQ9T 4N3WA 5CKEA 5M9OA 4AMCA 2KRSA 2A28A 3OW2A 5GAMh 2DEUA 2DILA 4C8QB 3UV5A 4Z1QA 3MKDA 3REAB 5D3SA 1VQ6A 4CUQA 1JQQA 4ANJA 1TUCA 4NS5A 4C92E 1VIEA 2L8DA 3JCMc 3QG1A 4F14A 4BE0A 1ZSZA 1SSHA 2AK5A 1N27A 1NPRA 1JXOA 2IPOB 2JT4A 4IUPA 4PJJA 1UECA 3HMEA 5KU3A 1ARKA 4QSRA 4PTBA 1ZA1B 3CPWS 4XY8A 5CZGA 2K5LA 3VKHA 4A9OA 2VKNA 2FEIA 4C8QF 2EAYA 2AT1B 2LQNA 2QA4T 5FE9A 4KUIA 3OYKA 2DERA 1QVGS 2QAZA 3LWHA 5C6SA 5FWCA 3UVWA 1H3HA 1VUBA 3RIRA 5LJ0A 4CL9A 2E5QA 1QVGA 2EYXA 5GAMj 3MQMA 2LT1A 4BI3A 5LKTA 5KYNA 4YYJA 1SHFA 1NJIC 3OYHA 1CKBA 2K57A 2LX9A 3I56T 2KQWA 4GLMA 4XU3A 5A5NA 1YJ9Q 3META 2WSFE 2VB6A 3R6OA 5CIUA 2QEXT 2J6FA 1BIAA 3C95A 3IQLA 2DVJA 3CCJQ 1VQ4Q 2X9HA 1RAFB 3S3OA 1RAEB 1M1KC 1KQSS 2GRCA 2JJ9A 5F36A 5E9YA 2EIFA 1VYVA 1WHMA 3CC4Q 4M7AC 4EPCA 3VS5A 4O77A 3M0UA 5GMKm 3UV4A 4UYFB 3UF4A 4FYYB 3VKGA 2KMTA 1U5SA 1UGSB 5I7YA 1GCQC 2E6NA 2WSCE 3PFSA 1XJWB 1J3TA 4LD9K 2G6FX 4AI6A 3TREA 4QNSA 5FE1A 1AOJA 4PFPA 4NUDA 1JRIA 3C0CA 5GAN2 2BE9B 5DKHA 3T9NA 2D6FA 5LJ2A 2YSQA 2XHCA 4QB3A 5KE2A 3PIPA 5ACYA 1C1AA 4HBYA 3CCQQ 3VS2A 1NZ9A 4M75D 3CBMA 2MCNA 1UE9A 4A9MA 2EJFA 1NE8A 5F61A 3OSSC 4O71A 3ULRB 5AD2A 2DPPB 4AG2C 1GXIE 4O72A 1WJRA 1VQLT 1MMGA 3CMAT 1W6XA 4XU1A 1BU1A 2JS0A 2VWFA 4PLIA 1Q86U 1G3SA 4ZN1A 3M0QA 5HRWA 3OYEA 2FHDA 3CMAQ 5I80A 2LSPB 4Z6IA 3QIIA 2LJ1A 3EHQA 1EIFA 2KT1A 2H3JA 4E7HA 3SVHA 2COZA 4L59A 1GCPA 1PWTA 2EJ9A 4TU4A 4Z1SA 3SEMA 2HQEA 1Y96A 1MHNA 1WX6A 1VQ8T 2I8NA 1K1ZA 3JCMe 2FVUA 3CCMT 1WXTA 5F3AA 5EA1A 2DVQA 4II1A 4RCBA 3CXCS 1VQ8Q 3CCQT 2D0QB 2O88A 5DFCA 4YH3A 4YYKA 5FE4A 3JB9G 3V8LA 4R0KA 5H1VA 5E3DA 3ERRA 2J05A 4OMPA 4BW2A 3EFRA 1MV0B 5EICA 3MO8A 5GMKi 3M0RA 1W2BP 1JJ2A 5F1LA 1NEBA 3JV3A 4FLPA 1W2BA 2CS7A 4LXCA 1JJ2P 2DRKA 4JDSA 5LUUA 4X9CA 4BI4A 5E74A 5H85A 1JO8A 2OX7A 2JW4A 3BW1A 4E7SA 4M78G 2LX7A 1WPYA 1M1GA 2WSEE 2JVVA 4M75E 1IO6A 3G4SA 1SG5A 1VOMA 3HL8A 3SFMA 2EYZA 5C89A 2CYZB 2LC4A 3FKMX 5FLXE 5HENA 1N5ZA 5FE2A 5I11A 1X75C 4J0SA 2HQHA 3FJPA 4A9JA 5CQAA 3OBYA 2DZCA 2O4XB 3NMZC 4LD6A 1KC8C 2J6KA 2DRMA 1SRMA 2LMJA 2RM4A 5CQYA 1Q82C 3QJ6A 2ZPHB 4LN2A 5FW9A 5D26A 2EJNA 3E2UA 2RA2A 1BI1A 1VQ5T 3D1DA 3JCMP 4BJXA 2DK3A 3VU3C 4HXNA 4LDUA 3JCMX 2O4XA 2NUPA 2RJCA 4ZNXA 1NBEB 5IG6A 1N8RC 5A7CA 1RADB 2JXBA 2ZPEB 2PZ1A 4QSWA 3MP6A 4LUEA 3RERA 4IR4A 5CQ6A 1XNIA 3E9FA 3CCSQ 4NXJA 2KK4A 2KROA 3M53A 1X6BA 3NPFA 3VV0A 2ROTA 4UIVA 2YRDA 4IR3A 3O35A 2JNGA 5DW1A 1OX8A 1GL5A 2MJVB 2EKHA 2QXFA 5CQ5A 3RCWA 4BY6B 2YQDA 5A2QE 4XU0A 3QHSA 3DB4A 3NXBA 5KE3A 4M78D 1WHGA 4O7BA 3JVMA 3ONIA 4J9EA 2RHXA 4A4HA 6AT1B 2L3SA 3CCMA 2XDBA 3VS3A 3PIOA 2ZPFB 1BCMA 4C0FA 4K11A 2CP2A 1YFNA 5HFRA 2L84A 3QYHB 2AKKA 4J0RA 3GIBA 1TUGB 1TU0B 4M75B 5HK3A 4KH0B 2SEMA 1RAAB 3O37A 2DTHA 1YJWA 4NR6A 3CCLA 3QO3A 3CC4A 2FZKB 3SB2A 5F5ZA 4LYWA 3CXCP 5FE0A 2EGAA 4XTVA 4C92B 5CS8A 5E7DA 4OMQA 2EKOA 4FU6A 2OUOA 3EGXA 1OYXA 4HVUA 2CP0A 4QEUA 5CO7A 5DW2A 3I9QA 3JCMV 3JB9D 1G5VA 3JCMf 5D3LA 3N5BB 1G2BA 5ENHA 1G3YA 4BY6C 1YJWQ 1U3OA 1AWOA 5HKCA 3M56A 1IHWA 5FU6C 4C5GA 5IXBA 5I83A 1ZHIA 2PNIA 1FYNA 1VQ9A 2ESWA 5EWVA 1BK2A 5ENCA 3FB9A 1X0JA 2E1HA 4MMKA 3F70A 3JCMW 2BZXA 4E7JA 8ATCB 1R8OB 4JRPA 5FU7B 5C7NA 4IUVA 4C8QD 2CH4W 3MEVA 5GAN6 1JBMA 1SRLA 2KTBB 4A9KA 3RUXA 3V8JA 3CCQA 2E5KA 1NYGA 2P4TA 3O5ZA 4BI8B 3EFOB 3CC2T 3P1FA 2NUZA 4XTWA 4M78E 5GAN5 3KBGA 4ZC9A 2MI6A 2CUBA 2YDWA 1M2OA 3G71A 5DM7R 3IU5A 4OGEA 1B34A 2RFJA 2CZ0B 3VKIA 4OGCA 1HK9A 2HNIA 4KUDK 2DD5A 3MJXA 4NYXA 3VS6A 4YYGA 5ETBA 3CC7A 2X3WD 3CQTA 4O5VA 2WP1A 4RTWA 2J06A 3QZ5B 3X25B 2YRCA 4MR4A 2DVSA 4HA8A 3S6WA 1YIJA 3I56Q 5A85A 4A4GA 1BBZA 2I2LA 1UHFA 3CCMQ 3SWNC 2R10A 1BB9A 4LDFA 5IH2A 5CQ4A 4M7DF 4F17A 1Y71A 5E0RA 4J83A 1PNJA 4RMOA 5D3NA 5AD3A 2OAUA 5E9KA 5GAN7 5CP5A 4D8KA 5CUCA 3QZSA 4UIXA 5TB6A 2DJZA 5JI8A 4Q0NA 2YWWA 4XUBA 4E2FB 5EG2A 3I55A 4PJOA 2OTJQ 3QWXX 4UC4A 1BI0A 2KBTA 4J5YA 4JJCA 1QWEA 3H9NA 3PT9A 5D24A 4L6V5 2H60A 1OZ3A 5LKXA 4KBMB 2FSAA 1KD1R 2XICA 3I3JA 3EGDA 2L2PA 1X2QA 2A08A 1KD1C 2JTEA 4A9EA 5KTXA 1IHVA 2A36A 3LJWA 4R55A 3OA6A 5ETDA 4ZGDB 2VV5A 2JM9A 1GFCA 5AMFA 1KSWA 3UWNA 3WVDB 1UFFA 3UDCA 1Q81C 4CC2A 3AHUA 2QQRA 4M78B 4Y91A 1PM3A 2DVEA 4ME7A 4DONA 2KYBA 4QSVA 1ACMB 2RHIA 5D3JA 1MMAA 3V7RA 1JSPB 1VQ9Q 3P8DA 2NUTA 1D0XA 4IUTA 2D9TA 4Z02A 3FIFA 1M3AA 4QEWA 1NPPA 1QCOA 1YJNQ 2DVVA 3Q2FA 1QLYA 1ZS5A 2HMAA 4PJLA 2K79A 2OTJT 1E6GA 2V8KA 5EPSA 1GCQA 4UIUA 1KHCA 1QWFA 5ENJA 4VUBA 2BKDN 1O9SA 1ZLMA 9ATCB 1V76A 5COIA 5L8TA 2M0YA 4L5GA 4C92A 4KGVB 5C0MA 2X4JA 5GAOq 4JJDA 3VUZA 3JAME 3GP8A 1NEGA 2Z0WA 3EG2A 5FH7A 2CZ7B 2OTLT 5LVRA 1YITQ 1M5Q1 3CD6A 1TUDA 3G4SQ 3V7SA 5EU1A 4GBQA 4ALHA 2HZYA 2KRNA 1BIBA 5ENBA 5CQ8A 5KCHA 4DBFA 4HBXA 5FE6A 1IGQA 4JRIA 5L99A 1ZBJA 2F5KA 1WXBA 3MCAB 4M77F 3MUKA 2R5MA 4NRBA 3FLGA 4RTUA 5G4RA 1VQPA 4M7DG 3HKSA 3THKA 1IREB 4V2SA 4C8QG 4C5HA 2EGEA 2RI5A 2VGNA 5GAMg 4IR6A 2QEXQ 5ENGA 5FDZA 4XTZA 1KIKA 1M1KU 2DKWA 1KQ2A 1QP3A 2E7NA 5I86A 5EWHA 2COWA 3REBB 1C6VX 4BW4A 1YCSB 5D3RA 4RUGA 1D1BA 4NR9A 4WHUA 2RJDA 3A8GB 4UIWA 1YITT 2B86A 4NR5A 1ZUUA 1YWPA 2HBWA 1WI7A 2W10A 3RMQA 2YEKA 1X43A 3A8OB 4D8DA 2QGFB 4J6YA 2X51A 3OS5A 5KYYA 2F6JA 3O33A 4TT6A 5EQ1A 1X6OA 2CKKA 2LCLA 4AT1B 1Y07A 4QT7A 3URGA 2GCXA 2DX1A 1WDXA 4PCIA 3CBPA 5IN1A 4DEXA 4MEOA 4EMKC 5CVIA 1K0XA 4NRCA 3HP9A 2QI2A 4A4EA 3OBWA 5I2SA 2YUPA 2HQXA 3JCMJ 1ZUKA 4MEQA 2A37A 4NQNA 4M77A 3TEEA 3PMTA 3M0SA 1KFZA 3L2QA 4FYWB 5CRMA 1OZ2A 3LQIA 2EQIA 2AHJB 1C0MA 3LQHA 1AZEA 4IORA 3JCMh 2C0TA 2DXCA 2D0NA 4LDWA 4TZ8A 5DX4A 1OEBA 3G71Q 2VYTA 3I55Q 4OGIA 5LKUA 1B07A 2MIOA 3HMFA 2HKQB 2YEMA 2QEXA 1VYUA 1X6GA 4UIYA 5TCMA 1BYMA 2J7IA 4J6XA 1MV3A 1VQ8A 1T3LA 1MMDA 1UTIA 2QASA 5LJ5d 4ATOA 2DFUA 3M59A 4JS5A 1OU8A 5FE3A 3H0IA 4MZMA 4ELZC 3OY9A 4HXLA 2CSIA 5EK9A 4OB1B 1VQOQ 1YI2Q 4LR6A 2BZ8A 3TVTA 3RNJA 1IRXA 3NTIA 1EZZB 2ED1A 5EI4A 1XTDA 2EYWA 2YW5A 4F7UB 2MOXA 4MEPA 2L3PA 1D3BA 5CY9A 2R0VA 4BDYA 1WUGA 1VQMT 2K7AA 2YUNA 5IGKA 2CH4A 2ZPIB 1G83A 4BACA 3LGFA 5FWBA 2HL3A 1VQMQ 3EFSA 1TTHB 1K9MU 2K5IA 3I5RA 3PTAA 5FRMA 4TQNA 1X69A 2PTKA 5DY7A 5EM3A 4XAXB 4YBTA 1PKSA 1M8MA 3VS0A 1VQLA 2DBKA 5EISA 3JB9H 1PCXA 3M5AA 4R56A 1VA7A 1VQ7T 4J9FA 1YI2T 5CGPA 2EQKA 4QY4A 2F6NA 2EYQA 4OMOA 3EG1A 4RTZA 4IR5A 3CC2Q 3SD4A 4LUDA 5FB0A 5F63A 1I07A 1JXMA 2EJGA 1O75A 3DKMA 3FDRA 4QW2A 2JMAA 5CQTA 5GJVB 1S72T 2CP7A 4C0DC 2RQVA 2BUDA 3MEUA 5A0LA 3LWIA 4ZGEB 1TSFA 1QVGP 2HAXA 4HXSA 1SF9A 3CCRQ 3OMCA 4MZTA 3WVEB 5D0CA 4CUSA
chains in the Genus database with same CATH topology
5LJ5j 1VQOA 4N4IA 4XYAA 5IAYA 3CCST 2V8JA 2KDSA 5LJ3e 5GAMf 4XTXA 5CKHA 5ENEA 5HELA 4Z6HA 1Q7YU 3A5ZB 2EWNA 4O74A 2XDDA 4X2IA 4BE1A 2JOYA 2OTJA 1JJ2S 4NR8A 3SDZA 3G4ST 3L1AA 1VQKT 4YY6A 3HRUA 4KT0E 2XD0A 3HPWA 4BW3A 5EGUA 4QYLA 4N4GA 5CR2A 4Z93A 2O01E 3RKYA 1G3WA 2N9GA 5HQ6A 2GF7A 5I29A 4A4FA 4A9HA 3LYIA 4JS4A 3LXJA 2RH2A 3LGLA 2E70A 2FB7A 3M54A 3HSBA 4C92G 2DO3A 1N6AA 2CZ6B 3L2ZA 3VYGA 1V29B 4RKUE 4JLGA 3RKWA 4B9WA 2G3RA 1XOVA 3MXFA 4LRGA 5FE7A 3JSCA 5I1QA 3I56A 2LT4A 5HK0A 3NTHA 2OSSA 4QUTA 2GFAA 3P5OA 4YYIA 3UT1A 5I21A 5LJ5e 2JZ2A 2Y90A 4O76A 5A81A 1EQFA 3AADA 3HFNA 5IBNA 5LJ3j 5L96A 4GLKA 5LKZA 1K8AC 1WQ7A 2C06A 1WJSA 2DXUA 4QC3A 5DKCA 5FH8A 1K73C 5F25A 2YLBA 5G4SA 2JTFA 4Y28E 3UVYA 3P1DA 1YJWT 5F2PA 1M90C 4AKNA 4DOVA 1VQNA 4M7DC 4YYNA 3UW9A 3AQAA 1YITA 1U1TA 1M9SA 4E7IA 3NFCA 5AYFA 2P0PA 4ZGJB 4MR6A 4EDUA 5GAOr 4IUUA 2FL7A 1M8VA 5D6YA 5J0DA 1HXDA 3S92A 5H1UA 5KCOA 3CCJA 3OYMA 5GAN4 2A7YA 4J7FA 4CLBA 2K3XA 3JVKA 5GMKl 4M7AA 3LH0A 5HFQA 2QQ9A 5GAOn 4FM4B 2E10A 4EMKB 4NOYA 2L5QA 5II1A 4CI0C 3OYDA 1KHIA 5GAOp 3OYAA 1M4ZA 4LC2A 4PY6A 4TTEA 3CCET 5DLXA 4PJOB 3S3NA 2L5EA 4C92F 2VXFA 1VQ4A 4QSTA 4N0AA 1VQKA 5EWWA 5D25A 1G3TA 4F7UE 4KV1A 4D6WA 4A9LA 3Q1JA 3OW2S 3M9QA 4ZTFA 2RNWA 5BT3A 2MMPA 3JB9J 2KAFA 5LVQA 4QQDA 4XU2A 2PVDB 2M9UA 4ALGA 3C4SA 3O34A 4CUPA 4HXMA 5IGLA 4MDWA 4X9DA 4E7KA 1N9SA 3FEOA 4ZTJA 5A5SA 4MENA 2QQBA 3CCRT 2ZCFB 3ZFJA 4Q0OA 2CGHA 5FU7C 1RI0A 4A4KA 4NR7A 2RHYA 4N4HA 1IZ6A 5LJ5f 4RVRA 4M78A 2RK1A 4O7EA 3JCMg 4YY4A 3TLPA 3U5KA 4QEVA 2F69A 4TZ2A 4QR5A 5FU6B 5E9IA 2VUBA 2M1HA 4M7AB 3M55A 3LQJA 5AMEA 2X35A 1VQPT 4M77D 5CKDA 3VYHB 1WUMA 5CTLA 2Y4YA 2DWWA 3V8KA 2NXBA 2LDMA 4C92C 4YK0A 1Q82U 1UGRB 4Y03A 4QBMA 3CCUA 5GMKe 2GFUA 5FFYA 3EAEA 3QYGB 2KSSA 1UGPB 2PU9B 1JM4B 4O6JA 5EPBA 5DFDA 3O8VA 2L3RA 5A83A 3UVXA 5J3BA 3GG3A 2LCCA 2R5AA 4QVCA 5EV9A 2RO0A 3OQ5A 3C12A 4JRKA 5DLZA 3KXTA 2RJEA 3OS2A 5D7XA 1H641 2JTMA 3JB9I 3OS1A 4QSSA 4M75G 5LJ3g 3DAIA 4MMLA 3DLMA 5DYXA 5I40A 3ME9A 4LZRA 5CCAA 1AHJB 4CFKA 4BE2A 2WACA 3OYIA 3RESA 1VQ7A 2QA4A 3U5JA 2A3LA 3X20B 2R58A 5A5QA 4P5NA 3E19A 4ZQLA 3MB4A 4HKEA 4OVAA 3JCMQ 4IUQA 3OYFA 5CRZA 3A8HB 3CMET 4C0GA 4YC9A 3UV2A 3DLLA 5JWMA 4YTLA 1VQNT 4RG8A 5CQXA 1YHQA 1FWZA 4TVRA 1Y7XA 4UYDA 4C8QA 1VQ4T 2X4WA 3HHTB 4KCXA 1BI3A 4RCCA 4BUGA 3QXEB 3JCMb 5IIDA 3Q2EA 5HQ5A 4QQ6A 1YIJT 3UVDA 1M1FA 3QKJA 5GAN8 4PLLA 4BB7A 2EQMA 2MF2A 3G0JA 3M4YA 1FXXA 2RO1A 2R57A 5C87A 4YYDA 2D82A 5LJ5g 4E47A 1W4SA 5I88A 2K5FA 4EMHA 5F60A 2ZPGB 3TCJA 5GMKh 4M7AD 2RD1A 1S72A 5HY6A 1UGQB 2RI2A 4J6WA 2X4YA 3BDUA 4UITA 2DVRA 2QDYB 4FT2A 4DA4A 5A0DA 3U5PA 5D3TA 1YBYA 1I8FA 2E64A 3GNGA 2DAQA 4QVDA 3L2RA 4C8QE 1Q7YC 2K3YA 1UEBA 3OS0A 4TU6A 4UYEA 3G71T 4MR3A 2X4XA 4CRIA 3QPHA 5FE8A 5CUBA 3CMEA 2LNVA 4DOWA 2XIDA 4A9IA 5DLOA 3JVLA 3X24B 5ENFA 5IGMA 4XUAA 3BFMA 1BI2A 4NL3A 5DLQE 2IG0A 3L2WA 5LJ3h 4WHWA 5EWCA 1OI1A 3QDRB 3OYCA 3OYGA 5EP7A 1KQ1A 3CCVA 3X28B 5D6XA 2KVQG 4BHWA 2M0OA 1QVFS 1UB4A 2XK0A 5DKDA 1U8RA 2WP2A 5CQ7A 4UIZA 2DATA 4HXKA 2DTOA 4HBWA 2YHTA 5E3GA 2XI9A 4X34A 5DYCA 1I81A 4OB0B 1BKBA 4NUEA 5GAN3 4E7LA 5C85A 4F7UF 4A53A 4LZSA 5L8UA 5CUDA 3G6EA 5CUAA 5HM0A 3ER0A 4C5IA 1YHQT 3RKXA 5A0GA 5GAMe 2DTIA 3D7CA 4A9FA 4PJOC 4NYVA 3H6ZA 4WF2A 1P92A 1SSFA 2QQSA 4NR4A 4NRAA 4PL6A 5E9VA 4J3IA 4O75A 3P8BB 3LLRA 3CCSA 3A8LB 4M7DE 5D6WA 3U5NA 2L89A 3SWNA 4JLIA 4C8QC 1N8RU 3C94A 2LRQA 2XDPA 4C0ZA 4XY9A 5DBMA 4IOQA 1MGQA 5CAIA 4OUFA 3OYLA 4JJNK 1W2BS 4NQMA 3G7ZA 3H8ZA 5FG4A 3CBOA 4BD3A 3CCRA 1QW1A 4HXOA 2KY9A 3A8MB 5DYAA 4LDYA 4PJOD 3GPLA 4ZN3A 1N9RA 5HCLA 5I89A 5KTWA 4OF1A 1QP2A 4FT4A 4M7DB 4A54A 4TYLA 3MULA 3OYYA 4M75F 2XU8A 5GANh 5CPEA 5LJ3d 4GY5A 5GANd 2K2VA 3QZ9B 2K4YA 1JB0E 5CUGA 4C67A 4O7AA 5EWDA 2DEQA 3O36A 2MAMA 2E6ZA 4J8OA 5CKFA 1D3BB 4NL2A 3CMAA 5GAOl 1XQHA 2XKOC 4RG2A 4TT2A 1X01A 2MWOA 4OP0A 4IKFA 1WNLA 4YBSA 2PUKB 3SVGA 4LDVA 4Q5WA 1K73U 4N0AC 4YYMA 3G0LA 4M7AF 3QJYA 4YBMA 3JVJA 4M77B 3GLXA 2RNXA 4XTUA 5GAMd 2DXTA 3I55T 1Y96B 3QBYA 5CQ3A 4O7CA 1PSEA 4PJOE 4YAXA 2OO1A 1U1SA 3S91A 4CUTA 4O70A 2V8IA 4E96A 4DQ2A 4HXRA 2L85A 1VQOT 3CCEA 2DKGA 5DYUA 5GANj 3G6ET 4MDXA 5FB1A 1YJNA 4M7AG 5CU8A 3MHXA 4QZSA 2LQKA 5HEMA 1RL2A 4XQ3A 3UPUA 2E41A 4J7IA 4M77E 5LJ5h 4GPJA 2RS9B 2PVOB 2P0KA 4JUVA 4XK8E 2LVMA 2EQJA 3CEYA 3PGGA 2Y4XA 3QUIA 4QSUA 2E7OA 3DWYA 1FX7A 4NUCA 3GF5A 1KG1A 2ZGWA 5H1TA 3U5OA 5GANf 3TU4K 2R0YA 5II2A 1NJIU 3P8HA 1YCYA 5J39A 1KQSA 3K2JA 3LX7A 1YI2A 4N4FA 1PSFA 3U5LA 4QSXA 5IT9E 2B8AA 4M77G 2HBPA 4NYWA 2E3KA 4M78F 2OTLA 3CD6T 3MP8A 1E6IA 5F1HA 3CCVT 4QQGA 3P1CA 5FFWA 5KTUA 3IU6A 2GQVA 1TH7A 5C8GA 4UYFA 4LDXA 1M90U 4C66A 5HRVA 2RHUA 4HCBA 1QVFA 5A5RA 3MEAA 2ZZDA 3PNWC 4PCEA 4XTYA 1I5LA 3ZEHA 4HXPA 4J1PA 3QZVA 3QZTA 4O78A 3CPWA 3OMGA 3OYJA 2R0SA 1VQMA 2NLUA 4YYHA 5DY9A 5GAOm 4F7UA 5L8RE 4O7FA 4BW1A 4FL6A 4HCCA 2M16A 2PUOB 5HRXA 3OSVA 4M78C 3V7CA 5C4QA 1LNXA 2QTXA 2RHZA 3L2VA 2DZ9A 2DD4A 2RNYA 4PS5A 5KHMA 5HLSA 5CFWA 5F62A 5L97A 4TS8A 3RMSA 5E9LA 4QYDA 4KV4A 2YELA 5CK9A 1KC8U 3CC7T 4MZPA 5D3HA 2VXEA 5FROA 2ZPBB 3NTKA 3HFOA 1ZQ1A 5LJ1A 4FIBA 4YH4A 4B9XA 3HRTA 4YADA 3OYNA 4ELYC 5FH6A 3JCMd 5GMKj 4C5EA 5BT4A 4HT8A 4OB2B 4HCZA 2JUFA 3MB3A 1WGSA 3SWNB 3FRNA 1H3ZA 3VJPA 2F5TX 3GOXA 4PKCC 3FC3A 5KO4A 2DIQA 5FFVA 3DB3A 3WXMB 1B34B 3L2UA 1I4K1 3CPFA 5GANe 2YLCA 5FBXA 2HD0A 3CC2A 4QVZA 4FSXA 2PQWA 4CURA 3E1SA 2CZ1B 4CFLA 5FRNA 1YJ9A 5I7XA 3M4GA 4PJOG 3INZA 2QQAA 3M58A 3KUFA 3VUBA 2RJFA 3J80E 4TT4A 3LW5E 5E9MA 4IURA 4UYGA 3ZBDA 2DIGA 5GANg 1YJ9T 1VQ6T 4F7UG 1VIFA 3MEWA 3CCJT 5K29A 3CCLT 2RI3A 2DXBA 4IOOA 5LL6S 3E9GA 3OB9A 2VC8A 5LJ3f 4M7DA 5I2MA 5A82A 5BT5A 5CUEA 5EPRA 2JN0A 3M57A 1K9MC 4PNOA 1VQ5A 3JB9F 1K8AU 4M7AE 3BY7A 5FE5A 5KH6A 1F68A 5DFBA 2YRVA 2XG8D 4C92D 4KULA 1LJOA 5HJCA 1WJQA 3J7AF 4QR3A 4M75C 4LZ2A 4C0DB 1LOJA 2IVWA 4MR5A 3P1EA 5A5PA 4M77C 2I7KA 1DJ7B 4BDZA 4OB3B 3CCUT 4EMKA 1Q86C 3PMIA 1ZBXA 5D3PA 2P0QA 1N72A 5E73A 4CUUA 2D9EA 2RK2A 4WIVA 2BIVA 3HRSA 3CXCA 5EVAA 2PVGB 3X26B 5FG5A 1KD1U 3ZYUA 3GNFB 4PKLA 3J81E 5FG6A 5L98A 3L42A 2VGMA 4HBVA 2LQ8A 4M7DD 4JRQA 4YABA 4QR4A 2YYNA 4EMGA 4YATA 1QVPA 2MWPA 4UYHA 3OYBA 1Q81U 5A5OA 4ZW1A 2LTOA 4LYSA 2RI7A 2FYKA 1YJNT 3CC4T 2EFIA 3QSUA 3S3MA 4LYIA 2E12A 4QSPA 4PJOF 4QUUA 2G4AA 1WQWA 4A9NA 3JRZA 4OGJA 2E65A 2RB6A 2EQUA 3MP1A 3HMHA 4M75A 5HQ7A 5CKBA 5J26A 3ASKA 4QSQA 4F3IA 5ENIA 4HT9A 3SVFA 3BDLA 5IGNA 4QC1A 4OMFB 3U5MA 1VQ9T 4N3WA 5CKEA 5M9OA 3OW2A 5GAMh 4C8QB 3UV5A 4Z1QA 5D3SA 1VQ6A 4CUQA 4NS5A 4C92E 1VIEA 2L8DA 3JCMc 3QG1A 4BE0A 1N27A 1NPRA 4IUPA 3HMEA 5KU3A 4QSRA 4PTBA 3CPWS 4XY8A 5CZGA 2K5LA 4A9OA 4C8QF 2EAYA 2QA4T 5FE9A 4KUIA 3OYKA 1QVGS 3LWHA 5C6SA 3UVWA 1VUBA 3RIRA 5LJ0A 4CL9A 2E5QA 1QVGA 5GAMj 3MQMA 2LT1A 4BI3A 5LKTA 4YYJA 1NJIC 3OYHA 2K57A 2LX9A 3I56T 2KQWA 4XU3A 5A5NA 3META 2WSFE 3R6OA 5CIUA 2QEXT 1BIAA 3C95A 3S3OA 1M1KC 1KQSS 2GRCA 5F36A 5E9YA 2EIFA 4M7AC 4EPCA 4O77A 5GMKm 3UV4A 4UYFB 2KMTA 1UGSB 5I7YA 2E6NA 3PFSA 2WSCE 4LD9K 3TREA 4QNSA 5FE1A 4NUDA 1JRIA 5GAN2 3T9NA 5DKHA 2D6FA 5LJ2A 2XHCA 4QB3A 5KE2A 3PIPA 5ACYA 4HBYA 1NZ9A 4M75D 3CBMA 4A9MA 2EJFA 1NE8A 5F61A 3OSSC 4O71A 5AD2A 2DPPB 1GXIE 4O72A 1WJRA 1VQLT 3CMAT 4XU1A 4PLIA 1Q86U 1G3SA 4ZN1A 5HRWA 3OYEA 2FHDA 5I80A 2LSPB 4Z6IA 3QIIA 1EIFA 2H3JA 4E7HA 3SVHA 4L59A 2EJ9A 4TU4A 4Z1SA 2HQEA 1Y96A 1MHNA 1VQ8T 2I8NA 3JCMe 2FVUA 3CCMT 5F3AA 5EA1A 2DVQA 4II1A 4RCBA 3CXCS 3CCQT 2D0QB 5DFCA 4YH3A 4YYKA 5FE4A 3JB9G 3V8LA 5H1VA 5E3DA 4BW2A 3EFRA 5EICA 3MO8A 5GMKi 1JJ2A 5F1LA 4FLPA 1W2BA 2CS7A 4JDSA 5LUUA 4X9CA 4BI4A 5E74A 3BW1A 5H85A 4M78G 1WPYA 1M1GA 2WSEE 2JVVA 4M75E 3G4SA 3HL8A 3SFMA 5C89A 2CYZB 2LC4A 3FKMX 5FLXE 5HENA 5FE2A 1X75C 4J0SA 3FJPA 4A9JA 5CQAA 3OBYA 2DZCA 2O4XB 4LD6A 1KC8C 2RM4A 5CQYA 1Q82C 3QJ6A 2ZPHB 5D26A 2RA2A 1BI1A 1VQ5T 3JCMP 4BJXA 2DK3A 3VU3C 4HXNA 4LDUA 3JCMX 2O4XA 2RJCA 5IG6A 1N8RC 5A7CA 2ZPEB 4QSWA 3MP6A 3RERA 4IR4A 5CQ6A 1XNIA 3E9FA 4NXJA 2KK4A 3M53A 3VV0A 4UIVA 4IR3A 3O35A 2JNGA 5DW1A 2MJVB 2QXFA 5CQ5A 3RCWA 4BY6B 2YQDA 5A2QE 4XU0A 3QHSA 3DB4A 3NXBA 5KE3A 4M78D 4O7BA 3JVMA 3ONIA 4A4HA 2RHXA 2XDBA 3CCMA 3PIOA 2ZPFB 4C0FA 5HFRA 2L84A 3QYHB 4J0RA 3GIBA 4M75B 5HK3A 3O37A 2DTHA 1YJWA 4NR6A 3CCLA 3QO3A 3CC4A 3SB2A 5F5ZA 4LYWA 5FE0A 4XTVA 4C92B 5CS8A 5E7DA 2EKOA 4FU6A 2OUOA 1OYXA 4QEUA 5CO7A 5DW2A 3JCMV 3JB9D 1G5VA 3JCMf 5D3LA 3N5BB 5ENHA 1G3YA 4BY6C 5HKCA 3M56A 5FU6C 4C5GA 5I83A 1ZHIA 1VQ9A 5EWVA 5ENCA 3FB9A 1X0JA 2E1HA 4MMKA 3F70A 3JCMW 4E7JA 1R8OB 4JRPA 5FU7B 5C7NA 4IUVA 4C8QD 3MEVA 5GAN6 1JBMA 2KTBB 4A9KA 3RUXA 3V8JA 3CCQA 2P4TA 4BI8B 3CC2T 3P1FA 4XTWA 4M78E 5GAN5 3KBGA 4ZC9A 2MI6A 2YDWA 3G71A 5DM7R 3IU5A 4OGEA 1B34A 2RFJA 2CZ0B 3VKIA 4OGCA 1HK9A 2HNIA 4KUDK 2DD5A 4NYXA 3CC7A 4YYGA 5ETBA 4O5VA 2WP1A 3QZ5B 3X25B 4MR4A 2DVSA 4HA8A 3S6WA 1YIJA 5A85A 4A4GA 2I2LA 3SWNC 2R10A 4LDFA 5CQ4A 4M7DF 1Y71A 5E0RA 4J83A 4RMOA 5D3NA 5AD3A 2OAUA 5E9KA 5GAN7 5CP5A 5CUCA 3QZSA 4UIXA 5TB6A 2DJZA 5JI8A 4Q0NA 4XUBA 5EG2A 3I55A 4PJOA 4UC4A 1BI0A 4J5YA 3PT9A 5D24A 4L6V5 2H60A 1OZ3A 5LKXA 4KBMB 2FSAA 2XICA 3I3JA 1KD1C 4A9EA 5KTXA 4R55A 3LJWA 3OA6A 5ETDA 4ZGDB 2VV5A 5AMFA 3UWNA 3WVDB 3UDCA 1Q81C 3AHUA 2QQRA 4M78B 4Y91A 2DVEA 4ME7A 4DONA 4QSVA 2RHIA 5D3JA 3V7RA 1JSPB 3P8DA 4IUTA 2D9TA 4Z02A 3FIFA 4QEWA 1NPPA 2DVVA 3Q2FA 1ZS5A 2OTJT 2V8KA 5EPSA 4UIUA 1KHCA 5ENJA 4VUBA 2BKDN 1O9SA 4L5GA 5COIA 5L8TA 4C92A 5C0MA 2X4JA 5GAOq 3VUZA 3JAME 3GP8A 5FH7A 2CZ7B 2OTLT 5LVRA 3CD6A 1M5Q1 3V7SA 5EU1A 4ALHA 1BIBA 5ENBA 5CQ8A 5KCHA 4HBXA 5FE6A 4JRIA 5L99A 2F5KA 3MCAB 4M77F 3MUKA 2R5MA 4NRBA 3FLGA 5G4RA 1VQPA 4M7DG 3HKSA 1IREB 4V2SA 4C8QG 4C5HA 2VGNA 2RI5A 5GAMg 4IR6A 5ENGA 5FDZA 4XTZA 1M1KU 2DKWA 1KQ2A 1QP3A 2E7NA 5I86A 5EWHA 4BW4A 5D3RA 4NR9A 4WHUA 2RJDA 3A8GB 4UIWA 1YITT 4NR5A 3RMQA 2YEKA 3A8OB 4J6YA 3OS5A 2F6JA 3O33A 4TT6A 5EQ1A 1X6OA 2CKKA 2LCLA 1Y07A 3URGA 2GCXA 4PCIA 3CBPA 5IN1A 4MEOA 4EMKC 5CVIA 4NRCA 3HP9A 2QI2A 4A4EA 3OBWA 5I2SA 2HQXA 3JCMJ 4MEQA 4NQNA 4M77A 3TEEA 3PMTA 3L2QA 5CRMA 1OZ2A 3LQIA 2AHJB 3LQHA 4IORA 3JCMh 2DXCA 4LDWA 4TZ8A 5DX4A 2VYTA 4OGIA 5LKUA 3HMFA 2YEMA 2QEXA 4UIYA 5TCMA 1BYMA 4J6XA 1VQ8A 5LJ5d 4ATOA 3M59A 4JS5A 5FE3A 4MZMA 4ELZC 3OY9A 4HXLA 5EK9A 4OB1B 4LR6A 3NTIA 5EI4A 1XTDA 2YW5A 4F7UB 4MEPA 1D3BA 5CY9A 2R0VA 4BDYA 1WUGA 1VQMT 2ZPIB 5IGKA 4BACA 3LGFA 3EFSA 1K9MU 2K5IA 3PTAA 5FRMA 4TQNA 5DY7A 5EM3A 4XAXB 4YBTA 1VQLA 5EISA 3JB9H 3M5AA 4R56A 1VQ7T 1YI2T 5CGPA 2EQKA 4QY4A 2F6NA 2EYQA 4IR5A 3SD4A 5FB0A 5F63A 2EJGA 1O75A 3DKMA 3FDRA 4QW2A 5CQTA 1S72T 4C0DC 2BUDA 3MEUA 5A0LA 3LWIA 4ZGEB 2HAXA 4HXSA 3OMCA 4MZTA 3WVEB 5D0CA 4CUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4I A;  4XYA A;  5DW1 A;  5IAY A;  3L2R A;  2MJV B;  2K3Y A;  5CQ5 A;  3RCW A;  5FBX A;  4QVZ A;  2YQD A;  3OS0 A;  5ENE A;  5HEL A;  2PQW A;  4TU6 A;  4UYE A;  4Z6H A;  3DB4 A;  3NXB A;  5KE3 A;  4MR3 A;  4CUR A;  2X4X A;  4O7B A;  3JVM A;  4CRI A;  3ONI A;  4O74 A;  2RHX A;  5FE8 A;  4X2I A;  5CUB A;  4A4H A;  4BE1 A;  4CFL A;  5FRN A;  4A9I A;  3JVL A;  4NR8 A;  5I7X A;  5ENF A;  5IGM A;  4XUA A;  5HFR A;  2L84 A;  4YY6 A;  3KUF A;  2RJF A;  4J0R A;  4TT4 A;  5E9M A;  4IUR A;  4UYG A;  2DIG A;  3O37 A;  2IG0 A;  3L2W A;  4BW3 A;  5EGU A;  4WHW A;  5EWC A;  4NR6 A;  4QYL A;  4N4G A;  3MEW A;  4Z93 A;  1OI1 A;  3OYC A;  3OYG A;  5EP7 A;  5F5Z A;  4LYW A;  5K29 A;  2RI3 A;  4IOO A;  5FE0 A;  2N9G A;  5HQ6 A;  2GF7 A;  3E9G A;  5I29 A;  5CS8 A;  5E7D A;  4A4F A;  4A9H A;  3LYI A;  5D6X A;  4BHW A;  2EKO A;  4FU6 A;  3OB9 A;  2OUO A;  2M0O A;  3LXJ A;  1OYX A;  3LGL A;  5A82 A;  2XK0 A;  5DKD A;  5BT5 A;  2WP2 A;  5CQ7 A;  4UIZ A;  5CUE A;  2DAT A;  4HXK A;  5EPR A;  4QEU A;  5DW2 A;  1G5V A;  4HBW A;  5E3G A;  5D3L A;  5ENH A;  4B9W A;  5FE5 A;  2G3R A;  4X34 A;  5DYC A;  3MXF A;  5KH6 A;  4C5G A;  4LRG A;  4NUE A;  5I83 A;  1F68 A;  5DFB A;  5FE7 A;  5I1Q A;  4E7L A;  5C85 A;  2YRV A;  5EWV A;  5ENC A;  1X0J A;  3NTH A;  2OSS A;  4LZS A;  4QUT A;  5L8U A;  5HJC A;  3P5O A;  1WJQ A;  2GFA A;  4YYI A;  5CUD A;  3F70 A;  3UT1 A;  5CUA A;  2JZ2 A;  5HM0 A;  4O76 A;  4QR3 A;  5A81 A;  4E7J A;  4LZ2 A;  1EQF A;  3AAD A;  5IBN A;  4C5I A;  4MR5 A;  5L96 A;  3P1E A;  5A5P A;  5LKZ A;  5C7N A;  2I7K A;  4IUV A;  3MEV A;  2KTB B;  4A9K A;  1WJS A;  4BDZ A;  4IR3 A;  4QC3 A;  5DKC A;  3P1F A;  3PMI A;  5FH8 A;  3D7C A;  4A9F A;  4NYV A;  3H6Z A;  5F25 A;  5D3P A;  4ZC9 A;  1SSF A;  4NR4 A;  2QQS A;  5G4S A;  2YDW A;  4NRA A;  2JTF A;  1N72 A;  4PL6 A;  5E73 A;  4CUU A;  2D9E A;  5E9V A;  3UVY A;  3IU5 A;  4J3I A;  3P1D A;  2RFJ A;  4O75 A;  5F2P A;  4WIV A;  2BIV A;  3LLR A;  4AKN A;  5EVA A;  5FG5 A;  5D6W A;  4YYN A;  4NYX A;  4YYG A;  5ETB A;  3UW9 A;  3ZYU A;  3U5N A;  2L89 A;  2WP1 A;  3AQA A;  2LRQ A;  4PKL A;  2XDP A;  4MR4 A;  2DVS A;  4XY9 A;  5DBM A;  3S6W A;  4IOQ A;  5FG6 A;  5L98 A;  5A85 A;  3L42 A;  4E7I A;  4A4G A;  4HBV A;  4OUF A;  2R10 A;  4MR6 A;  4LDF A;  4EDU A;  4YAB A;  5CQ4 A;  4QR4 A;  5E0R A;  4IUU A;  2YYN A;  3OYL A;  4YAT A;  4NQM A;  5D3N A;  2MWP A;  5AD3 A;  4UYH A;  5D6Y A;  3H8Z A;  5E9K A;  3OYB A;  5FG4 A;  5J0D A;  5CP5 A;  5A5O A;  5CUC A;  3QZS A;  4ZW1 A;  4UIX A;  2LTO A;  4LYS A;  3S92 A;  4BD3 A;  5TB6 A;  2RI7 A;  5H1U A;  5KCO A;  4HXO A;  5JI8 A;  4Q0N A;  3OYM A;  4XUB A;  2EFI A;  3S3M A;  4LYI A;  5DYA A;  4CLB A;  2K3X A;  3JVK A;  4QSP A;  5HCL A;  5I89 A;  3LH0 A;  4QUU A;  4UC4 A;  2G4A A;  5HFQ A;  5KTW A;  4A9N A;  5D24 A;  2H60 A;  1OZ3 A;  5LKX A;  2FSA A;  4OGJ A;  4TYL A;  3I3J A;  2EQU A;  3MUL A;  3MP1 A;  3HMH A;  5HQ7 A;  5II1 A;  3OYD A;  4A9E A;  5KTX A;  3LJW A;  3OA6 A;  5J26 A;  3ASK A;  4QSQ A;  5CPE A;  3OYA A;  4F3I A;  4GY5 A;  5ENI A;  4LC2 A;  4PY6 A;  5ETD A;  3SVF A;  4TTE A;  3BDL A;  5IGN A;  5DLX A;  5AMF A;  3UWN A;  4QC1 A;  2QQR A;  3U5M A;  3S3N A;  2L5E A;  4N3W A;  5CUG A;  4C67 A;  4O7A A;  5M9O A;  4QST A;  5EWD A;  4DON A;  5EWW A;  5D25 A;  4QSV A;  3O36 A;  4KV1 A;  5D3J A;  2RHI A;  3UV5 A;  4Z1Q A;  1JSP B;  5D3S A;  3P8D A;  4A9L A;  4CUQ A;  3Q1J A;  3M9Q A;  4IUT A;  2D9T A;  4ZTF A;  2RNW A;  5BT3 A;  4Z02 A;  4NS5 A;  2L8D A;  5LVQ A;  4QQD A;  4QEW A;  4BE0 A;  2DVV A;  4ALG A;  3Q2F A;  3C4S A;  3O34 A;  4CUP A;  1N27 A;  4RG2 A;  1ZS5 A;  4HXM A;  4IUP A;  4TT2 A;  3HME A;  5KU3 A;  4QSR A;  2MWO A;  5IGL A;  5EPS A;  4PTB A;  4UIU A;  1KHC A;  4E7K A;  4XY8 A;  5CZG A;  5ENJ A;  3FEO A;  4ZTJ A;  4IKF A;  4A9O A;  5A5S A;  4MEN A;  4YBS A;  2BKD N;  3SVG A;  5COI A;  5L8T A;  4Q5W A;  4YYM A;  3G0L A;  5C0M A;  4Q0O A;  4YBM A;  3JVJ A;  2RNX A;  5FE9 A;  3OYK A;  1RI0 A;  3QBY A;  5CQ3 A;  4NR7 A;  2RHY A;  4N4H A;  4O7C A;  5C6S A;  4RVR A;  3UVW A;  5FH7 A;  5LJ0 A;  4CL9 A;  5LVR A;  2E5Q A;  4O7E A;  4YAX A;  2OO1 A;  4YY4 A;  3TLP A;  3MQM A;  3U5K A;  4QEV A;  5EU1 A;  3S91 A;  4TZ2 A;  4CUT A;  4O70 A;  4QR5 A;  5LKT A;  4ALH A;  4YYJ A;  5E9I A;  3OYH A;  4E96 A;  5ENB A;  5CQ8 A;  2M1H A;  5KCH A;  4HXR A;  4HBX A;  5FE6 A;  5A5N A;  5L99 A;  3LQJ A;  2F5K A;  5AME A;  2L85 A;  3MET A;  2X35 A;  5CIU A;  5DYU A;  3MUK A;  2R5M A;  4NRB A;  3FLG A;  5FB1 A;  5G4R A;  1WUM A;  5CTL A;  5CU8 A;  3S3O A;  2DWW A;  2GRC A;  2NXB A;  5F36 A;  4QZS A;  5E9Y A;  2LDM A;  2RI5 A;  5HEM A;  4C5H A;  4IR6 A;  4YK0 A;  4Y03 A;  5ENG A;  4QBM A;  5FDZ A;  2GFU A;  4O77 A;  5FFY A;  2DKW A;  3EAE A;  2E7N A;  4GPJ A;  5EWH A;  3UV4 A;  4UYF B;  5I86 A;  2RS9 B;  2P0K A;  4BW4 A;  5D3R A;  5I7Y A;  1JM4 B;  2LVM A;  4NR9 A;  4WHU A;  2E6N A;  2EQJ A;  2RJD A;  5EPB A;  3CEY A;  3PFS A;  4UIW A;  5DFD A;  4QSU A;  3O8V A;  2L3R A;  2E7O A;  3DWY A;  4NR5 A;  5A83 A;  3UVX A;  3GG3 A;  4NUC A;  4QNS A;  5FE1 A;  2LCC A;  2YEK A;  4NUD A;  5DKH A;  5H1T A;  3U5O A;  5LJ2 A;  4QB3 A;  5KE2 A;  2R5A A;  2R0Y A;  5II2 A;  5EV9 A;  2F6J A;  2RO0 A;  3OQ5 A;  3P8H A;  5ACY A;  3O33 A;  4TT6 A;  5EQ1 A;  5J39 A;  4HBY A;  3K2J A;  2CKK A;  3LX7 A;  5DLZ A;  4N4F A;  4A9M A;  2RJE A;  5F61 A;  3OS2 A;  4O71 A;  5D7X A;  5AD2 A;  3U5L A;  4QSX A;  3OS1 A;  4QSS A;  2B8A A;  4O72 A;  1WJR A;  4PCI A;  3DAI A;  5IN1 A;  4MEO A;  3DLM A;  5DYX A;  5I40 A;  4PLI A;  4NYW A;  4NRC A;  2E3K A;  3ME9 A;  4A4E A;  4LZR A;  2HQX A;  4MEQ A;  1E6I A;  5F1H A;  3MP8 A;  5HRW A;  4NQN A;  4QQG A;  3OYE A;  3PMT A;  3P1C A;  4CFK A;  4BE2 A;  5FFW A;  5KTU A;  3IU6 A;  2FHD A;  2WAC A;  3L2Q A;  5CRM A;  2LSP B;  5I80 A;  3OYI A;  4Z6I A;  1OZ2 A;  3QII A;  3LQI A;  5C8G A;  4UYF A;  4C66 A;  5HRV A;  4E7H A;  3SVH A;  2RHU A;  3U5J A;  2R58 A;  5A5Q A;  3LQH A;  4L59 A;  4IOR A;  5A5R A;  3MEA A;  4ZQL A;  4TU4 A;  4TZ8 A;  5DX4 A;  4Z1S A;  3MB4 A;  3PNW C;  2HQE A;  4OVA A;  2VYT A;  1MHN A;  4OGI A;  4PCE A;  5LKU A;  3HMF A;  2YEM A;  2I8N A;  4IUQ A;  3OYF A;  4UIY A;  5TCM A;  5CRZ A;  3ZEH A;  4HXP A;  4J1P A;  3QZV A;  3QZT A;  4O78 A;  4YC9 A;  5F3A A;  3UV2 A;  3OMG A;  3OYJ A;  5EA1 A;  2DVQ A;  5JWM A;  4II1 A;  2R0S A;  5FE3 A;  5DFC A;  4YH3 A;  4YYK A;  5FE4 A;  3OY9 A;  4HXL A;  2NLU A;  4YYH A;  5EK9 A;  4O7F A;  5H1V A;  5E3D A;  4BW1 A;  4BW2 A;  4FL6 A;  4LR6 A;  5EIC A;  2M16 A;  4UYD A;  3MO8 A;  3NTI A;  5HRX A;  5F1L A;  5EI4 A;  4FLP A;  5C4Q A;  2X4W A;  2YW5 A;  5LUU A;  2RHZ A;  3L2V A;  4MEP A;  5E74 A;  4KCX A;  5H85 A;  2RNY A;  2R0V A;  5CY9 A;  4BDY A;  1WUG A;  4PS5 A;  5KHM A;  5IGK A;  5HLS A;  5CFW A;  5IID A;  4BAC A;  3Q2E A;  5HQ5 A;  5F62 A;  3LGF A;  5L97 A;  4QQ6 A;  3UVD A;  3QKJ A;  4PLL A;  4TS8 A;  5E9L A;  4QYD A;  5C89 A;  4KV4 A;  2YEL A;  3FKM X;  5FRM A;  5HEN A;  4TQN A;  5DY7 A;  2EQM A;  3G0J A;  5EM3 A;  4YBT A;  5FE2 A;  5D3H A;  5EIS A;  4J0S A;  2RO1 A;  2R57 A;  5C87 A;  4A9J A;  5CQA A;  4LD6 A;  5FRO A;  2O4X B;  4YYD A;  3NTK A;  3QJ6 A;  5CGP A;  2EQK A;  5LJ1 A;  5D26 A;  2F6N A;  4QY4 A;  4YH4 A;  2D82 A;  4B9X A;  4IR5 A;  4YAD A;  3SD4 A;  4BJX A;  5FB0 A;  3OYN A;  5F63 A;  5FH6 A;  5I88 A;  4HXN A;  5F60 A;  4C5E A;  2O4X A;  5BT4 A;  3FDR A;  2RJC A;  5IG6 A;  4HCZ A;  4QW2 A;  5A7C A;  3MB3 A;  5CQT A;  1WGS A;  1H3Z A;  2RI2 A;  2X4Y A;  4UIT A;  2DVR A;  3GOX A;  4QSW A;  3MP6 A;  2BUD A;  3FC3 A;  5KO4 A;  3U5P A;  3MEU A;  4IR4 A;  5CQ6 A;  1XNI A;  2DIQ A;  3E9F A;  4NXJ A;  5FFV A;  4HXS A;  5D3T A;  4CUS A;  3DB3 A;  4UIV A;  3OMC A;  3L2U A;  2DAQ A;  5D0C A;  3O35 A; 
#chains in the Genus database with same CATH topology
 5LJ5 j;  1VQO A;  2DET A;  4N4I A;  4XYA A;  5IAY A;  3CCS T;  2V8J A;  2KDS A;  5LJ3 e;  5GAM f;  4XTX A;  5CKH A;  5ENE A;  5HEL A;  4Z6H A;  1WZO A;  1Q7Y U;  3A5Z B;  2C0O A;  2EWN A;  1Q95 G;  2F2X A;  2RQU A;  4O74 A;  1NJI R;  2XDD A;  4X2I A;  2KRM A;  1YWO A;  2JOY A;  4BE1 A;  1YNZ A;  2W0Z A;  1Q81 R;  2OTJ A;  1JJ2 S;  2QK0 A;  4NR8 A;  3SDZ A;  3GBQ A;  3G4S T;  2DLP A;  3L1A A;  1VQK T;  1B7T A;  2CP5 A;  4YY6 A;  2HDA A;  3HRU A;  4KT0 E;  2XD0 A;  3HPW A;  4BW3 A;  5KYY B;  3OW2 P;  5EGU A;  4PFO A;  4QYL A;  4N4G A;  5CR2 A;  4Z93 A;  2O01 E;  1WXU A;  3RKY A;  1S72 Q;  1G3W A;  2N9G A;  5HQ6 A;  2GF7 A;  5I29 A;  2HCK A;  4A4F A;  1T3S A;  4PK4 A;  4A9H A;  3LYI A;  4JS4 A;  1EX4 A;  3LXJ A;  2RH2 A;  3LGL A;  1R77 A;  2E70 A;  2FB7 A;  3M54 A;  4RTT A;  3HSB A;  3UA7 A;  4C92 G;  2DO3 A;  2FG0 A;  2CDT A;  1N6A A;  2CZ6 B;  2DNU A;  3L2Z A;  2DYI A;  2E3H A;  3VYG A;  1V29 B;  4RKU E;  4JLG A;  3RKW A;  4B9W A;  2G3R A;  1XOV A;  3MXF A;  4LRG A;  2VAS A;  5FE7 A;  3JSC A;  5I1Q A;  3I56 A;  2HKN A;  1QKX A;  2LT4 A;  5HK0 A;  3NTH A;  2OSS A;  4QUT A;  2GFA A;  3P5O A;  4YYI A;  3UT1 A;  5I21 A;  5LJ5 e;  2JZ2 A;  4JPB W;  2Y90 A;  4O76 A;  5A81 A;  2LZ6 B;  1EQF A;  3AAD A;  3HFN A;  5IBN A;  3NGP A;  5LJ3 j;  5L96 A;  4GLK A;  5LKZ A;  1K8A C;  1WQ7 A;  3H0H A;  2C06 A;  2NYS A;  1WJS A;  2AIR B;  2V26 A;  2DXU A;  2DL3 A;  4QC3 A;  5DKC A;  3PVL A;  5FH8 A;  1FMV A;  1K73 C;  2BE7 D;  3FJ5 A;  2DA9 A;  5F25 A;  2YLB A;  5G4S A;  2FRY A;  2JTF A;  1QKW A;  4Y28 E;  2L0A A;  3UVY A;  3P1D A;  1ABO A;  5F2P A;  1YJW T;  1M90 C;  4AKN A;  4DOV A;  1VQN A;  4M7D C;  4YYN A;  3UW9 A;  1H92 A;  1SEM A;  3AQA A;  1YIT A;  2DMO A;  2FRW A;  1U1T A;  1M9S A;  1SHG A;  4E7I A;  3NFC A;  5AYF A;  2P0P A;  4ZGJ B;  1OOT A;  4MR6 A;  4EDU A;  5GAO r;  1W1F A;  1R0B G;  4IUU A;  2FL7 A;  1M8V A;  5D6Y A;  5J0D A;  1Y0M A;  1GBR A;  1HXD A;  3S92 A;  7AT1 B;  1JU5 C;  5H1U A;  1K9A A;  3PE0 A;  5KCO A;  3CCJ A;  3OYM A;  5GAN 4;  2A7Y A;  2YXY A;  4J7F A;  4CLB A;  2K3X A;  3HTR A;  3JVK A;  5GMK l;  5KYW A;  4M7A A;  3LH0 A;  5HFQ A;  2QQ9 A;  5GAO n;  3EGX B;  4FM4 B;  2E10 A;  4EMK B;  4NOY A;  2L5Q A;  5II1 A;  4CI0 C;  3OYD A;  1KHI A;  5GAO p;  1Z9Q A;  3G1J A;  2QDL A;  4DBH A;  3OYA A;  1M4Z A;  4LC2 A;  4PY6 A;  4TTE A;  3EG3 A;  3CCE T;  2QYZ A;  5DLX A;  4PJO B;  3S3N A;  2L5E A;  4C92 F;  2VXF A;  1VQ4 A;  4QST A;  5GJW B;  4N0A A;  1VQK A;  5EWW A;  4HVW A;  5D25 A;  1G3T A;  4F7U E;  4KV1 A;  4D6W A;  1TOV A;  4A9L A;  4M4Z A;  1M3C A;  3Q1J A;  3OW2 S;  3M9Q A;  4ZTF A;  5IHI A;  2RNW A;  5BT3 A;  2MMP A;  1IXD A;  3JB9 J;  2KAF A;  5LVQ A;  4QQD A;  4XU2 A;  2PVD B;  2M9U A;  4ALG A;  3C4S A;  3O34 A;  4CUP A;  4HXM A;  2GTO A;  1GFD A;  5IGL A;  1PHT A;  4MDW A;  4X9D A;  4E7K A;  1N9S A;  3FEO A;  4ZTJ A;  5A5S A;  4MEN A;  2FZG B;  1RAI B;  2QQB A;  3CCR T;  1PUO A;  5KYX A;  2ZCF B;  3ZFJ A;  4J9D A;  1OUL A;  4Q0O A;  2CGH A;  1M30 A;  5FU7 C;  1S1N A;  1RI0 A;  4HVV A;  4A4K A;  4NR7 A;  2RHY A;  1KC8 R;  5KYX B;  4N4H A;  1IZ6 A;  5LJ5 f;  4RVR A;  4M78 A;  1U06 A;  2RK1 A;  2EBP A;  4O7E A;  1NG2 A;  3JCM g;  4YY4 A;  3TLP A;  3U5K A;  4QEV A;  2F69 A;  4TZ2 A;  4QR5 A;  5FU6 B;  5E9I A;  2FO0 A;  2VUB A;  2M1H A;  4J9C A;  2V1Q A;  4M7A B;  4IIM A;  3M55 A;  1VQ6 Q;  3LQJ A;  5AME A;  2RN8 A;  4AKG A;  2X35 A;  1VQP T;  2QGG A;  2K2M A;  4M77 D;  5CKD A;  3VYH B;  1WUM A;  5CTL A;  2Y4Y A;  4CC7 A;  2DWW A;  4PJN A;  2MPX C;  3V8K A;  4ESR A;  2NXB A;  2LDM A;  1VQP Q;  4C92 C;  4YK0 A;  1Q82 U;  1UGR B;  2JS2 A;  4Y03 A;  4QBM A;  3CCU A;  5GMK e;  2HEQ A;  2GFU A;  4AKI A;  5FFY A;  2DL7 A;  3EAE A;  3MPU B;  1K9M R;  3QYG B;  2KSS A;  1UGP B;  2PU9 B;  1JM4 B;  4O6J A;  5EPB A;  5DFD A;  3O8V A;  1M90 R;  2L3R A;  3UA6 A;  5A83 A;  3UVX A;  5J3B A;  3GG3 A;  2KYM A;  2LCC A;  1FMW A;  4J9G A;  2GNC A;  3VS7 A;  2R5A A;  4QVC A;  5EV9 A;  2RO0 A;  3OQ5 A;  3C12 A;  4JRK A;  5DLZ A;  1MUZ A;  3KXT A;  2RJE A;  3OS2 A;  5D7X A;  4FW1 A;  1UUE A;  1H64 1;  2JTM A;  3JB9 I;  3OS1 A;  4QSS A;  2DL8 A;  3BE3 A;  4M75 G;  5LJ3 g;  3DAI A;  4MML A;  3DLM A;  5DYX A;  5I40 A;  3ME9 A;  4LZR A;  1Z9Z A;  3VRY A;  2I0N A;  2ED0 A;  5CCA A;  1AHJ B;  1UDL A;  1Q86 R;  3LH5 A;  4CFK A;  4BE2 A;  2WAC A;  3OYI A;  1RUW A;  3RES A;  1VQ7 A;  3CCE Q;  2XMF A;  2RNA A;  3AT1 B;  2QA4 A;  3U5J A;  2A3L A;  3H41 A;  3X20 B;  2R58 A;  5A5Q A;  1ZX6 A;  4P5N A;  2QA4 Q;  4KH1 B;  3E19 A;  4ZQL A;  1QVF P;  2ENM A;  3MB4 A;  4HKE A;  4OVA A;  3JCM Q;  4IUQ A;  4RTY A;  1Q82 R;  3OYF A;  2FPE A;  5CRZ A;  3A8H B;  3CME T;  5IXF A;  1IB8 A;  1W70 A;  4C0G A;  4YC9 A;  3UV2 A;  2DYB A;  3DLL A;  5JWM A;  2KXC A;  4YTL A;  2L3Q A;  1H8K A;  1VQN T;  4RG8 A;  2RMO A;  5CQX A;  1YHQ A;  1FWZ A;  4TVR A;  2YUQ A;  1Y7X A;  4UYD A;  4C8Q A;  2KI7 A;  1OPK A;  3ZL7 C;  1VQ4 T;  2NWM A;  2X4W A;  3HHT B;  2D1X A;  2A0F B;  4AFZ C;  4KCX A;  1BI3 A;  1NLO C;  1OU9 A;  4RCC A;  4BUG A;  3QXE B;  2CUD A;  1YN8 A;  3JCM b;  1I5O B;  5IID A;  3Q2E A;  2DL5 A;  5HQ5 A;  3SHW A;  4QQ6 A;  1YIJ T;  3UVD A;  1M1F A;  3QKJ A;  5GAN 8;  4PLL A;  4BB7 A;  2MF2 A;  2EQM A;  3G0J A;  3M4Y A;  1K0S A;  1FXX A;  1KK7 A;  1CKA A;  1YIJ Q;  2RO1 A;  2R57 A;  5C87 A;  4YYD A;  1RLQ C;  1AWW A;  2H8H A;  2D82 A;  5LJ5 g;  1W4S A;  4E47 A;  5I88 A;  2K5F A;  5F60 A;  2ZPG B;  4RTV A;  4AG1 C;  4EMH A;  2LJ0 A;  3TCJ A;  5GMK h;  4M7A D;  2RD1 A;  1S72 A;  3VS4 A;  5HY6 A;  1E6H A;  4KGZ B;  1X27 A;  1UGQ B;  2RI2 A;  4J6W A;  2X4Y A;  2FZC B;  3BDU A;  4UIT A;  2DVR A;  1SPK A;  2QDY B;  3CPW P;  4FT2 A;  4DA4 A;  5A0D A;  4EIK A;  3U5P A;  4CC3 A;  1M1K R;  5D3T A;  1YBY A;  1I8F A;  2E64 A;  3GNG A;  2DAQ A;  4QVD A;  2HSP A;  2O9V A;  2IIM A;  3L2R A;  4C8Q E;  1Q7Y C;  2K3Y A;  2JMC A;  2OAW A;  1UEB A;  3OS0 A;  4TU6 A;  4UYE A;  1ABQ A;  3G71 T;  4MR3 A;  2X4X A;  4CRI A;  3QPH A;  5FE8 A;  5CUB A;  3CME A;  2LNV A;  4HCK A;  4DOW A;  2XID A;  4A9I A;  5DLO A;  3JVL A;  3X24 B;  3QDF A;  1D0Y A;  5ENF A;  5IGM A;  4XUA A;  3BFM A;  1BI2 A;  4NL3 A;  1D1A A;  5DLQ E;  2IG0 A;  3L2W A;  3CD6 Q;  2YUO A;  5LJ3 h;  4WHW A;  5EWC A;  1OI1 A;  3CCU Q;  3QDR B;  1WLP B;  3OYC A;  3OYG A;  5EP7 A;  1WA7 A;  1KQ1 A;  3U23 A;  3CCV A;  5IHK A;  1AVZ C;  2ATC B;  3X28 B;  5D6X A;  2KVQ G;  4BHW A;  2RQR A;  1AWJ A;  1HSQ A;  1LCK A;  2M0O A;  1QVF S;  1UB4 A;  1OQK A;  2XK0 A;  5DKD A;  1U8R A;  2WP2 A;  5CQ7 A;  4UIZ A;  2DAT A;  2KR3 A;  4HXK A;  2DTO A;  1A0N B;  2CSQ A;  2BTT A;  4HBW A;  2YHT A;  5E3G A;  4WTO B;  2XI9 A;  1M2V A;  4X34 A;  5DYC A;  1I81 A;  2AKL A;  4OB0 B;  1BKB A;  4NUE A;  5GAN 3;  2CT4 A;  4E7L A;  1WHK A;  4F04 B;  5C85 A;  1WFW A;  2AZV A;  4F7U F;  1SKU B;  4A53 A;  4LZS A;  2GBQ A;  5L8U A;  1PKT A;  1N8R R;  3EG9 A;  5CUD A;  3G6E A;  5CUA A;  2KNB B;  5HM0 A;  3ER0 A;  4C5I A;  3TSW A;  2RPN A;  1YHQ T;  3RKX A;  5L23 A;  5A0G A;  3RBB B;  1AWX A;  5GAM e;  2DTI A;  3D7C A;  4A9F A;  4PJO C;  4NYV A;  3H6Z A;  2GGR A;  3RR6 A;  4WF2 A;  1T0H A;  1P92 A;  1SSF A;  2QQS A;  4NR4 A;  3RDV A;  4NRA A;  3EH2 A;  4PL6 A;  5E9V A;  1MNE A;  1QMC A;  4J3I A;  4O75 A;  2P4R A;  1NYF A;  3P8B B;  3LLR A;  2J6O A;  3CCS A;  4PJM A;  1HD3 A;  3A8L B;  1I0C A;  4M7D E;  5D6W A;  2K3B A;  3U5N A;  2L89 A;  3NHN A;  4JLI A;  3SWN A;  4C8Q C;  1N8R U;  3C94 A;  1WHJ A;  2LRQ A;  2OI3 A;  2XDP A;  4C0Z A;  2JM8 A;  4XY9 A;  5DBM A;  4AFS C;  4IOQ A;  2CT3 A;  2OTL Q;  1MGQ A;  5CAI A;  3CME Q;  4OUF A;  1PRL C;  1NLP C;  2EGC A;  3OYL A;  4JJN K;  1W2B S;  4NQM A;  3G7Z A;  3H8Z A;  5FG4 A;  3CBO A;  4PFZ A;  4BD3 A;  3CCR A;  2HSE B;  1LVK A;  1QW1 A;  4HXO A;  2KY9 A;  1ZSZ B;  3A8M B;  5DYA A;  4LDY A;  2CRE A;  4PJO D;  3GPL A;  2D8J A;  4ZN3 A;  2LQW A;  3QWY A;  2KE9 A;  1N9R A;  5HCL A;  5I89 A;  5EC7 A;  4A63 B;  5KTW A;  1WHH A;  1QP2 A;  4FT4 A;  4OF1 A;  4M7D B;  4A54 A;  4TYL A;  4LNP A;  3MUL A;  3OYY A;  1AT1 B;  4KGX B;  4M75 F;  4ORZ A;  2XU8 A;  5GAN h;  5CPE A;  5LJ3 d;  4GY5 A;  5GAN d;  2O9S A;  2K2V A;  3EGD B;  3QZ9 B;  2K4Y A;  5ECA A;  1JB0 E;  2AZS A;  5HCK A;  5CUG A;  4C67 A;  4O7A A;  5EWD A;  2DEQ A;  1TG0 A;  3EHR A;  3O36 A;  2M02 A;  2MAM A;  1YP5 A;  1K8A R;  2E6Z A;  1RAG B;  4J8O A;  5CKF A;  2EYY A;  1D3B B;  2OJ2 A;  1EFN A;  3PVQ A;  4NL2 A;  3CMA A;  5GAO l;  1XQH A;  1ZSZ C;  2XKO C;  4RG2 A;  4TT2 A;  1X01 A;  1KJW A;  2MWO A;  4OP0 A;  2LJ3 A;  4IKF A;  1TXQ A;  1WNL A;  4YBS A;  2PUK B;  3SVG A;  1AD5 A;  4LDV A;  4Q5W A;  1K73 U;  2ROL A;  4N0A C;  4YYM A;  3G0L A;  4M7A F;  3QJY A;  4YBM A;  3JVJ A;  4M77 B;  3GLX A;  4FYV B;  2RNX A;  4XTU A;  5GAM d;  2DXT A;  3I55 T;  4J9I A;  1Y96 B;  3QBY A;  5CQ3 A;  5KYU A;  4O7C A;  1PSE A;  4PJO E;  2EW3 A;  2DF6 A;  4YAX A;  2OO1 A;  1U1S A;  1UG1 A;  3S91 A;  4CUT A;  4O70 A;  3G6E Q;  5KYU B;  2V8I A;  4DBR A;  4E96 A;  4DQ2 A;  4HXR A;  4B6M A;  2ABL A;  2L85 A;  1VQO T;  4KRT A;  2DKG A;  3CCE A;  5DYU A;  4CC4 B;  5GAN j;  1NM7 A;  3G6E T;  4MDX A;  5FB1 A;  1QQJ A;  1YJN A;  2DM1 A;  4M7A G;  5CU8 A;  1HJD A;  3MHX A;  1R0C B;  1ZUY A;  1M3B A;  4QZS A;  2LQK A;  5HEM A;  1RL2 A;  4XQ3 A;  3UPU A;  2E41 A;  4J7I A;  2ECZ A;  4M77 E;  5LJ5 h;  4GPJ A;  4LE9 A;  4JJB A;  2RS9 B;  1GRI A;  2PVO B;  2P0K A;  4JUV A;  4XK8 E;  2LVM A;  1FMK A;  4F16 A;  2EQJ A;  3I5S A;  3CEY A;  3PGG A;  2Y4X A;  3QUI A;  4QSU A;  2E7O A;  3DWY A;  2C0I A;  4DBQ A;  1FX7 A;  4NUC A;  2VVK A;  3GF5 A;  1KG1 A;  2ZGW A;  2E3I A;  5KYW B;  2O31 A;  8AT1 B;  5H1T A;  2F1L A;  3U5O A;  5GAN f;  2GTJ A;  3TU4 K;  2R0Y A;  5II2 A;  1NJI U;  1VQ7 Q;  3P8H A;  4JZ3 A;  1YCY A;  3TSZ A;  1K73 R;  5J39 A;  1KQS A;  2YT6 A;  3K2J A;  3LX7 A;  1YI2 A;  4N4F A;  1UHC A;  1PSF A;  1VQN Q;  2F2V A;  3U5L A;  4QSX A;  5IT9 E;  2DE0 X;  1MND A;  2B8A A;  4WCI A;  4X1V A;  2SRC A;  1V1C A;  4M77 G;  1F1B B;  2HBP A;  4NYW A;  2E3K A;  4M78 F;  2OTL A;  3CD6 T;  3MP8 A;  1E6I A;  5F1H A;  3CCV T;  1PG5 B;  4QQG A;  3P1C A;  1G8X A;  5FFW A;  5KTU A;  3IU6 A;  2GQV A;  1PRM C;  1TH7 A;  5C8G A;  4UYF A;  4LDX A;  1M90 U;  4C66 A;  5HRV A;  1HYO A;  1OV3 A;  2RHU A;  2FPF A;  4HCB A;  1QVF A;  5A5R A;  2QTV A;  3MEA A;  2ZZD A;  4J9H A;  3PNW C;  1LPL A;  4PCE A;  3EH1 A;  3EG0 A;  4XTY A;  2V1R A;  1I5L A;  3ZEH A;  4HXP A;  4J1P A;  3QZV A;  3QZT A;  4O78 A;  4RTX A;  3CPW A;  4FSS A;  2MK5 A;  3OMG A;  3OYJ A;  1TWB A;  1VQK Q;  1WYX A;  2R0S A;  4Z8A A;  1VQM A;  2NLU A;  4YYH A;  5DY9 A;  5GAO m;  4F7U A;  5L8R E;  4O7F A;  4BW1 A;  3CCV Q;  4FL6 A;  4HCC A;  2M16 A;  2PUO B;  5HRX A;  3OSV A;  4M78 C;  3V7C A;  1B3Q A;  1K4U S;  5C4Q A;  1LNX A;  5IHN A;  2QTX A;  2RHZ A;  3L2V A;  4E7Z A;  2DZ9 A;  2DD4 A;  2RNY A;  4PS5 A;  5KHM A;  1X2K A;  3EG9 B;  5HLS A;  5CFW A;  1E7O A;  1OPL A;  5F62 A;  5L97 A;  1TS9 A;  2NUP B;  4TS8 A;  3RMS A;  5D7U A;  5E9L A;  4QYD A;  4KV4 A;  2YEL A;  5CK9 A;  1KC8 U;  1Y57 A;  3CC7 T;  2RF0 A;  4MZP A;  5D3H A;  2VXE A;  5FRO A;  2ZPB B;  3NTK A;  1ZSG A;  3HFO A;  1ZQ1 A;  5LJ1 A;  2QG9 B;  1RI9 A;  4FIB A;  4YH4 A;  2DJQ A;  4B9X A;  3HRT A;  1RAC B;  4Z88 A;  2LNH B;  4YAD A;  3OYN A;  4ELY C;  5FH6 A;  4QKU A;  3JCM d;  5GMK j;  4C5E A;  5BT4 A;  4HT8 A;  4OB2 B;  4HCZ A;  2JUF A;  3UAT A;  3MB3 A;  2KEA A;  1K76 A;  1WGS A;  3SWN B;  3EFO A;  3FRN A;  1H3Z A;  4OMN A;  2DBM A;  3VJP A;  2F5T X;  3GOX A;  4PKC C;  3FC3 A;  5KO4 A;  2DIQ A;  1KQS P;  1VQL Q;  2COY A;  5FFV A;  3DB3 A;  3WXM B;  1B34 B;  3L2U A;  2YDL A;  1GBQ A;  3VRZ A;  1I4K 1;  3A98 A;  3CPF A;  1WHL A;  5GAN e;  2YLC A;  5FBX A;  4AKH A;  2HD0 A;  3CC2 A;  4QVZ A;  2EPD A;  3M0P A;  2K9G A;  2PQW A;  4FSX A;  4CUR A;  1ZA2 B;  3E1S A;  2CZ1 B;  2X3X D;  4CFL A;  2RQT A;  5FRN A;  1D1C A;  1UGV A;  1YJ9 A;  5I7X A;  3D7S B;  1BCO A;  2KGT A;  3M4G A;  4PJO G;  3INZ A;  2QQA A;  1UJY A;  3M58 A;  1VQ5 Q;  3KUF A;  3VUB A;  2RJF A;  2EVR A;  2RQW A;  1JEG A;  1OX9 A;  1IGU A;  3CCL Q;  5I22 A;  4TT4 A;  3LW5 E;  5E9M A;  4IUR A;  4UYG A;  3ZBD A;  2DIG A;  5GAN g;  3J80 E;  1YJ9 T;  1VQ6 T;  1AEY A;  4F7U G;  4OMM A;  1VIF A;  1QCN A;  2DL4 A;  2MYS A;  3MEW A;  3CCJ T;  5K29 A;  4JZ4 A;  2RI3 A;  3CCL T;  2DXB A;  4IOO A;  2CP3 A;  2LP5 A;  5LL6 S;  3E9G A;  1MMN A;  3OB9 A;  2VC8 A;  5LJ3 f;  4M7D A;  5I2M A;  5A82 A;  5BT5 A;  4Z89 A;  5CUE A;  4J9B A;  2HL5 C;  5EPR A;  2JN0 A;  3M57 A;  1K9M C;  4PNO A;  1VQ5 A;  4E6R A;  3JB9 F;  2LCS A;  4Y92 A;  1K8A U;  4M7A E;  3BY7 A;  5FE5 A;  5KH6 A;  1F68 A;  5DFB A;  4AFQ C;  2YRV A;  2XG8 D;  4IIO A;  4C92 D;  3EGU A;  4KUL A;  1LJO A;  5HJC A;  1WJQ A;  3J7A F;  2H3E B;  1RAB B;  4QR3 A;  4M75 C;  4LZ2 A;  1I1J A;  4C0D B;  1LOJ A;  2IVW A;  4MR5 A;  3P1E A;  5A5P A;  2NUT B;  4M77 C;  1RAH B;  2I7K A;  1RLP C;  4DEY A;  1DJ7 B;  2CP6 A;  4BDZ A;  4OB3 B;  1PD1 A;  2KT8 A;  3CCU T;  2D8H A;  4EMK A;  1Q86 C;  1VYT A;  1M2V B;  3PMI A;  3A1P A;  2F2W A;  1M27 C;  1ZBX A;  2BZY A;  5D3P A;  1D09 B;  4FYX B;  2P0Q A;  1N72 A;  5E73 A;  4CUU A;  2D9E A;  2RK2 A;  2GQI A;  1UJ0 A;  1QCF A;  4WIV A;  2BIV A;  3CC7 Q;  3H0F A;  1AZG B;  3HRS A;  2E4H A;  3CXC A;  5EVA A;  2PVG B;  3X26 B;  5FG5 A;  1KD1 U;  3ZYU A;  3GNF B;  1T0J A;  4PKL A;  3I35 A;  3J81 E;  5FG6 A;  5L98 A;  3L42 A;  2VGM A;  4HBV A;  1YHQ Q;  2LQ8 A;  4M7D D;  4JRQ A;  4YAB A;  1CSK A;  2FPD A;  4QR4 A;  2ZAE A;  4OML A;  2YYN A;  4EMG A;  4YAT A;  1WIE A;  1QVP A;  2MWP A;  4UYH A;  3OYB A;  4HXJ A;  1Q81 U;  5A5O A;  5AT1 B;  4ZW1 A;  2LTO A;  4LYS A;  2RI7 A;  4AFU C;  2FYK A;  2K6D A;  1YJN T;  3R6N A;  3CC4 T;  2EFI A;  3QSU A;  3S3M A;  4LYI A;  2E12 A;  4QSP A;  4PJO F;  1PD0 A;  1ZKR A;  4QUU A;  2G4A A;  1D0Z A;  1WQW A;  3D1B A;  4A9N A;  3JRZ A;  4OGJ A;  2E65 A;  2RB6 A;  2EQU A;  3MP1 A;  3HMH A;  4M75 A;  5HQ7 A;  2M51 A;  5CKB A;  1Q7Y R;  5J26 A;  3ASK A;  4QSQ A;  3M0T A;  3VS1 A;  4F3I A;  5ENI A;  2O2O A;  4HT9 A;  3SVF A;  2KXD A;  3BDL A;  3KFV A;  5IGN A;  4FCY A;  1PC0 A;  2P84 A;  4QC1 A;  4FW2 A;  4OMF B;  3TQ7 P;  3U5M A;  1VQ9 T;  4N3W A;  5CKE A;  5M9O A;  4AMC A;  2KRS A;  2A28 A;  3OW2 A;  5GAM h;  2DEU A;  2DIL A;  4C8Q B;  3UV5 A;  4Z1Q A;  3MKD A;  3REA B;  5D3S A;  1VQ6 A;  4CUQ A;  1JQQ A;  4ANJ A;  1TUC A;  4NS5 A;  4C92 E;  1VIE A;  2L8D A;  3JCM c;  3QG1 A;  4F14 A;  4BE0 A;  1ZSZ A;  1SSH A;  2AK5 A;  1N27 A;  1NPR A;  1JXO A;  2IPO B;  2JT4 A;  4IUP A;  4PJJ A;  1UEC A;  3HME A;  5KU3 A;  1ARK A;  4QSR A;  4PTB A;  1ZA1 B;  3CPW S;  4XY8 A;  5CZG A;  2K5L A;  3VKH A;  4A9O A;  2VKN A;  2FEI A;  4C8Q F;  2EAY A;  2AT1 B;  2LQN A;  2QA4 T;  5FE9 A;  4KUI A;  3OYK A;  2DER A;  1QVG S;  2QAZ A;  3LWH A;  5C6S A;  5FWC A;  3UVW A;  1H3H A;  1VUB A;  3RIR A;  5LJ0 A;  4CL9 A;  2E5Q A;  1QVG A;  2EYX A;  5GAM j;  3MQM A;  2LT1 A;  4BI3 A;  5LKT A;  5KYN A;  4YYJ A;  1SHF A;  1NJI C;  3OYH A;  1CKB A;  2K57 A;  2LX9 A;  3I56 T;  2KQW A;  4GLM A;  4XU3 A;  5A5N A;  1YJ9 Q;  3MET A;  2WSF E;  2VB6 A;  3R6O A;  5CIU A;  2QEX T;  2J6F A;  1BIA A;  3C95 A;  3IQL A;  2DVJ A;  3CCJ Q;  1VQ4 Q;  2X9H A;  1RAF B;  3S3O A;  1RAE B;  1M1K C;  1KQS S;  2GRC A;  2JJ9 A;  5F36 A;  5E9Y A;  2EIF A;  1VYV A;  1WHM A;  3CC4 Q;  4M7A C;  4EPC A;  3VS5 A;  4O77 A;  3M0U A;  5GMK m;  3UV4 A;  4UYF B;  3UF4 A;  4FYY B;  3VKG A;  2KMT A;  1U5S A;  1UGS B;  5I7Y A;  1GCQ C;  2E6N A;  2WSC E;  3PFS A;  1XJW B;  1J3T A;  4LD9 K;  2G6F X;  4AI6 A;  3TRE A;  4QNS A;  5FE1 A;  1AOJ A;  4PFP A;  4NUD A;  1JRI A;  3C0C A;  5GAN 2;  2BE9 B;  5DKH A;  3T9N A;  2D6F A;  5LJ2 A;  2YSQ A;  2XHC A;  4QB3 A;  5KE2 A;  3PIP A;  5ACY A;  1C1A A;  4HBY A;  3CCQ Q;  3VS2 A;  1NZ9 A;  4M75 D;  3CBM A;  2MCN A;  1UE9 A;  4A9M A;  2EJF A;  1NE8 A;  5F61 A;  3OSS C;  4O71 A;  3ULR B;  5AD2 A;  2DPP B;  4AG2 C;  1GXI E;  4O72 A;  1WJR A;  1VQL T;  1MMG A;  3CMA T;  1W6X A;  4XU1 A;  1BU1 A;  2JS0 A;  2VWF A;  4PLI A;  1Q86 U;  1G3S A;  4ZN1 A;  3M0Q A;  5HRW A;  3OYE A;  2FHD A;  3CMA Q;  5I80 A;  2LSP B;  4Z6I A;  3QII A;  2LJ1 A;  3EHQ A;  1EIF A;  2KT1 A;  2H3J A;  4E7H A;  3SVH A;  2COZ A;  4L59 A;  1GCP A;  1PWT A;  2EJ9 A;  4TU4 A;  4Z1S A;  3SEM A;  2HQE A;  1Y96 A;  1MHN A;  1WX6 A;  1VQ8 T;  2I8N A;  1K1Z A;  3JCM e;  2FVU A;  3CCM T;  1WXT A;  5F3A A;  5EA1 A;  2DVQ A;  4II1 A;  4RCB A;  3CXC S;  1VQ8 Q;  3CCQ T;  2D0Q B;  2O88 A;  5DFC A;  4YH3 A;  4YYK A;  5FE4 A;  3JB9 G;  3V8L A;  4R0K A;  5H1V A;  5E3D A;  3ERR A;  2J05 A;  4OMP A;  4BW2 A;  3EFR A;  1MV0 B;  5EIC A;  3MO8 A;  5GMK i;  3M0R A;  1W2B P;  1JJ2 A;  5F1L A;  1NEB A;  3JV3 A;  4FLP A;  1W2B A;  2CS7 A;  4LXC A;  1JJ2 P;  2DRK A;  4JDS A;  5LUU A;  4X9C A;  4BI4 A;  5E74 A;  5H85 A;  1JO8 A;  2OX7 A;  2JW4 A;  3BW1 A;  4E7S A;  4M78 G;  2LX7 A;  1WPY A;  1M1G A;  2WSE E;  2JVV A;  4M75 E;  1IO6 A;  3G4S A;  1SG5 A;  1VOM A;  3HL8 A;  3SFM A;  2EYZ A;  5C89 A;  2CYZ B;  2LC4 A;  3FKM X;  5FLX E;  5HEN A;  1N5Z A;  5FE2 A;  5I11 A;  1X75 C;  4J0S A;  2HQH A;  3FJP A;  4A9J A;  5CQA A;  3OBY A;  2DZC A;  2O4X B;  3NMZ C;  4LD6 A;  1KC8 C;  2J6K A;  2DRM A;  1SRM A;  2LMJ A;  2RM4 A;  5CQY A;  1Q82 C;  3QJ6 A;  2ZPH B;  4LN2 A;  5FW9 A;  5D26 A;  2EJN A;  3E2U A;  2RA2 A;  1BI1 A;  1VQ5 T;  3D1D A;  3JCM P;  4BJX A;  2DK3 A;  3VU3 C;  4HXN A;  4LDU A;  3JCM X;  2O4X A;  2NUP A;  2RJC A;  4ZNX A;  1NBE B;  5IG6 A;  1N8R C;  5A7C A;  1RAD B;  2JXB A;  2ZPE B;  2PZ1 A;  4QSW A;  3MP6 A;  4LUE A;  3RER A;  4IR4 A;  5CQ6 A;  1XNI A;  3E9F A;  3CCS Q;  4NXJ A;  2KK4 A;  2KRO A;  3M53 A;  1X6B A;  3NPF A;  3VV0 A;  2ROT A;  4UIV A;  2YRD A;  4IR3 A;  3O35 A;  2JNG A;  5DW1 A;  1OX8 A;  1GL5 A;  2MJV B;  2EKH A;  2QXF A;  5CQ5 A;  3RCW A;  4BY6 B;  2YQD A;  5A2Q E;  4XU0 A;  3QHS A;  3DB4 A;  3NXB A;  5KE3 A;  4M78 D;  1WHG A;  4O7B A;  3JVM A;  3ONI A;  4J9E A;  2RHX A;  4A4H A;  6AT1 B;  2L3S A;  3CCM A;  2XDB A;  3VS3 A;  3PIO A;  2ZPF B;  1BCM A;  4C0F A;  4K11 A;  2CP2 A;  1YFN A;  5HFR A;  2L84 A;  3QYH B;  2AKK A;  4J0R A;  3GIB A;  1TUG B;  1TU0 B;  4M75 B;  5HK3 A;  4KH0 B;  2SEM A;  1RAA B;  3O37 A;  2DTH A;  1YJW A;  4NR6 A;  3CCL A;  3QO3 A;  3CC4 A;  2FZK B;  3SB2 A;  5F5Z A;  4LYW A;  3CXC P;  5FE0 A;  2EGA A;  4XTV A;  4C92 B;  5CS8 A;  5E7D A;  4OMQ A;  2EKO A;  4FU6 A;  2OUO A;  3EGX A;  1OYX A;  4HVU A;  2CP0 A;  4QEU A;  5CO7 A;  5DW2 A;  3I9Q A;  3JCM V;  3JB9 D;  1G5V A;  3JCM f;  5D3L A;  3N5B B;  1G2B A;  5ENH A;  1G3Y A;  4BY6 C;  1YJW Q;  1U3O A;  1AWO A;  5HKC A;  3M56 A;  1IHW A;  5FU6 C;  4C5G A;  5IXB A;  5I83 A;  1ZHI A;  2PNI A;  1FYN A;  1VQ9 A;  2ESW A;  5EWV A;  1BK2 A;  5ENC A;  3FB9 A;  1X0J A;  2E1H A;  4MMK A;  3F70 A;  3JCM W;  2BZX A;  4E7J A;  8ATC B;  1R8O B;  4JRP A;  5FU7 B;  5C7N A;  4IUV A;  4C8Q D;  2CH4 W;  3MEV A;  5GAN 6;  1JBM A;  1SRL A;  2KTB B;  4A9K A;  3RUX A;  3V8J A;  3CCQ A;  2E5K A;  1NYG A;  2P4T A;  3O5Z A;  4BI8 B;  3EFO B;  3CC2 T;  3P1F A;  2NUZ A;  4XTW A;  4M78 E;  5GAN 5;  3KBG A;  4ZC9 A;  2MI6 A;  2CUB A;  2YDW A;  1M2O A;  3G71 A;  5DM7 R;  3IU5 A;  4OGE A;  1B34 A;  2RFJ A;  2CZ0 B;  3VKI A;  4OGC A;  1HK9 A;  2HNI A;  4KUD K;  2DD5 A;  3MJX A;  4NYX A;  3VS6 A;  4YYG A;  5ETB A;  3CC7 A;  2X3W D;  3CQT A;  4O5V A;  2WP1 A;  4RTW A;  2J06 A;  3QZ5 B;  3X25 B;  2YRC A;  4MR4 A;  2DVS A;  4HA8 A;  3S6W A;  1YIJ A;  3I56 Q;  5A85 A;  4A4G A;  1BBZ A;  2I2L A;  1UHF A;  3CCM Q;  3SWN C;  2R10 A;  1BB9 A;  4LDF A;  5IH2 A;  5CQ4 A;  4M7D F;  4F17 A;  1Y71 A;  5E0R A;  4J83 A;  1PNJ A;  4RMO A;  5D3N A;  5AD3 A;  2OAU A;  5E9K A;  5GAN 7;  5CP5 A;  4D8K A;  5CUC A;  3QZS A;  4UIX A;  5TB6 A;  2DJZ A;  5JI8 A;  4Q0N A;  2YWW A;  4XUB A;  4E2F B;  5EG2 A;  3I55 A;  4PJO A;  2OTJ Q;  3QWX X;  4UC4 A;  1BI0 A;  2KBT A;  4J5Y A;  4JJC A;  1QWE A;  3H9N A;  3PT9 A;  5D24 A;  4L6V 5;  2H60 A;  1OZ3 A;  5LKX A;  4KBM B;  2FSA A;  1KD1 R;  2XIC A;  3I3J A;  3EGD A;  2L2P A;  1X2Q A;  2A08 A;  1KD1 C;  2JTE A;  4A9E A;  5KTX A;  1IHV A;  2A36 A;  3LJW A;  4R55 A;  3OA6 A;  5ETD A;  4ZGD B;  2VV5 A;  2JM9 A;  1GFC A;  5AMF A;  1KSW A;  3UWN A;  3WVD B;  1UFF A;  3UDC A;  1Q81 C;  4CC2 A;  3AHU A;  2QQR A;  4M78 B;  4Y91 A;  1PM3 A;  2DVE A;  4ME7 A;  4DON A;  2KYB A;  4QSV A;  1ACM B;  2RHI A;  5D3J A;  1MMA A;  3V7R A;  1JSP B;  1VQ9 Q;  3P8D A;  2NUT A;  1D0X A;  4IUT A;  2D9T A;  4Z02 A;  3FIF A;  1M3A A;  4QEW A;  1NPP A;  1QCO A;  1YJN Q;  2DVV A;  3Q2F A;  1QLY A;  1ZS5 A;  2HMA A;  4PJL A;  2K79 A;  2OTJ T;  1E6G A;  2V8K A;  5EPS A;  1GCQ A;  4UIU A;  1KHC A;  1QWF A;  5ENJ A;  4VUB A;  2BKD N;  1O9S A;  1ZLM A;  9ATC B;  1V76 A;  5COI A;  5L8T A;  2M0Y A;  4L5G A;  4C92 A;  4KGV B;  5C0M A;  2X4J A;  5GAO q;  4JJD A;  3VUZ A;  3JAM E;  3GP8 A;  1NEG A;  2Z0W A;  3EG2 A;  5FH7 A;  2CZ7 B;  2OTL T;  5LVR A;  1YIT Q;  1M5Q 1;  3CD6 A;  1TUD A;  3G4S Q;  3V7S A;  5EU1 A;  4GBQ A;  4ALH A;  2HZY A;  2KRN A;  1BIB A;  5ENB A;  5CQ8 A;  5KCH A;  4DBF A;  4HBX A;  5FE6 A;  1IGQ A;  4JRI A;  5L99 A;  1ZBJ A;  2F5K A;  1WXB A;  3MCA B;  4M77 F;  3MUK A;  2R5M A;  4NRB A;  3FLG A;  4RTU A;  5G4R A;  1VQP A;  4M7D G;  3HKS A;  3THK A;  1IRE B;  4V2S A;  4C8Q G;  4C5H A;  2EGE A;  2RI5 A;  2VGN A;  5GAM g;  4IR6 A;  2QEX Q;  5ENG A;  5FDZ A;  4XTZ A;  1KIK A;  1M1K U;  2DKW A;  1KQ2 A;  1QP3 A;  2E7N A;  5I86 A;  5EWH A;  2COW A;  3REB B;  1C6V X;  4BW4 A;  1YCS B;  5D3R A;  4RUG A;  1D1B A;  4NR9 A;  4WHU A;  2RJD A;  3A8G B;  4UIW A;  1YIT T;  2B86 A;  4NR5 A;  1ZUU A;  1YWP A;  2HBW A;  1WI7 A;  2W10 A;  3RMQ A;  2YEK A;  1X43 A;  3A8O B;  4D8D A;  2QGF B;  4J6Y A;  2X51 A;  3OS5 A;  5KYY A;  2F6J A;  3O33 A;  4TT6 A;  5EQ1 A;  1X6O A;  2CKK A;  2LCL A;  4AT1 B;  1Y07 A;  4QT7 A;  3URG A;  2GCX A;  2DX1 A;  1WDX A;  4PCI A;  3CBP A;  5IN1 A;  4DEX A;  4MEO A;  4EMK C;  5CVI A;  1K0X A;  4NRC A;  3HP9 A;  2QI2 A;  4A4E A;  3OBW A;  5I2S A;  2YUP A;  2HQX A;  3JCM J;  1ZUK A;  4MEQ A;  2A37 A;  4NQN A;  4M77 A;  3TEE A;  3PMT A;  3M0S A;  1KFZ A;  3L2Q A;  4FYW B;  5CRM A;  1OZ2 A;  3LQI A;  2EQI A;  2AHJ B;  1C0M A;  3LQH A;  1AZE A;  4IOR A;  3JCM h;  2C0T A;  2DXC A;  2D0N A;  4LDW A;  4TZ8 A;  5DX4 A;  1OEB A;  3G71 Q;  2VYT A;  3I55 Q;  4OGI A;  5LKU A;  1B07 A;  2MIO A;  3HMF A;  2HKQ B;  2YEM A;  2QEX A;  1VYU A;  1X6G A;  4UIY A;  5TCM A;  1BYM A;  2J7I A;  4J6X A;  1MV3 A;  1VQ8 A;  1T3L A;  1MMD A;  1UTI A;  2QAS A;  5LJ5 d;  4ATO A;  2DFU A;  3M59 A;  4JS5 A;  1OU8 A;  5FE3 A;  3H0I A;  4MZM A;  4ELZ C;  3OY9 A;  4HXL A;  2CSI A;  5EK9 A;  4OB1 B;  1VQO Q;  1YI2 Q;  4LR6 A;  2BZ8 A;  3TVT A;  3RNJ A;  1IRX A;  3NTI A;  1EZZ B;  2ED1 A;  5EI4 A;  1XTD A;  2EYW A;  2YW5 A;  4F7U B;  2MOX A;  4MEP A;  2L3P A;  1D3B A;  5CY9 A;  2R0V A;  4BDY A;  1WUG A;  1VQM T;  2K7A A;  2YUN A;  5IGK A;  2CH4 A;  2ZPI B;  1G83 A;  4BAC A;  3LGF A;  5FWB A;  2HL3 A;  1VQM Q;  3EFS A;  1TTH B;  1K9M U;  2K5I A;  3I5R A;  3PTA A;  5FRM A;  4TQN A;  1X69 A;  2PTK A;  5DY7 A;  5EM3 A;  4XAX B;  4YBT A;  1PKS A;  1M8M A;  3VS0 A;  1VQL A;  2DBK A;  5EIS A;  3JB9 H;  1PCX A;  3M5A A;  4R56 A;  1VA7 A;  1VQ7 T;  4J9F A;  1YI2 T;  5CGP A;  2EQK A;  4QY4 A;  2F6N A;  2EYQ A;  4OMO A;  3EG1 A;  4RTZ A;  4IR5 A;  3CC2 Q;  3SD4 A;  4LUD A;  5FB0 A;  5F63 A;  1I07 A;  1JXM A;  2EJG A;  1O75 A;  3DKM A;  3FDR A;  4QW2 A;  2JMA A;  5CQT A;  5GJV B;  1S72 T;  2CP7 A;  4C0D C;  2RQV A;  2BUD A;  3MEU A;  5A0L A;  3LWI A;  4ZGE B;  1TSF A;  1QVG P;  2HAX A;  4HXS A;  1SF9 A;  3CCR Q;  3OMC A;  4MZT A;  3WVE B;  5D0C A;  4CUS A; 
#chains in the Genus database with same CATH homology
 5LJ5 j;  1VQO A;  4N4I A;  4XYA A;  5IAY A;  3CCS T;  2V8J A;  2KDS A;  5LJ3 e;  5GAM f;  4XTX A;  5CKH A;  5ENE A;  5HEL A;  4Z6H A;  1Q7Y U;  3A5Z B;  2EWN A;  4O74 A;  2XDD A;  4X2I A;  4BE1 A;  2JOY A;  2OTJ A;  1JJ2 S;  4NR8 A;  3SDZ A;  3G4S T;  3L1A A;  1VQK T;  4YY6 A;  3HRU A;  4KT0 E;  2XD0 A;  3HPW A;  4BW3 A;  5EGU A;  4QYL A;  4N4G A;  5CR2 A;  4Z93 A;  2O01 E;  3RKY A;  1G3W A;  2N9G A;  5HQ6 A;  2GF7 A;  5I29 A;  4A4F A;  4A9H A;  3LYI A;  4JS4 A;  3LXJ A;  2RH2 A;  3LGL A;  2E70 A;  2FB7 A;  3M54 A;  3HSB A;  4C92 G;  2DO3 A;  1N6A A;  2CZ6 B;  3L2Z A;  3VYG A;  1V29 B;  4RKU E;  4JLG A;  3RKW A;  4B9W A;  2G3R A;  1XOV A;  3MXF A;  4LRG A;  5FE7 A;  3JSC A;  5I1Q A;  3I56 A;  2LT4 A;  5HK0 A;  3NTH A;  2OSS A;  4QUT A;  2GFA A;  3P5O A;  4YYI A;  3UT1 A;  5I21 A;  5LJ5 e;  2JZ2 A;  2Y90 A;  4O76 A;  5A81 A;  1EQF A;  3AAD A;  3HFN A;  5IBN A;  5LJ3 j;  5L96 A;  4GLK A;  5LKZ A;  1K8A C;  1WQ7 A;  2C06 A;  1WJS A;  2DXU A;  4QC3 A;  5DKC A;  5FH8 A;  1K73 C;  5F25 A;  2YLB A;  5G4S A;  2JTF A;  4Y28 E;  3UVY A;  3P1D A;  1YJW T;  5F2P A;  1M90 C;  4AKN A;  4DOV A;  1VQN A;  4M7D C;  4YYN A;  3UW9 A;  3AQA A;  1YIT A;  1U1T A;  1M9S A;  4E7I A;  3NFC A;  5AYF A;  2P0P A;  4ZGJ B;  4MR6 A;  4EDU A;  5GAO r;  4IUU A;  2FL7 A;  1M8V A;  5D6Y A;  5J0D A;  1HXD A;  3S92 A;  5H1U A;  5KCO A;  3CCJ A;  3OYM A;  5GAN 4;  2A7Y A;  4J7F A;  4CLB A;  2K3X A;  3JVK A;  5GMK l;  4M7A A;  3LH0 A;  5HFQ A;  2QQ9 A;  5GAO n;  4FM4 B;  2E10 A;  4EMK B;  4NOY A;  2L5Q A;  5II1 A;  4CI0 C;  3OYD A;  1KHI A;  5GAO p;  3OYA A;  1M4Z A;  4LC2 A;  4PY6 A;  4TTE A;  3CCE T;  5DLX A;  4PJO B;  3S3N A;  2L5E A;  4C92 F;  2VXF A;  1VQ4 A;  4QST A;  4N0A A;  1VQK A;  5EWW A;  5D25 A;  1G3T A;  4F7U E;  4KV1 A;  4D6W A;  4A9L A;  3Q1J A;  3OW2 S;  3M9Q A;  4ZTF A;  2RNW A;  5BT3 A;  2MMP A;  3JB9 J;  2KAF A;  5LVQ A;  4QQD A;  4XU2 A;  2PVD B;  2M9U A;  4ALG A;  3C4S A;  3O34 A;  4CUP A;  4HXM A;  5IGL A;  4MDW A;  4X9D A;  4E7K A;  1N9S A;  3FEO A;  4ZTJ A;  5A5S A;  4MEN A;  2QQB A;  3CCR T;  2ZCF B;  3ZFJ A;  4Q0O A;  2CGH A;  5FU7 C;  1RI0 A;  4A4K A;  4NR7 A;  2RHY A;  4N4H A;  1IZ6 A;  5LJ5 f;  4RVR A;  4M78 A;  2RK1 A;  4O7E A;  3JCM g;  4YY4 A;  3TLP A;  3U5K A;  4QEV A;  2F69 A;  4TZ2 A;  4QR5 A;  5FU6 B;  5E9I A;  2VUB A;  2M1H A;  4M7A B;  3M55 A;  3LQJ A;  5AME A;  2X35 A;  1VQP T;  4M77 D;  5CKD A;  3VYH B;  1WUM A;  5CTL A;  2Y4Y A;  2DWW A;  3V8K A;  2NXB A;  2LDM A;  4C92 C;  4YK0 A;  1Q82 U;  1UGR B;  4Y03 A;  4QBM A;  3CCU A;  5GMK e;  2GFU A;  5FFY A;  3EAE A;  3QYG B;  2KSS A;  1UGP B;  2PU9 B;  1JM4 B;  4O6J A;  5EPB A;  5DFD A;  3O8V A;  2L3R A;  5A83 A;  3UVX A;  5J3B A;  3GG3 A;  2LCC A;  2R5A A;  4QVC A;  5EV9 A;  2RO0 A;  3OQ5 A;  3C12 A;  4JRK A;  5DLZ A;  3KXT A;  2RJE A;  3OS2 A;  5D7X A;  1H64 1;  2JTM A;  3JB9 I;  3OS1 A;  4QSS A;  4M75 G;  5LJ3 g;  3DAI A;  4MML A;  3DLM A;  5DYX A;  5I40 A;  3ME9 A;  4LZR A;  5CCA A;  1AHJ B;  4CFK A;  4BE2 A;  2WAC A;  3OYI A;  3RES A;  1VQ7 A;  2QA4 A;  3U5J A;  2A3L A;  3X20 B;  2R58 A;  5A5Q A;  4P5N A;  3E19 A;  4ZQL A;  3MB4 A;  4HKE A;  4OVA A;  3JCM Q;  4IUQ A;  3OYF A;  5CRZ A;  3A8H B;  3CME T;  4C0G A;  4YC9 A;  3UV2 A;  3DLL A;  5JWM A;  4YTL A;  1VQN T;  4RG8 A;  5CQX A;  1YHQ A;  1FWZ A;  4TVR A;  1Y7X A;  4UYD A;  4C8Q A;  1VQ4 T;  2X4W A;  3HHT B;  4KCX A;  1BI3 A;  4RCC A;  4BUG A;  3QXE B;  3JCM b;  5IID A;  3Q2E A;  5HQ5 A;  4QQ6 A;  1YIJ T;  3UVD A;  1M1F A;  3QKJ A;  5GAN 8;  4PLL A;  4BB7 A;  2EQM A;  2MF2 A;  3G0J A;  3M4Y A;  1FXX A;  2RO1 A;  2R57 A;  5C87 A;  4YYD A;  2D82 A;  5LJ5 g;  4E47 A;  1W4S A;  5I88 A;  2K5F A;  4EMH A;  5F60 A;  2ZPG B;  3TCJ A;  5GMK h;  4M7A D;  2RD1 A;  1S72 A;  5HY6 A;  1UGQ B;  2RI2 A;  4J6W A;  2X4Y A;  3BDU A;  4UIT A;  2DVR A;  2QDY B;  4FT2 A;  4DA4 A;  5A0D A;  3U5P A;  5D3T A;  1YBY A;  1I8F A;  2E64 A;  3GNG A;  2DAQ A;  4QVD A;  3L2R A;  4C8Q E;  1Q7Y C;  2K3Y A;  1UEB A;  3OS0 A;  4TU6 A;  4UYE A;  3G71 T;  4MR3 A;  2X4X A;  4CRI A;  3QPH A;  5FE8 A;  5CUB A;  3CME A;  2LNV A;  4DOW A;  2XID A;  4A9I A;  5DLO A;  3JVL A;  3X24 B;  5ENF A;  5IGM A;  4XUA A;  3BFM A;  1BI2 A;  4NL3 A;  5DLQ E;  2IG0 A;  3L2W A;  5LJ3 h;  4WHW A;  5EWC A;  1OI1 A;  3QDR B;  3OYC A;  3OYG A;  5EP7 A;  1KQ1 A;  3CCV A;  3X28 B;  5D6X A;  2KVQ G;  4BHW A;  2M0O A;  1QVF S;  1UB4 A;  2XK0 A;  5DKD A;  1U8R A;  2WP2 A;  5CQ7 A;  4UIZ A;  2DAT A;  4HXK A;  2DTO A;  4HBW A;  2YHT A;  5E3G A;  2XI9 A;  4X34 A;  5DYC A;  1I81 A;  4OB0 B;  1BKB A;  4NUE A;  5GAN 3;  4E7L A;  5C85 A;  4F7U F;  4A53 A;  4LZS A;  5L8U A;  5CUD A;  3G6E A;  5CUA A;  5HM0 A;  3ER0 A;  4C5I A;  1YHQ T;  3RKX A;  5A0G A;  5GAM e;  2DTI A;  3D7C A;  4A9F A;  4PJO C;  4NYV A;  3H6Z A;  4WF2 A;  1P92 A;  1SSF A;  2QQS A;  4NR4 A;  4NRA A;  4PL6 A;  5E9V A;  4J3I A;  4O75 A;  3P8B B;  3LLR A;  3CCS A;  3A8L B;  4M7D E;  5D6W A;  3U5N A;  2L89 A;  3SWN A;  4JLI A;  4C8Q C;  1N8R U;  3C94 A;  2LRQ A;  2XDP A;  4C0Z A;  4XY9 A;  5DBM A;  4IOQ A;  1MGQ A;  5CAI A;  4OUF A;  3OYL A;  4JJN K;  1W2B S;  4NQM A;  3G7Z A;  3H8Z A;  5FG4 A;  3CBO A;  4BD3 A;  3CCR A;  1QW1 A;  4HXO A;  2KY9 A;  3A8M B;  5DYA A;  4LDY A;  4PJO D;  3GPL A;  4ZN3 A;  1N9R A;  5HCL A;  5I89 A;  5KTW A;  4OF1 A;  1QP2 A;  4FT4 A;  4M7D B;  4A54 A;  4TYL A;  3MUL A;  3OYY A;  4M75 F;  2XU8 A;  5GAN h;  5CPE A;  5LJ3 d;  4GY5 A;  5GAN d;  2K2V A;  3QZ9 B;  2K4Y A;  1JB0 E;  5CUG A;  4C67 A;  4O7A A;  5EWD A;  2DEQ A;  3O36 A;  2MAM A;  2E6Z A;  4J8O A;  5CKF A;  1D3B B;  4NL2 A;  3CMA A;  5GAO l;  1XQH A;  2XKO C;  4RG2 A;  4TT2 A;  1X01 A;  2MWO A;  4OP0 A;  4IKF A;  1WNL A;  4YBS A;  2PUK B;  3SVG A;  4LDV A;  4Q5W A;  1K73 U;  4N0A C;  4YYM A;  3G0L A;  4M7A F;  3QJY A;  4YBM A;  3JVJ A;  4M77 B;  3GLX A;  2RNX A;  4XTU A;  5GAM d;  2DXT A;  3I55 T;  1Y96 B;  3QBY A;  5CQ3 A;  4O7C A;  1PSE A;  4PJO E;  4YAX A;  2OO1 A;  1U1S A;  3S91 A;  4CUT A;  4O70 A;  2V8I A;  4E96 A;  4DQ2 A;  4HXR A;  2L85 A;  1VQO T;  3CCE A;  2DKG A;  5DYU A;  5GAN j;  3G6E T;  4MDX A;  5FB1 A;  1YJN A;  4M7A G;  5CU8 A;  3MHX A;  4QZS A;  2LQK A;  5HEM A;  1RL2 A;  4XQ3 A;  3UPU A;  2E41 A;  4J7I A;  4M77 E;  5LJ5 h;  4GPJ A;  2RS9 B;  2PVO B;  2P0K A;  4JUV A;  4XK8 E;  2LVM A;  2EQJ A;  3CEY A;  3PGG A;  2Y4X A;  3QUI A;  4QSU A;  2E7O A;  3DWY A;  1FX7 A;  4NUC A;  3GF5 A;  1KG1 A;  2ZGW A;  5H1T A;  3U5O A;  5GAN f;  3TU4 K;  2R0Y A;  5II2 A;  1NJI U;  3P8H A;  1YCY A;  5J39 A;  1KQS A;  3K2J A;  3LX7 A;  1YI2 A;  4N4F A;  1PSF A;  3U5L A;  4QSX A;  5IT9 E;  2B8A A;  4M77 G;  2HBP A;  4NYW A;  2E3K A;  4M78 F;  2OTL A;  3CD6 T;  3MP8 A;  1E6I A;  5F1H A;  3CCV T;  4QQG A;  3P1C A;  5FFW A;  5KTU A;  3IU6 A;  2GQV A;  1TH7 A;  5C8G A;  4UYF A;  4LDX A;  1M90 U;  4C66 A;  5HRV A;  2RHU A;  4HCB A;  1QVF A;  5A5R A;  3MEA A;  2ZZD A;  3PNW C;  4PCE A;  4XTY A;  1I5L A;  3ZEH A;  4HXP A;  4J1P A;  3QZV A;  3QZT A;  4O78 A;  3CPW A;  3OMG A;  3OYJ A;  2R0S A;  1VQM A;  2NLU A;  4YYH A;  5DY9 A;  5GAO m;  4F7U A;  5L8R E;  4O7F A;  4BW1 A;  4FL6 A;  4HCC A;  2M16 A;  2PUO B;  5HRX A;  3OSV A;  4M78 C;  3V7C A;  5C4Q A;  1LNX A;  2QTX A;  2RHZ A;  3L2V A;  2DZ9 A;  2DD4 A;  2RNY A;  4PS5 A;  5KHM A;  5HLS A;  5CFW A;  5F62 A;  5L97 A;  4TS8 A;  3RMS A;  5E9L A;  4QYD A;  4KV4 A;  2YEL A;  5CK9 A;  1KC8 U;  3CC7 T;  4MZP A;  5D3H A;  2VXE A;  5FRO A;  2ZPB B;  3NTK A;  3HFO A;  1ZQ1 A;  5LJ1 A;  4FIB A;  4YH4 A;  4B9X A;  3HRT A;  4YAD A;  3OYN A;  4ELY C;  5FH6 A;  3JCM d;  5GMK j;  4C5E A;  5BT4 A;  4HT8 A;  4OB2 B;  4HCZ A;  2JUF A;  3MB3 A;  1WGS A;  3SWN B;  3FRN A;  1H3Z A;  3VJP A;  2F5T X;  3GOX A;  4PKC C;  3FC3 A;  5KO4 A;  2DIQ A;  5FFV A;  3DB3 A;  3WXM B;  1B34 B;  3L2U A;  1I4K 1;  3CPF A;  5GAN e;  2YLC A;  5FBX A;  2HD0 A;  3CC2 A;  4QVZ A;  4FSX A;  2PQW A;  4CUR A;  3E1S A;  2CZ1 B;  4CFL A;  5FRN A;  1YJ9 A;  5I7X A;  3M4G A;  4PJO G;  3INZ A;  2QQA A;  3M58 A;  3KUF A;  3VUB A;  2RJF A;  3J80 E;  4TT4 A;  3LW5 E;  5E9M A;  4IUR A;  4UYG A;  3ZBD A;  2DIG A;  5GAN g;  1YJ9 T;  1VQ6 T;  4F7U G;  1VIF A;  3MEW A;  3CCJ T;  5K29 A;  3CCL T;  2RI3 A;  2DXB A;  4IOO A;  5LL6 S;  3E9G A;  3OB9 A;  2VC8 A;  5LJ3 f;  4M7D A;  5I2M A;  5A82 A;  5BT5 A;  5CUE A;  5EPR A;  2JN0 A;  3M57 A;  1K9M C;  4PNO A;  1VQ5 A;  3JB9 F;  1K8A U;  4M7A E;  3BY7 A;  5FE5 A;  5KH6 A;  1F68 A;  5DFB A;  2YRV A;  2XG8 D;  4C92 D;  4KUL A;  1LJO A;  5HJC A;  1WJQ A;  3J7A F;  4QR3 A;  4M75 C;  4LZ2 A;  4C0D B;  1LOJ A;  2IVW A;  4MR5 A;  3P1E A;  5A5P A;  4M77 C;  2I7K A;  1DJ7 B;  4BDZ A;  4OB3 B;  3CCU T;  4EMK A;  1Q86 C;  3PMI A;  1ZBX A;  5D3P A;  2P0Q A;  1N72 A;  5E73 A;  4CUU A;  2D9E A;  2RK2 A;  4WIV A;  2BIV A;  3HRS A;  3CXC A;  5EVA A;  2PVG B;  3X26 B;  5FG5 A;  1KD1 U;  3ZYU A;  3GNF B;  4PKL A;  3J81 E;  5FG6 A;  5L98 A;  3L42 A;  2VGM A;  4HBV A;  2LQ8 A;  4M7D D;  4JRQ A;  4YAB A;  4QR4 A;  2YYN A;  4EMG A;  4YAT A;  1QVP A;  2MWP A;  4UYH A;  3OYB A;  1Q81 U;  5A5O A;  4ZW1 A;  2LTO A;  4LYS A;  2RI7 A;  2FYK A;  1YJN T;  3CC4 T;  2EFI A;  3QSU A;  3S3M A;  4LYI A;  2E12 A;  4QSP A;  4PJO F;  4QUU A;  2G4A A;  1WQW A;  4A9N A;  3JRZ A;  4OGJ A;  2E65 A;  2RB6 A;  2EQU A;  3MP1 A;  3HMH A;  4M75 A;  5HQ7 A;  5CKB A;  5J26 A;  3ASK A;  4QSQ A;  4F3I A;  5ENI A;  4HT9 A;  3SVF A;  3BDL A;  5IGN A;  4QC1 A;  4OMF B;  3U5M A;  1VQ9 T;  4N3W A;  5CKE A;  5M9O A;  3OW2 A;  5GAM h;  4C8Q B;  3UV5 A;  4Z1Q A;  5D3S A;  1VQ6 A;  4CUQ A;  4NS5 A;  4C92 E;  1VIE A;  2L8D A;  3JCM c;  3QG1 A;  4BE0 A;  1N27 A;  1NPR A;  4IUP A;  3HME A;  5KU3 A;  4QSR A;  4PTB A;  3CPW S;  4XY8 A;  5CZG A;  2K5L A;  4A9O A;  4C8Q F;  2EAY A;  2QA4 T;  5FE9 A;  4KUI A;  3OYK A;  1QVG S;  3LWH A;  5C6S A;  3UVW A;  1VUB A;  3RIR A;  5LJ0 A;  4CL9 A;  2E5Q A;  1QVG A;  5GAM j;  3MQM A;  2LT1 A;  4BI3 A;  5LKT A;  4YYJ A;  1NJI C;  3OYH A;  2K57 A;  2LX9 A;  3I56 T;  2KQW A;  4XU3 A;  5A5N A;  3MET A;  2WSF E;  3R6O A;  5CIU A;  2QEX T;  1BIA A;  3C95 A;  3S3O A;  1M1K C;  1KQS S;  2GRC A;  5F36 A;  5E9Y A;  2EIF A;  4M7A C;  4EPC A;  4O77 A;  5GMK m;  3UV4 A;  4UYF B;  2KMT A;  1UGS B;  5I7Y A;  2E6N A;  3PFS A;  2WSC E;  4LD9 K;  3TRE A;  4QNS A;  5FE1 A;  4NUD A;  1JRI A;  5GAN 2;  3T9N A;  5DKH A;  2D6F A;  5LJ2 A;  2XHC A;  4QB3 A;  5KE2 A;  3PIP A;  5ACY A;  4HBY A;  1NZ9 A;  4M75 D;  3CBM A;  4A9M A;  2EJF A;  1NE8 A;  5F61 A;  3OSS C;  4O71 A;  5AD2 A;  2DPP B;  1GXI E;  4O72 A;  1WJR A;  1VQL T;  3CMA T;  4XU1 A;  4PLI A;  1Q86 U;  1G3S A;  4ZN1 A;  5HRW A;  3OYE A;  2FHD A;  5I80 A;  2LSP B;  4Z6I A;  3QII A;  1EIF A;  2H3J A;  4E7H A;  3SVH A;  4L59 A;  2EJ9 A;  4TU4 A;  4Z1S A;  2HQE A;  1Y96 A;  1MHN A;  1VQ8 T;  2I8N A;  3JCM e;  2FVU A;  3CCM T;  5F3A A;  5EA1 A;  2DVQ A;  4II1 A;  4RCB A;  3CXC S;  3CCQ T;  2D0Q B;  5DFC A;  4YH3 A;  4YYK A;  5FE4 A;  3JB9 G;  3V8L A;  5H1V A;  5E3D A;  4BW2 A;  3EFR A;  5EIC A;  3MO8 A;  5GMK i;  1JJ2 A;  5F1L A;  4FLP A;  1W2B A;  2CS7 A;  4JDS A;  5LUU A;  4X9C A;  4BI4 A;  5E74 A;  3BW1 A;  5H85 A;  4M78 G;  1WPY A;  1M1G A;  2WSE E;  2JVV A;  4M75 E;  3G4S A;  3HL8 A;  3SFM A;  5C89 A;  2CYZ B;  2LC4 A;  3FKM X;  5FLX E;  5HEN A;  5FE2 A;  1X75 C;  4J0S A;  3FJP A;  4A9J A;  5CQA A;  3OBY A;  2DZC A;  2O4X B;  4LD6 A;  1KC8 C;  2RM4 A;  5CQY A;  1Q82 C;  3QJ6 A;  2ZPH B;  5D26 A;  2RA2 A;  1BI1 A;  1VQ5 T;  3JCM P;  4BJX A;  2DK3 A;  3VU3 C;  4HXN A;  4LDU A;  3JCM X;  2O4X A;  2RJC A;  5IG6 A;  1N8R C;  5A7C A;  2ZPE B;  4QSW A;  3MP6 A;  3RER A;  4IR4 A;  5CQ6 A;  1XNI A;  3E9F A;  4NXJ A;  2KK4 A;  3M53 A;  3VV0 A;  4UIV A;  4IR3 A;  3O35 A;  2JNG A;  5DW1 A;  2MJV B;  2QXF A;  5CQ5 A;  3RCW A;  4BY6 B;  2YQD A;  5A2Q E;  4XU0 A;  3QHS A;  3DB4 A;  3NXB A;  5KE3 A;  4M78 D;  4O7B A;  3JVM A;  3ONI A;  4A4H A;  2RHX A;  2XDB A;  3CCM A;  3PIO A;  2ZPF B;  4C0F A;  5HFR A;  2L84 A;  3QYH B;  4J0R A;  3GIB A;  4M75 B;  5HK3 A;  3O37 A;  2DTH A;  1YJW A;  4NR6 A;  3CCL A;  3QO3 A;  3CC4 A;  3SB2 A;  5F5Z A;  4LYW A;  5FE0 A;  4XTV A;  4C92 B;  5CS8 A;  5E7D A;  2EKO A;  4FU6 A;  2OUO A;  1OYX A;  4QEU A;  5CO7 A;  5DW2 A;  3JCM V;  3JB9 D;  1G5V A;  3JCM f;  5D3L A;  3N5B B;  5ENH A;  1G3Y A;  4BY6 C;  5HKC A;  3M56 A;  5FU6 C;  4C5G A;  5I83 A;  1ZHI A;  1VQ9 A;  5EWV A;  5ENC A;  3FB9 A;  1X0J A;  2E1H A;  4MMK A;  3F70 A;  3JCM W;  4E7J A;  1R8O B;  4JRP A;  5FU7 B;  5C7N A;  4IUV A;  4C8Q D;  3MEV A;  5GAN 6;  1JBM A;  2KTB B;  4A9K A;  3RUX A;  3V8J A;  3CCQ A;  2P4T A;  4BI8 B;  3CC2 T;  3P1F A;  4XTW A;  4M78 E;  5GAN 5;  3KBG A;  4ZC9 A;  2MI6 A;  2YDW A;  3G71 A;  5DM7 R;  3IU5 A;  4OGE A;  1B34 A;  2RFJ A;  2CZ0 B;  3VKI A;  4OGC A;  1HK9 A;  2HNI A;  4KUD K;  2DD5 A;  4NYX A;  3CC7 A;  4YYG A;  5ETB A;  4O5V A;  2WP1 A;  3QZ5 B;  3X25 B;  4MR4 A;  2DVS A;  4HA8 A;  3S6W A;  1YIJ A;  5A85 A;  4A4G A;  2I2L A;  3SWN C;  2R10 A;  4LDF A;  5CQ4 A;  4M7D F;  1Y71 A;  5E0R A;  4J83 A;  4RMO A;  5D3N A;  5AD3 A;  2OAU A;  5E9K A;  5GAN 7;  5CP5 A;  5CUC A;  3QZS A;  4UIX A;  5TB6 A;  2DJZ A;  5JI8 A;  4Q0N A;  4XUB A;  5EG2 A;  3I55 A;  4PJO A;  4UC4 A;  1BI0 A;  4J5Y A;  3PT9 A;  5D24 A;  4L6V 5;  2H60 A;  1OZ3 A;  5LKX A;  4KBM B;  2FSA A;  2XIC A;  3I3J A;  1KD1 C;  4A9E A;  5KTX A;  4R55 A;  3LJW A;  3OA6 A;  5ETD A;  4ZGD B;  2VV5 A;  5AMF A;  3UWN A;  3WVD B;  3UDC A;  1Q81 C;  3AHU A;  2QQR A;  4M78 B;  4Y91 A;  2DVE A;  4ME7 A;  4DON A;  4QSV A;  2RHI A;  5D3J A;  3V7R A;  1JSP B;  3P8D A;  4IUT A;  2D9T A;  4Z02 A;  3FIF A;  4QEW A;  1NPP A;  2DVV A;  3Q2F A;  1ZS5 A;  2OTJ T;  2V8K A;  5EPS A;  4UIU A;  1KHC A;  5ENJ A;  4VUB A;  2BKD N;  1O9S A;  4L5G A;  5COI A;  5L8T A;  4C92 A;  5C0M A;  2X4J A;  5GAO q;  3VUZ A;  3JAM E;  3GP8 A;  5FH7 A;  2CZ7 B;  2OTL T;  5LVR A;  3CD6 A;  1M5Q 1;  3V7S A;  5EU1 A;  4ALH A;  1BIB A;  5ENB A;  5CQ8 A;  5KCH A;  4HBX A;  5FE6 A;  4JRI A;  5L99 A;  2F5K A;  3MCA B;  4M77 F;  3MUK A;  2R5M A;  4NRB A;  3FLG A;  5G4R A;  1VQP A;  4M7D G;  3HKS A;  1IRE B;  4V2S A;  4C8Q G;  4C5H A;  2VGN A;  2RI5 A;  5GAM g;  4IR6 A;  5ENG A;  5FDZ A;  4XTZ A;  1M1K U;  2DKW A;  1KQ2 A;  1QP3 A;  2E7N A;  5I86 A;  5EWH A;  4BW4 A;  5D3R A;  4NR9 A;  4WHU A;  2RJD A;  3A8G B;  4UIW A;  1YIT T;  4NR5 A;  3RMQ A;  2YEK A;  3A8O B;  4J6Y A;  3OS5 A;  2F6J A;  3O33 A;  4TT6 A;  5EQ1 A;  1X6O A;  2CKK A;  2LCL A;  1Y07 A;  3URG A;  2GCX A;  4PCI A;  3CBP A;  5IN1 A;  4MEO A;  4EMK C;  5CVI A;  4NRC A;  3HP9 A;  2QI2 A;  4A4E A;  3OBW A;  5I2S A;  2HQX A;  3JCM J;  4MEQ A;  4NQN A;  4M77 A;  3TEE A;  3PMT A;  3L2Q A;  5CRM A;  1OZ2 A;  3LQI A;  2AHJ B;  3LQH A;  4IOR A;  3JCM h;  2DXC A;  4LDW A;  4TZ8 A;  5DX4 A;  2VYT A;  4OGI A;  5LKU A;  3HMF A;  2YEM A;  2QEX A;  4UIY A;  5TCM A;  1BYM A;  4J6X A;  1VQ8 A;  5LJ5 d;  4ATO A;  3M59 A;  4JS5 A;  5FE3 A;  4MZM A;  4ELZ C;  3OY9 A;  4HXL A;  5EK9 A;  4OB1 B;  4LR6 A;  3NTI A;  5EI4 A;  1XTD A;  2YW5 A;  4F7U B;  4MEP A;  1D3B A;  5CY9 A;  2R0V A;  4BDY A;  1WUG A;  1VQM T;  2ZPI B;  5IGK A;  4BAC A;  3LGF A;  3EFS A;  1K9M U;  2K5I A;  3PTA A;  5FRM A;  4TQN A;  5DY7 A;  5EM3 A;  4XAX B;  4YBT A;  1VQL A;  5EIS A;  3JB9 H;  3M5A A;  4R56 A;  1VQ7 T;  1YI2 T;  5CGP A;  2EQK A;  4QY4 A;  2F6N A;  2EYQ A;  4IR5 A;  3SD4 A;  5FB0 A;  5F63 A;  2EJG A;  1O75 A;  3DKM A;  3FDR A;  4QW2 A;  5CQT A;  1S72 T;  4C0D C;  2BUD A;  3MEU A;  5A0L A;  3LWI A;  4ZGE B;  2HAX A;  4HXS A;  3OMC A;  4MZT A;  3WVE B;  5D0C A;  4CUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...