4N4IA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.3k36me3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
192
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDLVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
total genus 65
structure length 192
sequence length 211
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4iA02
2RI7A 1WGSA 3UVXA 4Z6IA 4BW2A 4BE2A 3U5NA 4MEQA 5A5QA 4NUEA 4OGIA 3GOXA 5KCOA 4LYSA 5ETBA 4MEOA 5C87A 4YC9A 2OO1A 5CFWA 1E6IA 2KTBB 4MENA 5HRVA 3LQIA 3QBYA 3SD4A 3OS1A 4IORA 5CUAA 2JTFA 1ZS5A 2YRVA 4YYDA 3QZTA 3OYKA 5D3TA 5EV9A 2XK0A 5KH6A 5D3SA 5FE7A 3OMGA 2F6JA 5BT3A 5COIA 5FFVA 4IUPA 5FRMA 4QQDA 4KV1A 2L8DA 4CUPA 4QEUA 3PMTA 4O7BA 3ME9A 4F3IA 5I80A 4NXJA 4PCIA 5EWVA 5L98A 2G3RA 3O33A 2D9EA 3DB3A 3UV5A 4YYHA 4TQNA 2WP1A 5A5OA 1JSPB 3C4SA 4A9MA 5C6SA 2LCCA 4ALGA 1X0JA 5FG4A 2YEKA 2HQXA 3MP8A 4YBMA 3Q1JA 2O4XB 4PCEA 5ENGA 5EWCA 5FB0A 5IGMA 5E3GA 4QQ6A 4C66A 2E6NA 4WIVA 5DFDA 5FE0A 2IG0A 5TCMA 4TT2A 5HELA 5A7CA 5G4SA 4IOOA 4DONA 4QR4A 5DFCA 5F1HA 2RI3A 3DB4A 4C5GA 5L8TA 5HEMA 3MB3A 4GY5A 3GG3A 4IR3A 3OYIA 5D6YA 2L5EA 5H1UA 4YBTA 3UWNA 3L2RA 5E7DA 3NXBA 5DLXA 3O35A 2DIGA 4IR5A 4QSTA 3LLRA 2RFJA 4Q5WA 5FE3A 1MHNA 3MEVA 4LRGA 4Z1QA 5E9MA 5EVAA 5D0CA 2RO1A 3U5KA 4QBMA 5C89A 5D6WA 3DAIA 3E9GA 3L2QA 4IURA 4BD3A 4NR8A 4HBYA 3OQ5A 2VYTA 3OYJA 5LVRA 4UYFA 3O34A 1KHCA 2RI2A 5F25A 5E9LA 5FE4A 4X34A 4N4HA 5CQ5A 3BDLA 5EISA 2LRQA 5AMFA 2EQMA 5FG5A 3PFSA 3ASKA 5CU8A 4QYLA 4BDZA 4QEVA 4UYHA 5EWDA 1EQFA 4NRBA 3G0JA 4E7KA 5EM3A 4NR9A 3ZEHA 2R10A 4BE1A 4NUCA 4YYGA 5CQ7A 4Z1SA 4QZSA 2L85A 5LJ0A 2R0VA 4UIUA 5CRZA 5CUGA 5FE2A 5D3PA 5I29A 3M9QA 5CQTA 5EGUA 5L99A 4KV4A 3MXFA 4TZ2A 4QYDA 3MUKA 5FFWA 3OYCA 5I7YA 5ENIA 4XY8A 3S3MA 4LZRA 2YQDA 4CFLA 3FEOA 4BW4A 4MR5A 2YELA 3FKMX 4XYAA 5IGNA 3OYGA 3NTKA 4HCZA 3OB9A 4OGJA 4OVAA 4Y03A 3OYHA 5II1A 5CY9A 2D9TA 4QC1A 3NTHA 3ZYUA 3UVYA 5HQ5A 3U5MA 5KE3A 5DYXA 2R0SA 4N4IA 4J0SA 5DYUA 4MR4A 3S92A 2L84A 4O7AA 5D3HA 3U5LA 5A82A 5FROA 4TYLA 4TTEA 3P5OA 5EWHA 5F61A 3E9FA 5LKTA 4L59A 3P8HA 4QW2A 4BDYA 5ENJA 5DLZA 5CQ8A 4ZTFA 2N9GA 2PQWA 5F36A 3UT1A 5CS8A 5H85A 1WUGA 5EK9A 4QEWA 5FE6A 5LJ1A 2EQUA 3OYBA 3QZVA 4QQGA 5FE1A 3U5OA 5A5SA 3RCWA 4TT4A 5CUDA 4LZ2A 5LVQA 4UIVA 5HQ6A 5F3AA 4Z02A 2RHUA 3UVDA 3QIIA 4X2IA 2NXBA 4CURA 2NLUA 5I83A 5KE2A 3QJ6A 5K29A 5IAYA 2FSAA 1OZ3A 3OYNA 4QVZA 5CQ4A 4NYWA 5CQ3A 5E9KA 3MP6A 5F63A 2QQRA 4HXSA 5DYAA 3OS2A 4RG2A 3MEWA 3FDRA 4YYIA 2FHDA 2X4WA 3S6WA 4CLBA 5I40A 3LJWA 5IBNA 2LVMA 3P8DA 2H60A 5IGLA 1OYXA 4IKFA 5FH8A 4CRIA 5ENHA 5HRWA 5C0MA 3S3OA 4IR6A 2D82A 3H6ZA 1G5VA 5D3JA 4BACA 5CUCA 4J3IA 4O7FA 4A9KA 4E7LA 3META 4QY4A 3LGLA 5E73A 4YATA 3SVGA 3P1FA 3QZSA 5FG6A 4FL6A 1XNIA 5IIDA 3O36A 4XUBA 5HM0A 5EU1A 5EPSA 5KTUA 4NQMA 4NS5A 5CUBA 2RHXA 5CZGA 3AQAA 5C8GA 5HFQA 4AKNA 5C7NA 4B9WA 2F5KA 4A4FA 4CUSA 5H1TA 4CFKA 5AMEA 4QSVA 4QR5A 2M16A 2MJVB 3U5JA 4WHWA 4C5IA 4IUTA 4II1A 3D7CA 1WUMA 3LXJA 4NR5A 4RVRA 4YYNA 2L3RA 3QKJA 4QC3A 4UIYA 5HFRA 2R5AA 4NYXA 5ACYA 4LYIA 2XDPA 5D25A 5AD3A 3LYIA 4CUQA 2K3XA 2QQSA 3OMCA 4TU4A 3AADA 4O7EA 5ENBA 2RS9B 2E5QA 4ZTJA 4O77A 3MQMA 3P1DA 5I89A 5I86A 2DWWA 3UV4A 4HBWA 3HMHA 5HENA 4Z93A 4HXRA 1WJRA 3OY9A 4J0RA 4PS5A 4E7JA 2L89A 5HJCA 4A9IA 2E7OA 4PL6A 4PLIA 5FH6A 5J26A 3OS0A 5ENCA 4YYJA 2EFIA 4E7HA 3SVFA 3LQJA 5DFBA 5L97A 5KU3A 3FC3A 3JVLA 4LZSA 4QSWA 4IUUA 2I8NA 4YYKA 4C5HA 4UYFB 3U5PA 5ENEA 2EQKA 5IG6A 2YW5A 4OUFA 3MEAA 3UW9A 5II2A 3JVJA 4UYEA 2RO0A 5LKUA 5CP5A 1N27A 4NR7A 4FLPA 3KUFA 5E3DA 5FH7A 4YYMA 4FU6A 3K2JA 4Q0NA 4N3WA 4UYGA 5DW1A 2OUOA 4NR6A 3OYAA 5I7XA 4UIXA 3I3JA 3LX7A 2M0OA 2GF7A 4GPJA 5CPEA 2RHYA 5CQAA 4NRAA 4CUTA 5D3RA 4QB3A 3HMFA 3L42A 3UVWA 5LKXA 4XUAA 4Z6HA 4IUVA 5FB1A 4E7IA 4UC4A 5I1QA 3TLPA 5E9YA 2O4XA 4HXPA 5A83A 5EICA 5G4RA 2RJEA 4QR3A 4A4HA 3LH0A 4UIWA 5FBXA 3IU6A 5IGKA 4A9HA 5DKCA 5LUUA 1WJQA 4QNSA 5D24A 5EA1A 3F70A 5EPBA 4J1PA 4A9JA 4ZW1A 4QSQA 2R0YA 4YK0A 4YADA 2WP2A 4A4EA 5FE5A 4BE0A 4ALHA 5D6XA 3O8VA 4LYWA 4LDFA 4A9NA 3MP1A 5KCHA 4HXNA 2DKWA 3Q2EA 4LR6A 4HXOA 5A5NA 3ONIA 2BUDA 4A4GA 5DKDA 2DIQA 5L8UA 3PNWC 3OYEA 5EP7A 4O76A 3MB4A 5LKZA 4MR3A 5L96A 3OYLA 4PKLA 5D7XA 2DVRA 4UITA 4YY6A 3LQHA 4YH3A 4HBVA 5FE9A 4LC2A 5BT4A 3PMIA 3DWYA 4LD6A 4BW1A 2I7KA 4O74A 5ENFA 4A9FA 5A85A 5KTWA 5FFYA 5D3LA 5IN1A 4N4GA 5CTLA 3P1EA 4PLLA 5D3NA 5CUEA 4QUUA 3L2UA 4EDUA 4NRCA 4N4FA 4Q0OA 5C85A 4ZC9A 4A9LA 2RNWA 5AD2A 5BT5A 3MEUA 3MULA 5F1LA 3LGFA 2E7NA 3P1CA 2R57A 3OA6A 4YAXA 3HMEA 5HRXA 4NYVA 4BHWA 4QSXA 2JZ2A 3OYDA 3NTIA 3H8ZA 2HQEA 2DAQA 2RJDA 2X4XA 4BJXA 2BIVA 5HQ7A 5EI4A 5DW2A 4UYDA 5LJ2A 4UIZA 4XY9A 5KO4A 2LDMA 2RHZA 5CGPA 5EPRA 4QSRA 5I88A 4A9OA 2EKOA 5ETDA 5E74A 5E9VA 4QSSA 3DLMA 5CQ6A 3O37A 4NQNA 2BKDN 4A9EA 5KHMA 5HCLA 3MO8A 3OYMA 4C67A 4QSUA 4WHUA 4O75A 2DVVA 5A5PA 2MWPA 2RHIA 5F5ZA 1N72A 3L2VA 2DATA 4YBSA 1H3ZA 4TU6A 5DYCA 4ZQLA 4KCXA 4TS8A 4O70A 2LTOA 5CIUA 2YEMA 4C5EA 3OYFA 4IR4A 2R58A 5C4QA 3EAEA 2GRCA 5EWWA 5DX4A 4PY6A 4MEPA 4HBXA 1JM4B 5JI8A 5F62A 4O78A 4O71A 5JWMA 5KTXA 2X4YA 3CEYA 3S91A 5J0DA 4NUDA 3UV2A 4BW3A 4E96A 3JVKA 2RNYA 5FE8A 1OI1A 4IOQA 2B8AA 2M1HA 2WACA 4QUTA 5DY7A 4CUUA 4YY4A 4HXLA 2G4AA 4PTBA 2RNXA 5HLSA 4O7CA 1OZ2A 2RJFA 5M9OA 2YYNA 2P0KA 2X35A 3Q2FA 4YH4A 2DVQA 3FLGA 4IUQA 5DBMA 4CL9A 4TT6A 5E0RA 4O72A 2OSSA 5DKHA 2EQJA 3S3NA 4TZ8A 5CRMA 3IU5A 2MWOA 3G0LA 4MR6A 1RI0A 2RJCA 5D26A 5A81A 5F2PA 1WJSA 2CKKA 1F68A 2K3YA 3L2WA 2RI5A 4QSPA 5A5RA 2F6NA 5J39A 2R5MA 2LSPB 5FDZA 5H1VA 3SVHA 5FRNA 4YABA 3JVMA 5EQ1A 5E9IA 2DVSA 1SSFA 2E3KA 2GFUA 5TB6A 4B9XA 2GFAA 4HXMA 4NR4A 2YDWA 4HXKA 5F60A
chains in the Genus database with same CATH superfamily
1QVFA 3UVXA 1Q82R 4BE2A 4A63B 4JJDA 4JUVA 4RTWA 3LWHA 1WXTA 1VQ5Q 1ZSZA 3M0UA 4NUEA 1Q95G 5KCOA 1I8FA 4LYSA 1Q82C 4MEOA 1T0JA 2O31A 3GNFB 5A0GA 3G7ZA 4C8QA 3JAME 4AFQC 1KK7A 2CS7A 1KHIA 2JS0A 4IORA 3CCRA 5EG2A 2GTOA 2JTFA 1ZS5A 3OW2P 8AT1B 1QP3A 2BZYA 3AHUA 5D3TA 2K6DA 5GAMg 5GANd 3RIRA 5BT3A 1RLQC 5FFVA 4C92G 4KV1A 1RUWA 2GNCA 4M7DG 4CUPA 2EGAA 4O7BA 3D1DA 3VS3A 4J7IA 1Q81U 2HBPA 1NJIC 4PCIA 2G3RA 2JJ9A 1I5OB 4LE9A 3JB9F 4TQNA 3C4SA 4AG2C 2O9SA 2AHJB 2LCCA 4ESRA 7AT1B 2YEKA 1TOVA 2V8IA 2BZXA 1IREB 3OS1A 1M1KU 3I5RA 4C66A 2E6NA 1U3OA 4WIVA 5DFDA 3M56A 3CD6T 2IG0A 2NWMA 2XG8D 4DOVA 3D1BA 2DE0X 4OMNA 1X2QA 4DONA 1VQOT 2EYYA 3VV0A 5F1HA 2AKLA 2RI3A 3DB4A 1BCOA 4C5GA 5L8TA 1UUEA 2M02A 2ED0A 1KC8C 1TUDA 4DEYA 3GNGA 1T3SA 3L2RA 4HVVA 3SB2A 4AT1B 3NXBA 5DLXA 5GAOr 2JMAA 3O35A 4MZTA 3LLRA 2RFJA 1M3BA 2DL4A 1IHWA 2PTKA 4LRGA 1Y0MA 3VS0A 1JXMA 2DZ9A 5LJ5d 3I5SA 5D6WA 1AZGB 1QKXA 2ZPBB 1PD0A 4HT8A 2YWWA 4XTXA 4UYFA 1UGSB 2DEQA 3WVEB 3C0CA 3A5ZB 1D1AA 3BDLA 4M78D 3QPHA 1W1FA 4FYVB 4QVDA 4FYYB 4J6WA 2K7AA 3CC4A 3CCEQ 4NRBA 3X26B 4E7KA 4NR9A 1Q86U 5I11A 2CREA 4BE1A 2V8KA 2RQTA 5CQ7A 2CP6A 1QCFA 5LJ0A 4UIUA 5CUGA 3A8GB 5D3PA 1AVZC 2HQHA 3OYCA 3EFSA 2RF0A 2PUKB 1XOVA 3M0RA 4OB1B 1VQ9A 2E1HA 1ZKRA 2V26A 3RKYA 4BUGA 2YELA 1EFNA 2EWNA 4V2SA 4F7UB 2VGNA 2Z0WA 4HCZA 4OGJA 4C0FA 4J9HA 4KT0E 2QA4A 2VB6A 3OYHA 2D9TA 3EHQA 3NTHA 3ZYUA 3RDVA 3U5MA 2R0SA 5DYUA 4MR4A 3GP8A 4EMKA 5A82A 2QYZA 3I56Q 4TTEA 3E9FA 3RMQA 5GANh 1FYNA 1ZQ1A 4BDYA 4LNPA 4EIKA 2L3SA 2K57A 2IVWA 4ZTFA 1VQMQ 1VQ8T 2PQWA 1VQPQ 3UT1A 1K73U 5CS8A 3HKSA 5GAOm 2EQUA 4QEWA 3OYBA 2QEXQ 5FLXE 3U5OA 4TT4A 5LVQA 3PIPA 4UIVA 5F3AA 1MMGA 5HY6A 3TREA 3CCLQ 2V8JA 4J9DA 1ZX6A 3M55A 5KE2A 5K29A 1TUGB 1OZ3A 2LP5A 4NYWA 5CQ3A 4M78B 4IIOA 2QQRA 4HXSA 2FZKB 1AEYA 1M9SA 4M75G 4Z88A 1ZA2B 3S6WA 5KYWA 3LJWA 1MMAA 3X25B 3P8DA 4M7AD 3CCLA 5LJ3h 5EC7A 2DVEA 5HRWA 3SDZA 2CZ0B 1IXDA 4IR6A 2D82A 2KNBB 3JB9D 1G5VA 3EG9A 4BACA 1Y96A 2QG9B 1W2BS 4J3IA 2DLPA 1NEGA 3V8KA 4O7FA 2KMTA 1B34B 4E7LA 3META 3HRTA 1KD1C 4O6JA 3REAB 5CQXA 3I56A 2JTEA 4BI4A 2E4HA 4P5NA 4C0DC 3WXMB 1AD5A 1YJNA 1JEGA 1RAFB 2OAWA 1O9SA 2MJVB 4OGEA 4MDXA 3HRUA 2DJZA 4IUTA 3BE3A 5L23A 1PG5B 4RVRA 2P4RA 1RL2A 2K5FA 2EGEA 4NYXA 5ACYA 3V8JA 5LJ5g 2KT1A 2CZ1B 4LYIA 3CCSQ 4PJOG 1NPPA 4AI6A 5D25A 5AD3A 2E65A 2JTMA 2XDPA 1B07A 4MMLA 3G6EA 1YJNQ 2B86A 1LPLA 1N8RU 1PKSA 1Z9QA 1X6OA 1NPRA 3EG9B 1UHCA 1M30A 1W2BP 3UV4A 5KYYB 4HBWA 4F16A 4Z93A 4HXRA 4O5VA 2L89A 4R56A 2E7OA 3M57A 4PLIA 2CH4W 5ENCA 1A0NB 2DL5A 5GAMd 5GANg 3LQJA 3SFMA 4QSWA 4M78F 4YYKA 4JRQA 3A98A 3EFOB 1VQLQ 4PJOE 3QJYA 4UYEA 1NLPC 1I1JA 1VQKT 2HAXA 2OUOA 4E47A 3G4SQ 3LX7A 1QWEA 1VYVA 4GPJA 5CQAA 5AYFA 2H3EB 2L0AA 2DNUA 4QB3A 2DZCA 4LDUA 3L42A 2XMFA 2F69A 2DK3A 2ABLA 1YI2A 5EICA 5G4RA 2RJEA 3VS4A 4A4HA 2JM9A 4UIWA 4A9HA 3TVTA 4RG8A 1KQSP 1QP2A 2CDTA 5GMKh 4J1PA 3CBOA 4EMHA 4M78A 4ZW1A 3EG0A 3M58A 4XU2A 4MZPA 1QCOA 2F5TX 3UDCA 2R0YA 4EMGA 2K4YA 2OTJT 5FE5A 2K9GA 4ALHA 3O8VA 5DM7R 3E19A 2X3XD 5KYNA 2KVQG 5A5NA 2YUQA 5DKDA 3VKHA 4PFZA 5EP7A 4C8QG 4MR3A 5L96A 5CR2A 1VQPT 1CSKA 4LC2A 5LJ3g 5BT4A 1FMWA 4DOWA 2CZ6B 2I7KA 3GLXA 4O74A 1G3SA 5FFYA 5CTLA 1YITQ 4M77G 4PLLA 1GRIA 2DF6A 4N4FA 1K8AR 3QSUA 1XTDA 1PD1A 3MULA 2E7NA 2LC4A 3JRZA 5HRXA 1OX9A 1QVFS 4Y28E 1PSFA 3OYDA 3NTIA 3H8ZA 2HQEA 4BJXA 3JCMb 2FO0A 4RTYA 4UYDA 1W70A 1Y07A 1I0CA 2RHZA 2HL5C 3N5BB 4ATOA 4XU1A 1M2VA 2ZPHB 4QSRA 2KQWA 4M7AE 4A9OA 2DYBA 3DLMA 3I9QA 2BKDN 4A9EA 5HCLA 2EVRA 2CYZB 3HFOA 2VWFA 3D7SB 1K4US 4TU6A 4JJCA 3TU4K 4C5EA 2X51A 4C8QD 1FMKA 1BCMA 1G2BA 5IHNA 3CCEA 4PY6A 1VQMT 3AT1B 1JM4B 5DY9A 1LOJA 5JWMA 2JT4A 3RERA 1WX6A 4M75A 3CCQA 1QMCA 4NUDA 1WPYA 4E96A 4BW3A 5FE8A 2K3BA 4M7AC 4LXCA 1Y96B 1T0HA 4FYXB 2RNXA 5HLSA 1HJDA 4C8QF 5M9OA 1B7TA 3H9NA 4J8OA 2A7YA 2MMPA 4IUQA 4YTLA 2EQJA 3M54A 4TZ8A 1Y57A 1U06A 1RI0A 4J5YA 3E1SA 1F68A 2K3YA 2KI7A 3CPWA 2RI5A 1JQQA 5A5RA 2F6NA 3EFOA 3PTAA 3L2ZA 2DETA 5EQ1A 5TB6A 4HXKA 4NR4A 1UE9A 3REBB 2W0ZA 3UF4A 4ANJA 2RI7A 1BIAA 2F2WA 2YT6A 3CC7A 4M75E 2ROTA 4MEQA 2COYA 3GOXA 2QEXA 2J6KA 2DM1A 4YC9A 2OO1A 1E6IA 2KTBB 4MENA 1IRXA 4MDWA 1K1ZA 2GQVA 4HA8A 1GCPA 5CUAA 3EFRA 3TQ7P 1QVGA 5LJ3j 4MMKA 3MJXA 2EJFA 2JNGA 3L1AA 5D3SA 5FE7A 4DBQA 2F6JA 5COIA 1GFDA 4QQDA 2L8DA 2KRSA 4QEUA 2KRMA 4F3IA 4NXJA 5IHIA 1K9AA 1YJ9Q 3DB3A 1YWPA 3UV5A 4YYHA 1BBZA 1X69A 2BTTA 1NG2A 2FEIA 5I22A 5HKCA 4A9MA 5C6SA 3JV3A 5FG4A 2KY9A 2HD0A 4YBMA 2E5KA 1OQKA 1RI9A 4PCEA 2O4XB 5EWCA 3OYYA 2ZPFB 5GAOq 1GXIE 4DBRA 1FX7A 3I55Q 1GBRA 1M4ZA 3M53A 2XHCA 5HELA 5A7CA 4PJOC 1WHGA 2LNVA 1BKBA 4RMOA 4J9GA 2DKGA 3CCMA 5HEMA 3MB3A 3GG3A 1WDXA 3OYIA 2RPNA 3A1PA 5D6YA 3CCJQ 3G4ST 2P84A 2L5EA 2JM8A 5LJ3e 3CPWP 4YBTA 3UWNA 3V7CA 4QSTA 3VRYA 4Z89A 2O2OA 3CPWS 3MEVA 1VQ7Q 3CMEA 5D0CA 2OTLQ 2RO1A 2CUBA 2M51A 1E7OA 1GFCA 3OYJA 1SRLA 2KE9A 4QKUA 3R6OA 2JUFA 5E9LA 2DPPB 2GTJA 2EAYA 5CQ5A 1ACMB 5EISA 1SHFA 2LRQA 2LQNA 1AWOA 2EQMA 1WIEA 4HXJA 4QYLA 1PSEA 3EH1A 4BDZA 2KEAA 3G0JA 2LCLA 5EM3A 3CCMQ 4NUCA 4YYGA 1I4K1 1VQNQ 3PVQA 1WLPB 4XQ3A 2HNIA 1YNZA 4L6V5 5L99A 3M0QA 4QYDA 1ZLMA 3MUKA 1M3AA 1RABB 2A3LA 1IO6A 4XY8A 1AZEA 3S3MA 2AZVA 5IH2A 2YQDA 4CFLA 5CKFA 4CC7A 4BW4A 3NTKA 3OB9A 1FMVA 3G71T 5LJ5e 1K73R 4ELZC 2PUOB 4FYWB 2IIMA 5GJVB 3CCMT 2CSQA 4M7DC 4N4IA 3VYHB 5GMKi 2X9HA 1K0SA 2L84A 5D3HA 4HVUA 5FROA 4TYLA 4XTVA 3SWNC 2QA4T 3P8HA 5GANj 4M77C 1ZBJA 5DLZA 1WQ7A 2OJ2A 2DFUA 2RMOA 4JS4A 1YJ9A 2XDBA 1RAAB 5FE6A 3C12A 3VRZA 3JCMg 1V1CA 1N9SA 2A08A 3UVDA 3QIIA 2MCNA 1TSFA 4AFZC 1GL5A 2GQIA 1U5SA 1HD3A 2DRMA 4JZ4A 3OSSC 1ZBXA 2GCXA 1G3TA 5GAOn 3OYNA 4J7FA 3CCLT 1WHMA 1ZSGA 4C92A 3I55A 3CC2Q 3MEWA 1D3BA 3FDRA 4YYIA 4EMKB 5I40A 4XTUA 2RQVA 1OYXA 1EZZB 2FPDA 2LX9A 3C94A 4XU3A 2F2XA 2DMOA 3S3OA 3JCMc 4DQ2A 4M75F 2MF2A 4AKHA 4QY4A 1YJ9T 4ME7A 3SVGA 4GLMA 3THKA 4F7UG 3GPLA 3QZSA 3CMAA 5A0LA 2MIOA 2P4TA 5HM0A 3JB9H 5EPSA 2RHXA 4ZNXA 4BI3A 3AQAA 5C8GA 2CZ7B 4B9WA 2F5KA 5H1TA 4CFKA 5GAOp 3JB9G 1M1KR 1C1AA 4II1A 3D7CA 2L3RA 1WUMA 4NR5A 4FW2A 5FWBA 2LT1A 4QC3A 4UIYA 3QKJA 1NM7A 4L5GA 4DBFA 4XK8E 1UG1A 1GBQA 2D8JA 4CUQA 2K3XA 2RD1A 4TU4A 2AT1B 3AADA 4J9BA 5ENBA 3NMZC 1MGQA 3UA7A 2E5QA 3RR6A 3P1DA 1VQ4A 1R0BG 4PJLA 3CCET 2ATCB 4PNOA 4J0RA 4CC3A 1R8OB 1RADB 2YLBA 3V7RA 5J26A 2EFIA 2MOXA 3SVFA 1TU0B 5L97A 3HP9A 5KU3A 3FC3A 3JVLA 2FZCB 2RH2A 1UGRB 4IUUA 3U5PA 4OMFB 5IG6A 4OUFA 2VUBA 2RO0A 2V1RA 1BI1A 3P8BB 2MYSA 1KD1R 2J6FA 2OTLT 1D09B 1UTIA 1VIFA 1NZ9A 1ZA1B 1AWXA 3X20B 4FLPA 1GCQA 1OU9A 5FH7A 3CCQQ 3K2JA 2NUPB 5DLOA 3OYAA 1M1FA 2JN0A 3EG3A 2O9VA 2E3IA 1H92A 2RHYA 4KGZB 1PRMC 1KQSS 4R0KA 3VS6A 1B34A 5A2QE 3CPFA 3UVWA 2JOYA 4XUAA 1VQ4T 1VQOQ 4UC4A 1HK9A 5DLQE 3SEMA 5A83A 3HRSA 1C0MA 1M27C 2DX1A 3IU6A 2ZPIB 4FSSA 2HBWA 2DXBA 1BB9A 1WJQA 2JXBA 5D24A 1D1CA 5I2MA 1MNEA 3F70A 2FYKA 1PCXA 4A9JA 4AG1C 2XKOC 4M7DB 1WXBA 2LJ1A 4C92B 2RM4A 2VXFA 4M75D 2RNAA 3FJ5A 2EBPA 2KBTA 1NYGA 1AWWA 2KDSA 4LYWA 5GMKl 3CC2A 4LDFA 2M9UA 4A9NA 2QASA 1M5Q1 3QDFA 2DKWA 2L5QA 4LR6A 1CKAA 3ONIA 2BUDA 2MK5A 2KGTA 4E2FB 2YUPA 1PC0A 4RTTA 3OYEA 1D0YA 2SEMA 3OYLA 2PVGB 4PKLA 2DVRA 3LQHA 4HBVA 1QVGS 2JMCA 3OS5A 1N5ZA 5A85A 5KTWA 3CQTA 2DEUA 2DERA 4FCYA 5D3NA 1VQPA 2LQ8A 4EDUA 4NRCA 4Q0OA 1OULA 1VQNA 1VIEA 5AD2A 5BT5A 5F1LA 1Z9ZA 5GANe 3OA6A 4YAXA 1KQ1A 2OTJA 1VUBA 2RJDA 1SPKA 2BIVA 2EKHA 1ABQA 4RTUA 2JW4A 4XY9A 5KO4A 2LDMA 3DLLA 2EGCA 1PKTA 3CC7T 5IHKA 2MAMA 3CCUA 2CP7A 3EG2A 5CKBA 5I88A 2FRWA 2EKOA 2CUDA 4M7AB 5E74A 5E9VA 5CQ6A 3IQLA 4XTYA 1NE8A 4NQNA 5KHMA 2DBKA 3OYMA 4C67A 4QSUA 4X1VA 1VQ8A 2MWPA 5GAN2 2RHIA 5L8RE 5F5ZA 5GAMj 3L2VA 4FSXA 2EIFA 5GAMh 5I2SA 4ZQLA 1VQ6T 4KCXA 5KYXA 4TS8A 4M77F 5CIUA 2YEMA 2R58A 5C4QA 1SF9A 2Y90A 4RCBA 1VQ4Q 1VQKA 2LJ0A 3WVDB 2MPXC 1UDLA 3QYGB 5JI8A 2AIRB 3R6NA 4O78A 2DBMA 1G8XA 3S91A 5J0DA 3A8HB 2OX7A 2M1HA 5CVIA 2B8AA 5DY7A 3CCQT 1OZ2A 1TTHB 2X35A 4RUGA 3Q2FA 4DA4A 1LVKA 3FLGA 1R77A 5DBMA 1KG1A 2LX7A 2CP2A 1BIBA 5E0RA 3BW1A 2LNHB 4CI0C 5DKHA 1CKBA 3IU5A 2MWOA 4MR6A 4JLIA 4RTXA 2HKNA 3HFNA 5A81A 1N9RA 4FM4B 3L2WA 1EIFA 2YXYA 1P92A 2EYXA 3QZ9B 3TCJA 5J39A 5H1VA 1X6GA 1WHJA 3UA6A 1VOMA 2GFUA 1YHQA 2O88A 2QDYB 2GFAA 3PVLA 4RTVA 5KH6A 5F60A 1WGSA 2XD0A 4C92E 3ZL7C 3U5NA 3MHXA 4FW1A 5ETBA 5C87A 2KYBA 5CFWA 2YUNA 1ZUUA 1M1GA 1YHQT 3PGGA 3RBBB 5HRVA 2I2LA 4AFUC 2DRKA 1YWOA 3QBYA 3SD4A 3CMAT 3CCVA 4M7AF 2VKNA 4J9IA 3QO3A 2D0NA 3JCMh 1VA7A 4PJOA 4J6YA 2RQWA 1O75A 2XK0A 4FIBA 1QCNA 5GJWB 4JZ3A 1N6AA 2MI6A 4IUPA 5FRMA 1YHQQ 3ME9A 1W4SA 3KFVA 3VJPA 1OPLA 3FJPA 4OF1A 2XU8A 5EWVA 5L98A 4C92C 3O33A 2D9EA 3PIOA 1EX4A 4GLKA 1JSPB 2PVDB 2NUPA 1X0JA 1SRMA 2HQXA 3MP8A 3FIFA 2DL8A 4HKEA 5E3GA 1IGQA 2NYSA 3CCVQ 4KUIA 5TCMA 4TT2A 1HXDA 3BY7A 2YHTA 4E7ZA 1D3BB 5G4SA 4IOOA 4QR4A 3HPWA 2QTXA 1GCQC 3NGPA 4IR3A 5LJ3d 5CCAA 1VQ6A 4F7UE 4OB3B 4CC4B 4OMQA 3NFCA 1YCSB 2ECZA 2JS2A 2QQ9A 1VQKQ 1W6XA 5E7DA 2ZGWA 2F2VA 2DIGA 2DXUA 4Q5WA 5FE3A 1N8RC 2L2PA 5GAN4 1YBYA 1K0XA 4Z1QA 1UECA 5E9MA 5EVAA 2Y4YA 3U5KA 4QBMA 5C89A 1PHTA 3E9GA 4IURA 2ZPGB 1VQ8Q 3OQ5A 2VYTA 3O34A 4ZGDB 4KH1B 5GMKm 2DD4A 1ARKA 5FE4A 1QQJA 5AMFA 1H3HA 3QYHB 3ASKA 5CU8A 2QAZA 4PFPA 3M59A 4UYHA 5EWDA 1EQFA 4X9CA 3ZEHA 2R10A 3HHTB 3CCRQ 3QZ5B 3G71Q 3JSCA 1YN8A 2L85A 3LH5A 1X6BA 2BE9B 2R0VA 4XTZA 5CRZA 3SWNB 3M9QA 1QKWA 5EGUA 1BI3A 3MXFA 1K73C 5FFWA 1MMNA 5KYWB 5I7YA 1D0XA 4LZRA 2RK1A 4MR5A 2E10A 5I21A 3FKMX 4XYAA 2FPEA 2EYZA 3OYGA 2ROLA 4OVAA 5II1A 5CY9A 4M7AA 4QC1A 2VXEA 5HQ5A 5LJ5f 3S92A 1PNJA 2FZGB 5GAMf 5HK3A 4WCIA 3U5LA 3CXCS 5EWHA 2E64A 5F61A 3A8OB 5LKTA 4L59A 4JS5A 4QW2A 2FG0A 3EH2A 2N9GA 3RKXA 5F36A 1WUGA 5LJ1A 2DL3A 3QZVA 4QQGA 5FE1A 4EPCA 1VQOA 4Z02A 2LJ3A 2V1QA 1LNXA 4X2IA 1Q86C 4CURA 1QVPA 2NLUA 1M8VA 3QJ6A 3CCJT 5IAYA 2FSAA 5CQ4A 3MP6A 2FL7A 5E9KA 4C0DB 3OS2A 5GAN7 3ZFJA 4RG2A 1TG0A 2AZSA 1YITA 2LVMA 2H60A 1YP5A 5IGLA 2QEXT 2LQWA 2I0NA 2EQIA 1JO8A 5ENHA 1VQLA 2GGRA 3H6ZA 3U23A 1KQSA 5D3JA 1WNLA 1JRIA 4C8QC 4A9KA 4Z8AA 2NUZA 4YATA 1YI2T 5FG6A 2DA9A 5IIDA 1K8AU 4NQMA 3QWYA 5CZGA 3H0HA 2O01E 2KROA 4DBHA 4AKNA 1WHKA 3CCUT 3RESA 5AMEA 4QSVA 4QR5A 1RAIB 1TWBA 2KR3A 4WHWA 4F7UF 4C5IA 2L3QA 4YYNA 5GAN3 2R5AA 5HFRA 1M1KC 1QW1A 1H8KA 2BE7D 3JCMd 2P0PA 2H8HA 3OMCA 3TSWA 4C8QE 3OW2A 9ATCB 1VQ9T 2RS9B 2HMAA 4ZTJA 1NJIU 2COZA 2DWWA 3GBQA 4GBQA 3G4SA 1C6VX 1YJWQ 4J9FA 1WJRA 4PS5A 4JDSA 5HJCA 2QTVA 2D0QB 1KC8U 4PL6A 2HDAA 1E6HA 5FH6A 4TVRA 2DD5A 3OS0A 4E7HA 2C0OA 5GAN6 4A53A 5DFBA 1JJ2A 2AK5A 5FU7C 4UYFB 2EQKA 5FU6C 2YW5A 2CP0A 4OMLA 1WQWA 5II2A 1AOJA 3JVJA 3QUIA 1ZUKA 1KJWA 1WHLA 4NR7A 5CO7A 1UGQB 2K5IA 4M77A 1VQMA 4K11A 4YYMA 4FU6A 2IPOB 4N3WA 2EJGA 4UYGA 4D8DA 4NR6A 5I7XA 1D0ZA 4PK4A 2M0OA 1N8RR 4C92F 4NRAA 4CUTA 5D3RA 4ORZA 1YJWA 4IUVA 4JRPA 4E7IA 1QVFP 5E9YA 2O4XA 4HXPA 4VUBA 3T9NA 5FBXA 5IGKA 4KRTA 4HVWA 3CC2T 5GMKj 4MZMA 5EA1A 3EG1A 5EPBA 2D1XA 2YLCA 4YK0A 1HYOA 1E6GA 3OBYA 4BE0A 2VC8A 2QDLA 3CBPA 4ZGEB 5KCHA 1JJ2P 3Q2EA 2DJQA 3ER0A 2AKKA 4A4GA 2DIQA 1VYUA 5L8UA 1UEBA 4O76A 2GBQA 5LKZA 4J9CA 5CQYA 5IXBA 2COWA 1Y7XA 2EYQA 5KYUA 2J7IA 4OB2B 3DWYA 2KAFA 5LJ5h 2VASA 5D3LA 5IN1A 4N4GA 4LDYA 5CUEA 3VKGA 1YI2Q 1I81A 2CT3A 4RCCA 3CD6A 4JLGA 4M7DD 4ZGJB 1JJ2S 2HSPA 2HEQA 3V7SA 2RNWA 2XI9A 3M5AA 1NLOC 4LDVA 3LGFA 3H0IA 4AFSC 1S72A 2HCKA 4F17A 3G6ET 6AT1B 4NYVA 4BHWA 4QSXA 2JZ2A 4ELYC 4HT9A 1LCKA 4M77B 5HQ7A 4M77E 4OMPA 4R55A 2ZAEA 5FU6B 3VYGA 2WSCE 5LJ3f 3J81E 1BI2A 3CBMA 3HSBA 3C95A 4C8QB 4QSSA 4N0AC 2YUOA 3CCRT 3MO8A 4WHUA 1OV3A 1KQ2A 3MPUB 4YBSA 2DL7A 1NBEB 1H3ZA 4PJOD 3O5ZA 2LQKA 5DYCA 1G3YA 2YDLA 4O70A 3JCMP 1X01A 3RKWA 1WZOA 3OYFA 4IR4A 2K5LA 3EAEA 2GRCA 5EWWA 4MEPA 1SEMA 2X4YA 4D6WA 2CGHA 5HCKA 3JVKA 2RNYA 2WACA 4DEXA 4CUUA 4PTBA 4AKIA 4O7CA 2RJFA 2YYNA 4NL2A 2XIDA 2P0KA 3NHNA 2HL3A 3E2UA 4YH4A 3GF5A 3VS1A 2DVQA 2QXFA 2K2MA 4CL9A 2ZCFB 1OPKA 5D7UA 5LL6S 4O72A 2PZ1A 2QGFB 2OSSA 3S3NA 5CRMA 1VQLT 2OAUA 3MCAB 5J3BA 4QT7A 1XQHA 3RNJA 5D26A 1WJSA 5F2PA 2CKKA 4F04B 2NUTB 3DKMA 3CC4T 4QSPA 1WHHA 1VQ7A 3MKDA 2LSPB 1IB8A 3FRNA 5FDZA 3SVHA 1RACB 1WA7A 5A0DA 3CCVT 2KXCA 5E9IA 1FWZA 4CC2A 3G6EQ 4HXMA 3UATA 2YDWA 3CCJA 4Z6IA 4BW2A 4C92D 1HSQA 3QHSA 1YJNT 4LDWA 5A5QA 4OGIA 1T3LA 2C0IA 4M78C 3JCMQ 4M7DF 3LQIA 3G71A 4HCCA 1S72T 4HCKA 2FRYA 2YRVA 1WXUA 4YYDA 3QZTA 3OYKA 5EV9A 1UJ0A 4PJOB 1U1TA 1J3TA 4QVCA 3M0TA 3OMGA 3CMAQ 5GAN5 2ED1A 4E6RA 1UB4A 3PMTA 2WSEE 4KGVB 3I35A 5I80A 4XTWA 1M90U 4HCBA 2RN8A 3FB9A 5A5OA 2WP1A 4PJOF 4ALGA 2X4JA 3JCMX 3PT9A 4KH0B 1Y71A 1X2KA 4M78E 3Q1JA 4QQ6A 5IGMA 5ENGA 5FE0A 1JU5C 1R0CB 2PVOB 3CXCA 1IZ6A 2CP3A 2H3JA 2CT4A 3EGXB 2DXCA 3X24B 1BYMA 5DFCA 4OMOA 3M4YA 1QLYA 4GY5A 4FT2A 2RQUA 1G3WA 4Y91A 5CKHA 1KD1U 2L3PA 5H1UA 1OOTA 4M75B 3VUBA 4PJMA 1KC8R 3JCMJ 2CSIA 4M78G 3SHWA 4IR5A 3BFMA 5FWCA 1MHNA 3CXCP 1JBMA 3PE0A 1AT1B 2KYMA 1Q86R 2XDDA 3DAIA 3L2QA 1X27A 1WYXA 4NR8A 4BD3A 4HBYA 2HSEB 1KIKA 2LT4A 5LVRA 1RAEB 1KHCA 2DTHA 3RMSA 4KUDK 1MV0B 2RI2A 1M2VB 5F25A 3G1JA 4X34A 4N4HA 4A54A 3V8LA 5KYXB 1PM3A 5FG5A 2WSFE 3PFSA 2QK0A 4QEVA 1Q7YC 4Y92A 1YJWT 3JB9I 1K8AC 1AWJA 5CAIA 3VUZA 4WF2A 2DXTA 1JB0E 2DYIA 2K79A 1UGPB 1SG5A 4Z1SA 4QZSA 5IT9E 1VQ9Q 1FXXA 1M3CA 5I29A 5FE2A 3INZA 1V29B 5CQTA 4KV4A 4TZ2A 1SHGA 1G83A 2P0QA 1YIJT 5ENIA 1RAHB 3CC7Q 2DO3A 2D8HA 3FEOA 2YRCA 1AHJB 2K2VA 4WTOB 5IGNA 3EGDA 4NL3A 1VQ5A 3H41A 1D1BA 1X75C 3CCUQ 3J7AF 4Y03A 1MUZA 5KE3A 3UVYA 5DYXA 2E3HA 3H0FA 4J0SA 3KBGA 4O7AA 1OX8A 4JRIA 2E6ZA 2ZZDA 3P5OA 3OW2S 1ZUYA 2OTLA 5ENJA 5CQ8A 3TSZA 1WFWA 2E41A 5H85A 4BY6B 5EK9A 4AKGA 4AMCA 5A5SA 3RCWA 5CUDA 4LZ2A 5GMKe 5HQ6A 1ZSZC 2RHUA 2NXBA 1VYTA 1BU1A 1K76A 2OTJQ 1OEBA 2CH4A 1QWFA 5I83A 4J9EA 4F7UA 3VS7A 2OI3A 4QVZA 1ABOA 2FPFA 5F63A 3ULRB 5DYAA 1M8MA 3URGA 2LZ6B 2FHDA 2X4WA 1IGUA 4CLBA 4KULA 5IBNA 1YCYA 1PWTA 2PNIA 4IKFA 3CD6Q 5FH8A 4CRIA 4XAXB 3ERRA 5C0MA 3QG1A 1PRLC 1MV3A 2J06A 3LW5E 3QXEB 3JCMV 4LUEA 3M0SA 5CUCA 2DVJA 3EHRA 5HK0A 3LGLA 5AT1B 5E73A 5GAOl 3P1FA 1U1SA 4FL6A 1UFFA 2X3WD 3JB9J 1XNIA 1YITT 3O36A 4XUBA 1UGVA 5EU1A 5KTUA 4NS5A 5CUBA 4PFOA 4X9DA 1Q7YU 4FT4A 1JXOA 5FW9A 1UHFA 1NJIR 5HFQA 5C7NA 2HKQB 2Y4XA 4LD9K 4A4FA 4CUSA 1RLPC 2RA2A 2LMJA 3OSVA 2M16A 2VGMA 3VU3C 4JJNK 4B6MA 3U5JA 2C0TA 3LXJA 1S72Q 2KSSA 3EGXA 1YIJQ 2ESWA 3A8MB 2DTIA 3LYIA 1U8RA 3X28B 2D6FA 2QQSA 2EJNA 1TS9A 4O7EA 1VQ5T 4C0ZA 1WI7A 1M90C 4O77A 4M75C 3MQMA 5I89A 4OGCA 5I86A 1YFNA 2FB7A 3EGDB 5KYYA 1Q81C 3HMHA 5HENA 1XJWB 3OY9A 2VV5A 4E7JA 4A9IA 3HTRA 4A4KA 2QGGA 3CCST 4YYJA 3J80E 2LCSA 4XU0A 4LZSA 1Q7YR 3JCMW 2I8NA 4C5HA 4J83A 5ENEA 3MEAA 3UW9A 3JCMf 2QQAA 4OMMA 2PU9B 5LKUA 3M0PA 4PKCC 1Q82U 5CP5A 1N27A 5CKDA 4BI8B 2HZYA 2W10A 1B3QA 3KUFA 1H641 5E3DA 2BZ8A 4PJJA 2C06A 4Q0NA 2A0FB 2KRNA 1QVGP 1KFZA 5DW1A 3LWIA 4UIXA 3I3JA 2FVUA 2GF7A 5CPEA 3EGUA 5GAMe 1ZHIA 3HMFA 2EYWA 3OBWA 4ZN1A 1W2BA 5LKXA 4Z6HA 5FB1A 5I1QA 3TLPA 1OU8A 4LDXA 4QR3A 2EJ9A 1MNDA 3LH0A 2NUTA 5DKCA 5LUUA 4QNSA 4IIMA 4QSQA 2KT8A 4YADA 2RQRA 2WP2A 4A4EA 4OP0A 5D6XA 5CK9A 4E7SA 3CMEQ 3QWXX 3MP1A 4D8KA 4HXNA 2QI2A 1V76A 4HXOA 2G6FX 4M4ZA 1M90R 3PNWC 3VKIA 2SRCA 3MB4A 1BI0A 3A8LB 4YY6A 5D7XA 4BY6C 4UITA 4YH3A 3HL8A 2A28A 5FE9A 2J6OA 3PMIA 4LD6A 5LJ5j 1M2OA 1I07A 4BW1A 1K9MC 4RTZA 3CCSA 1ZSZB 5ENFA 4A9FA 1S1NA 4PJNA 3NPFA 3P1EA 1Q81R 4QUUA 1TXQA 4JJBA 2JVVA 3BDUA 3JCMe 2E12A 3L2UA 2YRDA 3ZBDA 5C85A 4ZC9A 4LUDA 4A9LA 1PUOA 3MEUA 4LN2A 3P1CA 2R57A 4NOYA 3HMEA 5KYUB 2A36A 2X4XA 2DAQA 1TUCA 5EI4A 5DW2A 1K9MR 1BK2A 5LJ2A 4UIZA 2KK4A 3CC4Q 1I5LA 2QQBA 1DJ7B 2A37A 3QDRB 5CGPA 3CMET 5EPRA 1NEBA 1NYFA 4BB7A 5ETDA 1MMDA 4M7DE 1VQNT 1UJYA 3O37A 5A5PA 4O75A 2DVVA 1YIJA 2RK2A 4C0GA 1N72A 2KXDA 3M4GA 4JPBW 1K9MU 2XICA 3VS5A 2J05A 2CP5A 1SSHA 4J6XA 2F1LA 2LTOA 2DTOA 2EPDA 5DX4A 1TH7A 5ECAA 4HBXA 3UPUA 5F62A 5KTXA 4O71A 3CEYA 2M0YA 1KSWA 3VS2A 3UV2A 3TEEA 2QA4Q 1OI1A 4IOQA 3RUXA 3I56T 1VQ6Q 4QUTA 4YY4A 4KBMB 4HXLA 2G4AA 1VQ7T 4M7AG 4OB0B 5IXFA 1X43A 4N0AA 1IHVA 8ATCB 5GANf 2YSQA 4F14A 4ZN3A 1RAGB 4RKUE 4JRKA 5GAN8 4TT6A 4M7DA 2DILA 2ENMA 2EW3A 1LJOA 4EMKC 3G0LA 3KXTA 2RJCA 2ZPEB 1SKUB 2RB6A 5FU7B 2VVKA 4KGXB 3SWNA 2R5MA 5CKEA 5FRNA 3I55T 4YABA 3JVMA 1F1BB 2DVSA 1SSFA 2E3KA 3GIBA 4B9XA 5FB0A 2E70A 4M77D 2DATA
chains in the Genus database with same CATH topology
1QVFA 3UVXA 4BE2A 4JUVA 3LWHA 4NUEA 5KCOA 1I8FA 4LYSA 1Q82C 4MEOA 3GNFB 5A0GA 3G7ZA 4C8QA 3JAME 2CS7A 1KHIA 4IORA 3CCRA 5EG2A 2JTFA 1ZS5A 1QP3A 3AHUA 5D3TA 5GAMg 5GANd 3RIRA 5BT3A 5FFVA 4C92G 4KV1A 4M7DG 4CUPA 4O7BA 4J7IA 1Q81U 2HBPA 1NJIC 4PCIA 2G3RA 3JB9F 4TQNA 3C4SA 2AHJB 2LCCA 2YEKA 2V8IA 1IREB 3OS1A 1M1KU 4C66A 2E6NA 4WIVA 5DFDA 3M56A 3CD6T 2IG0A 2XG8D 4DOVA 4DONA 1VQOT 3VV0A 5F1HA 2RI3A 3DB4A 4C5GA 5L8TA 1KC8C 3GNGA 3L2RA 3SB2A 3NXBA 5DLXA 5GAOr 3O35A 4MZTA 3LLRA 2RFJA 4LRGA 2DZ9A 5LJ5d 5D6WA 2ZPBB 4HT8A 4XTXA 4UYFA 1UGSB 2DEQA 3WVEB 3A5ZB 3BDLA 4M78D 3QPHA 4QVDA 4J6WA 3CC4A 4NRBA 3X26B 4E7KA 4NR9A 1Q86U 4BE1A 2V8KA 5CQ7A 5LJ0A 4UIUA 5CUGA 3A8GB 5D3PA 3OYCA 3EFSA 2PUKB 1XOVA 4OB1B 1VQ9A 2E1HA 3RKYA 4BUGA 2YELA 2EWNA 4V2SA 4F7UB 2VGNA 4HCZA 4OGJA 4C0FA 4KT0E 2QA4A 3OYHA 2D9TA 3NTHA 3ZYUA 3U5MA 2R0SA 5DYUA 4MR4A 3GP8A 4EMKA 5A82A 4TTEA 3E9FA 3RMQA 5GANh 1ZQ1A 4BDYA 2K57A 2IVWA 4ZTFA 1VQ8T 2PQWA 3UT1A 1K73U 5CS8A 3HKSA 5GAOm 2EQUA 4QEWA 3OYBA 5FLXE 3U5OA 4TT4A 5LVQA 3PIPA 4UIVA 5F3AA 5HY6A 3TREA 2V8JA 3M55A 5KE2A 5K29A 1OZ3A 4NYWA 5CQ3A 4M78B 2QQRA 4HXSA 1M9SA 4M75G 3S6WA 3LJWA 3X25B 3P8DA 4M7AD 3CCLA 5LJ3h 2DVEA 5HRWA 3SDZA 2CZ0B 4IR6A 2D82A 3JB9D 1G5VA 4BACA 1Y96A 1W2BS 4J3IA 3V8KA 4O7FA 2KMTA 1B34B 4E7LA 3META 3HRTA 1KD1C 4O6JA 5CQXA 3I56A 4BI4A 4P5NA 4C0DC 3WXMB 1YJNA 1O9SA 2MJVB 4OGEA 4MDXA 3HRUA 2DJZA 4IUTA 4RVRA 1RL2A 2K5FA 4NYXA 5ACYA 3V8JA 5LJ5g 2CZ1B 4LYIA 4PJOG 1NPPA 2JTMA 5D25A 5AD3A 2E65A 2XDPA 4MMLA 3G6EA 1N8RU 1X6OA 1NPRA 3UV4A 4HBWA 4Z93A 4HXRA 4O5VA 2L89A 4R56A 2E7OA 3M57A 4PLIA 5ENCA 5GAMd 5GANg 3LQJA 3SFMA 4QSWA 4M78F 4YYKA 4JRQA 4PJOE 3QJYA 4UYEA 1VQKT 2HAXA 2OUOA 4E47A 3LX7A 4GPJA 5CQAA 5AYFA 4QB3A 2DZCA 4LDUA 3L42A 2F69A 2DK3A 1YI2A 5EICA 5G4RA 2RJEA 4A4HA 4UIWA 4A9HA 4RG8A 1QP2A 5GMKh 4J1PA 3CBOA 4EMHA 4M78A 4ZW1A 3M58A 4XU2A 4MZPA 2F5TX 3UDCA 2R0YA 4EMGA 2K4YA 2OTJT 5FE5A 4ALHA 3O8VA 5DM7R 3E19A 2KVQG 5A5NA 5DKDA 4C8QG 5EP7A 4MR3A 5L96A 5CR2A 1VQPT 4LC2A 5LJ3g 5BT4A 4DOWA 2CZ6B 2I7KA 3GLXA 4O74A 1G3SA 5FFYA 5CTLA 4M77G 4PLLA 4N4FA 3QSUA 1XTDA 3MULA 2E7NA 2LC4A 3JRZA 5HRXA 1QVFS 4Y28E 1PSFA 3OYDA 3NTIA 3H8ZA 2HQEA 4BJXA 3JCMb 4UYDA 1Y07A 2RHZA 3N5BB 4ATOA 4XU1A 2ZPHB 4QSRA 2KQWA 4M7AE 4A9OA 3DLMA 2BKDN 4A9EA 5HCLA 2CYZB 3HFOA 4TU6A 3TU4K 4C5EA 4C8QD 3CCEA 4PY6A 1VQMT 1JM4B 5DY9A 1LOJA 5JWMA 3RERA 4M75A 3CCQA 4NUDA 1WPYA 4E96A 4BW3A 5FE8A 4M7AC 1Y96B 2RNXA 5HLSA 4C8QF 5M9OA 4J8OA 2A7YA 2MMPA 4IUQA 4YTLA 2EQJA 3M54A 4TZ8A 1RI0A 4J5YA 3E1SA 1F68A 2K3YA 3CPWA 2RI5A 5A5RA 2F6NA 3PTAA 3L2ZA 5EQ1A 5TB6A 4HXKA 4NR4A 2RI7A 1BIAA 3CC7A 4M75E 4MEQA 3GOXA 2QEXA 4YC9A 2OO1A 1E6IA 2KTBB 4MENA 4MDWA 2GQVA 4HA8A 5CUAA 3EFRA 1QVGA 5LJ3j 4MMKA 2EJFA 2JNGA 3L1AA 5D3SA 5FE7A 2F6JA 5COIA 4QQDA 2L8DA 4QEUA 4F3IA 4NXJA 3DB3A 3UV5A 4YYHA 5HKCA 4A9MA 5C6SA 5FG4A 2KY9A 2HD0A 4YBMA 2O4XB 4PCEA 3OYYA 5EWCA 5GAOq 2ZPFB 1GXIE 1FX7A 1M4ZA 3M53A 2XHCA 5HELA 5A7CA 4PJOC 2LNVA 1BKBA 4RMOA 2DKGA 3CCMA 5HEMA 3MB3A 3GG3A 3OYIA 5D6YA 3G4ST 2L5EA 5LJ3e 4YBTA 3UWNA 3V7CA 4QSTA 3CPWS 3MEVA 3CMEA 5D0CA 2RO1A 3OYJA 3R6OA 2JUFA 5E9LA 2DPPB 2EAYA 5CQ5A 5EISA 2LRQA 2EQMA 4QYLA 1PSEA 4BDZA 3G0JA 2LCLA 5EM3A 4NUCA 4YYGA 1I4K1 4XQ3A 2HNIA 4L6V5 5L99A 4QYDA 3MUKA 2A3LA 4XY8A 3S3MA 2YQDA 4CFLA 5CKFA 4BW4A 3NTKA 3OB9A 3G71T 5LJ5e 4ELZC 2PUOB 3CCMT 4M7DC 4N4IA 3VYHB 5GMKi 2L84A 5D3HA 5FROA 4TYLA 4XTVA 3SWNC 2QA4T 3P8HA 5GANj 4M77C 5DLZA 1WQ7A 4JS4A 1YJ9A 2XDBA 5FE6A 3C12A 3JCMg 1N9SA 3UVDA 3QIIA 3OSSC 1ZBXA 2GCXA 1G3TA 5GAOn 3OYNA 4J7FA 3CCLT 4C92A 3I55A 3MEWA 1D3BA 3FDRA 4YYIA 4EMKB 5I40A 4XTUA 1OYXA 2LX9A 3C94A 4XU3A 3S3OA 3JCMc 4DQ2A 4M75F 2MF2A 4QY4A 1YJ9T 4ME7A 3SVGA 4F7UG 3GPLA 3QZSA 3CMAA 5A0LA 2P4TA 5HM0A 3JB9H 5EPSA 2RHXA 4BI3A 3AQAA 5C8GA 2CZ7B 4B9WA 2F5KA 5H1TA 4CFKA 5GAOp 3JB9G 4II1A 3D7CA 2L3RA 1WUMA 4NR5A 2LT1A 4QC3A 4UIYA 3QKJA 4L5GA 4XK8E 4CUQA 2K3XA 2RD1A 4TU4A 3AADA 5ENBA 1MGQA 2E5QA 3P1DA 1VQ4A 3CCET 4PNOA 4J0RA 1R8OB 2YLBA 3V7RA 5J26A 2EFIA 3SVFA 3HP9A 5L97A 5KU3A 3FC3A 3JVLA 2RH2A 1UGRB 4IUUA 3U5PA 4OMFB 5IG6A 4OUFA 2VUBA 2RO0A 2OTLT 1BI1A 3P8BB 1VIFA 1NZ9A 3X20B 4FLPA 5FH7A 3K2JA 5DLOA 3OYAA 1M1FA 2JN0A 2RHYA 1KQSS 1B34A 5A2QE 3CPFA 3UVWA 2JOYA 4XUAA 1VQ4T 4UC4A 1HK9A 5DLQE 5A83A 3HRSA 3IU6A 2ZPIB 2DXBA 1WJQA 5D24A 5I2MA 3F70A 2FYKA 4A9JA 2XKOC 4M7DB 4C92B 2RM4A 2VXFA 4M75D 2KDSA 4LYWA 5GMKl 3CC2A 4LDFA 2M9UA 4A9NA 1M5Q1 2DKWA 2L5QA 4LR6A 3ONIA 2BUDA 3OYEA 3OYLA 2PVGB 4PKLA 2DVRA 3LQHA 4HBVA 1QVGS 3OS5A 5A85A 5KTWA 5D3NA 1VQPA 2LQ8A 4EDUA 4NRCA 4Q0OA 1VQNA 1VIEA 5AD2A 5BT5A 5F1LA 5GANe 3OA6A 4YAXA 1KQ1A 2OTJA 1VUBA 2RJDA 2BIVA 4XY9A 5KO4A 2LDMA 3DLLA 3CC7T 2MAMA 3CCUA 5CKBA 5I88A 2EKOA 4M7AB 5E74A 5E9VA 5CQ6A 4XTYA 1NE8A 4NQNA 5KHMA 3OYMA 4C67A 4QSUA 1VQ8A 2MWPA 5GAN2 2RHIA 5L8RE 5F5ZA 5GAMj 3L2VA 4FSXA 2EIFA 5GAMh 5I2SA 4ZQLA 1VQ6T 4KCXA 4TS8A 4M77F 5CIUA 2YEMA 2R58A 5C4QA 2Y90A 4RCBA 1VQKA 3WVDB 3QYGB 5JI8A 4O78A 3S91A 5J0DA 3A8HB 2M1HA 5CVIA 2B8AA 5DY7A 3CCQT 1OZ2A 2X35A 3Q2FA 4DA4A 3FLGA 5DBMA 1KG1A 1BIBA 5E0RA 3BW1A 4CI0C 5DKHA 3IU5A 2MWOA 4MR6A 4JLIA 3HFNA 5A81A 1N9RA 4FM4B 3L2WA 1EIFA 5J39A 1P92A 3QZ9B 3TCJA 5H1VA 2GFUA 1YHQA 2QDYB 2GFAA 5KH6A 5F60A 1WGSA 2XD0A 4C92E 3U5NA 3MHXA 5ETBA 5C87A 5CFWA 1M1GA 1YHQT 3PGGA 5HRVA 2I2LA 3QBYA 3SD4A 3CMAT 3CCVA 4M7AF 3QO3A 3JCMh 4PJOA 4J6YA 1O75A 2XK0A 4FIBA 1N6AA 2MI6A 4IUPA 5FRMA 3ME9A 1W4SA 3VJPA 4OF1A 3FJPA 2XU8A 5EWVA 5L98A 4C92C 3O33A 2D9EA 3PIOA 4GLKA 1JSPB 2PVDB 1X0JA 2HQXA 3MP8A 3FIFA 4HKEA 5E3GA 4KUIA 5TCMA 4TT2A 1HXDA 3BY7A 2YHTA 1D3BB 5G4SA 4IOOA 4QR4A 3HPWA 2QTXA 4IR3A 5LJ3d 5CCAA 1VQ6A 4F7UE 4OB3B 3NFCA 2QQ9A 5E7DA 2ZGWA 2DIGA 2DXUA 4Q5WA 5FE3A 1N8RC 5GAN4 1YBYA 4Z1QA 5E9MA 5EVAA 2Y4YA 3U5KA 4QBMA 5C89A 3E9GA 4IURA 2ZPGB 3OQ5A 2VYTA 3O34A 4ZGDB 5GMKm 2DD4A 5FE4A 5AMFA 3QYHB 3ASKA 5CU8A 3M59A 4UYHA 5EWDA 1EQFA 4X9CA 3ZEHA 2R10A 3HHTB 3QZ5B 3JSCA 2L85A 2R0VA 4XTZA 5CRZA 3SWNB 3M9QA 5EGUA 1BI3A 3MXFA 1K73C 5FFWA 5I7YA 4LZRA 2RK1A 4MR5A 2E10A 5I21A 3FKMX 4XYAA 3OYGA 4OVAA 5II1A 5CY9A 4M7AA 4QC1A 2VXEA 5HQ5A 5LJ5f 3S92A 5GAMf 5HK3A 3U5LA 3CXCS 5EWHA 2E64A 5F61A 3A8OB 5LKTA 4L59A 4JS5A 4QW2A 2N9GA 3RKXA 5F36A 1WUGA 5LJ1A 3QZVA 4QQGA 5FE1A 4EPCA 1VQOA 4Z02A 1LNXA 4X2IA 1Q86C 4CURA 1QVPA 2NLUA 1M8VA 3QJ6A 3CCJT 5IAYA 2FSAA 5CQ4A 3MP6A 2FL7A 5E9KA 4C0DB 3OS2A 5GAN7 3ZFJA 4RG2A 1YITA 2LVMA 2H60A 5IGLA 2QEXT 5ENHA 1VQLA 3H6ZA 1KQSA 5D3JA 1WNLA 1JRIA 4C8QC 4A9KA 4YATA 1YI2T 5FG6A 5IIDA 1K8AU 4NQMA 5CZGA 2O01E 4AKNA 3CCUT 3RESA 5AMEA 4QSVA 4QR5A 4WHWA 4F7UF 4C5IA 4YYNA 5GAN3 2R5AA 5HFRA 1M1KC 1QW1A 3JCMd 2P0PA 3OMCA 4C8QE 3OW2A 1VQ9T 2RS9B 4ZTJA 1NJIU 2DWWA 3G4SA 1WJRA 4PS5A 4JDSA 5HJCA 2D0QB 1KC8U 4PL6A 5FH6A 4TVRA 2DD5A 3OS0A 4E7HA 5GAN6 4A53A 5DFBA 1JJ2A 5FU7C 4UYFB 2EQKA 5FU6C 2YW5A 1WQWA 5II2A 3JVJA 3QUIA 4NR7A 5CO7A 1UGQB 2K5IA 4M77A 1VQMA 4YYMA 4FU6A 4N3WA 2EJGA 4UYGA 4NR6A 5I7XA 2M0OA 4C92F 4NRAA 4CUTA 5D3RA 1YJWA 4IUVA 4JRPA 4E7IA 5E9YA 2O4XA 4HXPA 4VUBA 3T9NA 5FBXA 5IGKA 3CC2T 5GMKj 4MZMA 5EA1A 5EPBA 2YLCA 4YK0A 3OBYA 4BE0A 2VC8A 3CBPA 4ZGEB 5KCHA 3Q2EA 3ER0A 4A4GA 2DIQA 5L8UA 1UEBA 4O76A 5LKZA 5CQYA 1Y7XA 2EYQA 4OB2B 3DWYA 2KAFA 5LJ5h 5D3LA 5IN1A 4N4GA 4LDYA 5CUEA 1I81A 4RCCA 3CD6A 4JLGA 4M7DD 4ZGJB 1JJ2S 3V7SA 2RNWA 2XI9A 3M5AA 4LDVA 3LGFA 1S72A 3G6ET 4NYVA 4BHWA 4QSXA 2JZ2A 4ELYC 4HT9A 4M77B 5HQ7A 4M77E 4R55A 5FU6B 3VYGA 2WSCE 5LJ3f 3J81E 1BI2A 3CBMA 3HSBA 3C95A 4C8QB 4QSSA 4N0AC 3CCRT 3MO8A 4WHUA 1KQ2A 4YBSA 1H3ZA 4PJOD 2LQKA 5DYCA 1G3YA 4O70A 3JCMP 1X01A 3RKWA 3OYFA 4IR4A 2K5LA 3EAEA 2GRCA 5EWWA 4MEPA 2X4YA 4D6WA 2CGHA 3JVKA 2RNYA 2WACA 4CUUA 4PTBA 4O7CA 2RJFA 2YYNA 4NL2A 2XIDA 2P0KA 4YH4A 3GF5A 2DVQA 2QXFA 4CL9A 2ZCFB 5LL6S 4O72A 2OSSA 3S3NA 5CRMA 1VQLT 2OAUA 3MCAB 5J3BA 1XQHA 5D26A 1WJSA 5F2PA 2CKKA 3DKMA 3CC4T 4QSPA 1VQ7A 2LSPB 3FRNA 5FDZA 3SVHA 5A0DA 3CCVT 5E9IA 1FWZA 4HXMA 2YDWA 3CCJA 4Z6IA 4BW2A 4C92D 3QHSA 1YJNT 4LDWA 5A5QA 4OGIA 4M78C 3JCMQ 4M7DF 3LQIA 3G71A 4HCCA 1S72T 2YRVA 4YYDA 3QZTA 3OYKA 5EV9A 4PJOB 1U1TA 4QVCA 3OMGA 5GAN5 1UB4A 3PMTA 2WSEE 5I80A 4XTWA 1M90U 4HCBA 3FB9A 5A5OA 2WP1A 4PJOF 4ALGA 2X4JA 3JCMX 3PT9A 1Y71A 4M78E 3Q1JA 4QQ6A 5IGMA 5ENGA 5FE0A 2PVOB 3CXCA 1IZ6A 2H3JA 3X24B 2DXCA 1BYMA 5DFCA 3M4YA 4GY5A 4FT2A 1G3WA 4Y91A 5CKHA 1KD1U 5H1UA 4M75B 3VUBA 3JCMJ 4M78G 4IR5A 3BFMA 1MHNA 1JBMA 2XDDA 3DAIA 3L2QA 4BD3A 4NR8A 4HBYA 2LT4A 5LVRA 1KHCA 2DTHA 3RMSA 4KUDK 2RI2A 5F25A 4X34A 4N4HA 4A54A 3V8LA 5FG5A 2WSFE 3PFSA 4QEVA 1Q7YC 1YJWT 3JB9I 1K8AC 5CAIA 3VUZA 4WF2A 2DXTA 1JB0E 1UGPB 4Z1SA 4QZSA 5IT9E 1FXXA 5I29A 5FE2A 3INZA 1V29B 5CQTA 4KV4A 4TZ2A 2P0QA 1YIJT 5ENIA 2DO3A 3FEOA 1AHJB 2K2VA 5IGNA 4NL3A 1VQ5A 1X75C 3J7AF 4Y03A 5KE3A 3UVYA 5DYXA 4J0SA 3KBGA 4O7AA 4JRIA 2E6ZA 2ZZDA 3P5OA 3OW2S 2OTLA 5ENJA 5CQ8A 2E41A 5H85A 4BY6B 5EK9A 5A5SA 3RCWA 5CUDA 4LZ2A 5GMKe 5HQ6A 2RHUA 2NXBA 5I83A 4F7UA 4QVZA 5F63A 5DYAA 3URGA 2FHDA 2X4WA 4CLBA 4KULA 5IBNA 1YCYA 4IKFA 5FH8A 4CRIA 4XAXB 5C0MA 3QG1A 3LW5E 3QXEB 3JCMV 5CUCA 5HK0A 3LGLA 5E73A 5GAOl 3P1FA 1U1SA 4FL6A 3JB9J 1XNIA 1YITT 3O36A 4XUBA 5EU1A 5KTUA 4NS5A 5CUBA 4X9DA 1Q7YU 4FT4A 5HFQA 5C7NA 4LD9K 2Y4XA 4A4FA 4CUSA 2RA2A 3OSVA 2M16A 2VGMA 3VU3C 4JJNK 3U5JA 3LXJA 2KSSA 3A8MB 2DTIA 3LYIA 1U8RA 3X28B 2D6FA 2QQSA 4O7EA 1VQ5T 4C0ZA 1M90C 4O77A 4M75C 3MQMA 5I89A 4OGCA 5I86A 1Q81C 2FB7A 3HMHA 5HENA 3OY9A 2VV5A 4E7JA 4A9IA 4A4KA 3CCST 4YYJA 3J80E 4XU0A 4LZSA 3JCMW 2I8NA 4C5HA 4J83A 5ENEA 3MEAA 3UW9A 3JCMf 2QQAA 4PKCC 2PU9B 5LKUA 1Q82U 5CP5A 1N27A 5CKDA 4BI8B 3KUFA 1H641 5E3DA 2C06A 4Q0NA 5DW1A 3LWIA 4UIXA 3I3JA 2FVUA 2GF7A 5CPEA 5GAMe 1ZHIA 3HMFA 3OBWA 4ZN1A 1W2BA 5LKXA 4Z6HA 5FB1A 5I1QA 3TLPA 4LDXA 4QR3A 2EJ9A 3LH0A 5DKCA 5LUUA 4QNSA 4QSQA 4YADA 2WP2A 4A4EA 4OP0A 5CK9A 5D6XA 3MP1A 4HXNA 2QI2A 4HXOA 3PNWC 3VKIA 3MB4A 1BI0A 3A8LB 4YY6A 4BY6C 5D7XA 4UITA 4YH3A 3HL8A 5FE9A 3PMIA 4LD6A 5LJ5j 4BW1A 1K9MC 3CCSA 5ENFA 4A9FA 3P1EA 4QUUA 2JVVA 3BDUA 3JCMe 2E12A 3L2UA 3ZBDA 5C85A 4ZC9A 4A9LA 3MEUA 3P1CA 2R57A 4NOYA 3HMEA 2X4XA 2DAQA 5EI4A 5DW2A 5LJ2A 4UIZA 2KK4A 1I5LA 2QQBA 1DJ7B 3QDRB 5CGPA 3CMET 5EPRA 4BB7A 5ETDA 4M7DE 1VQNT 3O37A 5A5PA 4O75A 2DVVA 1YIJA 2RK2A 4C0GA 1N72A 3M4GA 1K9MU 2XICA 4J6XA 2LTOA 2DTOA 5DX4A 1TH7A 4HBXA 3UPUA 5F62A 5KTXA 4O71A 3CEYA 3UV2A 3TEEA 1OI1A 4IOQA 3RUXA 3I56T 4QUTA 4YY4A 4KBMB 4HXLA 2G4AA 1VQ7T 4M7AG 4OB0B 4N0AA 5GANf 4ZN3A 4RKUE 4JRKA 5GAN8 4TT6A 4M7DA 1LJOA 4EMKC 3G0LA 3KXTA 2RJCA 2ZPEB 2RB6A 5FU7B 3SWNA 2R5MA 5CKEA 5FRNA 3I55T 4YABA 3JVMA 2DVSA 1SSFA 2E3KA 3GIBA 4B9XA 5FB0A 2E70A 4M77D 2DATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI7 A;  1WGS A;  3UVX A;  4Z6I A;  4BW2 A;  4BE2 A;  3U5N A;  4MEQ A;  5A5Q A;  4NUE A;  4OGI A;  3GOX A;  5KCO A;  4LYS A;  5ETB A;  4MEO A;  5C87 A;  4YC9 A;  2OO1 A;  5CFW A;  1E6I A;  2KTB B;  4MEN A;  5HRV A;  3LQI A;  3QBY A;  3SD4 A;  3OS1 A;  4IOR A;  5CUA A;  2JTF A;  1ZS5 A;  2YRV A;  4YYD A;  3QZT A;  3OYK A;  5D3T A;  5EV9 A;  2XK0 A;  5KH6 A;  5D3S A;  5FE7 A;  3OMG A;  2F6J A;  5BT3 A;  5COI A;  5FFV A;  4IUP A;  5FRM A;  4QQD A;  4KV1 A;  2L8D A;  4CUP A;  4QEU A;  3PMT A;  4O7B A;  3ME9 A;  4F3I A;  5I80 A;  4NXJ A;  4PCI A;  5EWV A;  5L98 A;  2G3R A;  3O33 A;  2D9E A;  3DB3 A;  3UV5 A;  4YYH A;  4TQN A;  2WP1 A;  5A5O A;  1JSP B;  3C4S A;  4A9M A;  5C6S A;  2LCC A;  4ALG A;  1X0J A;  5FG4 A;  2YEK A;  2HQX A;  3MP8 A;  4YBM A;  3Q1J A;  2O4X B;  4PCE A;  5ENG A;  5EWC A;  5FB0 A;  5IGM A;  5E3G A;  4QQ6 A;  4C66 A;  2E6N A;  4WIV A;  5DFD A;  5FE0 A;  2IG0 A;  5TCM A;  4TT2 A;  5HEL A;  5A7C A;  5G4S A;  4IOO A;  4DON A;  4QR4 A;  5DFC A;  5F1H A;  2RI3 A;  3DB4 A;  4C5G A;  5L8T A;  5HEM A;  3MB3 A;  4GY5 A;  3GG3 A;  4IR3 A;  3OYI A;  5D6Y A;  2L5E A;  5H1U A;  4YBT A;  3UWN A;  3L2R A;  5E7D A;  3NXB A;  5DLX A;  3O35 A;  2DIG A;  4IR5 A;  4QST A;  3LLR A;  2RFJ A;  4Q5W A;  5FE3 A;  1MHN A;  3MEV A;  4LRG A;  4Z1Q A;  5E9M A;  5EVA A;  5D0C A;  2RO1 A;  3U5K A;  4QBM A;  5C89 A;  5D6W A;  3DAI A;  3E9G A;  3L2Q A;  4IUR A;  4BD3 A;  4NR8 A;  4HBY A;  3OQ5 A;  2VYT A;  3OYJ A;  5LVR A;  4UYF A;  3O34 A;  1KHC A;  2RI2 A;  5F25 A;  5E9L A;  5FE4 A;  4X34 A;  4N4H A;  5CQ5 A;  3BDL A;  5EIS A;  2LRQ A;  5AMF A;  2EQM A;  5FG5 A;  3PFS A;  3ASK A;  5CU8 A;  4QYL A;  4BDZ A;  4QEV A;  4UYH A;  5EWD A;  1EQF A;  4NRB A;  3G0J A;  4E7K A;  5EM3 A;  4NR9 A;  3ZEH A;  2R10 A;  4BE1 A;  4NUC A;  4YYG A;  5CQ7 A;  4Z1S A;  4QZS A;  2L85 A;  5LJ0 A;  2R0V A;  4UIU A;  5CRZ A;  5CUG A;  5FE2 A;  5D3P A;  5I29 A;  3M9Q A;  5CQT A;  5EGU A;  5L99 A;  4KV4 A;  3MXF A;  4TZ2 A;  4QYD A;  3MUK A;  5FFW A;  3OYC A;  5I7Y A;  5ENI A;  4XY8 A;  3S3M A;  4LZR A;  2YQD A;  4CFL A;  3FEO A;  4BW4 A;  4MR5 A;  2YEL A;  3FKM X;  4XYA A;  5IGN A;  3OYG A;  3NTK A;  4HCZ A;  3OB9 A;  4OGJ A;  4OVA A;  4Y03 A;  3OYH A;  5II1 A;  5CY9 A;  2D9T A;  4QC1 A;  3NTH A;  3ZYU A;  3UVY A;  5HQ5 A;  3U5M A;  5KE3 A;  5DYX A;  2R0S A;  4N4I A;  4J0S A;  5DYU A;  4MR4 A;  3S92 A;  2L84 A;  4O7A A;  5D3H A;  3U5L A;  5A82 A;  5FRO A;  4TYL A;  4TTE A;  3P5O A;  5EWH A;  5F61 A;  3E9F A;  5LKT A;  4L59 A;  3P8H A;  4QW2 A;  4BDY A;  5ENJ A;  5DLZ A;  5CQ8 A;  4ZTF A;  2N9G A;  2PQW A;  5F36 A;  3UT1 A;  5CS8 A;  5H85 A;  1WUG A;  5EK9 A;  4QEW A;  5FE6 A;  5LJ1 A;  2EQU A;  3OYB A;  3QZV A;  4QQG A;  5FE1 A;  3U5O A;  5A5S A;  3RCW A;  4TT4 A;  5CUD A;  4LZ2 A;  5LVQ A;  4UIV A;  5HQ6 A;  5F3A A;  4Z02 A;  2RHU A;  3UVD A;  3QII A;  4X2I A;  2NXB A;  4CUR A;  2NLU A;  5I83 A;  5KE2 A;  3QJ6 A;  5K29 A;  5IAY A;  2FSA A;  1OZ3 A;  3OYN A;  4QVZ A;  5CQ4 A;  4NYW A;  5CQ3 A;  5E9K A;  3MP6 A;  5F63 A;  2QQR A;  4HXS A;  5DYA A;  3OS2 A;  4RG2 A;  3MEW A;  3FDR A;  4YYI A;  2FHD A;  2X4W A;  3S6W A;  4CLB A;  5I40 A;  3LJW A;  5IBN A;  2LVM A;  3P8D A;  2H60 A;  5IGL A;  1OYX A;  4IKF A;  5FH8 A;  4CRI A;  5ENH A;  5HRW A;  5C0M A;  3S3O A;  4IR6 A;  2D82 A;  3H6Z A;  1G5V A;  5D3J A;  4BAC A;  5CUC A;  4J3I A;  4O7F A;  4A9K A;  4E7L A;  3MET A;  4QY4 A;  3LGL A;  5E73 A;  4YAT A;  3SVG A;  3P1F A;  3QZS A;  5FG6 A;  4FL6 A;  1XNI A;  5IID A;  3O36 A;  4XUB A;  5HM0 A;  5EU1 A;  5EPS A;  5KTU A;  4NQM A;  4NS5 A;  5CUB A;  2RHX A;  5CZG A;  3AQA A;  5C8G A;  5HFQ A;  4AKN A;  5C7N A;  4B9W A;  2F5K A;  4A4F A;  4CUS A;  5H1T A;  4CFK A;  5AME A;  4QSV A;  4QR5 A;  2M16 A;  2MJV B;  3U5J A;  4WHW A;  4C5I A;  4IUT A;  4II1 A;  3D7C A;  1WUM A;  3LXJ A;  4NR5 A;  4RVR A;  4YYN A;  2L3R A;  3QKJ A;  4QC3 A;  4UIY A;  5HFR A;  2R5A A;  4NYX A;  5ACY A;  4LYI A;  2XDP A;  5D25 A;  5AD3 A;  3LYI A;  4CUQ A;  2K3X A;  2QQS A;  3OMC A;  4TU4 A;  3AAD A;  4O7E A;  5ENB A;  2RS9 B;  2E5Q A;  4ZTJ A;  4O77 A;  3MQM A;  3P1D A;  5I89 A;  5I86 A;  2DWW A;  3UV4 A;  4HBW A;  3HMH A;  5HEN A;  4Z93 A;  4HXR A;  1WJR A;  3OY9 A;  4J0R A;  4PS5 A;  4E7J A;  2L89 A;  5HJC A;  4A9I A;  2E7O A;  4PL6 A;  4PLI A;  5FH6 A;  5J26 A;  3OS0 A;  5ENC A;  4YYJ A;  2EFI A;  4E7H A;  3SVF A;  3LQJ A;  5DFB A;  5L97 A;  5KU3 A;  3FC3 A;  3JVL A;  4LZS A;  4QSW A;  4IUU A;  2I8N A;  4YYK A;  4C5H A;  4UYF B;  3U5P A;  5ENE A;  2EQK A;  5IG6 A;  2YW5 A;  4OUF A;  3MEA A;  3UW9 A;  5II2 A;  3JVJ A;  4UYE A;  2RO0 A;  5LKU A;  5CP5 A;  1N27 A;  4NR7 A;  4FLP A;  3KUF A;  5E3D A;  5FH7 A;  4YYM A;  4FU6 A;  3K2J A;  4Q0N A;  4N3W A;  4UYG A;  5DW1 A;  2OUO A;  4NR6 A;  3OYA A;  5I7X A;  4UIX A;  3I3J A;  3LX7 A;  2M0O A;  2GF7 A;  4GPJ A;  5CPE A;  2RHY A;  5CQA A;  4NRA A;  4CUT A;  5D3R A;  4QB3 A;  3HMF A;  3L42 A;  3UVW A;  5LKX A;  4XUA A;  4Z6H A;  4IUV A;  5FB1 A;  4E7I A;  4UC4 A;  5I1Q A;  3TLP A;  5E9Y A;  2O4X A;  4HXP A;  5A83 A;  5EIC A;  5G4R A;  2RJE A;  4QR3 A;  4A4H A;  3LH0 A;  4UIW A;  5FBX A;  3IU6 A;  5IGK A;  4A9H A;  5DKC A;  5LUU A;  1WJQ A;  4QNS A;  5D24 A;  5EA1 A;  3F70 A;  5EPB A;  4J1P A;  4A9J A;  4ZW1 A;  4QSQ A;  2R0Y A;  4YK0 A;  4YAD A;  2WP2 A;  4A4E A;  5FE5 A;  4BE0 A;  4ALH A;  5D6X A;  3O8V A;  4LYW A;  4LDF A;  4A9N A;  3MP1 A;  5KCH A;  4HXN A;  2DKW A;  3Q2E A;  4LR6 A;  4HXO A;  5A5N A;  3ONI A;  2BUD A;  4A4G A;  5DKD A;  2DIQ A;  5L8U A;  3PNW C;  3OYE A;  5EP7 A;  4O76 A;  3MB4 A;  5LKZ A;  4MR3 A;  5L96 A;  3OYL A;  4PKL A;  5D7X A;  2DVR A;  4UIT A;  4YY6 A;  3LQH A;  4YH3 A;  4HBV A;  5FE9 A;  4LC2 A;  5BT4 A;  3PMI A;  3DWY A;  4LD6 A;  4BW1 A;  2I7K A;  4O74 A;  5ENF A;  4A9F A;  5A85 A;  5KTW A;  5FFY A;  5D3L A;  5IN1 A;  4N4G A;  5CTL A;  3P1E A;  4PLL A;  5D3N A;  5CUE A;  4QUU A;  3L2U A;  4EDU A;  4NRC A;  4N4F A;  4Q0O A;  5C85 A;  4ZC9 A;  4A9L A;  2RNW A;  5AD2 A;  5BT5 A;  3MEU A;  3MUL A;  5F1L A;  3LGF A;  2E7N A;  3P1C A;  2R57 A;  3OA6 A;  4YAX A;  3HME A;  5HRX A;  4NYV A;  4BHW A;  4QSX A;  2JZ2 A;  3OYD A;  3NTI A;  3H8Z A;  2HQE A;  2DAQ A;  2RJD A;  2X4X A;  4BJX A;  2BIV A;  5HQ7 A;  5EI4 A;  5DW2 A;  4UYD A;  5LJ2 A;  4UIZ A;  4XY9 A;  5KO4 A;  2LDM A;  2RHZ A;  5CGP A;  5EPR A;  4QSR A;  5I88 A;  4A9O A;  2EKO A;  5ETD A;  5E74 A;  5E9V A;  4QSS A;  3DLM A;  5CQ6 A;  3O37 A;  4NQN A;  2BKD N;  4A9E A;  5KHM A;  5HCL A;  3MO8 A;  3OYM A;  4C67 A;  4QSU A;  4WHU A;  4O75 A;  2DVV A;  5A5P A;  2MWP A;  2RHI A;  5F5Z A;  1N72 A;  3L2V A;  2DAT A;  4YBS A;  1H3Z A;  4TU6 A;  5DYC A;  4ZQL A;  4KCX A;  4TS8 A;  4O70 A;  2LTO A;  5CIU A;  2YEM A;  4C5E A;  3OYF A;  4IR4 A;  2R58 A;  5C4Q A;  3EAE A;  2GRC A;  5EWW A;  5DX4 A;  4PY6 A;  4MEP A;  4HBX A;  1JM4 B;  5JI8 A;  5F62 A;  4O78 A;  4O71 A;  5JWM A;  5KTX A;  2X4Y A;  3CEY A;  3S91 A;  5J0D A;  4NUD A;  3UV2 A;  4BW3 A;  4E96 A;  3JVK A;  2RNY A;  5FE8 A;  1OI1 A;  4IOQ A;  2B8A A;  2M1H A;  2WAC A;  4QUT A;  5DY7 A;  4CUU A;  4YY4 A;  4HXL A;  2G4A A;  4PTB A;  2RNX A;  5HLS A;  4O7C A;  1OZ2 A;  2RJF A;  5M9O A;  2YYN A;  2P0K A;  2X35 A;  3Q2F A;  4YH4 A;  2DVQ A;  3FLG A;  4IUQ A;  5DBM A;  4CL9 A;  4TT6 A;  5E0R A;  4O72 A;  2OSS A;  5DKH A;  2EQJ A;  3S3N A;  4TZ8 A;  5CRM A;  3IU5 A;  2MWO A;  3G0L A;  4MR6 A;  1RI0 A;  2RJC A;  5D26 A;  5A81 A;  5F2P A;  1WJS A;  2CKK A;  1F68 A;  2K3Y A;  3L2W A;  2RI5 A;  4QSP A;  5A5R A;  2F6N A;  5J39 A;  2R5M A;  2LSP B;  5FDZ A;  5H1V A;  3SVH A;  5FRN A;  4YAB A;  3JVM A;  5EQ1 A;  5E9I A;  2DVS A;  1SSF A;  2E3K A;  2GFU A;  5TB6 A;  4B9X A;  2GFA A;  4HXM A;  4NR4 A;  2YDW A;  4HXK A;  5F60 A; 
#chains in the Genus database with same CATH topology
 1QVF A;  3UVX A;  1Q82 R;  4BE2 A;  4A63 B;  4JJD A;  4JUV A;  4RTW A;  3LWH A;  1WXT A;  1VQ5 Q;  1ZSZ A;  3M0U A;  4NUE A;  1Q95 G;  5KCO A;  1I8F A;  4LYS A;  1Q82 C;  4MEO A;  1T0J A;  2O31 A;  3GNF B;  5A0G A;  3G7Z A;  4C8Q A;  3JAM E;  4AFQ C;  1KK7 A;  2CS7 A;  1KHI A;  2JS0 A;  4IOR A;  3CCR A;  5EG2 A;  2GTO A;  2JTF A;  1ZS5 A;  3OW2 P;  8AT1 B;  1QP3 A;  2BZY A;  3AHU A;  5D3T A;  2K6D A;  5GAM g;  5GAN d;  3RIR A;  5BT3 A;  1RLQ C;  5FFV A;  4C92 G;  4KV1 A;  1RUW A;  2GNC A;  4M7D G;  4CUP A;  2EGA A;  4O7B A;  3D1D A;  3VS3 A;  4J7I A;  1Q81 U;  2HBP A;  1NJI C;  4PCI A;  2G3R A;  2JJ9 A;  1I5O B;  4LE9 A;  3JB9 F;  4TQN A;  3C4S A;  4AG2 C;  2O9S A;  2AHJ B;  2LCC A;  4ESR A;  7AT1 B;  2YEK A;  1TOV A;  2V8I A;  2BZX A;  1IRE B;  3OS1 A;  1M1K U;  3I5R A;  4C66 A;  2E6N A;  1U3O A;  4WIV A;  5DFD A;  3M56 A;  3CD6 T;  2IG0 A;  2NWM A;  2XG8 D;  4DOV A;  3D1B A;  2DE0 X;  4OMN A;  1X2Q A;  4DON A;  1VQO T;  2EYY A;  3VV0 A;  5F1H A;  2AKL A;  2RI3 A;  3DB4 A;  1BCO A;  4C5G A;  5L8T A;  1UUE A;  2M02 A;  2ED0 A;  1KC8 C;  1TUD A;  4DEY A;  3GNG A;  1T3S A;  3L2R A;  4HVV A;  3SB2 A;  4AT1 B;  3NXB A;  5DLX A;  5GAO r;  2JMA A;  3O35 A;  4MZT A;  3LLR A;  2RFJ A;  1M3B A;  2DL4 A;  1IHW A;  2PTK A;  4LRG A;  1Y0M A;  3VS0 A;  1JXM A;  2DZ9 A;  5LJ5 d;  3I5S A;  5D6W A;  1AZG B;  1QKX A;  2ZPB B;  1PD0 A;  4HT8 A;  2YWW A;  4XTX A;  4UYF A;  1UGS B;  2DEQ A;  3WVE B;  3C0C A;  3A5Z B;  1D1A A;  3BDL A;  4M78 D;  3QPH A;  1W1F A;  4FYV B;  4QVD A;  4FYY B;  4J6W A;  2K7A A;  3CC4 A;  3CCE Q;  4NRB A;  3X26 B;  4E7K A;  4NR9 A;  1Q86 U;  5I11 A;  2CRE A;  4BE1 A;  2V8K A;  2RQT A;  5CQ7 A;  2CP6 A;  1QCF A;  5LJ0 A;  4UIU A;  5CUG A;  3A8G B;  5D3P A;  1AVZ C;  2HQH A;  3OYC A;  3EFS A;  2RF0 A;  2PUK B;  1XOV A;  3M0R A;  4OB1 B;  1VQ9 A;  2E1H A;  1ZKR A;  2V26 A;  3RKY A;  4BUG A;  2YEL A;  1EFN A;  2EWN A;  4V2S A;  4F7U B;  2VGN A;  2Z0W A;  4HCZ A;  4OGJ A;  4C0F A;  4J9H A;  4KT0 E;  2QA4 A;  2VB6 A;  3OYH A;  2D9T A;  3EHQ A;  3NTH A;  3ZYU A;  3RDV A;  3U5M A;  2R0S A;  5DYU A;  4MR4 A;  3GP8 A;  4EMK A;  5A82 A;  2QYZ A;  3I56 Q;  4TTE A;  3E9F A;  3RMQ A;  5GAN h;  1FYN A;  1ZQ1 A;  4BDY A;  4LNP A;  4EIK A;  2L3S A;  2K57 A;  2IVW A;  4ZTF A;  1VQM Q;  1VQ8 T;  2PQW A;  1VQP Q;  3UT1 A;  1K73 U;  5CS8 A;  3HKS A;  5GAO m;  2EQU A;  4QEW A;  3OYB A;  2QEX Q;  5FLX E;  3U5O A;  4TT4 A;  5LVQ A;  3PIP A;  4UIV A;  5F3A A;  1MMG A;  5HY6 A;  3TRE A;  3CCL Q;  2V8J A;  4J9D A;  1ZX6 A;  3M55 A;  5KE2 A;  5K29 A;  1TUG B;  1OZ3 A;  2LP5 A;  4NYW A;  5CQ3 A;  4M78 B;  4IIO A;  2QQR A;  4HXS A;  2FZK B;  1AEY A;  1M9S A;  4M75 G;  4Z88 A;  1ZA2 B;  3S6W A;  5KYW A;  3LJW A;  1MMA A;  3X25 B;  3P8D A;  4M7A D;  3CCL A;  5LJ3 h;  5EC7 A;  2DVE A;  5HRW A;  3SDZ A;  2CZ0 B;  1IXD A;  4IR6 A;  2D82 A;  2KNB B;  3JB9 D;  1G5V A;  3EG9 A;  4BAC A;  1Y96 A;  2QG9 B;  1W2B S;  4J3I A;  2DLP A;  1NEG A;  3V8K A;  4O7F A;  2KMT A;  1B34 B;  4E7L A;  3MET A;  3HRT A;  1KD1 C;  4O6J A;  3REA B;  5CQX A;  3I56 A;  2JTE A;  4BI4 A;  2E4H A;  4P5N A;  4C0D C;  3WXM B;  1AD5 A;  1YJN A;  1JEG A;  1RAF B;  2OAW A;  1O9S A;  2MJV B;  4OGE A;  4MDX A;  3HRU A;  2DJZ A;  4IUT A;  3BE3 A;  5L23 A;  1PG5 B;  4RVR A;  2P4R A;  1RL2 A;  2K5F A;  2EGE A;  4NYX A;  5ACY A;  3V8J A;  5LJ5 g;  2KT1 A;  2CZ1 B;  4LYI A;  3CCS Q;  4PJO G;  1NPP A;  4AI6 A;  5D25 A;  5AD3 A;  2E65 A;  2JTM A;  2XDP A;  1B07 A;  4MML A;  3G6E A;  1YJN Q;  2B86 A;  1LPL A;  1N8R U;  1PKS A;  1Z9Q A;  1X6O A;  1NPR A;  3EG9 B;  1UHC A;  1M30 A;  1W2B P;  3UV4 A;  5KYY B;  4HBW A;  4F16 A;  4Z93 A;  4HXR A;  4O5V A;  2L89 A;  4R56 A;  2E7O A;  3M57 A;  4PLI A;  2CH4 W;  5ENC A;  1A0N B;  2DL5 A;  5GAM d;  5GAN g;  3LQJ A;  3SFM A;  4QSW A;  4M78 F;  4YYK A;  4JRQ A;  3A98 A;  3EFO B;  1VQL Q;  4PJO E;  3QJY A;  4UYE A;  1NLP C;  1I1J A;  1VQK T;  2HAX A;  2OUO A;  4E47 A;  3G4S Q;  3LX7 A;  1QWE A;  1VYV A;  4GPJ A;  5CQA A;  5AYF A;  2H3E B;  2L0A A;  2DNU A;  4QB3 A;  2DZC A;  4LDU A;  3L42 A;  2XMF A;  2F69 A;  2DK3 A;  2ABL A;  1YI2 A;  5EIC A;  5G4R A;  2RJE A;  3VS4 A;  4A4H A;  2JM9 A;  4UIW A;  4A9H A;  3TVT A;  4RG8 A;  1KQS P;  1QP2 A;  2CDT A;  5GMK h;  4J1P A;  3CBO A;  4EMH A;  4M78 A;  4ZW1 A;  3EG0 A;  3M58 A;  4XU2 A;  4MZP A;  1QCO A;  2F5T X;  3UDC A;  2R0Y A;  4EMG A;  2K4Y A;  2OTJ T;  5FE5 A;  2K9G A;  4ALH A;  3O8V A;  5DM7 R;  3E19 A;  2X3X D;  5KYN A;  2KVQ G;  5A5N A;  2YUQ A;  5DKD A;  3VKH A;  4PFZ A;  5EP7 A;  4C8Q G;  4MR3 A;  5L96 A;  5CR2 A;  1VQP T;  1CSK A;  4LC2 A;  5LJ3 g;  5BT4 A;  1FMW A;  4DOW A;  2CZ6 B;  2I7K A;  3GLX A;  4O74 A;  1G3S A;  5FFY A;  5CTL A;  1YIT Q;  4M77 G;  4PLL A;  1GRI A;  2DF6 A;  4N4F A;  1K8A R;  3QSU A;  1XTD A;  1PD1 A;  3MUL A;  2E7N A;  2LC4 A;  3JRZ A;  5HRX A;  1OX9 A;  1QVF S;  4Y28 E;  1PSF A;  3OYD A;  3NTI A;  3H8Z A;  2HQE A;  4BJX A;  3JCM b;  2FO0 A;  4RTY A;  4UYD A;  1W70 A;  1Y07 A;  1I0C A;  2RHZ A;  2HL5 C;  3N5B B;  4ATO A;  4XU1 A;  1M2V A;  2ZPH B;  4QSR A;  2KQW A;  4M7A E;  4A9O A;  2DYB A;  3DLM A;  3I9Q A;  2BKD N;  4A9E A;  5HCL A;  2EVR A;  2CYZ B;  3HFO A;  2VWF A;  3D7S B;  1K4U S;  4TU6 A;  4JJC A;  3TU4 K;  4C5E A;  2X51 A;  4C8Q D;  1FMK A;  1BCM A;  1G2B A;  5IHN A;  3CCE A;  4PY6 A;  1VQM T;  3AT1 B;  1JM4 B;  5DY9 A;  1LOJ A;  5JWM A;  2JT4 A;  3RER A;  1WX6 A;  4M75 A;  3CCQ A;  1QMC A;  4NUD A;  1WPY A;  4E96 A;  4BW3 A;  5FE8 A;  2K3B A;  4M7A C;  4LXC A;  1Y96 B;  1T0H A;  4FYX B;  2RNX A;  5HLS A;  1HJD A;  4C8Q F;  5M9O A;  1B7T A;  3H9N A;  4J8O A;  2A7Y A;  2MMP A;  4IUQ A;  4YTL A;  2EQJ A;  3M54 A;  4TZ8 A;  1Y57 A;  1U06 A;  1RI0 A;  4J5Y A;  3E1S A;  1F68 A;  2K3Y A;  2KI7 A;  3CPW A;  2RI5 A;  1JQQ A;  5A5R A;  2F6N A;  3EFO A;  3PTA A;  3L2Z A;  2DET A;  5EQ1 A;  5TB6 A;  4HXK A;  4NR4 A;  1UE9 A;  3REB B;  2W0Z A;  3UF4 A;  4ANJ A;  2RI7 A;  1BIA A;  2F2W A;  2YT6 A;  3CC7 A;  4M75 E;  2ROT A;  4MEQ A;  2COY A;  3GOX A;  2QEX A;  2J6K A;  2DM1 A;  4YC9 A;  2OO1 A;  1E6I A;  2KTB B;  4MEN A;  1IRX A;  4MDW A;  1K1Z A;  2GQV A;  4HA8 A;  1GCP A;  5CUA A;  3EFR A;  3TQ7 P;  1QVG A;  5LJ3 j;  4MMK A;  3MJX A;  2EJF A;  2JNG A;  3L1A A;  5D3S A;  5FE7 A;  4DBQ A;  2F6J A;  5COI A;  1GFD A;  4QQD A;  2L8D A;  2KRS A;  4QEU A;  2KRM A;  4F3I A;  4NXJ A;  5IHI A;  1K9A A;  1YJ9 Q;  3DB3 A;  1YWP A;  3UV5 A;  4YYH A;  1BBZ A;  1X69 A;  2BTT A;  1NG2 A;  2FEI A;  5I22 A;  5HKC A;  4A9M A;  5C6S A;  3JV3 A;  5FG4 A;  2KY9 A;  2HD0 A;  4YBM A;  2E5K A;  1OQK A;  1RI9 A;  4PCE A;  2O4X B;  5EWC A;  3OYY A;  2ZPF B;  5GAO q;  1GXI E;  4DBR A;  1FX7 A;  3I55 Q;  1GBR A;  1M4Z A;  3M53 A;  2XHC A;  5HEL A;  5A7C A;  4PJO C;  1WHG A;  2LNV A;  1BKB A;  4RMO A;  4J9G A;  2DKG A;  3CCM A;  5HEM A;  3MB3 A;  3GG3 A;  1WDX A;  3OYI A;  2RPN A;  3A1P A;  5D6Y A;  3CCJ Q;  3G4S T;  2P84 A;  2L5E A;  2JM8 A;  5LJ3 e;  3CPW P;  4YBT A;  3UWN A;  3V7C A;  4QST A;  3VRY A;  4Z89 A;  2O2O A;  3CPW S;  3MEV A;  1VQ7 Q;  3CME A;  5D0C A;  2OTL Q;  2RO1 A;  2CUB A;  2M51 A;  1E7O A;  1GFC A;  3OYJ A;  1SRL A;  2KE9 A;  4QKU A;  3R6O A;  2JUF A;  5E9L A;  2DPP B;  2GTJ A;  2EAY A;  5CQ5 A;  1ACM B;  5EIS A;  1SHF A;  2LRQ A;  2LQN A;  1AWO A;  2EQM A;  1WIE A;  4HXJ A;  4QYL A;  1PSE A;  3EH1 A;  4BDZ A;  2KEA A;  3G0J A;  2LCL A;  5EM3 A;  3CCM Q;  4NUC A;  4YYG A;  1I4K 1;  1VQN Q;  3PVQ A;  1WLP B;  4XQ3 A;  2HNI A;  1YNZ A;  4L6V 5;  5L99 A;  3M0Q A;  4QYD A;  1ZLM A;  3MUK A;  1M3A A;  1RAB B;  2A3L A;  1IO6 A;  4XY8 A;  1AZE A;  3S3M A;  2AZV A;  5IH2 A;  2YQD A;  4CFL A;  5CKF A;  4CC7 A;  4BW4 A;  3NTK A;  3OB9 A;  1FMV A;  3G71 T;  5LJ5 e;  1K73 R;  4ELZ C;  2PUO B;  4FYW B;  2IIM A;  5GJV B;  3CCM T;  2CSQ A;  4M7D C;  4N4I A;  3VYH B;  5GMK i;  2X9H A;  1K0S A;  2L84 A;  5D3H A;  4HVU A;  5FRO A;  4TYL A;  4XTV A;  3SWN C;  2QA4 T;  3P8H A;  5GAN j;  4M77 C;  1ZBJ A;  5DLZ A;  1WQ7 A;  2OJ2 A;  2DFU A;  2RMO A;  4JS4 A;  1YJ9 A;  2XDB A;  1RAA B;  5FE6 A;  3C12 A;  3VRZ A;  3JCM g;  1V1C A;  1N9S A;  2A08 A;  3UVD A;  3QII A;  2MCN A;  1TSF A;  4AFZ C;  1GL5 A;  2GQI A;  1U5S A;  1HD3 A;  2DRM A;  4JZ4 A;  3OSS C;  1ZBX A;  2GCX A;  1G3T A;  5GAO n;  3OYN A;  4J7F A;  3CCL T;  1WHM A;  1ZSG A;  4C92 A;  3I55 A;  3CC2 Q;  3MEW A;  1D3B A;  3FDR A;  4YYI A;  4EMK B;  5I40 A;  4XTU A;  2RQV A;  1OYX A;  1EZZ B;  2FPD A;  2LX9 A;  3C94 A;  4XU3 A;  2F2X A;  2DMO A;  3S3O A;  3JCM c;  4DQ2 A;  4M75 F;  2MF2 A;  4AKH A;  4QY4 A;  1YJ9 T;  4ME7 A;  3SVG A;  4GLM A;  3THK A;  4F7U G;  3GPL A;  3QZS A;  3CMA A;  5A0L A;  2MIO A;  2P4T A;  5HM0 A;  3JB9 H;  5EPS A;  2RHX A;  4ZNX A;  4BI3 A;  3AQA A;  5C8G A;  2CZ7 B;  4B9W A;  2F5K A;  5H1T A;  4CFK A;  5GAO p;  3JB9 G;  1M1K R;  1C1A A;  4II1 A;  3D7C A;  2L3R A;  1WUM A;  4NR5 A;  4FW2 A;  5FWB A;  2LT1 A;  4QC3 A;  4UIY A;  3QKJ A;  1NM7 A;  4L5G A;  4DBF A;  4XK8 E;  1UG1 A;  1GBQ A;  2D8J A;  4CUQ A;  2K3X A;  2RD1 A;  4TU4 A;  2AT1 B;  3AAD A;  4J9B A;  5ENB A;  3NMZ C;  1MGQ A;  3UA7 A;  2E5Q A;  3RR6 A;  3P1D A;  1VQ4 A;  1R0B G;  4PJL A;  3CCE T;  2ATC B;  4PNO A;  4J0R A;  4CC3 A;  1R8O B;  1RAD B;  2YLB A;  3V7R A;  5J26 A;  2EFI A;  2MOX A;  3SVF A;  1TU0 B;  5L97 A;  3HP9 A;  5KU3 A;  3FC3 A;  3JVL A;  2FZC B;  2RH2 A;  1UGR B;  4IUU A;  3U5P A;  4OMF B;  5IG6 A;  4OUF A;  2VUB A;  2RO0 A;  2V1R A;  1BI1 A;  3P8B B;  2MYS A;  1KD1 R;  2J6F A;  2OTL T;  1D09 B;  1UTI A;  1VIF A;  1NZ9 A;  1ZA1 B;  1AWX A;  3X20 B;  4FLP A;  1GCQ A;  1OU9 A;  5FH7 A;  3CCQ Q;  3K2J A;  2NUP B;  5DLO A;  3OYA A;  1M1F A;  2JN0 A;  3EG3 A;  2O9V A;  2E3I A;  1H92 A;  2RHY A;  4KGZ B;  1PRM C;  1KQS S;  4R0K A;  3VS6 A;  1B34 A;  5A2Q E;  3CPF A;  3UVW A;  2JOY A;  4XUA A;  1VQ4 T;  1VQO Q;  4UC4 A;  1HK9 A;  5DLQ E;  3SEM A;  5A83 A;  3HRS A;  1C0M A;  1M27 C;  2DX1 A;  3IU6 A;  2ZPI B;  4FSS A;  2HBW A;  2DXB A;  1BB9 A;  1WJQ A;  2JXB A;  5D24 A;  1D1C A;  5I2M A;  1MNE A;  3F70 A;  2FYK A;  1PCX A;  4A9J A;  4AG1 C;  2XKO C;  4M7D B;  1WXB A;  2LJ1 A;  4C92 B;  2RM4 A;  2VXF A;  4M75 D;  2RNA A;  3FJ5 A;  2EBP A;  2KBT A;  1NYG A;  1AWW A;  2KDS A;  4LYW A;  5GMK l;  3CC2 A;  4LDF A;  2M9U A;  4A9N A;  2QAS A;  1M5Q 1;  3QDF A;  2DKW A;  2L5Q A;  4LR6 A;  1CKA A;  3ONI A;  2BUD A;  2MK5 A;  2KGT A;  4E2F B;  2YUP A;  1PC0 A;  4RTT A;  3OYE A;  1D0Y A;  2SEM A;  3OYL A;  2PVG B;  4PKL A;  2DVR A;  3LQH A;  4HBV A;  1QVG S;  2JMC A;  3OS5 A;  1N5Z A;  5A85 A;  5KTW A;  3CQT A;  2DEU A;  2DER A;  4FCY A;  5D3N A;  1VQP A;  2LQ8 A;  4EDU A;  4NRC A;  4Q0O A;  1OUL A;  1VQN A;  1VIE A;  5AD2 A;  5BT5 A;  5F1L A;  1Z9Z A;  5GAN e;  3OA6 A;  4YAX A;  1KQ1 A;  2OTJ A;  1VUB A;  2RJD A;  1SPK A;  2BIV A;  2EKH A;  1ABQ A;  4RTU A;  2JW4 A;  4XY9 A;  5KO4 A;  2LDM A;  3DLL A;  2EGC A;  1PKT A;  3CC7 T;  5IHK A;  2MAM A;  3CCU A;  2CP7 A;  3EG2 A;  5CKB A;  5I88 A;  2FRW A;  2EKO A;  2CUD A;  4M7A B;  5E74 A;  5E9V A;  5CQ6 A;  3IQL A;  4XTY A;  1NE8 A;  4NQN A;  5KHM A;  2DBK A;  3OYM A;  4C67 A;  4QSU A;  4X1V A;  1VQ8 A;  2MWP A;  5GAN 2;  2RHI A;  5L8R E;  5F5Z A;  5GAM j;  3L2V A;  4FSX A;  2EIF A;  5GAM h;  5I2S A;  4ZQL A;  1VQ6 T;  4KCX A;  5KYX A;  4TS8 A;  4M77 F;  5CIU A;  2YEM A;  2R58 A;  5C4Q A;  1SF9 A;  2Y90 A;  4RCB A;  1VQ4 Q;  1VQK A;  2LJ0 A;  3WVD B;  2MPX C;  1UDL A;  3QYG B;  5JI8 A;  2AIR B;  3R6N A;  4O78 A;  2DBM A;  1G8X A;  3S91 A;  5J0D A;  3A8H B;  2OX7 A;  2M1H A;  5CVI A;  2B8A A;  5DY7 A;  3CCQ T;  1OZ2 A;  1TTH B;  2X35 A;  4RUG A;  3Q2F A;  4DA4 A;  1LVK A;  3FLG A;  1R77 A;  5DBM A;  1KG1 A;  2LX7 A;  2CP2 A;  1BIB A;  5E0R A;  3BW1 A;  2LNH B;  4CI0 C;  5DKH A;  1CKB A;  3IU5 A;  2MWO A;  4MR6 A;  4JLI A;  4RTX A;  2HKN A;  3HFN A;  5A81 A;  1N9R A;  4FM4 B;  3L2W A;  1EIF A;  2YXY A;  1P92 A;  2EYX A;  3QZ9 B;  3TCJ A;  5J39 A;  5H1V A;  1X6G A;  1WHJ A;  3UA6 A;  1VOM A;  2GFU A;  1YHQ A;  2O88 A;  2QDY B;  2GFA A;  3PVL A;  4RTV A;  5KH6 A;  5F60 A;  1WGS A;  2XD0 A;  4C92 E;  3ZL7 C;  3U5N A;  3MHX A;  4FW1 A;  5ETB A;  5C87 A;  2KYB A;  5CFW A;  2YUN A;  1ZUU A;  1M1G A;  1YHQ T;  3PGG A;  3RBB B;  5HRV A;  2I2L A;  4AFU C;  2DRK A;  1YWO A;  3QBY A;  3SD4 A;  3CMA T;  3CCV A;  4M7A F;  2VKN A;  4J9I A;  3QO3 A;  2D0N A;  3JCM h;  1VA7 A;  4PJO A;  4J6Y A;  2RQW A;  1O75 A;  2XK0 A;  4FIB A;  1QCN A;  5GJW B;  4JZ3 A;  1N6A A;  2MI6 A;  4IUP A;  5FRM A;  1YHQ Q;  3ME9 A;  1W4S A;  3KFV A;  3VJP A;  1OPL A;  3FJP A;  4OF1 A;  2XU8 A;  5EWV A;  5L98 A;  4C92 C;  3O33 A;  2D9E A;  3PIO A;  1EX4 A;  4GLK A;  1JSP B;  2PVD B;  2NUP A;  1X0J A;  1SRM A;  2HQX A;  3MP8 A;  3FIF A;  2DL8 A;  4HKE A;  5E3G A;  1IGQ A;  2NYS A;  3CCV Q;  4KUI A;  5TCM A;  4TT2 A;  1HXD A;  3BY7 A;  2YHT A;  4E7Z A;  1D3B B;  5G4S A;  4IOO A;  4QR4 A;  3HPW A;  2QTX A;  1GCQ C;  3NGP A;  4IR3 A;  5LJ3 d;  5CCA A;  1VQ6 A;  4F7U E;  4OB3 B;  4CC4 B;  4OMQ A;  3NFC A;  1YCS B;  2ECZ A;  2JS2 A;  2QQ9 A;  1VQK Q;  1W6X A;  5E7D A;  2ZGW A;  2F2V A;  2DIG A;  2DXU A;  4Q5W A;  5FE3 A;  1N8R C;  2L2P A;  5GAN 4;  1YBY A;  1K0X A;  4Z1Q A;  1UEC A;  5E9M A;  5EVA A;  2Y4Y A;  3U5K A;  4QBM A;  5C89 A;  1PHT A;  3E9G A;  4IUR A;  2ZPG B;  1VQ8 Q;  3OQ5 A;  2VYT A;  3O34 A;  4ZGD B;  4KH1 B;  5GMK m;  2DD4 A;  1ARK A;  5FE4 A;  1QQJ A;  5AMF A;  1H3H A;  3QYH B;  3ASK A;  5CU8 A;  2QAZ A;  4PFP A;  3M59 A;  4UYH A;  5EWD A;  1EQF A;  4X9C A;  3ZEH A;  2R10 A;  3HHT B;  3CCR Q;  3QZ5 B;  3G71 Q;  3JSC A;  1YN8 A;  2L85 A;  3LH5 A;  1X6B A;  2BE9 B;  2R0V A;  4XTZ A;  5CRZ A;  3SWN B;  3M9Q A;  1QKW A;  5EGU A;  1BI3 A;  3MXF A;  1K73 C;  5FFW A;  1MMN A;  5KYW B;  5I7Y A;  1D0X A;  4LZR A;  2RK1 A;  4MR5 A;  2E10 A;  5I21 A;  3FKM X;  4XYA A;  2FPE A;  2EYZ A;  3OYG A;  2ROL A;  4OVA A;  5II1 A;  5CY9 A;  4M7A A;  4QC1 A;  2VXE A;  5HQ5 A;  5LJ5 f;  3S92 A;  1PNJ A;  2FZG B;  5GAM f;  5HK3 A;  4WCI A;  3U5L A;  3CXC S;  5EWH A;  2E64 A;  5F61 A;  3A8O B;  5LKT A;  4L59 A;  4JS5 A;  4QW2 A;  2FG0 A;  3EH2 A;  2N9G A;  3RKX A;  5F36 A;  1WUG A;  5LJ1 A;  2DL3 A;  3QZV A;  4QQG A;  5FE1 A;  4EPC A;  1VQO A;  4Z02 A;  2LJ3 A;  2V1Q A;  1LNX A;  4X2I A;  1Q86 C;  4CUR A;  1QVP A;  2NLU A;  1M8V A;  3QJ6 A;  3CCJ T;  5IAY A;  2FSA A;  5CQ4 A;  3MP6 A;  2FL7 A;  5E9K A;  4C0D B;  3OS2 A;  5GAN 7;  3ZFJ A;  4RG2 A;  1TG0 A;  2AZS A;  1YIT A;  2LVM A;  2H60 A;  1YP5 A;  5IGL A;  2QEX T;  2LQW A;  2I0N A;  2EQI A;  1JO8 A;  5ENH A;  1VQL A;  2GGR A;  3H6Z A;  3U23 A;  1KQS A;  5D3J A;  1WNL A;  1JRI A;  4C8Q C;  4A9K A;  4Z8A A;  2NUZ A;  4YAT A;  1YI2 T;  5FG6 A;  2DA9 A;  5IID A;  1K8A U;  4NQM A;  3QWY A;  5CZG A;  3H0H A;  2O01 E;  2KRO A;  4DBH A;  4AKN A;  1WHK A;  3CCU T;  3RES A;  5AME A;  4QSV A;  4QR5 A;  1RAI B;  1TWB A;  2KR3 A;  4WHW A;  4F7U F;  4C5I A;  2L3Q A;  4YYN A;  5GAN 3;  2R5A A;  5HFR A;  1M1K C;  1QW1 A;  1H8K A;  2BE7 D;  3JCM d;  2P0P A;  2H8H A;  3OMC A;  3TSW A;  4C8Q E;  3OW2 A;  9ATC B;  1VQ9 T;  2RS9 B;  2HMA A;  4ZTJ A;  1NJI U;  2COZ A;  2DWW A;  3GBQ A;  4GBQ A;  3G4S A;  1C6V X;  1YJW Q;  4J9F A;  1WJR A;  4PS5 A;  4JDS A;  5HJC A;  2QTV A;  2D0Q B;  1KC8 U;  4PL6 A;  2HDA A;  1E6H A;  5FH6 A;  4TVR A;  2DD5 A;  3OS0 A;  4E7H A;  2C0O A;  5GAN 6;  4A53 A;  5DFB A;  1JJ2 A;  2AK5 A;  5FU7 C;  4UYF B;  2EQK A;  5FU6 C;  2YW5 A;  2CP0 A;  4OML A;  1WQW A;  5II2 A;  1AOJ A;  3JVJ A;  3QUI A;  1ZUK A;  1KJW A;  1WHL A;  4NR7 A;  5CO7 A;  1UGQ B;  2K5I A;  4M77 A;  1VQM A;  4K11 A;  4YYM A;  4FU6 A;  2IPO B;  4N3W A;  2EJG A;  4UYG A;  4D8D A;  4NR6 A;  5I7X A;  1D0Z A;  4PK4 A;  2M0O A;  1N8R R;  4C92 F;  4NRA A;  4CUT A;  5D3R A;  4ORZ A;  1YJW A;  4IUV A;  4JRP A;  4E7I A;  1QVF P;  5E9Y A;  2O4X A;  4HXP A;  4VUB A;  3T9N A;  5FBX A;  5IGK A;  4KRT A;  4HVW A;  3CC2 T;  5GMK j;  4MZM A;  5EA1 A;  3EG1 A;  5EPB A;  2D1X A;  2YLC A;  4YK0 A;  1HYO A;  1E6G A;  3OBY A;  4BE0 A;  2VC8 A;  2QDL A;  3CBP A;  4ZGE B;  5KCH A;  1JJ2 P;  3Q2E A;  2DJQ A;  3ER0 A;  2AKK A;  4A4G A;  2DIQ A;  1VYU A;  5L8U A;  1UEB A;  4O76 A;  2GBQ A;  5LKZ A;  4J9C A;  5CQY A;  5IXB A;  2COW A;  1Y7X A;  2EYQ A;  5KYU A;  2J7I A;  4OB2 B;  3DWY A;  2KAF A;  5LJ5 h;  2VAS A;  5D3L A;  5IN1 A;  4N4G A;  4LDY A;  5CUE A;  3VKG A;  1YI2 Q;  1I81 A;  2CT3 A;  4RCC A;  3CD6 A;  4JLG A;  4M7D D;  4ZGJ B;  1JJ2 S;  2HSP A;  2HEQ A;  3V7S A;  2RNW A;  2XI9 A;  3M5A A;  1NLO C;  4LDV A;  3LGF A;  3H0I A;  4AFS C;  1S72 A;  2HCK A;  4F17 A;  3G6E T;  6AT1 B;  4NYV A;  4BHW A;  4QSX A;  2JZ2 A;  4ELY C;  4HT9 A;  1LCK A;  4M77 B;  5HQ7 A;  4M77 E;  4OMP A;  4R55 A;  2ZAE A;  5FU6 B;  3VYG A;  2WSC E;  5LJ3 f;  3J81 E;  1BI2 A;  3CBM A;  3HSB A;  3C95 A;  4C8Q B;  4QSS A;  4N0A C;  2YUO A;  3CCR T;  3MO8 A;  4WHU A;  1OV3 A;  1KQ2 A;  3MPU B;  4YBS A;  2DL7 A;  1NBE B;  1H3Z A;  4PJO D;  3O5Z A;  2LQK A;  5DYC A;  1G3Y A;  2YDL A;  4O70 A;  3JCM P;  1X01 A;  3RKW A;  1WZO A;  3OYF A;  4IR4 A;  2K5L A;  3EAE A;  2GRC A;  5EWW A;  4MEP A;  1SEM A;  2X4Y A;  4D6W A;  2CGH A;  5HCK A;  3JVK A;  2RNY A;  2WAC A;  4DEX A;  4CUU A;  4PTB A;  4AKI A;  4O7C A;  2RJF A;  2YYN A;  4NL2 A;  2XID A;  2P0K A;  3NHN A;  2HL3 A;  3E2U A;  4YH4 A;  3GF5 A;  3VS1 A;  2DVQ A;  2QXF A;  2K2M A;  4CL9 A;  2ZCF B;  1OPK A;  5D7U A;  5LL6 S;  4O72 A;  2PZ1 A;  2QGF B;  2OSS A;  3S3N A;  5CRM A;  1VQL T;  2OAU A;  3MCA B;  5J3B A;  4QT7 A;  1XQH A;  3RNJ A;  5D26 A;  1WJS A;  5F2P A;  2CKK A;  4F04 B;  2NUT B;  3DKM A;  3CC4 T;  4QSP A;  1WHH A;  1VQ7 A;  3MKD A;  2LSP B;  1IB8 A;  3FRN A;  5FDZ A;  3SVH A;  1RAC B;  1WA7 A;  5A0D A;  3CCV T;  2KXC A;  5E9I A;  1FWZ A;  4CC2 A;  3G6E Q;  4HXM A;  3UAT A;  2YDW A;  3CCJ A;  4Z6I A;  4BW2 A;  4C92 D;  1HSQ A;  3QHS A;  1YJN T;  4LDW A;  5A5Q A;  4OGI A;  1T3L A;  2C0I A;  4M78 C;  3JCM Q;  4M7D F;  3LQI A;  3G71 A;  4HCC A;  1S72 T;  4HCK A;  2FRY A;  2YRV A;  1WXU A;  4YYD A;  3QZT A;  3OYK A;  5EV9 A;  1UJ0 A;  4PJO B;  1U1T A;  1J3T A;  4QVC A;  3M0T A;  3OMG A;  3CMA Q;  5GAN 5;  2ED1 A;  4E6R A;  1UB4 A;  3PMT A;  2WSE E;  4KGV B;  3I35 A;  5I80 A;  4XTW A;  1M90 U;  4HCB A;  2RN8 A;  3FB9 A;  5A5O A;  2WP1 A;  4PJO F;  4ALG A;  2X4J A;  3JCM X;  3PT9 A;  4KH0 B;  1Y71 A;  1X2K A;  4M78 E;  3Q1J A;  4QQ6 A;  5IGM A;  5ENG A;  5FE0 A;  1JU5 C;  1R0C B;  2PVO B;  3CXC A;  1IZ6 A;  2CP3 A;  2H3J A;  2CT4 A;  3EGX B;  2DXC A;  3X24 B;  1BYM A;  5DFC A;  4OMO A;  3M4Y A;  1QLY A;  4GY5 A;  4FT2 A;  2RQU A;  1G3W A;  4Y91 A;  5CKH A;  1KD1 U;  2L3P A;  5H1U A;  1OOT A;  4M75 B;  3VUB A;  4PJM A;  1KC8 R;  3JCM J;  2CSI A;  4M78 G;  3SHW A;  4IR5 A;  3BFM A;  5FWC A;  1MHN A;  3CXC P;  1JBM A;  3PE0 A;  1AT1 B;  2KYM A;  1Q86 R;  2XDD A;  3DAI A;  3L2Q A;  1X27 A;  1WYX A;  4NR8 A;  4BD3 A;  4HBY A;  2HSE B;  1KIK A;  2LT4 A;  5LVR A;  1RAE B;  1KHC A;  2DTH A;  3RMS A;  4KUD K;  1MV0 B;  2RI2 A;  1M2V B;  5F25 A;  3G1J A;  4X34 A;  4N4H A;  4A54 A;  3V8L A;  5KYX B;  1PM3 A;  5FG5 A;  2WSF E;  3PFS A;  2QK0 A;  4QEV A;  1Q7Y C;  4Y92 A;  1YJW T;  3JB9 I;  1K8A C;  1AWJ A;  5CAI A;  3VUZ A;  4WF2 A;  2DXT A;  1JB0 E;  2DYI A;  2K79 A;  1UGP B;  1SG5 A;  4Z1S A;  4QZS A;  5IT9 E;  1VQ9 Q;  1FXX A;  1M3C A;  5I29 A;  5FE2 A;  3INZ A;  1V29 B;  5CQT A;  4KV4 A;  4TZ2 A;  1SHG A;  1G83 A;  2P0Q A;  1YIJ T;  5ENI A;  1RAH B;  3CC7 Q;  2DO3 A;  2D8H A;  3FEO A;  2YRC A;  1AHJ B;  2K2V A;  4WTO B;  5IGN A;  3EGD A;  4NL3 A;  1VQ5 A;  3H41 A;  1D1B A;  1X75 C;  3CCU Q;  3J7A F;  4Y03 A;  1MUZ A;  5KE3 A;  3UVY A;  5DYX A;  2E3H A;  3H0F A;  4J0S A;  3KBG A;  4O7A A;  1OX8 A;  4JRI A;  2E6Z A;  2ZZD A;  3P5O A;  3OW2 S;  1ZUY A;  2OTL A;  5ENJ A;  5CQ8 A;  3TSZ A;  1WFW A;  2E41 A;  5H85 A;  4BY6 B;  5EK9 A;  4AKG A;  4AMC A;  5A5S A;  3RCW A;  5CUD A;  4LZ2 A;  5GMK e;  5HQ6 A;  1ZSZ C;  2RHU A;  2NXB A;  1VYT A;  1BU1 A;  1K76 A;  2OTJ Q;  1OEB A;  2CH4 A;  1QWF A;  5I83 A;  4J9E A;  4F7U A;  3VS7 A;  2OI3 A;  4QVZ A;  1ABO A;  2FPF A;  5F63 A;  3ULR B;  5DYA A;  1M8M A;  3URG A;  2LZ6 B;  2FHD A;  2X4W A;  1IGU A;  4CLB A;  4KUL A;  5IBN A;  1YCY A;  1PWT A;  2PNI A;  4IKF A;  3CD6 Q;  5FH8 A;  4CRI A;  4XAX B;  3ERR A;  5C0M A;  3QG1 A;  1PRL C;  1MV3 A;  2J06 A;  3LW5 E;  3QXE B;  3JCM V;  4LUE A;  3M0S A;  5CUC A;  2DVJ A;  3EHR A;  5HK0 A;  3LGL A;  5AT1 B;  5E73 A;  5GAO l;  3P1F A;  1U1S A;  4FL6 A;  1UFF A;  2X3W D;  3JB9 J;  1XNI A;  1YIT T;  3O36 A;  4XUB A;  1UGV A;  5EU1 A;  5KTU A;  4NS5 A;  5CUB A;  4PFO A;  4X9D A;  1Q7Y U;  4FT4 A;  1JXO A;  5FW9 A;  1UHF A;  1NJI R;  5HFQ A;  5C7N A;  2HKQ B;  2Y4X A;  4LD9 K;  4A4F A;  4CUS A;  1RLP C;  2RA2 A;  2LMJ A;  3OSV A;  2M16 A;  2VGM A;  3VU3 C;  4JJN K;  4B6M A;  3U5J A;  2C0T A;  3LXJ A;  1S72 Q;  2KSS A;  3EGX A;  1YIJ Q;  2ESW A;  3A8M B;  2DTI A;  3LYI A;  1U8R A;  3X28 B;  2D6F A;  2QQS A;  2EJN A;  1TS9 A;  4O7E A;  1VQ5 T;  4C0Z A;  1WI7 A;  1M90 C;  4O77 A;  4M75 C;  3MQM A;  5I89 A;  4OGC A;  5I86 A;  1YFN A;  2FB7 A;  3EGD B;  5KYY A;  1Q81 C;  3HMH A;  5HEN A;  1XJW B;  3OY9 A;  2VV5 A;  4E7J A;  4A9I A;  3HTR A;  4A4K A;  2QGG A;  3CCS T;  4YYJ A;  3J80 E;  2LCS A;  4XU0 A;  4LZS A;  1Q7Y R;  3JCM W;  2I8N A;  4C5H A;  4J83 A;  5ENE A;  3MEA A;  3UW9 A;  3JCM f;  2QQA A;  4OMM A;  2PU9 B;  5LKU A;  3M0P A;  4PKC C;  1Q82 U;  5CP5 A;  1N27 A;  5CKD A;  4BI8 B;  2HZY A;  2W10 A;  1B3Q A;  3KUF A;  1H64 1;  5E3D A;  2BZ8 A;  4PJJ A;  2C06 A;  4Q0N A;  2A0F B;  2KRN A;  1QVG P;  1KFZ A;  5DW1 A;  3LWI A;  4UIX A;  3I3J A;  2FVU A;  2GF7 A;  5CPE A;  3EGU A;  5GAM e;  1ZHI A;  3HMF A;  2EYW A;  3OBW A;  4ZN1 A;  1W2B A;  5LKX A;  4Z6H A;  5FB1 A;  5I1Q A;  3TLP A;  1OU8 A;  4LDX A;  4QR3 A;  2EJ9 A;  1MND A;  3LH0 A;  2NUT A;  5DKC A;  5LUU A;  4QNS A;  4IIM A;  4QSQ A;  2KT8 A;  4YAD A;  2RQR A;  2WP2 A;  4A4E A;  4OP0 A;  5D6X A;  5CK9 A;  4E7S A;  3CME Q;  3QWX X;  3MP1 A;  4D8K A;  4HXN A;  2QI2 A;  1V76 A;  4HXO A;  2G6F X;  4M4Z A;  1M90 R;  3PNW C;  3VKI A;  2SRC A;  3MB4 A;  1BI0 A;  3A8L B;  4YY6 A;  5D7X A;  4BY6 C;  4UIT A;  4YH3 A;  3HL8 A;  2A28 A;  5FE9 A;  2J6O A;  3PMI A;  4LD6 A;  5LJ5 j;  1M2O A;  1I07 A;  4BW1 A;  1K9M C;  4RTZ A;  3CCS A;  1ZSZ B;  5ENF A;  4A9F A;  1S1N A;  4PJN A;  3NPF A;  3P1E A;  1Q81 R;  4QUU A;  1TXQ A;  4JJB A;  2JVV A;  3BDU A;  3JCM e;  2E12 A;  3L2U A;  2YRD A;  3ZBD A;  5C85 A;  4ZC9 A;  4LUD A;  4A9L A;  1PUO A;  3MEU A;  4LN2 A;  3P1C A;  2R57 A;  4NOY A;  3HME A;  5KYU B;  2A36 A;  2X4X A;  2DAQ A;  1TUC A;  5EI4 A;  5DW2 A;  1K9M R;  1BK2 A;  5LJ2 A;  4UIZ A;  2KK4 A;  3CC4 Q;  1I5L A;  2QQB A;  1DJ7 B;  2A37 A;  3QDR B;  5CGP A;  3CME T;  5EPR A;  1NEB A;  1NYF A;  4BB7 A;  5ETD A;  1MMD A;  4M7D E;  1VQN T;  1UJY A;  3O37 A;  5A5P A;  4O75 A;  2DVV A;  1YIJ A;  2RK2 A;  4C0G A;  1N72 A;  2KXD A;  3M4G A;  4JPB W;  1K9M U;  2XIC A;  3VS5 A;  2J05 A;  2CP5 A;  1SSH A;  4J6X A;  2F1L A;  2LTO A;  2DTO A;  2EPD A;  5DX4 A;  1TH7 A;  5ECA A;  4HBX A;  3UPU A;  5F62 A;  5KTX A;  4O71 A;  3CEY A;  2M0Y A;  1KSW A;  3VS2 A;  3UV2 A;  3TEE A;  2QA4 Q;  1OI1 A;  4IOQ A;  3RUX A;  3I56 T;  1VQ6 Q;  4QUT A;  4YY4 A;  4KBM B;  4HXL A;  2G4A A;  1VQ7 T;  4M7A G;  4OB0 B;  5IXF A;  1X43 A;  4N0A A;  1IHV A;  8ATC B;  5GAN f;  2YSQ A;  4F14 A;  4ZN3 A;  1RAG B;  4RKU E;  4JRK A;  5GAN 8;  4TT6 A;  4M7D A;  2DIL A;  2ENM A;  2EW3 A;  1LJO A;  4EMK C;  3G0L A;  3KXT A;  2RJC A;  2ZPE B;  1SKU B;  2RB6 A;  5FU7 B;  2VVK A;  4KGX B;  3SWN A;  2R5M A;  5CKE A;  5FRN A;  3I55 T;  4YAB A;  3JVM A;  1F1B B;  2DVS A;  1SSF A;  2E3K A;  3GIB A;  4B9X A;  5FB0 A;  2E70 A;  4M77 D;  2DAT A; 
#chains in the Genus database with same CATH homology
 1QVF A;  3UVX A;  4BE2 A;  4JUV A;  3LWH A;  4NUE A;  5KCO A;  1I8F A;  4LYS A;  1Q82 C;  4MEO A;  3GNF B;  5A0G A;  3G7Z A;  4C8Q A;  3JAM E;  2CS7 A;  1KHI A;  4IOR A;  3CCR A;  5EG2 A;  2JTF A;  1ZS5 A;  1QP3 A;  3AHU A;  5D3T A;  5GAM g;  5GAN d;  3RIR A;  5BT3 A;  5FFV A;  4C92 G;  4KV1 A;  4M7D G;  4CUP A;  4O7B A;  4J7I A;  1Q81 U;  2HBP A;  1NJI C;  4PCI A;  2G3R A;  3JB9 F;  4TQN A;  3C4S A;  2AHJ B;  2LCC A;  2YEK A;  2V8I A;  1IRE B;  3OS1 A;  1M1K U;  4C66 A;  2E6N A;  4WIV A;  5DFD A;  3M56 A;  3CD6 T;  2IG0 A;  2XG8 D;  4DOV A;  4DON A;  1VQO T;  3VV0 A;  5F1H A;  2RI3 A;  3DB4 A;  4C5G A;  5L8T A;  1KC8 C;  3GNG A;  3L2R A;  3SB2 A;  3NXB A;  5DLX A;  5GAO r;  3O35 A;  4MZT A;  3LLR A;  2RFJ A;  4LRG A;  2DZ9 A;  5LJ5 d;  5D6W A;  2ZPB B;  4HT8 A;  4XTX A;  4UYF A;  1UGS B;  2DEQ A;  3WVE B;  3A5Z B;  3BDL A;  4M78 D;  3QPH A;  4QVD A;  4J6W A;  3CC4 A;  4NRB A;  3X26 B;  4E7K A;  4NR9 A;  1Q86 U;  4BE1 A;  2V8K A;  5CQ7 A;  5LJ0 A;  4UIU A;  5CUG A;  3A8G B;  5D3P A;  3OYC A;  3EFS A;  2PUK B;  1XOV A;  4OB1 B;  1VQ9 A;  2E1H A;  3RKY A;  4BUG A;  2YEL A;  2EWN A;  4V2S A;  4F7U B;  2VGN A;  4HCZ A;  4OGJ A;  4C0F A;  4KT0 E;  2QA4 A;  3OYH A;  2D9T A;  3NTH A;  3ZYU A;  3U5M A;  2R0S A;  5DYU A;  4MR4 A;  3GP8 A;  4EMK A;  5A82 A;  4TTE A;  3E9F A;  3RMQ A;  5GAN h;  1ZQ1 A;  4BDY A;  2K57 A;  2IVW A;  4ZTF A;  1VQ8 T;  2PQW A;  3UT1 A;  1K73 U;  5CS8 A;  3HKS A;  5GAO m;  2EQU A;  4QEW A;  3OYB A;  5FLX E;  3U5O A;  4TT4 A;  5LVQ A;  3PIP A;  4UIV A;  5F3A A;  5HY6 A;  3TRE A;  2V8J A;  3M55 A;  5KE2 A;  5K29 A;  1OZ3 A;  4NYW A;  5CQ3 A;  4M78 B;  2QQR A;  4HXS A;  1M9S A;  4M75 G;  3S6W A;  3LJW A;  3X25 B;  3P8D A;  4M7A D;  3CCL A;  5LJ3 h;  2DVE A;  5HRW A;  3SDZ A;  2CZ0 B;  4IR6 A;  2D82 A;  3JB9 D;  1G5V A;  4BAC A;  1Y96 A;  1W2B S;  4J3I A;  3V8K A;  4O7F A;  2KMT A;  1B34 B;  4E7L A;  3MET A;  3HRT A;  1KD1 C;  4O6J A;  5CQX A;  3I56 A;  4BI4 A;  4P5N A;  4C0D C;  3WXM B;  1YJN A;  1O9S A;  2MJV B;  4OGE A;  4MDX A;  3HRU A;  2DJZ A;  4IUT A;  4RVR A;  1RL2 A;  2K5F A;  4NYX A;  5ACY A;  3V8J A;  5LJ5 g;  2CZ1 B;  4LYI A;  4PJO G;  1NPP A;  2JTM A;  5D25 A;  5AD3 A;  2E65 A;  2XDP A;  4MML A;  3G6E A;  1N8R U;  1X6O A;  1NPR A;  3UV4 A;  4HBW A;  4Z93 A;  4HXR A;  4O5V A;  2L89 A;  4R56 A;  2E7O A;  3M57 A;  4PLI A;  5ENC A;  5GAM d;  5GAN g;  3LQJ A;  3SFM A;  4QSW A;  4M78 F;  4YYK A;  4JRQ A;  4PJO E;  3QJY A;  4UYE A;  1VQK T;  2HAX A;  2OUO A;  4E47 A;  3LX7 A;  4GPJ A;  5CQA A;  5AYF A;  4QB3 A;  2DZC A;  4LDU A;  3L42 A;  2F69 A;  2DK3 A;  1YI2 A;  5EIC A;  5G4R A;  2RJE A;  4A4H A;  4UIW A;  4A9H A;  4RG8 A;  1QP2 A;  5GMK h;  4J1P A;  3CBO A;  4EMH A;  4M78 A;  4ZW1 A;  3M58 A;  4XU2 A;  4MZP A;  2F5T X;  3UDC A;  2R0Y A;  4EMG A;  2K4Y A;  2OTJ T;  5FE5 A;  4ALH A;  3O8V A;  5DM7 R;  3E19 A;  2KVQ G;  5A5N A;  5DKD A;  4C8Q G;  5EP7 A;  4MR3 A;  5L96 A;  5CR2 A;  1VQP T;  4LC2 A;  5LJ3 g;  5BT4 A;  4DOW A;  2CZ6 B;  2I7K A;  3GLX A;  4O74 A;  1G3S A;  5FFY A;  5CTL A;  4M77 G;  4PLL A;  4N4F A;  3QSU A;  1XTD A;  3MUL A;  2E7N A;  2LC4 A;  3JRZ A;  5HRX A;  1QVF S;  4Y28 E;  1PSF A;  3OYD A;  3NTI A;  3H8Z A;  2HQE A;  4BJX A;  3JCM b;  4UYD A;  1Y07 A;  2RHZ A;  3N5B B;  4ATO A;  4XU1 A;  2ZPH B;  4QSR A;  2KQW A;  4M7A E;  4A9O A;  3DLM A;  2BKD N;  4A9E A;  5HCL A;  2CYZ B;  3HFO A;  4TU6 A;  3TU4 K;  4C5E A;  4C8Q D;  3CCE A;  4PY6 A;  1VQM T;  1JM4 B;  5DY9 A;  1LOJ A;  5JWM A;  3RER A;  4M75 A;  3CCQ A;  4NUD A;  1WPY A;  4E96 A;  4BW3 A;  5FE8 A;  4M7A C;  1Y96 B;  2RNX A;  5HLS A;  4C8Q F;  5M9O A;  4J8O A;  2A7Y A;  2MMP A;  4IUQ A;  4YTL A;  2EQJ A;  3M54 A;  4TZ8 A;  1RI0 A;  4J5Y A;  3E1S A;  1F68 A;  2K3Y A;  3CPW A;  2RI5 A;  5A5R A;  2F6N A;  3PTA A;  3L2Z A;  5EQ1 A;  5TB6 A;  4HXK A;  4NR4 A;  2RI7 A;  1BIA A;  3CC7 A;  4M75 E;  4MEQ A;  3GOX A;  2QEX A;  4YC9 A;  2OO1 A;  1E6I A;  2KTB B;  4MEN A;  4MDW A;  2GQV A;  4HA8 A;  5CUA A;  3EFR A;  1QVG A;  5LJ3 j;  4MMK A;  2EJF A;  2JNG A;  3L1A A;  5D3S A;  5FE7 A;  2F6J A;  5COI A;  4QQD A;  2L8D A;  4QEU A;  4F3I A;  4NXJ A;  3DB3 A;  3UV5 A;  4YYH A;  5HKC A;  4A9M A;  5C6S A;  5FG4 A;  2KY9 A;  2HD0 A;  4YBM A;  2O4X B;  4PCE A;  3OYY A;  5EWC A;  5GAO q;  2ZPF B;  1GXI E;  1FX7 A;  1M4Z A;  3M53 A;  2XHC A;  5HEL A;  5A7C A;  4PJO C;  2LNV A;  1BKB A;  4RMO A;  2DKG A;  3CCM A;  5HEM A;  3MB3 A;  3GG3 A;  3OYI A;  5D6Y A;  3G4S T;  2L5E A;  5LJ3 e;  4YBT A;  3UWN A;  3V7C A;  4QST A;  3CPW S;  3MEV A;  3CME A;  5D0C A;  2RO1 A;  3OYJ A;  3R6O A;  2JUF A;  5E9L A;  2DPP B;  2EAY A;  5CQ5 A;  5EIS A;  2LRQ A;  2EQM A;  4QYL A;  1PSE A;  4BDZ A;  3G0J A;  2LCL A;  5EM3 A;  4NUC A;  4YYG A;  1I4K 1;  4XQ3 A;  2HNI A;  4L6V 5;  5L99 A;  4QYD A;  3MUK A;  2A3L A;  4XY8 A;  3S3M A;  2YQD A;  4CFL A;  5CKF A;  4BW4 A;  3NTK A;  3OB9 A;  3G71 T;  5LJ5 e;  4ELZ C;  2PUO B;  3CCM T;  4M7D C;  4N4I A;  3VYH B;  5GMK i;  2L84 A;  5D3H A;  5FRO A;  4TYL A;  4XTV A;  3SWN C;  2QA4 T;  3P8H A;  5GAN j;  4M77 C;  5DLZ A;  1WQ7 A;  4JS4 A;  1YJ9 A;  2XDB A;  5FE6 A;  3C12 A;  3JCM g;  1N9S A;  3UVD A;  3QII A;  3OSS C;  1ZBX A;  2GCX A;  1G3T A;  5GAO n;  3OYN A;  4J7F A;  3CCL T;  4C92 A;  3I55 A;  3MEW A;  1D3B A;  3FDR A;  4YYI A;  4EMK B;  5I40 A;  4XTU A;  1OYX A;  2LX9 A;  3C94 A;  4XU3 A;  3S3O A;  3JCM c;  4DQ2 A;  4M75 F;  2MF2 A;  4QY4 A;  1YJ9 T;  4ME7 A;  3SVG A;  4F7U G;  3GPL A;  3QZS A;  3CMA A;  5A0L A;  2P4T A;  5HM0 A;  3JB9 H;  5EPS A;  2RHX A;  4BI3 A;  3AQA A;  5C8G A;  2CZ7 B;  4B9W A;  2F5K A;  5H1T A;  4CFK A;  5GAO p;  3JB9 G;  4II1 A;  3D7C A;  2L3R A;  1WUM A;  4NR5 A;  2LT1 A;  4QC3 A;  4UIY A;  3QKJ A;  4L5G A;  4XK8 E;  4CUQ A;  2K3X A;  2RD1 A;  4TU4 A;  3AAD A;  5ENB A;  1MGQ A;  2E5Q A;  3P1D A;  1VQ4 A;  3CCE T;  4PNO A;  4J0R A;  1R8O B;  2YLB A;  3V7R A;  5J26 A;  2EFI A;  3SVF A;  3HP9 A;  5L97 A;  5KU3 A;  3FC3 A;  3JVL A;  2RH2 A;  1UGR B;  4IUU A;  3U5P A;  4OMF B;  5IG6 A;  4OUF A;  2VUB A;  2RO0 A;  2OTL T;  1BI1 A;  3P8B B;  1VIF A;  1NZ9 A;  3X20 B;  4FLP A;  5FH7 A;  3K2J A;  5DLO A;  3OYA A;  1M1F A;  2JN0 A;  2RHY A;  1KQS S;  1B34 A;  5A2Q E;  3CPF A;  3UVW A;  2JOY A;  4XUA A;  1VQ4 T;  4UC4 A;  1HK9 A;  5DLQ E;  5A83 A;  3HRS A;  3IU6 A;  2ZPI B;  2DXB A;  1WJQ A;  5D24 A;  5I2M A;  3F70 A;  2FYK A;  4A9J A;  2XKO C;  4M7D B;  4C92 B;  2RM4 A;  2VXF A;  4M75 D;  2KDS A;  4LYW A;  5GMK l;  3CC2 A;  4LDF A;  2M9U A;  4A9N A;  1M5Q 1;  2DKW A;  2L5Q A;  4LR6 A;  3ONI A;  2BUD A;  3OYE A;  3OYL A;  2PVG B;  4PKL A;  2DVR A;  3LQH A;  4HBV A;  1QVG S;  3OS5 A;  5A85 A;  5KTW A;  5D3N A;  1VQP A;  2LQ8 A;  4EDU A;  4NRC A;  4Q0O A;  1VQN A;  1VIE A;  5AD2 A;  5BT5 A;  5F1L A;  5GAN e;  3OA6 A;  4YAX A;  1KQ1 A;  2OTJ A;  1VUB A;  2RJD A;  2BIV A;  4XY9 A;  5KO4 A;  2LDM A;  3DLL A;  3CC7 T;  2MAM A;  3CCU A;  5CKB A;  5I88 A;  2EKO A;  4M7A B;  5E74 A;  5E9V A;  5CQ6 A;  4XTY A;  1NE8 A;  4NQN A;  5KHM A;  3OYM A;  4C67 A;  4QSU A;  1VQ8 A;  2MWP A;  5GAN 2;  2RHI A;  5L8R E;  5F5Z A;  5GAM j;  3L2V A;  4FSX A;  2EIF A;  5GAM h;  5I2S A;  4ZQL A;  1VQ6 T;  4KCX A;  4TS8 A;  4M77 F;  5CIU A;  2YEM A;  2R58 A;  5C4Q A;  2Y90 A;  4RCB A;  1VQK A;  3WVD B;  3QYG B;  5JI8 A;  4O78 A;  3S91 A;  5J0D A;  3A8H B;  2M1H A;  5CVI A;  2B8A A;  5DY7 A;  3CCQ T;  1OZ2 A;  2X35 A;  3Q2F A;  4DA4 A;  3FLG A;  5DBM A;  1KG1 A;  1BIB A;  5E0R A;  3BW1 A;  4CI0 C;  5DKH A;  3IU5 A;  2MWO A;  4MR6 A;  4JLI A;  3HFN A;  5A81 A;  1N9R A;  4FM4 B;  3L2W A;  1EIF A;  5J39 A;  1P92 A;  3QZ9 B;  3TCJ A;  5H1V A;  2GFU A;  1YHQ A;  2QDY B;  2GFA A;  5KH6 A;  5F60 A;  1WGS A;  2XD0 A;  4C92 E;  3U5N A;  3MHX A;  5ETB A;  5C87 A;  5CFW A;  1M1G A;  1YHQ T;  3PGG A;  5HRV A;  2I2L A;  3QBY A;  3SD4 A;  3CMA T;  3CCV A;  4M7A F;  3QO3 A;  3JCM h;  4PJO A;  4J6Y A;  1O75 A;  2XK0 A;  4FIB A;  1N6A A;  2MI6 A;  4IUP A;  5FRM A;  3ME9 A;  1W4S A;  3VJP A;  4OF1 A;  3FJP A;  2XU8 A;  5EWV A;  5L98 A;  4C92 C;  3O33 A;  2D9E A;  3PIO A;  4GLK A;  1JSP B;  2PVD B;  1X0J A;  2HQX A;  3MP8 A;  3FIF A;  4HKE A;  5E3G A;  4KUI A;  5TCM A;  4TT2 A;  1HXD A;  3BY7 A;  2YHT A;  1D3B B;  5G4S A;  4IOO A;  4QR4 A;  3HPW A;  2QTX A;  4IR3 A;  5LJ3 d;  5CCA A;  1VQ6 A;  4F7U E;  4OB3 B;  3NFC A;  2QQ9 A;  5E7D A;  2ZGW A;  2DIG A;  2DXU A;  4Q5W A;  5FE3 A;  1N8R C;  5GAN 4;  1YBY A;  4Z1Q A;  5E9M A;  5EVA A;  2Y4Y A;  3U5K A;  4QBM A;  5C89 A;  3E9G A;  4IUR A;  2ZPG B;  3OQ5 A;  2VYT A;  3O34 A;  4ZGD B;  5GMK m;  2DD4 A;  5FE4 A;  5AMF A;  3QYH B;  3ASK A;  5CU8 A;  3M59 A;  4UYH A;  5EWD A;  1EQF A;  4X9C A;  3ZEH A;  2R10 A;  3HHT B;  3QZ5 B;  3JSC A;  2L85 A;  2R0V A;  4XTZ A;  5CRZ A;  3SWN B;  3M9Q A;  5EGU A;  1BI3 A;  3MXF A;  1K73 C;  5FFW A;  5I7Y A;  4LZR A;  2RK1 A;  4MR5 A;  2E10 A;  5I21 A;  3FKM X;  4XYA A;  3OYG A;  4OVA A;  5II1 A;  5CY9 A;  4M7A A;  4QC1 A;  2VXE A;  5HQ5 A;  5LJ5 f;  3S92 A;  5GAM f;  5HK3 A;  3U5L A;  3CXC S;  5EWH A;  2E64 A;  5F61 A;  3A8O B;  5LKT A;  4L59 A;  4JS5 A;  4QW2 A;  2N9G A;  3RKX A;  5F36 A;  1WUG A;  5LJ1 A;  3QZV A;  4QQG A;  5FE1 A;  4EPC A;  1VQO A;  4Z02 A;  1LNX A;  4X2I A;  1Q86 C;  4CUR A;  1QVP A;  2NLU A;  1M8V A;  3QJ6 A;  3CCJ T;  5IAY A;  2FSA A;  5CQ4 A;  3MP6 A;  2FL7 A;  5E9K A;  4C0D B;  3OS2 A;  5GAN 7;  3ZFJ A;  4RG2 A;  1YIT A;  2LVM A;  2H60 A;  5IGL A;  2QEX T;  5ENH A;  1VQL A;  3H6Z A;  1KQS A;  5D3J A;  1WNL A;  1JRI A;  4C8Q C;  4A9K A;  4YAT A;  1YI2 T;  5FG6 A;  5IID A;  1K8A U;  4NQM A;  5CZG A;  2O01 E;  4AKN A;  3CCU T;  3RES A;  5AME A;  4QSV A;  4QR5 A;  4WHW A;  4F7U F;  4C5I A;  4YYN A;  5GAN 3;  2R5A A;  5HFR A;  1M1K C;  1QW1 A;  3JCM d;  2P0P A;  3OMC A;  4C8Q E;  3OW2 A;  1VQ9 T;  2RS9 B;  4ZTJ A;  1NJI U;  2DWW A;  3G4S A;  1WJR A;  4PS5 A;  4JDS A;  5HJC A;  2D0Q B;  1KC8 U;  4PL6 A;  5FH6 A;  4TVR A;  2DD5 A;  3OS0 A;  4E7H A;  5GAN 6;  4A53 A;  5DFB A;  1JJ2 A;  5FU7 C;  4UYF B;  2EQK A;  5FU6 C;  2YW5 A;  1WQW A;  5II2 A;  3JVJ A;  3QUI A;  4NR7 A;  5CO7 A;  1UGQ B;  2K5I A;  4M77 A;  1VQM A;  4YYM A;  4FU6 A;  4N3W A;  2EJG A;  4UYG A;  4NR6 A;  5I7X A;  2M0O A;  4C92 F;  4NRA A;  4CUT A;  5D3R A;  1YJW A;  4IUV A;  4JRP A;  4E7I A;  5E9Y A;  2O4X A;  4HXP A;  4VUB A;  3T9N A;  5FBX A;  5IGK A;  3CC2 T;  5GMK j;  4MZM A;  5EA1 A;  5EPB A;  2YLC A;  4YK0 A;  3OBY A;  4BE0 A;  2VC8 A;  3CBP A;  4ZGE B;  5KCH A;  3Q2E A;  3ER0 A;  4A4G A;  2DIQ A;  5L8U A;  1UEB A;  4O76 A;  5LKZ A;  5CQY A;  1Y7X A;  2EYQ A;  4OB2 B;  3DWY A;  2KAF A;  5LJ5 h;  5D3L A;  5IN1 A;  4N4G A;  4LDY A;  5CUE A;  1I81 A;  4RCC A;  3CD6 A;  4JLG A;  4M7D D;  4ZGJ B;  1JJ2 S;  3V7S A;  2RNW A;  2XI9 A;  3M5A A;  4LDV A;  3LGF A;  1S72 A;  3G6E T;  4NYV A;  4BHW A;  4QSX A;  2JZ2 A;  4ELY C;  4HT9 A;  4M77 B;  5HQ7 A;  4M77 E;  4R55 A;  5FU6 B;  3VYG A;  2WSC E;  5LJ3 f;  3J81 E;  1BI2 A;  3CBM A;  3HSB A;  3C95 A;  4C8Q B;  4QSS A;  4N0A C;  3CCR T;  3MO8 A;  4WHU A;  1KQ2 A;  4YBS A;  1H3Z A;  4PJO D;  2LQK A;  5DYC A;  1G3Y A;  4O70 A;  3JCM P;  1X01 A;  3RKW A;  3OYF A;  4IR4 A;  2K5L A;  3EAE A;  2GRC A;  5EWW A;  4MEP A;  2X4Y A;  4D6W A;  2CGH A;  3JVK A;  2RNY A;  2WAC A;  4CUU A;  4PTB A;  4O7C A;  2RJF A;  2YYN A;  4NL2 A;  2XID A;  2P0K A;  4YH4 A;  3GF5 A;  2DVQ A;  2QXF A;  4CL9 A;  2ZCF B;  5LL6 S;  4O72 A;  2OSS A;  3S3N A;  5CRM A;  1VQL T;  2OAU A;  3MCA B;  5J3B A;  1XQH A;  5D26 A;  1WJS A;  5F2P A;  2CKK A;  3DKM A;  3CC4 T;  4QSP A;  1VQ7 A;  2LSP B;  3FRN A;  5FDZ A;  3SVH A;  5A0D A;  3CCV T;  5E9I A;  1FWZ A;  4HXM A;  2YDW A;  3CCJ A;  4Z6I A;  4BW2 A;  4C92 D;  3QHS A;  1YJN T;  4LDW A;  5A5Q A;  4OGI A;  4M78 C;  3JCM Q;  4M7D F;  3LQI A;  3G71 A;  4HCC A;  1S72 T;  2YRV A;  4YYD A;  3QZT A;  3OYK A;  5EV9 A;  4PJO B;  1U1T A;  4QVC A;  3OMG A;  5GAN 5;  1UB4 A;  3PMT A;  2WSE E;  5I80 A;  4XTW A;  1M90 U;  4HCB A;  3FB9 A;  5A5O A;  2WP1 A;  4PJO F;  4ALG A;  2X4J A;  3JCM X;  3PT9 A;  1Y71 A;  4M78 E;  3Q1J A;  4QQ6 A;  5IGM A;  5ENG A;  5FE0 A;  2PVO B;  3CXC A;  1IZ6 A;  2H3J A;  3X24 B;  2DXC A;  1BYM A;  5DFC A;  3M4Y A;  4GY5 A;  4FT2 A;  1G3W A;  4Y91 A;  5CKH A;  1KD1 U;  5H1U A;  4M75 B;  3VUB A;  3JCM J;  4M78 G;  4IR5 A;  3BFM A;  1MHN A;  1JBM A;  2XDD A;  3DAI A;  3L2Q A;  4BD3 A;  4NR8 A;  4HBY A;  2LT4 A;  5LVR A;  1KHC A;  2DTH A;  3RMS A;  4KUD K;  2RI2 A;  5F25 A;  4X34 A;  4N4H A;  4A54 A;  3V8L A;  5FG5 A;  2WSF E;  3PFS A;  4QEV A;  1Q7Y C;  1YJW T;  3JB9 I;  1K8A C;  5CAI A;  3VUZ A;  4WF2 A;  2DXT A;  1JB0 E;  1UGP B;  4Z1S A;  4QZS A;  5IT9 E;  1FXX A;  5I29 A;  5FE2 A;  3INZ A;  1V29 B;  5CQT A;  4KV4 A;  4TZ2 A;  2P0Q A;  1YIJ T;  5ENI A;  2DO3 A;  3FEO A;  1AHJ B;  2K2V A;  5IGN A;  4NL3 A;  1VQ5 A;  1X75 C;  3J7A F;  4Y03 A;  5KE3 A;  3UVY A;  5DYX A;  4J0S A;  3KBG A;  4O7A A;  4JRI A;  2E6Z A;  2ZZD A;  3P5O A;  3OW2 S;  2OTL A;  5ENJ A;  5CQ8 A;  2E41 A;  5H85 A;  4BY6 B;  5EK9 A;  5A5S A;  3RCW A;  5CUD A;  4LZ2 A;  5GMK e;  5HQ6 A;  2RHU A;  2NXB A;  5I83 A;  4F7U A;  4QVZ A;  5F63 A;  5DYA A;  3URG A;  2FHD A;  2X4W A;  4CLB A;  4KUL A;  5IBN A;  1YCY A;  4IKF A;  5FH8 A;  4CRI A;  4XAX B;  5C0M A;  3QG1 A;  3LW5 E;  3QXE B;  3JCM V;  5CUC A;  5HK0 A;  3LGL A;  5E73 A;  5GAO l;  3P1F A;  1U1S A;  4FL6 A;  3JB9 J;  1XNI A;  1YIT T;  3O36 A;  4XUB A;  5EU1 A;  5KTU A;  4NS5 A;  5CUB A;  4X9D A;  1Q7Y U;  4FT4 A;  5HFQ A;  5C7N A;  4LD9 K;  2Y4X A;  4A4F A;  4CUS A;  2RA2 A;  3OSV A;  2M16 A;  2VGM A;  3VU3 C;  4JJN K;  3U5J A;  3LXJ A;  2KSS A;  3A8M B;  2DTI A;  3LYI A;  1U8R A;  3X28 B;  2D6F A;  2QQS A;  4O7E A;  1VQ5 T;  4C0Z A;  1M90 C;  4O77 A;  4M75 C;  3MQM A;  5I89 A;  4OGC A;  5I86 A;  1Q81 C;  2FB7 A;  3HMH A;  5HEN A;  3OY9 A;  2VV5 A;  4E7J A;  4A9I A;  4A4K A;  3CCS T;  4YYJ A;  3J80 E;  4XU0 A;  4LZS A;  3JCM W;  2I8N A;  4C5H A;  4J83 A;  5ENE A;  3MEA A;  3UW9 A;  3JCM f;  2QQA A;  4PKC C;  2PU9 B;  5LKU A;  1Q82 U;  5CP5 A;  1N27 A;  5CKD A;  4BI8 B;  3KUF A;  1H64 1;  5E3D A;  2C06 A;  4Q0N A;  5DW1 A;  3LWI A;  4UIX A;  3I3J A;  2FVU A;  2GF7 A;  5CPE A;  5GAM e;  1ZHI A;  3HMF A;  3OBW A;  4ZN1 A;  1W2B A;  5LKX A;  4Z6H A;  5FB1 A;  5I1Q A;  3TLP A;  4LDX A;  4QR3 A;  2EJ9 A;  3LH0 A;  5DKC A;  5LUU A;  4QNS A;  4QSQ A;  4YAD A;  2WP2 A;  4A4E A;  4OP0 A;  5CK9 A;  5D6X A;  3MP1 A;  4HXN A;  2QI2 A;  4HXO A;  3PNW C;  3VKI A;  3MB4 A;  1BI0 A;  3A8L B;  4YY6 A;  4BY6 C;  5D7X A;  4UIT A;  4YH3 A;  3HL8 A;  5FE9 A;  3PMI A;  4LD6 A;  5LJ5 j;  4BW1 A;  1K9M C;  3CCS A;  5ENF A;  4A9F A;  3P1E A;  4QUU A;  2JVV A;  3BDU A;  3JCM e;  2E12 A;  3L2U A;  3ZBD A;  5C85 A;  4ZC9 A;  4A9L A;  3MEU A;  3P1C A;  2R57 A;  4NOY A;  3HME A;  2X4X A;  2DAQ A;  5EI4 A;  5DW2 A;  5LJ2 A;  4UIZ A;  2KK4 A;  1I5L A;  2QQB A;  1DJ7 B;  3QDR B;  5CGP A;  3CME T;  5EPR A;  4BB7 A;  5ETD A;  4M7D E;  1VQN T;  3O37 A;  5A5P A;  4O75 A;  2DVV A;  1YIJ A;  2RK2 A;  4C0G A;  1N72 A;  3M4G A;  1K9M U;  2XIC A;  4J6X A;  2LTO A;  2DTO A;  5DX4 A;  1TH7 A;  4HBX A;  3UPU A;  5F62 A;  5KTX A;  4O71 A;  3CEY A;  3UV2 A;  3TEE A;  1OI1 A;  4IOQ A;  3RUX A;  3I56 T;  4QUT A;  4YY4 A;  4KBM B;  4HXL A;  2G4A A;  1VQ7 T;  4M7A G;  4OB0 B;  4N0A A;  5GAN f;  4ZN3 A;  4RKU E;  4JRK A;  5GAN 8;  4TT6 A;  4M7D A;  1LJO A;  4EMK C;  3G0L A;  3KXT A;  2RJC A;  2ZPE B;  2RB6 A;  5FU7 B;  3SWN A;  2R5M A;  5CKE A;  5FRN A;  3I55 T;  4YAB A;  3JVM A;  2DVS A;  1SSF A;  2E3K A;  3GIB A;  4B9X A;  5FB0 A;  2E70 A;  4M77 D;  2DAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...