4N4IA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.3k36me3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
192
Chain Sequence
b'NKQEMGTYLRFIVSRMKERAIDLVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 65
structure length 192
sequence length 211
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4iA02
5EK9A 4LZSA 3LH0A 5M9OA 3LGFA 5HELA 5II1A 2G3RA 5ENHA 4MR4A 4UIXA 5E9KA 5E74A 4GPJA 3NTIA 5F36A 4LZ2A 4YYIA 4TZ8A 3SVHA 4LC2A 5I29A 5EV9A 4QNSA 5LKTA 4A4EA 4A9EA 4NR6A 3S91A 1OI1A 4NUDA 4TS8A 1EQFA 3JVLA 5DYCA 5EM3A 3ZYUA 5I80A 5E9MA 2X4WA 4QSUA 5LVQA 2YDWA 5DYXA 4A9NA 2K3XA 2YRVA 5C85A 4II1A 4CUPA 3OMCA 4HXPA 4PL6A 4TTEA 5LJ1A 4YYJA 4A9OA 4BE2A 2YQDA 5II2A 2N9GA 2L5EA 4QUTA 2HQXA 1X0JA 4O74A 5FROA 5C0MA 5FE3A 3IU6A 4TQNA 5FBXA 3H6ZA 4WHWA 4FL6A 2FHDA 5D7XA 4YC9A 3MQMA 2RHXA 4E7HA 5CS8A 4MENA 4HXOA 4O76A 2BKDN 5I7XA 2RI5A 4HXMA 2O4XA 1MHNA 4NS5A 4N3WA 4O7FA 5F61A 3LQJA 2LCCA 5G4SA 2D9EA 5L98A 3H8ZA 5J39A 2YEKA 5D3RA 5D0CA 4BD3A 1XNIA 4ZTFA 3MO8A 3S92A 3DLMA 5CP5A 4HBXA 2LSPB 2CKKA 3MP6A 4E7JA 2F5KA 3M9QA 4IUTA 3LQHA 5FE6A 3RCWA 4ZC9A 5FDZA 5FFWA 5CUCA 4QUUA 4A9FA 5IGLA 5KH6A 5A5PA 5D3HA 2MJVB 5HFQA 2D82A 1ZS5A 3UVXA 3E9GA 4QQDA 5EWDA 4QBMA 5D3LA 3PNWC 4BW2A 4NR8A 4YYHA 3FEOA 5I89A 4UIVA 1N72A 4IORA 3S6WA 5L99A 4XUBA 3MEUA 5EWHA 3GOXA 4KCXA 5CFWA 2O4XB 4NR9A 5IGKA 3QIIA 5C7NA 3G0LA 3FKMX 4IR4A 4Q0NA 3OYAA 3PMIA 5D6WA 4MEQA 5E9YA 3HMEA 5CUAA 5D26A 5F60A 5AD2A 5F25A 4MEOA 2D9TA 5HLSA 5ETDA 4C5IA 3OYHA 4LZRA 4YH4A 5AD3A 3Q1JA 4CUQA 4IUPA 4J1PA 5L97A 4YY6A 5K29A 2G4AA 4NQMA 2RNYA 4QW2A 5FE9A 4UC4A 5COIA 5E3DA 5FE1A 5DBMA 2JTFA 5CPEA 4OGIA 5D25A 5ENBA 2LDMA 4O71A 3LYIA 2RJCA 2H60A 4IR5A 4J0RA 4NR4A 5HQ7A 4A9LA 3MP8A 3OYMA 5DKHA 2L89A 2EQKA 4QZSA 3OS1A 3F70A 3ZEHA 5FFVA 4LRGA 4CUSA 5BT4A 5HEMA 2DAQA 3NTHA 5C87A 4IUUA 4E7KA 3O36A 5DFDA 4LYWA 2MWOA 3JVKA 3HMHA 5H1UA 4QEWA 3META 3U5OA 5I88A 4NYVA 3QKJA 3K2JA 5EP7A 4IKFA 3O8VA 3DB3A 3D7CA 4QEUA 1G5VA 5DYAA 4Z1SA 4Y03A 3DAIA 5EWWA 2GF7A 2OO1A 2R5AA 2RI3A 2RHUA 4Q5WA 4IR3A 5IAYA 4YBTA 2WACA 3NXBA 5KCOA 3OYLA 4NXJA 5EU1A 5A81A 2K3YA 4CUTA 2RO1A 5I83A 3QZTA 2B8AA 1WUGA 2DVSA 5FE5A 2R0YA 2HQEA 3E9FA 4HCZA 4CRIA 5CQTA 3MULA 2OUOA 2RS9B 3MUKA 4TU6A 3UVWA 5J0DA 2RHZA 5IN1A 4YBMA 3P8HA 3TLPA 5ENIA 5IBNA 4MR6A 2LTOA 4BE1A 5FE0A 4QR5A 5DW2A 4O75A 5EWVA 5FRMA 5DX4A 3OYJA 3U5KA 5IIDA 4QR4A 5ENFA 2WP2A 3OYFA 3LLRA 4UIUA 4FLPA 4PY6A 3OYNA 4BACA 4WHUA 3LXJA 2L85A 4NUCA 5LJ2A 4HBVA 4ZTJA 4N4HA 4YBSA 3S3NA 4WIVA 2R0VA 5D3PA 5FH6A 4O7CA 4A9MA 4YABA 3AADA 4NR7A 4QSRA 5I7YA 5IGNA 4BJXA 5C6SA 5A82A 4PTBA 2M0OA 4PLLA 4GY5A 4OVAA 4RVRA 3UVDA 5BT5A 3L2VA 3G0JA 2DVQA 5CQ3A 4UIWA 3FC3A 4TZ2A 3QBYA 5EQ1A 2BUDA 4PCIA 3L2QA 3UVYA 2F6NA 5I86A 5ENGA 3ME9A 2RI2A 4UITA 5CQ8A 4A4HA 5FE8A 2YW5A 5F62A 4BW4A 2EQMA 4C5EA 4XUAA 3OYIA 5CY9A 1WJRA 5C4QA 2EKOA 2R57A 4A9KA 4CFKA 5F1HA 5FG5A 5LKUA 4YY4A 4LR6A 2EQJA 5HQ5A 3PFSA 5FE4A 4L59A 4BE0A 4ALHA 3CEYA 4Z6IA 5CU8A 4PCEA 1WJSA 2GFUA 3S3MA 2I7KA 5KU3A 5DLXA 5KE2A 5E0RA 4QSWA 2L8DA 2QQSA 3MEVA 3P1EA 5CUEA 2RJFA 2R10A 4OUFA 5F3AA 4TYLA 5ENJA 5HQ6A 4O7AA 3GG3A 4O72A 5CRMA 3IU5A 4QY4A 3DWYA 2NXBA 3AQAA 4BHWA 5A5RA 5FE2A 4IURA 2RFJA 5F1LA 4YYKA 4TT4A 5L8TA 3O33A 4TT2A 5CRZA 5LKXA 1OYXA 3JVMA 4E96A 5KTUA 4ALGA 4RG2A 5H85A 3JVJA 3OYCA 2YEMA 4YYNA 4YYDA 3UWNA 5D6XA 2YYNA 4QSSA 5CQ4A 5E73A 4IUVA 5A5SA 2DVRA 4A9JA 5ENCA 2RJEA 4MR3A 3L2UA 2KTBB 5A5QA 5CUDA 5CGPA 4NUEA 4PKLA 4O77A 3O34A 3LGLA 2F6JA 4O78A 2X4YA 4QSVA 5J26A 4BDYA 4Z93A 4QSPA 4XY8A 3OYDA 3MP1A 4ZW1A 4CURA 2WP1A 4C67A 5D24A 5DW1A 5EGUA 4HXKA 3UV4A 3L2RA 5HJCA 5FG4A 3O37A 5I40A 5KO4A 5FRNA 4LDFA 4NYWA 5KTXA 3P8DA 4LD6A 5DY7A 4O7EA 4MR5A 4QQ6A 4UYEA 3U5PA 4NRCA 3FDRA 4N4GA 5E9LA 4KV1A 4F3IA 2OSSA 3OA6A 3NTKA 4QC3A 3Q2EA 4N4IA 1F68A 5H1TA 2RI7A 3MXFA 3P5OA 5FH7A 2DIGA 2X4XA 5CIUA 2E7NA 4CL9A 3OB9A 5EWCA 1WUMA 5EA1A 2E6NA 4UYFA 4BW3A 1WGSA 4CLBA 3U5NA 4QSQA 2DVVA 3OS0A 5FE7A 4C66A 4YK0A 4A4GA 4NRAA 4Z1QA 1JSPB 5LJ0A 5FFYA 3UW9A 5A5OA 3SD4A 2FSAA 4IUQA 5L8UA 4QEVA 4IR6A 3EAEA 4TU4A 4HXSA 3QJ6A 2NLUA 5DKCA 5I1QA 2R5MA 4YAXA 2GFAA 4YADA 3ASKA 4O70A 5F63A 5C8GA 4YATA 3LQIA 4QSTA 5LKZA 5CQ7A 4A9HA 2RNXA 2R58A 2DKWA 5CTLA 5HRWA 5TB6A 2X35A 4UYDA 5HFRA 2L3RA 4YYMA 4IOOA 4QVZA 3PMTA 2RO0A 3L2WA 4AKNA 4UYFB 4CFLA 2EQUA 2LVMA 4O7BA 1KHCA 5EICA 3DB4A 4NR5A 4UYHA 5FH8A 3L42A 4DONA 3LJWA 5JI8A 2RNWA 3MEAA 3P1DA 3UV2A 3SVFA 5DFCA 3OYKA 5IG6A 2RHIA 4J0SA 1OZ2A 5CQAA 4IOQA 5ACYA 1N27A 4HXRA 4N4FA 1JM4B 1OZ3A 3QZSA 5DLZA 5E9VA 4OGJA 5D3NA 5AMEA 5LUUA 5KHMA 3U5JA 2YELA 5EISA 5CQ5A 2XDPA 4HBYA 5E3GA 5G4RA 4A9IA 3OYEA 1E6IA 4TT6A 4QQGA 4PLIA 5D3SA 3ONIA 4BDZA 5F2PA 5A85A 5A5NA 5DFBA 3OMGA 3Q2FA 5D6YA 4YYGA 4EDUA 4QR3A 4FU6A 3FLGA 5HRXA 3OY9A 2DATA 2RHYA 3MB4A 3QZVA 4X34A 2DIQA 4HXNA 4YH3A 4XY9A 2L84A 5CZGA 3UV5A 2EFIA 5ETBA 3U5LA 5TCMA 2VYTA 4C5GA 4LYIA 4A4FA 4Z02A 5F5ZA 4NQNA 5IGMA 4QYLA 4UIZA 5BT3A 5D3JA 3I3JA 3OS2A 5A7CA 5KTWA 2R0SA 5C89A 2PQWA 4X2IA 5DKDA 5FB1A 1RI0A 4Q0OA 5AMFA 5HM0A 2BIVA 5CQ6A 3HMFA 4PS5A 4UYGA 5EI4A 4B9WA 1WJQA 5CUGA 2I8NA 3O35A 2M16A 3U5MA 4B9XA 4KV4A 5E9IA 5DYUA 5EPSA 5A83A 2E7OA 4LYSA 5JWMA 2IG0A 2P0KA 5KCHA 4ZQLA 4J3IA 4UIYA 2XK0A 5LVRA 2E5QA 2RJDA 5H1VA 2GRCA 1H3ZA 2MWPA 4QYDA 5EVAA 2M1HA 5FB0A 2DWWA 4BW1A 4QB3A 4HBWA 4CUUA 3OYGA 2QQRA 5HENA 5CUBA 4Z6HA 4QSXA 4QC1A 5KE3A 5E7DA 5FG6A 4E7LA 4MEPA 5EPBA 4HXLA 5L96A 3OYBA 4E7IA 3S3OA 3P1FA 3BDLA 2E3KA 4NYXA 3C4SA 2LRQA 4NRBA 4XYAA 5EPRA 3OQ5A 3UT1A 3MB3A 1SSFA 5HRVA 3LX7A 4C5HA 2JZ2A 5ENEA 3SVGA 5HCLA 3MEWA 3KUFA 3P1CA 5D3TA
chains in the Genus database with same CATH superfamily
5EK9A 3I55T 2EKHA 5II1A 5ENHA 2K7AA 3PIOA 4TZ8A 1GRIA 1Y96A 5A2QE 4EMHA 4LC2A 4QNSA 1C6VX 2K4YA 1M90R 1D1CA 1EQFA 4F7UA 4M78A 5LVQA 1B7TA 1N8RU 1S72T 1WX6A 3C94A 4TTEA 4RMOA 1K4US 4YYJA 4BE2A 2YQDA 4D8DA 2N9GA 3CCMA 1YITT 2HQXA 2PZ1A 4D8KA 4TQNA 1G83A 1U8RA 2P4TA 3H6ZA 4WHWA 4FL6A 3CC4Q 4M7DB 2AZSA 4M7AD 3NPFA 4BI4A 1VQ9T 1V29B 5KYUA 2J06A 4E7HA 3GNFB 5CS8A 4O76A 5CK9A 4RTZA 2RI5A 3MEWA 4RTWA 2CH4A 4NS5A 4O7FA 2HBPA 4OGCA 4C92C 1IGQA 1UE9A 1RACB 2RN8A 4BD3A 2LJ0A 3MO8A 3S92A 1X6GA 4CC2A 3N5BB 2LSPB 2CKKA 1R77A 5CKHA 3V8JA 3M9QA 3LQHA 5A0GA 4ZC9A 3PVLA 5FFWA 2HCKA 2YLCA 5CUCA 2QI2A 5LJ5e 2V1QA 2LNHB 4QUUA 3CCJA 1AT1B 3UA7A 2CP7A 3UVXA 2CUDA 1BI2A 4QQDA 1NJIC 4C92D 3PNWC 1PNJA 1PKTA 4J7IA 3FEOA 1KD1U 4RCCA 2PUKB 5KYYA 1NEGA 3A8OB 3MEUA 3P8BB 3QHSA 5A0DA 1H3HA 4NR9A 3QIIA 1IZ6A 4LDWA 3FKMX 1NE8A 5GAN5 4MEQA 5F60A 5D26A 1HYOA 3M4YA 4BI8B 4C8QF 2D8HA 2D9TA 1UEBA 3QG1A 3CD6Q 2C0OA 5ETDA 3M0RA 4LZRA 2E70A 3Q1JA 2DXBA 4AFSC 1KC8U 2FL7A 4NQMA 1VQNT 2F1LA 2L0AA 5GAN8 5FE1A 2QEXA 2JTFA 1CKAA 2LX9A 2JMCA 1K0SA 1S72Q 4NR4A 3MP8A 3CPWP 3L1AA 2RQVA 4HCKA 2DILA 4OMQA 2RPNA 1R8OB 1WHHA 2VGMA 3LW5E 1Q81R 2DAQA 4PJOE 1NLPC 1M3AA 3JVKA 4ZGDB 4NYVA 3A5ZB 5LJ3h 4IKFA 2LP5A 1UHFA 3M0QA 1AWOA 1PRMC 3DAIA 2R5AA 3G6EA 2OO1A 1JJ2P 1Y07A 4M7DG 2KVQG 4AFQC 4NL3A 4XTZA 3NXBA 1KC8C 2E6ZA 5A81A 4M78E 3QZTA 2GBQA 1WUGA 5FE5A 5CQTA 4BY6C 4FCYA 1WHGA 3CCUQ 5IN1A 4YBMA 2XMFA 1X01A 4N0AC 2CREA 5ENIA 4ZGJB 1Q7YR 2XU8A 3JCMQ 2CZ7B 2GTJA 4QR5A 1BK2A 1U1TA 3JCMW 4C8QA 5DX4A 3U5KA 2WP2A 3OYFA 1JO8A 3EG2A 5FWBA 1B07A 3LLRA 5CVIA 3V7CA 3X20B 4DEYA 5GAN7 3G71Q 3LXJA 1VQ5T 4FSSA 1VQPQ 4N4HA 1UGRB 1TTHB 4A9MA 4A63B 3S3NA 3AADA 1JBMA 1TUDA 1X75C 4QSRA 5IGNA 1ABQA 4BJXA 3EG9B 2NUPB 4PTBA 2ZPFB 2DPPB 3EH2A 2E12A 4GY5A 4OVAA 3UVDA 3OYYA 4LDVA 3L2VA 1UHCA 4UIWA 4TZ2A 2SEMA 5EQ1A 2D0NA 1VYTA 1MMAA 3GNGA 5I86A 3RIRA 2RI2A 4UITA 1HXDA 4MZMA 2OTLA 4C5EA 2HL5C 1D0XA 4JJNK 5C4QA 4RTTA 1KJWA 1YBYA 5FG5A 5LKUA 2EGCA 1YHQT 3FRNA 1EIFA 1K9MC 5HQ5A 3URGA 5FE4A 2KEAA 4M75D 1K8AR 1WJSA 2AZVA 1Q82R 5KE2A 2QYZA 2Y4XA 2L8DA 2QQSA 3P1EA 2RJFA 3MPUB 4O7AA 3ZL7C 3GG3A 1VQLA 1K73C 3DLLA 1JXOA 4F04B 4BHWA 5A5RA 5GJVB 2KRNA 3CCQA 1M1KU 2HL3A 4MZTA 1NG2A 1YIJT 5KTUA 1YWPA 1SRLA 3JCMe 4ALGA 4J5YA 1VQMA 4MMLA 1MMDA 4M77C 1F1BB 4HVVA 2DJZA 1JXMA 4IUVA 5A5SA 1EZZB 5ENCA 1RAFB 5LJ5h 4MR3A 1XOVA 3VS4A 2KTBB 1ZUKA 1N8RR 5CGPA 2F6JA 4O78A 3AHUA 2X4YA 4QSVA 1M1GA 4OGEA 4QSPA 1FX7A 3HRTA 3VS5A 1ZKRA 4M7AF 5DW1A 5EGUA 2J6FA 3HFOA 3L2RA 2RQWA 3O37A 1QVGP 4M7DE 3CXCP 3EGXB 3TCJA 1KHIA 2RF0A 4MDWA 2Y4YA 3WXMB 3NTKA 1S1NA 4QC3A 2IVWA 1F68A 1OX8A 2ZPEB 1VQ6T 5H1TA 2RI7A 2L3SA 5FH7A 2HEQA 2V8KA 3LWHA 3EG9A 5EWCA 2J6KA 4KGXB 1M8MA 4A4KA 1X2QA 5GAOr 1WGSA 2NYSA 2F5TX 2M9UA 2EYQA 2DNUA 1UJYA 1G2BA 4NRAA 2E10A 5LJ0A 5FFYA 5A5OA 1SF9A 1LPLA 4C92F 1IB8A 4QEVA 5I2SA 4P5NA 2NLUA 1OU9A 5I1QA 3VYHB 1KD1R 2ZPGB 3FB9A 1ZQ1A 3VYGA 3ASKA 1AWJA 4QT7A 3LQIA 1SG5A 2DERA 1HK9A 2YRCA 5CQ7A 2F2XA 2PU9B 2QA4T 5HRWA 4LNPA 2X35A 2JT4A 3CMAA 5HFRA 3M56A 4YYMA 4IOOA 3H0HA 3PMTA 2RO0A 4CC4B 3UDCA 2K5FA 2GQVA 3H0FA 3SDZA 3OW2P 2QQBA 3JB9H 1D0ZA 1QWEA 2RNWA 2RM4A 3P1DA 1YJNA 3VKHA 3UV2A 5DFCA 3J80E 1QP3A 3BDUA 1OEBA 2JOYA 1JM4B 1W1FA 1OZ3A 3QZSA 1JU5C 2PVDB 4J83A 1HJDA 5KHMA 1Y71A 5FU6B 3A8MB 2EAYA 4M7AA 4FIBA 4HBYA 1M90U 4X9CA 1W70A 3JCMJ 5G4RA 4CC3A 2EVRA 2KBTA 3HP9A 4TT6A 1TU0B 2HD0A 1KFZA 6AT1B 5A5NA 2DL5A 1E6HA 2DJQA 4YYGA 4EIKA 4LXCA 1ZSZA 2COYA 2DIQA 4HXNA 2QGGA 2DE0X 5ETBA 5TCMA 5GAOm 2DZCA 1NEBA 2DBMA 3RMQA 5D3JA 2BE7D 3VS6A 3CCEA 5A7CA 2QGFB 1D0YA 5GANj 1ZA1B 5D7UA 1YJWQ 3C12A 4UYGA 2KXCA 4B9WA 2QDYB 5CUGA 2EPDA 4KV4A 3CCLA 5EPSA 2CP3A 4LYSA 5KCHA 4ZQLA 2ZPBB 3I5SA 2XK0A 5LVRA 3FJ5A 2OI3A 1VQ4T 4FT2A 4JJCA 5CKEA 4CUUA 2ED0A 2Y90A 2BE9B 1V1CA 4Z6HA 4QSXA 1RADB 1YFNA 2CP2A 2IPOB 4OF1A 4E7LA 5EPBA 5L96A 4JRPA 4E7IA 1W6XA 2E3KA 3C4SA 2LRQA 3JCMh 5EPRA 1D1AA 8AT1B 3VS3A 2MYSA 4QVDA 3QZ9B 1YN8A 5HRVA 2YUNA 5ENEA 4IUTA 4PS5A 5D3TA 3VS0A 4LZSA 2YLBA 1XTDA 3CCRQ 2G6FX 1S72A 4UIXA 1YITA 5E74A 4ELZC 5F36A 2OTJT 1U3OA 3SVHA 3EFRA 4A9EA 4NR6A 3S91A 4NUDA 1M30A 3C0CA 3G4SQ 2ROLA 2X4WA 5E9MA 1VQ9A 4QSUA 5DYXA 3OSSC 4CUPA 2ED1A 3M0SA 3X26B 5FE3A 4AFZC 4RTUA 2KSSA 1Q81U 3M54A 2OX7A 3BE3A 5D7XA 2K5LA 1WFWA 3MQMA 2PVGB 3RUXA 2P0QA 5DLOA 3MHXA 1OQKA 3V7RA 4KUIA 2GCXA 2X4JA 4LN2A 2FPEA 2DKGA 2DTIA 1Q86C 5FLXE 2ABLA 1EX4A 1Y96B 2VC8A 2LCCA 4M7AE 5L98A 2E65A 2CS7A 2YEKA 2O2OA 3VS1A 2PVOB 4F7UB 4M78B 1B3QA 4KH1B 4HT9A 2QK0A 5FE6A 3RCWA 3TU4K 1W2BP 1QP2A 2WSCE 2CP5A 5A5PA 2MJVB 2DL7A 1Q7YU 5I21A 2P0PA 3E9GA 3GP8A 1X2KA 4OMLA 5EWDA 1IHWA 4YYHA 5KYUB 5I89A 4IORA 4XTYA 3CC4T 1QVFP 2A0FB 4EMGA 5EWHA 1SPKA 4OMFB 4KCXA 4DA4A 5GAMe 1LCKA 1OPKA 1PD0A 2VGNA 5C7NA 1KSWA 4FSXA 5GAMj 5CUAA 2EJGA 5HLSA 5FW9A 4C5IA 5LJ3j 3OYHA 4YH4A 1VYVA 4CUQA 2CZ6B 2XHCA 3HTRA 2H8HA 4M75A 4IUPA 3REBB 1ZUYA 1K1ZA 2X51A 2RQUA 5K29A 1U06A 2G4AA 2HKQB 5GAOp 1SRMA 2RNYA 5FE9A 4UC4A 2FB7A 1AZGB 5DBMA 4J9DA 2ZZDA 1KIKA 2EGEA 4O71A 3LYIA 2RJCA 2H60A 3M53A 4HCCA 4MMKA 3OS1A 2DTHA 1YP5A 3F70A 2DVJA 2VKNA 3E2UA 4LRGA 1PSFA 2JJ9A 2NWMA 1NPRA 3EG0A 1ZBJA 5BT4A 3NTHA 4JZ3A 1JQQA 5C87A 4IUUA 3THKA 4DOVA 2JTMA 5GAN3 5H1UA 2COWA 4QEWA 2PTKA 1FMKA 3CD6T 3DB3A 2CSQA 2W10A 4Z1SA 5LL6S 4Y03A 2GF7A 4PJOG 4IR3A 4HXJA 2CZ0B 2WACA 1O9SA 3D1DA 4CUTA 2DVSA 2R0YA 3FJPA 3I9QA 1AOJA 2RS9B 3MUKA 1UGPB 2W0ZA 3UVWA 4J7FA 5J0DA 1VQ5A 2JM8A 2RK2A 3EFOA 1MMNA 4F7UG 4M78G 3I56Q 4MR6A 5FE0A 2XDDA 2YXYA 4O75A 5EWVA 1K8AC 2JUFA 2LMJA 1Q82C 3GIBA 2C0IA 4NUCA 1M3BA 1Z9ZA 4WIVA 2R0VA 4YABA 2A28A 4NR7A 4KUDK 1VQ8Q 1FYNA 5I7YA 5C6SA 5A82A 2AIRB 1ZBXA 4PLLA 4RVRA 3PIPA 1YHQA 3M0UA 2EBPA 3ERRA 3QSUA 3QBYA 4DBRA 1KQSP 5CR2A 3UA6A 3L2QA 4C0DB 2AKKA 3ME9A 2CGHA 5FE8A 3CCUT 4BW4A 2EQMA 2A7YA 3VKGA 1SEMA 5LJ5j 1TWBA 1YI2Q 1N8RC 4M4ZA 4C8QB 2RB6A 4LR6A 2EQJA 4BE0A 1NZ9A 4Z6IA 2DF6A 2GFUA 4EMKC 1YIJA 3S3MA 3G71T 3VRZA 3RNJA 1KQ2A 4AMCA 2A36A 1VQPT 5CUEA 3TVTA 5HQ6A 5CRMA 1AHJB 2FYKA 2NXBA 1OV3A 2KRSA 1NYFA 2NUZA 5FE2A 3REAB 3KXTA 1AWWA 3OSVA 4M75E 2RK1A 3GBQA 3O33A 4TT2A 5LKXA 5HCKA 1OYXA 3QZ5B 4JJDA 5H85A 4YYDA 3OBWA 2YYNA 4QSSA 5E73A 2DVRA 4A9JA 4X9DA 1VUBA 1NBEB 3L2ZA 3LGLA 3QUIA 2QQAA 1IHVA 1C1AA 4FYVB 2QAZA 4Z93A 1VQ6A 4JRKA 4CURA 1KD1C 1LOJA 1GXIE 2KT1A 5HJCA 5FG4A 5GAMh 1M3CA 2YRDA 4NYWA 3P8DA 4LD6A 4XU1A 3A8GB 4ATOA 4MR5A 4PKCC 2CYZB 4E7ZA 4LDUA 2YDLA 1BI1A 1UJ0A 1ABOA 4N4GA 2XD0A 2OSSA 3OA6A 5A0LA 5GAN2 2ZGWA 1UGQB 3HHTB 3P5OA 4XK8E 4PNOA 1W4SA 1M27C 4F7UE 5EA1A 1X43A 2E6NA 2JMAA 1I1JA 4J9HA 1VQOQ 1M2VA 1GBRA 3CMEQ 1FXXA 3G7ZA 4A4GA 4Z1QA 2I0NA 3UW9A 3EFSA 3WVEB 2QA4A 2M02A 2FO0A 5GMKl 3EAEA 2DRKA 4HXSA 5DKCA 2R5MA 2DXUA 2VUBA 1WHJA 4YADA 1YWOA 4PJNA 5F63A 3M4GA 2OAWA 1R0BG 3VUZA 3A8HB 2R58A 1YNZA 2X9HA 4C8QG 1ZA2B 4HCBA 3QJYA 1X27A 4LUEA 4XAXB 1WQ7A 4OB0B 5EICA 4NR5A 4UYHA 1MV3A 4DONA 2A08A 5DY9A 3SVFA 4FYXB 2DXCA 4J0SA 3VJPA 4WCIA 2MCNA 2EJNA 3JB9D 5ACYA 4KULA 4HXRA 4AFUC 5E9VA 4JDSA 4OGJA 5LUUA 2YELA 1J3TA 2GTOA 1B34A 5EISA 5I22A 2DEUA 2DFUA 1VQKT 4A9IA 3TSZA 4RG8A 3OYEA 3EG1A 4E47A 5D3SA 4QKUA 1YJ9Q 3JCMf 5DFBA 2NUTA 1M8VA 2D0QB 4LDXA 4QR3A 4DBHA 5HRXA 4R0KA 2DATA 3QZVA 1GCPA 3NFCA 5GJWB 4YH3A 4ZGEB 1BI0A 3UV5A 3CC7Q 4C5GA 4LYIA 2EYWA 4J6YA 4UIZA 2AKLA 1NM7A 5I11A 4R56A 1N5ZA 1VQ4A 5KTWA 4ZN3A 1PWTA 5FB1A 1AVZC 4Q0OA 2KXDA 4M7AB 2AT1B 4CI0C 4PJOC 2O31A 3CCVQ 2BZ8A 1WQWA 1SSHA 3RESA 1GCQA 2CSIA 2E7OA 2IG0A 3SWNA 4YTLA 5FU7B 5H1VA 2GRCA 4M77D 2MWPA 5EVAA 4JPBW 5FB0A 1ZSZB 5J3BA 2C06A 4QB3A 4M78C 2RQTA 4PJOD 4ANJA 2QQRA 4JRQA 3HSBA 1O75A 3MCAB 2DX1A 5HENA 5CUBA 4QC1A 4LUDA 4HXLA 3JCMV 3S3OA 3P1FA 3BDLA 3CPWA 1P92A 2OTJA 3PVQA 1M1KC 5KYXA 4NOYA 3OQ5A 5GMKe 4C92B 2K79A 1QVPA 2YUPA 1RAIB 3M55A 3KUFA 4OB3B 3P1CA 4Z89A 4AI6A 4QYDA 3CCMQ 1YJWT 2DXTA 5M9OA 2G3RA 4MR4A 5E9KA 4GPJA 4LZ2A 2EW3A 4C8QE 5I29A 5LKTA 1JJ2A 4A4EA 1VQKQ 1WA7A 3HRUA 4TS8A 1DJ7B 2K2VA 3JVLA 3ZYUA 3J81E 2YRVA 4II1A 5C85A 2VV5A 4PL6A 5LJ1A 4A9OA 4GBQA 2CH4W 3A1PA 2L5EA 4QUTA 1X0JA 4ME7A 5FROA 2LJ1A 5C0MA 1TUGB 2ATCB 5HK0A 2RH2A 4MENA 3JCMb 3OBYA 1UFFA 3CCJQ 2BKDN 4HXMA 2L3PA 2O4XA 1MHNA 3E19A 3CCRT 4N3WA 3J7AF 5G4SA 3H8ZA 2VWFA 5D3RA 5D0CA 4XU3A 1XNIA 4O6JA 3RR6A 5CP5A 4HBXA 4BB7A 4NL2A 1X6BA 3CC4A 3MP6A 3JCMg 3G4ST 3CCSQ 1WDXA 2HKNA 1X6OA 1WXUA 4M7AG 1I8FA 4A9FA 1OX9A 5KH6A 5GANf 2D82A 1ZS5A 4QBMA 2LX7A 4NR8A 5CO7A 5IHNA 4UIVA 1N72A 1WNLA 3S6WA 4XUBA 1VIEA 3ZBDA 3GOXA 2QEXQ 1Y0MA 1IRXA 5CFWA 4C0ZA 2DL3A 5GAN6 3JB9J 4IR4A 2DD5A 4Q0NA 3I35A 3PMIA 5AD2A 1PUOA 5F25A 4MEOA 3SFMA 2KGTA 3VS7A 4C92A 4M7DC 1RLQC 5AD3A 1H641 3LWIA 4BY6B 1FMVA 5CCAA 4J1PA 4OB1B 4PFPA 4AG2C 1V76A 2E3IA 1M90C 5COIA 5E3DA 5CPEA 2LNVA 4RCBA 4C0FA 5CQXA 2LDMA 1M9SA 9ATCB 2B86A 4M7DD 3CD6A 4A9LA 4J9IA 3OYMA 3TSWA 3G6EQ 3QO3A 3CQTA 4QZSA 2FPDA 3V7SA 2XIDA 2K6DA 4E2FB 4EMKA 4C0DC 5FFVA 1K0XA 4CUSA 4QVCA 4J6XA 2KY9A 3V8LA 4Y28E 3KFVA 2QDLA 4FT4A 5DFDA 1QCNA 2MWOA 3V8KA 4E7KA 2F69A 3D1BA 2COZA 3U5OA 5I88A 1RAEB 3O8VA 1QVGA 4KT0E 4M75B 3JB9F 1RAAB 3CXCA 2EIFA 4IIMA 4Q5WA 4YBTA 3MJXA 1BB9A 1PRLC 1NPPA 4F14A 2VXEA 3JSCA 2OUOA 4TU6A 3JRZA 2LQNA 2RHZA 2KK4A 2J05A 3P8HA 5IBNA 1TUCA 3FIFA 2MAMA 4ELYC 1WYXA 4R55A 2DBKA 3ZFJA 2XKOC 5FRMA 3OYJA 5IIDA 4QR4A 4CC7A 4KBMB 5GMKh 1PC0A 4UIUA 4BACA 3OYNA 2L85A 4HBVA 1IO6A 1RI9A 5D3PA 3RERA 4O7CA 2HAXA 2M0YA 1BKBA 3CCUA 2LQKA 3OW2S 1IREB 4MDXA 2DMOA 2QQ9A 1QLYA 4OMNA 5BT5A 1XQHA 4DOWA 3G0JA 2DVQA 5CQ3A 2LT1A 3FC3A 1N9SA 1UDLA 1M4ZA 2EGAA 1WPYA 2BUDA 3SB2A 4PCIA 2DVEA 4M77F 5HY6A 2E1HA 3OW2A 2F6NA 1ZHIA 3EFOB 3G71A 3CPFA 4D6WA 5GANg 5ENGA 5CQ8A 3HPWA 4N0AA 5GAMf 1VQPA 2QTXA 1VQLQ 2QG9B 4PJOF 5CY9A 1WJRA 3CCQQ 4BUGA 5LJ3f 2R57A 5AT1B 3I56T 2CP6A 4ORZA 3TEEA 2YUOA 4L59A 1VQMQ 2HSPA 5CU8A 1Q81C 4PCEA 3G1JA 5CAIA 2I7KA 1VYUA 5DLXA 5E0RA 3HFNA 3MEVA 1BIBA 3RKXA 2R10A 1SHGA 2MIOA 4C92E 4TYLA 1Z9QA 4O72A 4JJBA 1VQ8T 4QY4A 4J9EA 2QASA 3ER0A 3AQAA 1RAHB 1A0NB 2RFJA 5F1LA 3NHNA 5CRZA 2VASA 4E96A 4RG2A 3ULRB 4WF2A 2YEMA 3UWNA 5D6XA 1FMWA 1TG0A 2SRCA 4E7SA 2D6FA 1LVKA 1N6AA 2DL8A 4M75G 2K2MA 2DK3A 2RJEA 3A98A 1YI2T 2GQIA 4NUEA 4O77A 1GFCA 2L5QA 2KRMA 1Q7YC 1ZX6A 1JRIA 4BDYA 4Z88A 4Z8AA 4B6MA 4HVUA 4ZNXA 3UV4A 4HXKA 2O88A 5I40A 3T9NA 2LJ3A 3JV3A 5FRNA 4LDFA 5KTXA 2DA9A 2DZ9A 1E6GA 4QQ6A 4UYEA 4X1VA 1Q95G 3FDRA 2K9GA 5E9LA 2KYBA 4F3IA 1U5SA 1TH7A 3Q2EA 4N4IA 1ACMB 2VVKA 1WI7A 4M77A 3MXFA 4JLGA 4CL9A 3OB9A 4A54A 1BIAA 1QWFA 3X28B 2F2VA 4UYFA 2E4HA 4CLBA 2DVVA 3OS0A 5FE7A 3EH1A 4C66A 2V8JA 2RA2A 3NMZC 5CKFA 1MNEA 4PJMA 2VXFA 2QXFA 3CMAQ 1JSPB 1KG1A 3SD4A 3JCMd 2CT3A 4GLMA 4HT8A 1M2OA 2FSAA 2JN0A 5L8UA 4JZ4A 1T0JA 3QJ6A 4Y92A 2KE9A 4JLIA 1U1SA 4M7AC 2CP0A 4YAXA 2X3WD 1YJNQ 3C95A 2GFAA 4XTXA 4KH0B 4O70A 2CZ1B 4YATA 1T3LA 1NJIU 4A9HA 1VIFA 1QQJA 1D09B 3R6OA 3R6NA 2L3RA 5LJ5f 5FU7C 3CBMA 3QWYA 4QVZA 1BBZA 1GL5A 4AKNA 4CFLA 1ZSZC 2EQUA 2LVMA 4F17A 5GAOq 4O7BA 1KHCA 2PNIA 3DB4A 1M2VB 5CQYA 2WSEE 2ZPHB 1VQKA 5GAMg 3EGDA 1VQOT 3VV0A 5IG6A 3CMET 2RHIA 2KQWA 1OZ2A 5GAOn 3RDVA 4DBFA 4IOQA 5LJ3g 1T3SA 4M7DF 5DLZA 3TQ7P 4JS5A 2FPFA 5GMKi 1UUEA 2LZ6B 2XDPA 3PTAA 2FRWA 1W2BS 4PFOA 1E6IA 4QQGA 3NGPA 4PLIA 3ONIA 2YSQA 4BDZA 2X3XD 3CCEQ 3OMGA 5D6YA 4XU2A 1W2BA 5KYWB 2J7IA 4FU6A 1WHLA 3EG3A 3MB4A 4E6RA 1VQ7T 1QVFS 3CCLQ 5CZGA 2EFIA 3U5LA 4C0GA 4V2SA 2VYTA 4Y91A 5ECAA 7AT1B 4A4FA 5F5ZA 5FWCA 4QYLA 1QVFA 3CCSA 3I3JA 2HNIA 1GBQA 2PQWA 5DKDA 3UATA 1RI0A 2E64A 1Q86R 1B34B 4MZPA 2ENMA 5EC7A 3I55Q 2KMTA 4XQ3A 1AD5A 2I8NA 2YUQA 1RABB 2JVVA 2DO3A 4L5GA 5E9IA 5DYUA 5A83A 2P0KA 5JWMA 2NUTB 2FZGB 4J3IA 5GAN4 2E5QA 1YJ9T 3BW1A 5FU6C 3QWXX 3QDFA 2DWWA 4BW1A 2DL4A 2DYIA 4PJLA 4HBWA 3OYGA 3CC2T 1YITQ 2LCSA 5EG2A 3U23A 1YJWA 5KE3A 2MMPA 5FG6A 3OYBA 1JB0E 3CC7T 4M77E 2OJ2A 4NYXA 2FRYA 2DRMA 8ATCB 3QYGB 4O5VA 4DEXA 2HSEB 1KQ1A 1VQ9Q 3RMSA 2RNAA 3HKSA 3CBPA 1JEGA 4M7DA 1Y7XA 3H0IA 3PGGA 1PSEA 2RHUA 4XTUA 3LH0A 2LQWA 2D1XA 3LGFA 5HELA 3OS5A 1SHFA 3CCVT 3SWNB 3UF4A 3GF5A 4FW1A 4RTYA 1TOVA 3NTIA 1PKSA 4YYIA 1G3YA 1N9RA 1UTIA 3RBBB 5GANd 2H3EB 5EV9A 3X24B 1OI1A 5DYCA 5EM3A 5I80A 1UB4A 2YDWA 4A9NA 2DLPA 2K3XA 3OMCA 4HXPA 1ARKA 5LJ5g 1YCSB 5II2A 4O74A 3CCRA 2CDTA 1K9MU 3IU6A 2DEQA 5KYXB 1RL2A 1NLOC 1VQ7Q 5FBXA 5KYWA 3QYHB 1OOTA 1ZLMA 2FHDA 4YC9A 5GAOl 2RHXA 2HDAA 4HXOA 3G4SA 1WHKA 1K73U 2P84A 2JTEA 2MOXA 1WLPB 5I7XA 1R0CB 4DQ2A 3CCMT 5F61A 3D7SB 3LQJA 2BZXA 4VUBA 2D9EA 5J39A 4ZTFA 1KQSS 2GNCA 3DLMA 1VQNQ 1PD1A 2E3HA 4M75C 4E7JA 2O9SA 2F5KA 1H92A 5FDZA 1KQSA 4KGZB 1KK7A 5IGLA 5D3HA 5HFQA 1OPLA 2L2PA 3CC2Q 1EFNA 1MMGA 5D3LA 3LH5A 4BW2A 4LD9K 1C0MA 2HBWA 5L99A 2ESWA 4PJJA 2O4XB 5IGKA 1TSFA 2AHJB 3G0LA 3CCJT 3OYAA 5D6WA 1QCOA 5E9YA 3HMEA 4HA8A 2MK5A 2A37A 3QPHA 1QCFA 2KNBB 5IXBA 1VOMA 1X69A 2LQ8A 5L97A 1PG5B 4YY6A 2FZKB 1QKWA 2MI6A 2VB6A 3IQLA 5KYNA 1WHMA 3GLXA 3CCST 4QW2A 1I81A 5L23A 3E1SA 1AEYA 2OAUA 4OGIA 4AT1B 5D25A 5ENBA 3CPWS 2K57A 4IIOA 4LE9A 2KT8A 4IR5A 3PT9A 4J0RA 5HQ7A 5DKHA 2L89A 2EQKA 1NJIR 1E7OA 3HL8A 4DBQA 3ZEHA 2QEXT 3M57A 2KI7A 5HEMA 3VU3C 5IXFA 4XU0A 2DM1A 3O36A 3M5AA 4LYWA 5GMKj 3HMHA 2HMAA 1VQ5Q 3META 3QXEB 2FVUA 2FG0A 3QKJA 3K2JA 5EP7A 4M78D 4AKGA 3H9NA 4J6WA 5DM7R 3D7CA 4QEUA 1MGQA 1JJ2S 1G5VA 5DYAA 3INZA 1G3SA 3MKDA 5EWWA 3JCMc 5IAYA 2RI3A 2GGRA 5GAMd 5KCOA 3OYLA 4NXJA 5EU1A 5DLQE 4ZN1A 2NUPA 2K3YA 1BI3A 5LJ3d 2RO1A 5L8RE 4AG1C 4J9CA 5I83A 2B8AA 2V26A 4HCZA 3E9FA 2HQEA 4CRIA 1D1BA 2A3LA 3MULA 1AWXA 2O01E 1LJOA 4EMKB 3G6ET 1VA7A 3TLPA 4J9FA 2CT4A 4HVWA 2LTOA 4J9BA 1YHQQ 2Z0WA 4BE1A 4WTOB 5DW2A 1IXDA 1SKUB 1PM3A 5ENFA 4FLPA 4PY6A 4WHUA 5LJ2A 4ZTJA 4TVRA 4YBSA 5FH6A 5IH2A 2CUBA 4J8OA 1RLPC 3JCMP 1MNDA 2M0OA 2KYMA 4OMMA 2DETA 3M0PA 3I56A 2EJ9A 4FM4B 3GPLA 1I5LA 2YWWA 1YIJQ 1KC8R 1T0HA 3BFMA 3UVYA 2ZAEA 4A4HA 5CKDA 2YW5A 5F62A 1BCOA 4XUAA 3OYIA 2EKOA 5GMKm 4A9KA 4CFKA 1VQ8A 5F1HA 3M58A 4YY4A 4OMPA 1UGSB 2DTOA 2E5KA 3PFSA 2J6OA 3SEMA 4ALHA 3CEYA 2V1RA 1WXTA 5KU3A 2JS0A 4QSWA 4FYYB 5AYFA 2OTLT 4OUFA 5F3AA 1FWZA 5ENJA 3IU5A 1M5Q1 3DWYA 2DYBA 3EGXA 1YI2A 1QKXA 4IURA 4YYKA 4TT4A 5L8TA 1VQ6Q 1IGUA 3JVMA 2KROA 3HRSA 2JS2A 2F2WA 4HKEA 4C92G 3JVJA 1K9AA 3OYCA 4YYNA 2XICA 1CKBA 3M59A 2H3JA 5GANe 5CQ4A 1I4K1 4L6V5 5IHIA 1VQLT 4K11A 2K3BA 3L2UA 5A5QA 2RQRA 5CUDA 3CCQT 2LC4A 3KBGA 1WIEA 4PKLA 4EPCA 3O34A 3EHQA 3JAME 3BY7A 1BCMA 2RMOA 5J26A 1VQMT 1K9MR 2ROTA 4XY8A 3OYDA 3TREA 1QVGS 2YHTA 3MP1A 4ZW1A 2WP1A 4OMOA 4C67A 5LJ5d 1I5OB 5D24A 3I5RA 3CXCS 1G3TA 1K76A 1HD3A 1MUZA 5KO4A 1NYGA 1ZSGA 2EYXA 5IHKA 4C8QC 4BI3A 5DY7A 1PCXA 4O7EA 1UG1A 2HZYA 3M0TA 3U5PA 4NRCA 1BU1A 2FEIA 2QA4Q 4KV1A 1K73R 4RUGA 3I55A 3VUBA 4PK4A 2DIGA 2X4XA 5CIUA 2E7NA 2MF2A 1OULA 2LCLA 3VKIA 4RTXA 5HK3A 1WUMA 4J9GA 4OB2B 4AKHA 1OU8A 4BW3A 1Q86U 3U5NA 4QSQA 4C8QD 4YK0A 1XJWB 1WXBA 1H8KA 3AT1B 2KAFA 1M1FA 1HSQA 4RTVA 3PE0A 2EJFA 4IUQA 4IR6A 1D3BB 4TU4A 2EWNA 2EYZA 4M75F 2DD4A 1MV0B 5C8GA 4QSTA 5LKZA 4JS4A 2OTLQ 1VQOA 2JW4A 2RNXA 3H41A 2WSFE 3SHWA 2DKWA 5CTLA 3CMEA 5TB6A 4M77B 5IT9E 4UYDA 3JCMX 2AK5A 3RKYA 3L2WA 4UYFB 4F16A 4PJOB 3L42A 5FH8A 4XTVA 1M1KR 2KR3A 1BYMA 2YT6A 3LJWA 5JI8A 3MEAA 3A8LB 2FZCB 3DKMA 2P4RA 2QTVA 3OYKA 2JM9A 1ZUUA 2MPXC 4GLKA 5CQAA 3CMAT 2V8IA 1N27A 1RAGB 4JRIA 1UGVA 4N4FA 2LT4A 3U5JA 3QDRB 5D3NA 5AMEA 4ESRA 4AKIA 5CQ5A 1VQ7A 5E3GA 2ZPIB 2KDSA 2ECZA 2M51A 1YJNT 1GCQC 5F2PA 3CBOA 5A85A 1VQ4Q 3SWNC 1TXQA 4XTWA 1AZEA 3Q2FA 1QW1A 1PHTA 1LNXA 2IIMA 4EDUA 4F7UF 4M78F 3FLGA 3OY9A 1YCYA 2RHYA 2XG8D 4X34A 1TS9A 3EGUA 4LDYA 4XY9A 2L84A 2BZYA 3JB9G 2XI9A 2L3QA 3EGDB 4KGVB 4Z02A 4JUVA 2C0TA 4NQNA 5IGMA 1VQNA 3VRYA 5BT3A 2E41A 5CKBA 1YJ9A 3OS2A 2R0SA 5C89A 1QMCA 4X2IA 5LJ3e 2BIVA 5AMFA 5HM0A 3UPUA 1RUWA 5CQ6A 2EQIA 3HMFA 5EI4A 4FYWB 2XDBA 2PUOB 4FW2A 1WJQA 3CC2A 1WZOA 3O35A 2M16A 3U5MA 4B9XA 2BTTA 3X25B 2OTJQ 2JXBA 1Y57A 1I07A 4KRTA 3CC7A 4UIYA 1G3WA 1I0CA 2RJDA 1H3ZA 1D3BA 3CCET 2M1HA 4PFZA 2RD1A 3VS2A 5I2MA 3JB9I 5KYYB 2HQHA 2O9VA 2ZCFB 5E7DA 4OP0A 4A53A 3CCLT 4MEPA 3CCVA 1K8AU 2JNGA 1GFDA 4RKUE 1Q82U 3RKWA 3WVDB 3O5ZA 1CSKA 4NRBA 4XYAA 3UT1A 3MB3A 1SSFA 1G8XA 3LX7A 4C5HA 2JZ2A 4PJOA 5GANh 2I2LA 3SVGA 2K5IA 5HCLA 5HKCA 1UECA 3EHRA 2D8JA 2EYYA 4M77G
chains in the Genus database with same CATH topology
5EK9A 3I55T 5II1A 5ENHA 3PIOA 4TZ8A 1Y96A 5A2QE 4EMHA 4LC2A 4QNSA 2K4YA 1EQFA 4F7UA 4M78A 5LVQA 1N8RU 1S72T 3C94A 4TTEA 4RMOA 4YYJA 4BE2A 2YQDA 3CCMA 2N9GA 1YITT 2HQXA 4TQNA 1U8RA 2P4TA 3H6ZA 4WHWA 4FL6A 4M7DB 4M7AD 4BI4A 1VQ9T 1V29B 4E7HA 3GNFB 5CS8A 4O76A 5CK9A 2RI5A 4NS5A 4O7FA 2HBPA 4OGCA 4C92C 4BD3A 3MO8A 3S92A 3N5BB 2LSPB 2CKKA 5CKHA 3V8JA 3M9QA 3LQHA 5A0GA 4ZC9A 5FFWA 2YLCA 5CUCA 2QI2A 5LJ5e 4QUUA 3CCJA 3UVXA 1BI2A 4QQDA 1NJIC 4C92D 3PNWC 4J7IA 1KD1U 3FEOA 4RCCA 2PUKB 3A8OB 3MEUA 3P8BB 3QHSA 5A0DA 4NR9A 3QIIA 1IZ6A 4LDWA 3FKMX 1NE8A 5GAN5 4MEQA 5F60A 5D26A 3M4YA 4BI8B 4C8QF 2D9TA 3QG1A 1UEBA 5ETDA 4LZRA 2E70A 3Q1JA 2DXBA 1KC8U 2FL7A 4NQMA 1VQNT 5GAN8 5FE1A 2QEXA 2JTFA 2LX9A 4NR4A 3MP8A 3L1AA 1R8OB 2VGMA 3LW5E 2DAQA 4PJOE 3JVKA 4ZGDB 4NYVA 3A5ZB 5LJ3h 4IKFA 3DAIA 2R5AA 3G6EA 2OO1A 1Y07A 4M7DG 2KVQG 4NL3A 4XTZA 3NXBA 1KC8C 2E6ZA 5A81A 4M78E 3QZTA 1WUGA 5FE5A 5CQTA 4BY6C 5IN1A 4YBMA 1X01A 4N0AC 5ENIA 4ZGJB 2XU8A 3JCMQ 2CZ7B 4QR5A 1U1TA 3JCMW 4C8QA 5DX4A 3U5KA 2WP2A 3OYFA 3V7CA 3LLRA 5CVIA 5GAN7 3X20B 3LXJA 1VQ5T 4N4HA 1UGRB 3S3NA 4A9MA 3AADA 1JBMA 1X75C 4QSRA 5IGNA 4BJXA 4PTBA 2ZPFB 2DPPB 2E12A 4GY5A 4OVAA 3UVDA 3OYYA 4LDVA 3L2VA 4UIWA 4TZ2A 5EQ1A 3GNGA 5I86A 3RIRA 2RI2A 4UITA 1HXDA 4MZMA 2OTLA 4C5EA 4JJNK 5C4QA 1YBYA 5FG5A 5LKUA 1YHQT 3FRNA 1EIFA 1K9MC 5HQ5A 3URGA 5FE4A 4M75D 1WJSA 5KE2A 2Y4XA 2L8DA 2QQSA 3P1EA 2RJFA 4O7AA 3GG3A 1VQLA 1K73C 3DLLA 4BHWA 5A5RA 3CCQA 1M1KU 4MZTA 1YIJT 5KTUA 3JCMe 4ALGA 4J5YA 1VQMA 4MMLA 4M77C 2DJZA 4IUVA 5A5SA 5ENCA 5LJ5h 4MR3A 1XOVA 2KTBB 5CGPA 2F6JA 4O78A 3AHUA 2X4YA 4QSVA 1M1GA 4OGEA 4QSPA 1FX7A 3HRTA 4M7AF 5DW1A 5EGUA 3HFOA 3L2RA 3O37A 4M7DE 3TCJA 1KHIA 4MDWA 2Y4YA 3WXMB 3NTKA 4QC3A 2IVWA 1F68A 1VQ6T 2ZPEB 5H1TA 2RI7A 5FH7A 2V8KA 3LWHA 5EWCA 4A4KA 5GAOr 1WGSA 2F5TX 2M9UA 2EYQA 4NRAA 2E10A 5LJ0A 5FFYA 5A5OA 4C92F 4QEVA 5I2SA 4P5NA 2NLUA 3VYHB 5I1QA 2ZPGB 3FB9A 1ZQ1A 3VYGA 3ASKA 3LQIA 1HK9A 5CQ7A 2PU9B 2QA4T 5HRWA 2X35A 3CMAA 5HFRA 3M56A 4YYMA 4IOOA 3PMTA 2RO0A 3UDCA 2K5FA 2GQVA 3SDZA 2QQBA 3JB9H 2RNWA 2RM4A 3P1DA 1YJNA 3UV2A 5DFCA 3J80E 1QP3A 3BDUA 2JOYA 1JM4B 2PVDB 1OZ3A 3QZSA 4J83A 5KHMA 1Y71A 5FU6B 3A8MB 2EAYA 4M7AA 4FIBA 4HBYA 1M90U 4X9CA 3JCMJ 5G4RA 3HP9A 4TT6A 2HD0A 5A5NA 4YYGA 2DIQA 4HXNA 5ETBA 5TCMA 5GAOm 2DZCA 3RMQA 5D3JA 3CCEA 5A7CA 5GANj 3C12A 4UYGA 4B9WA 2QDYB 5CUGA 4KV4A 3CCLA 5EPSA 4LYSA 5KCHA 4ZQLA 2ZPBB 2XK0A 5LVRA 1VQ4T 4FT2A 5CKEA 4CUUA 2Y90A 4Z6HA 4QSXA 4OF1A 4E7LA 5EPBA 5L96A 4JRPA 4E7IA 2E3KA 3C4SA 2LRQA 3JCMh 5EPRA 4QVDA 3QZ9B 5HRVA 5ENEA 4IUTA 4PS5A 5D3TA 4LZSA 2YLBA 1XTDA 1S72A 4UIXA 1YITA 5E74A 4ELZC 5F36A 2OTJT 3SVHA 3EFRA 4A9EA 4NR6A 3S91A 4NUDA 2X4WA 5E9MA 1VQ9A 4QSUA 5DYXA 3OSSC 4CUPA 3X26B 5FE3A 2KSSA 1Q81U 3M54A 5D7XA 2K5LA 2PVGB 3MQMA 3RUXA 2P0QA 5DLOA 3MHXA 3V7RA 4KUIA 2GCXA 2X4JA 2DKGA 2DTIA 1Q86C 5FLXE 1Y96B 2VC8A 2LCCA 4M7AE 5L98A 2E65A 2CS7A 2YEKA 2PVOB 4F7UB 4M78B 4HT9A 5FE6A 3RCWA 3TU4K 1QP2A 2WSCE 5A5PA 2MJVB 1Q7YU 5I21A 2P0PA 3E9GA 3GP8A 5EWDA 4YYHA 5I89A 4IORA 4XTYA 3CC4T 4EMGA 5EWHA 4DA4A 4OMFB 4KCXA 5GAMe 2VGNA 5C7NA 4FSXA 5GAMj 5CUAA 2EJGA 5HLSA 4C5IA 5LJ3j 3OYHA 4YH4A 4CUQA 2CZ6B 2XHCA 4M75A 4IUPA 5K29A 2G4AA 5GAOp 2RNYA 5FE9A 4UC4A 2FB7A 5DBMA 2ZZDA 4O71A 3LYIA 2RJCA 2H60A 3M53A 4HCCA 4MMKA 3OS1A 2DTHA 3F70A 4LRGA 1PSFA 1NPRA 5BT4A 3NTHA 5C87A 4IUUA 4DOVA 2JTMA 5GAN3 5H1UA 4QEWA 3CD6T 3DB3A 4Z1SA 5LL6S 4Y03A 2GF7A 4PJOG 4IR3A 2CZ0B 2WACA 1O9SA 4CUTA 2DVSA 2R0YA 3FJPA 2RS9B 3MUKA 1UGPB 4J7FA 3UVWA 5J0DA 1VQ5A 2RK2A 4F7UG 4M78G 4MR6A 5FE0A 2XDDA 4O75A 5EWVA 1K8AC 2JUFA 1Q82C 3GIBA 4NUCA 4WIVA 2R0VA 4YABA 4NR7A 4KUDK 5I7YA 5C6SA 5A82A 1ZBXA 4PLLA 4RVRA 3PIPA 1YHQA 3QSUA 3QBYA 5CR2A 3L2QA 4C0DB 3ME9A 2CGHA 5FE8A 3CCUT 4BW4A 2EQMA 2A7YA 1N8RC 5LJ5j 4C8QB 2RB6A 4LR6A 2EQJA 4BE0A 1NZ9A 4Z6IA 2GFUA 4EMKC 1YIJA 3S3MA 3G71T 1KQ2A 1VQPT 5CUEA 5HQ6A 5CRMA 1AHJB 2FYKA 2NXBA 5FE2A 3KXTA 3OSVA 4M75E 2RK1A 3O33A 4TT2A 5LKXA 1OYXA 3QZ5B 5H85A 4YYDA 3OBWA 2YYNA 4QSSA 5E73A 2DVRA 4A9JA 4X9DA 1VUBA 3L2ZA 3LGLA 3QUIA 2QQAA 4Z93A 1VQ6A 4JRKA 4CURA 1KD1C 1LOJA 1GXIE 5HJCA 5FG4A 5GAMh 4NYWA 3P8DA 4LD6A 4XU1A 3A8GB 4MR5A 4PKCC 2CYZB 4LDUA 1BI1A 4N4GA 2XD0A 2OSSA 3OA6A 5A0LA 5GAN2 2ZGWA 1UGQB 3HHTB 3P5OA 4XK8E 4PNOA 1W4SA 4F7UE 5EA1A 2E6NA 1FXXA 3G7ZA 4A4GA 4Z1QA 3UW9A 3EFSA 3WVEB 2QA4A 5GMKl 3EAEA 4HXSA 5DKCA 2R5MA 2DXUA 2VUBA 4YADA 5F63A 3M4GA 3VUZA 3A8HB 2R58A 4C8QG 4HCBA 3QJYA 4XAXB 1WQ7A 4OB0B 5EICA 4NR5A 4UYHA 4DONA 5DY9A 3SVFA 2DXCA 4J0SA 3VJPA 3JB9D 5ACYA 4KULA 4HXRA 5E9VA 4JDSA 4OGJA 5LUUA 2YELA 1B34A 5EISA 1VQKT 4A9IA 4RG8A 3OYEA 4E47A 5D3SA 3JCMf 5DFBA 1M8VA 2D0QB 4LDXA 4QR3A 5HRXA 2DATA 3QZVA 3NFCA 4YH3A 4ZGEB 1BI0A 3UV5A 4C5GA 4LYIA 4J6YA 4UIZA 4R56A 1VQ4A 5KTWA 4ZN3A 5FB1A 4Q0OA 4M7AB 4CI0C 4PJOC 1WQWA 3RESA 2E7OA 2IG0A 3SWNA 4YTLA 5FU7B 5H1VA 2GRCA 4M77D 2MWPA 5EVAA 5FB0A 5J3BA 2C06A 4QB3A 4M78C 4PJOD 2QQRA 4JRQA 3HSBA 1O75A 3MCAB 5HENA 5CUBA 4QC1A 4HXLA 3JCMV 3S3OA 3P1FA 3BDLA 3CPWA 1P92A 2OTJA 1M1KC 4NOYA 3OQ5A 5GMKe 4C92B 1QVPA 3M55A 4OB3B 3KUFA 3P1CA 4QYDA 1YJWT 2DXTA 5M9OA 2G3RA 4MR4A 5E9KA 4GPJA 4LZ2A 4C8QE 5I29A 5LKTA 1JJ2A 4A4EA 3HRUA 4TS8A 1DJ7B 2K2VA 3JVLA 3ZYUA 3J81E 2YRVA 4II1A 5C85A 2VV5A 4PL6A 5LJ1A 4A9OA 2L5EA 4QUTA 1X0JA 4ME7A 5FROA 5C0MA 5HK0A 2RH2A 4MENA 3JCMb 3OBYA 2BKDN 4HXMA 2O4XA 1MHNA 3E19A 3CCRT 4N3WA 3J7AF 5G4SA 3H8ZA 5D3RA 5D0CA 4XU3A 1XNIA 4O6JA 5CP5A 4HBXA 4BB7A 4NL2A 3CC4A 3MP6A 3JCMg 3G4ST 1X6OA 4M7AG 1I8FA 4A9FA 5KH6A 5GANf 2D82A 1ZS5A 4QBMA 4NR8A 5CO7A 3S6WA 4UIVA 1N72A 1WNLA 4XUBA 1VIEA 3ZBDA 3GOXA 5CFWA 4C0ZA 5GAN6 3JB9J 4IR4A 2DD5A 4Q0NA 3PMIA 5AD2A 5F25A 4MEOA 3SFMA 4C92A 4M7DC 5AD3A 1H641 3LWIA 4BY6B 5CCAA 4J1PA 4OB1B 1M90C 5COIA 5E3DA 5CPEA 2LNVA 4RCBA 4C0FA 5CQXA 2LDMA 1M9SA 4M7DD 3CD6A 4A9LA 3OYMA 3QO3A 4QZSA 3V7SA 2XIDA 4EMKA 4C0DC 5FFVA 4CUSA 4QVCA 4J6XA 2KY9A 3V8LA 4Y28E 3V8KA 4FT4A 4E7KA 5DFDA 2MWOA 2F69A 3U5OA 5I88A 3O8VA 1QVGA 4KT0E 4M75B 3JB9F 3CXCA 2EIFA 4Q5WA 4YBTA 1NPPA 2VXEA 3JSCA 2OUOA 4TU6A 3JRZA 2RHZA 2KK4A 3P8HA 5IBNA 3FIFA 2MAMA 4ELYC 4R55A 3ZFJA 2XKOC 5FRMA 3OYJA 5IIDA 4QR4A 4KBMB 5GMKh 4UIUA 4BACA 3OYNA 2L85A 4HBVA 5D3PA 3RERA 4O7CA 2HAXA 1BKBA 3CCUA 2LQKA 3OW2S 1IREB 4MDXA 2QQ9A 5BT5A 1XQHA 4DOWA 3G0JA 2DVQA 5CQ3A 2LT1A 3FC3A 1N9SA 1M4ZA 1WPYA 2BUDA 3SB2A 4PCIA 2DVEA 4M77F 5HY6A 2E1HA 3OW2A 2F6NA 1ZHIA 3G71A 3CPFA 4D6WA 5GANg 5ENGA 5CQ8A 3HPWA 4N0AA 5GAMf 1VQPA 2QTXA 4PJOF 5CY9A 1WJRA 4BUGA 5LJ3f 2R57A 3I56T 3TEEA 4L59A 5CU8A 1Q81C 4PCEA 5CAIA 2I7KA 5DLXA 5E0RA 3HFNA 3MEVA 1BIBA 3RKXA 2R10A 4C92E 4TYLA 4O72A 1VQ8T 4QY4A 3ER0A 3AQAA 2RFJA 5F1LA 5CRZA 4E96A 4RG2A 4WF2A 2YEMA 3UWNA 5D6XA 2D6FA 1N6AA 4M75G 2DK3A 2RJEA 1YI2T 4NUEA 4O77A 2L5QA 1Q7YC 1JRIA 4BDYA 3UV4A 4HXKA 5I40A 3T9NA 5FRNA 4LDFA 5KTXA 2DZ9A 4QQ6A 4UYEA 3FDRA 5E9LA 4F3IA 1TH7A 3Q2EA 4N4IA 4M77A 3MXFA 4JLGA 4CL9A 3OB9A 4A54A 1BIAA 3X28B 4UYFA 4CLBA 2DVVA 3OS0A 5FE7A 4C66A 2V8JA 2RA2A 5CKFA 2VXFA 2QXFA 1JSPB 1KG1A 3SD4A 3JCMd 4HT8A 2FSAA 2JN0A 5L8UA 3QJ6A 4JLIA 4M7AC 1U1SA 4YAXA 3C95A 2GFAA 4XTXA 4O70A 2CZ1B 4YATA 1NJIU 4A9HA 1VIFA 3R6OA 2L3RA 5LJ5f 5FU7C 3CBMA 4QVZA 4AKNA 4CFLA 2EQUA 2LVMA 5GAOq 4ATOA 4O7BA 1KHCA 3DB4A 5CQYA 2WSEE 2ZPHB 1VQKA 5GAMg 1VQOT 3VV0A 5IG6A 3CMET 2RHIA 2KQWA 1OZ2A 5GAOn 4IOQA 5LJ3g 4M7DF 5DLZA 4JS5A 5GMKi 2XDPA 3PTAA 1W2BS 1E6IA 4QQGA 4PLIA 3ONIA 4BDZA 3OMGA 5D6YA 4XU2A 1W2BA 4FU6A 3MB4A 1QVFS 1VQ7T 5CZGA 2EFIA 3U5LA 4C0GA 4V2SA 2VYTA 4Y91A 4A4FA 5F5ZA 4QYLA 1QVFA 3CCSA 3I3JA 2HNIA 2PQWA 5DKDA 1RI0A 2E64A 1B34B 4MZPA 2KMTA 4XQ3A 2I8NA 2JVVA 2DO3A 4L5GA 5E9IA 5DYUA 5A83A 2P0KA 5JWMA 4J3IA 5GAN4 2E5QA 1YJ9T 3BW1A 5FU6C 2DWWA 4BW1A 4HBWA 3OYGA 3CC2T 5EG2A 1YJWA 5KE3A 2MMPA 5FG6A 3OYBA 1JB0E 3CC7T 4M77E 4NYXA 3QYGB 4O5VA 1KQ1A 3RMSA 3HKSA 3CBPA 4M7DA 1Y7XA 3PGGA 1PSEA 2RHUA 4XTUA 3LH0A 3LGFA 5HELA 3OS5A 3CCVT 3SWNB 3GF5A 3NTIA 4YYIA 1G3YA 1N9RA 5GANd 5EV9A 3X24B 1OI1A 5DYCA 5EM3A 5I80A 1UB4A 2YDWA 4A9NA 2K3XA 3OMCA 4HXPA 5LJ5g 5II2A 4O74A 3CCRA 1K9MU 3IU6A 2DEQA 1RL2A 5FBXA 3QYHB 2FHDA 4YC9A 5GAOl 2RHXA 4HXOA 3G4SA 1K73U 5I7XA 4DQ2A 3CCMT 5F61A 3LQJA 4VUBA 2D9EA 5J39A 4ZTFA 1KQSS 3DLMA 4M75C 4E7JA 2F5KA 5FDZA 1KQSA 5IGLA 5D3HA 5HFQA 5D3LA 4BW2A 4LD9K 5L99A 2O4XB 5IGKA 2AHJB 3G0LA 3CCJT 3OYAA 5D6WA 5E9YA 3HMEA 4HA8A 3QPHA 2LQ8A 5L97A 4YY6A 2MI6A 3GLXA 3CCST 4QW2A 1I81A 3E1SA 2OAUA 4OGIA 5D25A 5ENBA 3CPWS 2K57A 4IR5A 3PT9A 4J0RA 5HQ7A 5DKHA 2L89A 2EQKA 3HL8A 3ZEHA 2QEXT 3M57A 5HEMA 3VU3C 4XU0A 3O36A 3M5AA 4LYWA 5GMKj 3HMHA 3META 3QXEB 2FVUA 3QKJA 3K2JA 5EP7A 4M78D 4J6WA 5DM7R 3D7CA 4QEUA 1MGQA 1JJ2S 1G5VA 5DYAA 3INZA 1G3SA 5EWWA 3JCMc 5IAYA 2RI3A 5GAMd 5KCOA 3OYLA 4NXJA 5EU1A 5DLQE 4ZN1A 2K3YA 1BI3A 5LJ3d 2RO1A 5L8RE 5I83A 2B8AA 4HCZA 3E9FA 2HQEA 4CRIA 2A3LA 3MULA 2O01E 1LJOA 4EMKB 3G6ET 3TLPA 2LTOA 4BE1A 5DW2A 5ENFA 4FLPA 4PY6A 4WHUA 5LJ2A 4ZTJA 4TVRA 4YBSA 5FH6A 4J8OA 3JCMP 2M0OA 3I56A 2EJ9A 4FM4B 3GPLA 1I5LA 3BFMA 3UVYA 5CKDA 4A4HA 2YW5A 5F62A 4XUAA 3OYIA 2EKOA 5GMKm 4A9KA 4CFKA 1VQ8A 5F1HA 3M58A 4YY4A 1UGSB 2DTOA 3PFSA 4ALHA 3CEYA 5KU3A 4QSWA 5AYFA 2OTLT 4OUFA 5F3AA 1FWZA 5ENJA 3IU5A 1M5Q1 3DWYA 1YI2A 4IURA 4YYKA 4TT4A 5L8TA 3JVMA 3HRSA 4HKEA 4C92G 3JVJA 3OYCA 4YYNA 2XICA 3M59A 2H3JA 5GANe 5CQ4A 1I4K1 4L6V5 1VQLT 3L2UA 5A5QA 3CCQT 5CUDA 2LC4A 3KBGA 4PKLA 4EPCA 3O34A 3JAME 3BY7A 5J26A 1VQMT 4XY8A 3OYDA 3TREA 1QVGS 2YHTA 3MP1A 4ZW1A 2WP1A 4C67A 5LJ5d 3CXCS 5D24A 1G3TA 5KO4A 4C8QC 4BI3A 5DY7A 4O7EA 3U5PA 4NRCA 4KV1A 3I55A 3VUBA 2DIGA 2X4XA 5CIUA 2E7NA 2MF2A 2LCLA 5HK3A 3VKIA 1WUMA 4OB2B 4BW3A 1Q86U 3U5NA 4QSQA 4C8QD 4YK0A 2KAFA 1M1FA 2EJFA 4IUQA 4IR6A 1D3BB 4TU4A 2EWNA 4M75F 2DD4A 5C8GA 4QSTA 5LKZA 4JS4A 1VQOA 2RNXA 3CMEA 2WSFE 5IT9E 2DKWA 5CTLA 5TB6A 4M77B 4UYDA 3JCMX 3RKYA 3L2WA 4UYFB 4PJOB 3L42A 5FH8A 4XTVA 1BYMA 3LJWA 5JI8A 3MEAA 3A8LB 3DKMA 3OYKA 4GLKA 5CQAA 3CMAT 2V8IA 1N27A 4JRIA 4N4FA 2LT4A 3U5JA 3QDRB 5D3NA 5AMEA 5CQ5A 1VQ7A 5E3GA 2ZPIB 2KDSA 1YJNT 5F2PA 3CBOA 5A85A 3SWNC 4XTWA 3Q2FA 1QW1A 1LNXA 4EDUA 4F7UF 4M78F 3FLGA 3OY9A 1YCYA 2RHYA 2XG8D 4X34A 4LDYA 4XY9A 2L84A 3JB9G 2XI9A 4Z02A 4JUVA 4NQNA 5IGMA 1VQNA 5BT3A 2E41A 5CKBA 1YJ9A 3OS2A 2R0SA 5C89A 5LJ3e 4X2IA 2BIVA 5AMFA 5HM0A 3UPUA 5CQ6A 3HMFA 5EI4A 2XDBA 2PUOB 1WJQA 3CC2A 3O35A 2M16A 3U5MA 4B9XA 3X25B 3CC7A 4UIYA 1G3WA 2RJDA 1H3ZA 1D3BA 3CCET 2M1HA 2RD1A 5I2MA 3JB9I 2ZCFB 5E7DA 4OP0A 4A53A 3CCLT 4MEPA 3CCVA 1K8AU 2JNGA 4RKUE 1Q82U 3RKWA 3WVDB 4NRBA 4XYAA 3UT1A 3MB3A 1SSFA 3LX7A 4C5HA 2JZ2A 4PJOA 5GANh 2I2LA 3SVGA 2K5IA 5HCLA 5HKCA 3MEWA 4M77G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK9 A;  4LZS A;  3LH0 A;  5M9O A;  3LGF A;  5HEL A;  5II1 A;  2G3R A;  5ENH A;  4MR4 A;  4UIX A;  5E9K A;  5E74 A;  4GPJ A;  3NTI A;  5F36 A;  4LZ2 A;  4YYI A;  4TZ8 A;  3SVH A;  4LC2 A;  5I29 A;  5EV9 A;  4QNS A;  5LKT A;  4A4E A;  4A9E A;  4NR6 A;  3S91 A;  1OI1 A;  4NUD A;  4TS8 A;  1EQF A;  3JVL A;  5DYC A;  5EM3 A;  3ZYU A;  5I80 A;  5E9M A;  2X4W A;  4QSU A;  5LVQ A;  2YDW A;  5DYX A;  4A9N A;  2K3X A;  2YRV A;  5C85 A;  4II1 A;  4CUP A;  3OMC A;  4HXP A;  4PL6 A;  4TTE A;  5LJ1 A;  4YYJ A;  4A9O A;  4BE2 A;  2YQD A;  5II2 A;  2N9G A;  2L5E A;  4QUT A;  2HQX A;  1X0J A;  4O74 A;  5FRO A;  5C0M A;  5FE3 A;  3IU6 A;  4TQN A;  5FBX A;  3H6Z A;  4WHW A;  4FL6 A;  2FHD A;  5D7X A;  4YC9 A;  3MQM A;  2RHX A;  4E7H A;  5CS8 A;  4MEN A;  4HXO A;  4O76 A;  2BKD N;  5I7X A;  2RI5 A;  4HXM A;  2O4X A;  1MHN A;  4NS5 A;  4N3W A;  4O7F A;  5F61 A;  3LQJ A;  2LCC A;  5G4S A;  2D9E A;  5L98 A;  3H8Z A;  5J39 A;  2YEK A;  5D3R A;  5D0C A;  4BD3 A;  1XNI A;  4ZTF A;  3MO8 A;  3S92 A;  3DLM A;  5CP5 A;  4HBX A;  2LSP B;  2CKK A;  3MP6 A;  4E7J A;  2F5K A;  3M9Q A;  4IUT A;  3LQH A;  5FE6 A;  3RCW A;  4ZC9 A;  5FDZ A;  5FFW A;  5CUC A;  4QUU A;  4A9F A;  5IGL A;  5KH6 A;  5A5P A;  5D3H A;  2MJV B;  5HFQ A;  2D82 A;  1ZS5 A;  3UVX A;  3E9G A;  4QQD A;  5EWD A;  4QBM A;  5D3L A;  3PNW C;  4BW2 A;  4NR8 A;  4YYH A;  3FEO A;  5I89 A;  4UIV A;  1N72 A;  4IOR A;  3S6W A;  5L99 A;  4XUB A;  3MEU A;  5EWH A;  3GOX A;  4KCX A;  5CFW A;  2O4X B;  4NR9 A;  5IGK A;  3QII A;  5C7N A;  3G0L A;  3FKM X;  4IR4 A;  4Q0N A;  3OYA A;  3PMI A;  5D6W A;  4MEQ A;  5E9Y A;  3HME A;  5CUA A;  5D26 A;  5F60 A;  5AD2 A;  5F25 A;  4MEO A;  2D9T A;  5HLS A;  5ETD A;  4C5I A;  3OYH A;  4LZR A;  4YH4 A;  5AD3 A;  3Q1J A;  4CUQ A;  4IUP A;  4J1P A;  5L97 A;  4YY6 A;  5K29 A;  2G4A A;  4NQM A;  2RNY A;  4QW2 A;  5FE9 A;  4UC4 A;  5COI A;  5E3D A;  5FE1 A;  5DBM A;  2JTF A;  5CPE A;  4OGI A;  5D25 A;  5ENB A;  2LDM A;  4O71 A;  3LYI A;  2RJC A;  2H60 A;  4IR5 A;  4J0R A;  4NR4 A;  5HQ7 A;  4A9L A;  3MP8 A;  3OYM A;  5DKH A;  2L89 A;  2EQK A;  4QZS A;  3OS1 A;  3F70 A;  3ZEH A;  5FFV A;  4LRG A;  4CUS A;  5BT4 A;  5HEM A;  2DAQ A;  3NTH A;  5C87 A;  4IUU A;  4E7K A;  3O36 A;  5DFD A;  4LYW A;  2MWO A;  3JVK A;  3HMH A;  5H1U A;  4QEW A;  3MET A;  3U5O A;  5I88 A;  4NYV A;  3QKJ A;  3K2J A;  5EP7 A;  4IKF A;  3O8V A;  3DB3 A;  3D7C A;  4QEU A;  1G5V A;  5DYA A;  4Z1S A;  4Y03 A;  3DAI A;  5EWW A;  2GF7 A;  2OO1 A;  2R5A A;  2RI3 A;  2RHU A;  4Q5W A;  4IR3 A;  5IAY A;  4YBT A;  2WAC A;  3NXB A;  5KCO A;  3OYL A;  4NXJ A;  5EU1 A;  5A81 A;  2K3Y A;  4CUT A;  2RO1 A;  5I83 A;  3QZT A;  2B8A A;  1WUG A;  2DVS A;  5FE5 A;  2R0Y A;  2HQE A;  3E9F A;  4HCZ A;  4CRI A;  5CQT A;  3MUL A;  2OUO A;  2RS9 B;  3MUK A;  4TU6 A;  3UVW A;  5J0D A;  2RHZ A;  5IN1 A;  4YBM A;  3P8H A;  3TLP A;  5ENI A;  5IBN A;  4MR6 A;  2LTO A;  4BE1 A;  5FE0 A;  4QR5 A;  5DW2 A;  4O75 A;  5EWV A;  5FRM A;  5DX4 A;  3OYJ A;  3U5K A;  5IID A;  4QR4 A;  5ENF A;  2WP2 A;  3OYF A;  3LLR A;  4UIU A;  4FLP A;  4PY6 A;  3OYN A;  4BAC A;  4WHU A;  3LXJ A;  2L85 A;  4NUC A;  5LJ2 A;  4HBV A;  4ZTJ A;  4N4H A;  4YBS A;  3S3N A;  4WIV A;  2R0V A;  5D3P A;  5FH6 A;  4O7C A;  4A9M A;  4YAB A;  3AAD A;  4NR7 A;  4QSR A;  5I7Y A;  5IGN A;  4BJX A;  5C6S A;  5A82 A;  4PTB A;  2M0O A;  4PLL A;  4GY5 A;  4OVA A;  4RVR A;  3UVD A;  5BT5 A;  3L2V A;  3G0J A;  2DVQ A;  5CQ3 A;  4UIW A;  3FC3 A;  4TZ2 A;  3QBY A;  5EQ1 A;  2BUD A;  4PCI A;  3L2Q A;  3UVY A;  2F6N A;  5I86 A;  5ENG A;  3ME9 A;  2RI2 A;  4UIT A;  5CQ8 A;  4A4H A;  5FE8 A;  2YW5 A;  5F62 A;  4BW4 A;  2EQM A;  4C5E A;  4XUA A;  3OYI A;  5CY9 A;  1WJR A;  5C4Q A;  2EKO A;  2R57 A;  4A9K A;  4CFK A;  5F1H A;  5FG5 A;  5LKU A;  4YY4 A;  4LR6 A;  2EQJ A;  5HQ5 A;  3PFS A;  5FE4 A;  4L59 A;  4BE0 A;  4ALH A;  3CEY A;  4Z6I A;  5CU8 A;  4PCE A;  1WJS A;  2GFU A;  3S3M A;  2I7K A;  5KU3 A;  5DLX A;  5KE2 A;  5E0R A;  4QSW A;  2L8D A;  2QQS A;  3MEV A;  3P1E A;  5CUE A;  2RJF A;  2R10 A;  4OUF A;  5F3A A;  4TYL A;  5ENJ A;  5HQ6 A;  4O7A A;  3GG3 A;  4O72 A;  5CRM A;  3IU5 A;  4QY4 A;  3DWY A;  2NXB A;  3AQA A;  4BHW A;  5A5R A;  5FE2 A;  4IUR A;  2RFJ A;  5F1L A;  4YYK A;  4TT4 A;  5L8T A;  3O33 A;  4TT2 A;  5CRZ A;  5LKX A;  1OYX A;  3JVM A;  4E96 A;  5KTU A;  4ALG A;  4RG2 A;  5H85 A;  3JVJ A;  3OYC A;  2YEM A;  4YYN A;  4YYD A;  3UWN A;  5D6X A;  2YYN A;  4QSS A;  5CQ4 A;  5E73 A;  4IUV A;  5A5S A;  2DVR A;  4A9J A;  5ENC A;  2RJE A;  4MR3 A;  3L2U A;  2KTB B;  5A5Q A;  5CUD A;  5CGP A;  4NUE A;  4PKL A;  4O77 A;  3O34 A;  3LGL A;  2F6J A;  4O78 A;  2X4Y A;  4QSV A;  5J26 A;  4BDY A;  4Z93 A;  4QSP A;  4XY8 A;  3OYD A;  3MP1 A;  4ZW1 A;  4CUR A;  2WP1 A;  4C67 A;  5D24 A;  5DW1 A;  5EGU A;  4HXK A;  3UV4 A;  3L2R A;  5HJC A;  5FG4 A;  3O37 A;  5I40 A;  5KO4 A;  5FRN A;  4LDF A;  4NYW A;  5KTX A;  3P8D A;  4LD6 A;  5DY7 A;  4O7E A;  4MR5 A;  4QQ6 A;  4UYE A;  3U5P A;  4NRC A;  3FDR A;  4N4G A;  5E9L A;  4KV1 A;  4F3I A;  2OSS A;  3OA6 A;  3NTK A;  4QC3 A;  3Q2E A;  4N4I A;  1F68 A;  5H1T A;  2RI7 A;  3MXF A;  3P5O A;  5FH7 A;  2DIG A;  2X4X A;  5CIU A;  2E7N A;  4CL9 A;  3OB9 A;  5EWC A;  1WUM A;  5EA1 A;  2E6N A;  4UYF A;  4BW3 A;  1WGS A;  4CLB A;  3U5N A;  4QSQ A;  2DVV A;  3OS0 A;  5FE7 A;  4C66 A;  4YK0 A;  4A4G A;  4NRA A;  4Z1Q A;  1JSP B;  5LJ0 A;  5FFY A;  3UW9 A;  5A5O A;  3SD4 A;  2FSA A;  4IUQ A;  5L8U A;  4QEV A;  4IR6 A;  3EAE A;  4TU4 A;  4HXS A;  3QJ6 A;  2NLU A;  5DKC A;  5I1Q A;  2R5M A;  4YAX A;  2GFA A;  4YAD A;  3ASK A;  4O70 A;  5F63 A;  5C8G A;  4YAT A;  3LQI A;  4QST A;  5LKZ A;  5CQ7 A;  4A9H A;  2RNX A;  2R58 A;  2DKW A;  5CTL A;  5HRW A;  5TB6 A;  2X35 A;  4UYD A;  5HFR A;  2L3R A;  4YYM A;  4IOO A;  4QVZ A;  3PMT A;  2RO0 A;  3L2W A;  4AKN A;  4UYF B;  4CFL A;  2EQU A;  2LVM A;  4O7B A;  1KHC A;  5EIC A;  3DB4 A;  4NR5 A;  4UYH A;  5FH8 A;  3L42 A;  4DON A;  3LJW A;  5JI8 A;  2RNW A;  3MEA A;  3P1D A;  3UV2 A;  3SVF A;  5DFC A;  3OYK A;  5IG6 A;  2RHI A;  4J0S A;  1OZ2 A;  5CQA A;  4IOQ A;  5ACY A;  1N27 A;  4HXR A;  4N4F A;  1JM4 B;  1OZ3 A;  3QZS A;  5DLZ A;  5E9V A;  4OGJ A;  5D3N A;  5AME A;  5LUU A;  5KHM A;  3U5J A;  2YEL A;  5EIS A;  5CQ5 A;  2XDP A;  4HBY A;  5E3G A;  5G4R A;  4A9I A;  3OYE A;  1E6I A;  4TT6 A;  4QQG A;  4PLI A;  5D3S A;  3ONI A;  4BDZ A;  5F2P A;  5A85 A;  5A5N A;  5DFB A;  3OMG A;  3Q2F A;  5D6Y A;  4YYG A;  4EDU A;  4QR3 A;  4FU6 A;  3FLG A;  5HRX A;  3OY9 A;  2DAT A;  2RHY A;  3MB4 A;  3QZV A;  4X34 A;  2DIQ A;  4HXN A;  4YH3 A;  4XY9 A;  2L84 A;  5CZG A;  3UV5 A;  2EFI A;  5ETB A;  3U5L A;  5TCM A;  2VYT A;  4C5G A;  4LYI A;  4A4F A;  4Z02 A;  5F5Z A;  4NQN A;  5IGM A;  4QYL A;  4UIZ A;  5BT3 A;  5D3J A;  3I3J A;  3OS2 A;  5A7C A;  5KTW A;  2R0S A;  5C89 A;  2PQW A;  4X2I A;  5DKD A;  5FB1 A;  1RI0 A;  4Q0O A;  5AMF A;  5HM0 A;  2BIV A;  5CQ6 A;  3HMF A;  4PS5 A;  4UYG A;  5EI4 A;  4B9W A;  1WJQ A;  5CUG A;  2I8N A;  3O35 A;  2M16 A;  3U5M A;  4B9X A;  4KV4 A;  5E9I A;  5DYU A;  5EPS A;  5A83 A;  2E7O A;  4LYS A;  5JWM A;  2IG0 A;  2P0K A;  5KCH A;  4ZQL A;  4J3I A;  4UIY A;  2XK0 A;  5LVR A;  2E5Q A;  2RJD A;  5H1V A;  2GRC A;  1H3Z A;  2MWP A;  4QYD A;  5EVA A;  2M1H A;  5FB0 A;  2DWW A;  4BW1 A;  4QB3 A;  4HBW A;  4CUU A;  3OYG A;  2QQR A;  5HEN A;  5CUB A;  4Z6H A;  4QSX A;  4QC1 A;  5KE3 A;  5E7D A;  5FG6 A;  4E7L A;  4MEP A;  5EPB A;  4HXL A;  5L96 A;  3OYB A;  4E7I A;  3S3O A;  3P1F A;  3BDL A;  2E3K A;  4NYX A;  3C4S A;  2LRQ A;  4NRB A;  4XYA A;  5EPR A;  3OQ5 A;  3UT1 A;  3MB3 A;  1SSF A;  5HRV A;  3LX7 A;  4C5H A;  2JZ2 A;  5ENE A;  3SVG A;  5HCL A;  3MEW A;  3KUF A;  3P1C A;  5D3T A; 
#chains in the Genus database with same CATH topology
 5EK9 A;  3I55 T;  2EKH A;  5II1 A;  5ENH A;  2K7A A;  3PIO A;  4TZ8 A;  1GRI A;  1Y96 A;  5A2Q E;  4EMH A;  4LC2 A;  4QNS A;  1C6V X;  2K4Y A;  1M90 R;  1D1C A;  1EQF A;  4F7U A;  4M78 A;  5LVQ A;  1B7T A;  1N8R U;  1S72 T;  1WX6 A;  3C94 A;  4TTE A;  4RMO A;  1K4U S;  4YYJ A;  4BE2 A;  2YQD A;  4D8D A;  2N9G A;  3CCM A;  1YIT T;  2HQX A;  2PZ1 A;  4D8K A;  4TQN A;  1G83 A;  1U8R A;  2P4T A;  3H6Z A;  4WHW A;  4FL6 A;  3CC4 Q;  4M7D B;  2AZS A;  4M7A D;  3NPF A;  4BI4 A;  1VQ9 T;  1V29 B;  5KYU A;  2J06 A;  4E7H A;  3GNF B;  5CS8 A;  4O76 A;  5CK9 A;  4RTZ A;  2RI5 A;  3MEW A;  4RTW A;  2CH4 A;  4NS5 A;  4O7F A;  2HBP A;  4OGC A;  4C92 C;  1IGQ A;  1UE9 A;  1RAC B;  2RN8 A;  4BD3 A;  2LJ0 A;  3MO8 A;  3S92 A;  1X6G A;  4CC2 A;  3N5B B;  2LSP B;  2CKK A;  1R77 A;  5CKH A;  3V8J A;  3M9Q A;  3LQH A;  5A0G A;  4ZC9 A;  3PVL A;  5FFW A;  2HCK A;  2YLC A;  5CUC A;  2QI2 A;  5LJ5 e;  2V1Q A;  2LNH B;  4QUU A;  3CCJ A;  1AT1 B;  3UA7 A;  2CP7 A;  3UVX A;  2CUD A;  1BI2 A;  4QQD A;  1NJI C;  4C92 D;  3PNW C;  1PNJ A;  1PKT A;  4J7I A;  3FEO A;  1KD1 U;  4RCC A;  2PUK B;  5KYY A;  1NEG A;  3A8O B;  3MEU A;  3P8B B;  3QHS A;  5A0D A;  1H3H A;  4NR9 A;  3QII A;  1IZ6 A;  4LDW A;  3FKM X;  1NE8 A;  5GAN 5;  4MEQ A;  5F60 A;  5D26 A;  1HYO A;  3M4Y A;  4BI8 B;  4C8Q F;  2D8H A;  2D9T A;  1UEB A;  3QG1 A;  3CD6 Q;  2C0O A;  5ETD A;  3M0R A;  4LZR A;  2E70 A;  3Q1J A;  2DXB A;  4AFS C;  1KC8 U;  2FL7 A;  4NQM A;  1VQN T;  2F1L A;  2L0A A;  5GAN 8;  5FE1 A;  2QEX A;  2JTF A;  1CKA A;  2LX9 A;  2JMC A;  1K0S A;  1S72 Q;  4NR4 A;  3MP8 A;  3CPW P;  3L1A A;  2RQV A;  4HCK A;  2DIL A;  4OMQ A;  2RPN A;  1R8O B;  1WHH A;  2VGM A;  3LW5 E;  1Q81 R;  2DAQ A;  4PJO E;  1NLP C;  1M3A A;  3JVK A;  4ZGD B;  4NYV A;  3A5Z B;  5LJ3 h;  4IKF A;  2LP5 A;  1UHF A;  3M0Q A;  1AWO A;  1PRM C;  3DAI A;  2R5A A;  3G6E A;  2OO1 A;  1JJ2 P;  1Y07 A;  4M7D G;  2KVQ G;  4AFQ C;  4NL3 A;  4XTZ A;  3NXB A;  1KC8 C;  2E6Z A;  5A81 A;  4M78 E;  3QZT A;  2GBQ A;  1WUG A;  5FE5 A;  5CQT A;  4BY6 C;  4FCY A;  1WHG A;  3CCU Q;  5IN1 A;  4YBM A;  2XMF A;  1X01 A;  4N0A C;  2CRE A;  5ENI A;  4ZGJ B;  1Q7Y R;  2XU8 A;  3JCM Q;  2CZ7 B;  2GTJ A;  4QR5 A;  1BK2 A;  1U1T A;  3JCM W;  4C8Q A;  5DX4 A;  3U5K A;  2WP2 A;  3OYF A;  1JO8 A;  3EG2 A;  5FWB A;  1B07 A;  3LLR A;  5CVI A;  3V7C A;  3X20 B;  4DEY A;  5GAN 7;  3G71 Q;  3LXJ A;  1VQ5 T;  4FSS A;  1VQP Q;  4N4H A;  1UGR B;  1TTH B;  4A9M A;  4A63 B;  3S3N A;  3AAD A;  1JBM A;  1TUD A;  1X75 C;  4QSR A;  5IGN A;  1ABQ A;  4BJX A;  3EG9 B;  2NUP B;  4PTB A;  2ZPF B;  2DPP B;  3EH2 A;  2E12 A;  4GY5 A;  4OVA A;  3UVD A;  3OYY A;  4LDV A;  3L2V A;  1UHC A;  4UIW A;  4TZ2 A;  2SEM A;  5EQ1 A;  2D0N A;  1VYT A;  1MMA A;  3GNG A;  5I86 A;  3RIR A;  2RI2 A;  4UIT A;  1HXD A;  4MZM A;  2OTL A;  4C5E A;  2HL5 C;  1D0X A;  4JJN K;  5C4Q A;  4RTT A;  1KJW A;  1YBY A;  5FG5 A;  5LKU A;  2EGC A;  1YHQ T;  3FRN A;  1EIF A;  1K9M C;  5HQ5 A;  3URG A;  5FE4 A;  2KEA A;  4M75 D;  1K8A R;  1WJS A;  2AZV A;  1Q82 R;  5KE2 A;  2QYZ A;  2Y4X A;  2L8D A;  2QQS A;  3P1E A;  2RJF A;  3MPU B;  4O7A A;  3ZL7 C;  3GG3 A;  1VQL A;  1K73 C;  3DLL A;  1JXO A;  4F04 B;  4BHW A;  5A5R A;  5GJV B;  2KRN A;  3CCQ A;  1M1K U;  2HL3 A;  4MZT A;  1NG2 A;  1YIJ T;  5KTU A;  1YWP A;  1SRL A;  3JCM e;  4ALG A;  4J5Y A;  1VQM A;  4MML A;  1MMD A;  4M77 C;  1F1B B;  4HVV A;  2DJZ A;  1JXM A;  4IUV A;  5A5S A;  1EZZ B;  5ENC A;  1RAF B;  5LJ5 h;  4MR3 A;  1XOV A;  3VS4 A;  2KTB B;  1ZUK A;  1N8R R;  5CGP A;  2F6J A;  4O78 A;  3AHU A;  2X4Y A;  4QSV A;  1M1G A;  4OGE A;  4QSP A;  1FX7 A;  3HRT A;  3VS5 A;  1ZKR A;  4M7A F;  5DW1 A;  5EGU A;  2J6F A;  3HFO A;  3L2R A;  2RQW A;  3O37 A;  1QVG P;  4M7D E;  3CXC P;  3EGX B;  3TCJ A;  1KHI A;  2RF0 A;  4MDW A;  2Y4Y A;  3WXM B;  3NTK A;  1S1N A;  4QC3 A;  2IVW A;  1F68 A;  1OX8 A;  2ZPE B;  1VQ6 T;  5H1T A;  2RI7 A;  2L3S A;  5FH7 A;  2HEQ A;  2V8K A;  3LWH A;  3EG9 A;  5EWC A;  2J6K A;  4KGX B;  1M8M A;  4A4K A;  1X2Q A;  5GAO r;  1WGS A;  2NYS A;  2F5T X;  2M9U A;  2EYQ A;  2DNU A;  1UJY A;  1G2B A;  4NRA A;  2E10 A;  5LJ0 A;  5FFY A;  5A5O A;  1SF9 A;  1LPL A;  4C92 F;  1IB8 A;  4QEV A;  5I2S A;  4P5N A;  2NLU A;  1OU9 A;  5I1Q A;  3VYH B;  1KD1 R;  2ZPG B;  3FB9 A;  1ZQ1 A;  3VYG A;  3ASK A;  1AWJ A;  4QT7 A;  3LQI A;  1SG5 A;  2DER A;  1HK9 A;  2YRC A;  5CQ7 A;  2F2X A;  2PU9 B;  2QA4 T;  5HRW A;  4LNP A;  2X35 A;  2JT4 A;  3CMA A;  5HFR A;  3M56 A;  4YYM A;  4IOO A;  3H0H A;  3PMT A;  2RO0 A;  4CC4 B;  3UDC A;  2K5F A;  2GQV A;  3H0F A;  3SDZ A;  3OW2 P;  2QQB A;  3JB9 H;  1D0Z A;  1QWE A;  2RNW A;  2RM4 A;  3P1D A;  1YJN A;  3VKH A;  3UV2 A;  5DFC A;  3J80 E;  1QP3 A;  3BDU A;  1OEB A;  2JOY A;  1JM4 B;  1W1F A;  1OZ3 A;  3QZS A;  1JU5 C;  2PVD B;  4J83 A;  1HJD A;  5KHM A;  1Y71 A;  5FU6 B;  3A8M B;  2EAY A;  4M7A A;  4FIB A;  4HBY A;  1M90 U;  4X9C A;  1W70 A;  3JCM J;  5G4R A;  4CC3 A;  2EVR A;  2KBT A;  3HP9 A;  4TT6 A;  1TU0 B;  2HD0 A;  1KFZ A;  6AT1 B;  5A5N A;  2DL5 A;  1E6H A;  2DJQ A;  4YYG A;  4EIK A;  4LXC A;  1ZSZ A;  2COY A;  2DIQ A;  4HXN A;  2QGG A;  2DE0 X;  5ETB A;  5TCM A;  5GAO m;  2DZC A;  1NEB A;  2DBM A;  3RMQ A;  5D3J A;  2BE7 D;  3VS6 A;  3CCE A;  5A7C A;  2QGF B;  1D0Y A;  5GAN j;  1ZA1 B;  5D7U A;  1YJW Q;  3C12 A;  4UYG A;  2KXC A;  4B9W A;  2QDY B;  5CUG A;  2EPD A;  4KV4 A;  3CCL A;  5EPS A;  2CP3 A;  4LYS A;  5KCH A;  4ZQL A;  2ZPB B;  3I5S A;  2XK0 A;  5LVR A;  3FJ5 A;  2OI3 A;  1VQ4 T;  4FT2 A;  4JJC A;  5CKE A;  4CUU A;  2ED0 A;  2Y90 A;  2BE9 B;  1V1C A;  4Z6H A;  4QSX A;  1RAD B;  1YFN A;  2CP2 A;  2IPO B;  4OF1 A;  4E7L A;  5EPB A;  5L96 A;  4JRP A;  4E7I A;  1W6X A;  2E3K A;  3C4S A;  2LRQ A;  3JCM h;  5EPR A;  1D1A A;  8AT1 B;  3VS3 A;  2MYS A;  4QVD A;  3QZ9 B;  1YN8 A;  5HRV A;  2YUN A;  5ENE A;  4IUT A;  4PS5 A;  5D3T A;  3VS0 A;  4LZS A;  2YLB A;  1XTD A;  3CCR Q;  2G6F X;  1S72 A;  4UIX A;  1YIT A;  5E74 A;  4ELZ C;  5F36 A;  2OTJ T;  1U3O A;  3SVH A;  3EFR A;  4A9E A;  4NR6 A;  3S91 A;  4NUD A;  1M30 A;  3C0C A;  3G4S Q;  2ROL A;  2X4W A;  5E9M A;  1VQ9 A;  4QSU A;  5DYX A;  3OSS C;  4CUP A;  2ED1 A;  3M0S A;  3X26 B;  5FE3 A;  4AFZ C;  4RTU A;  2KSS A;  1Q81 U;  3M54 A;  2OX7 A;  3BE3 A;  5D7X A;  2K5L A;  1WFW A;  3MQM A;  2PVG B;  3RUX A;  2P0Q A;  5DLO A;  3MHX A;  1OQK A;  3V7R A;  4KUI A;  2GCX A;  2X4J A;  4LN2 A;  2FPE A;  2DKG A;  2DTI A;  1Q86 C;  5FLX E;  2ABL A;  1EX4 A;  1Y96 B;  2VC8 A;  2LCC A;  4M7A E;  5L98 A;  2E65 A;  2CS7 A;  2YEK A;  2O2O A;  3VS1 A;  2PVO B;  4F7U B;  4M78 B;  1B3Q A;  4KH1 B;  4HT9 A;  2QK0 A;  5FE6 A;  3RCW A;  3TU4 K;  1W2B P;  1QP2 A;  2WSC E;  2CP5 A;  5A5P A;  2MJV B;  2DL7 A;  1Q7Y U;  5I21 A;  2P0P A;  3E9G A;  3GP8 A;  1X2K A;  4OML A;  5EWD A;  1IHW A;  4YYH A;  5KYU B;  5I89 A;  4IOR A;  4XTY A;  3CC4 T;  1QVF P;  2A0F B;  4EMG A;  5EWH A;  1SPK A;  4OMF B;  4KCX A;  4DA4 A;  5GAM e;  1LCK A;  1OPK A;  1PD0 A;  2VGN A;  5C7N A;  1KSW A;  4FSX A;  5GAM j;  5CUA A;  2EJG A;  5HLS A;  5FW9 A;  4C5I A;  5LJ3 j;  3OYH A;  4YH4 A;  1VYV A;  4CUQ A;  2CZ6 B;  2XHC A;  3HTR A;  2H8H A;  4M75 A;  4IUP A;  3REB B;  1ZUY A;  1K1Z A;  2X51 A;  2RQU A;  5K29 A;  1U06 A;  2G4A A;  2HKQ B;  5GAO p;  1SRM A;  2RNY A;  5FE9 A;  4UC4 A;  2FB7 A;  1AZG B;  5DBM A;  4J9D A;  2ZZD A;  1KIK A;  2EGE A;  4O71 A;  3LYI A;  2RJC A;  2H60 A;  3M53 A;  4HCC A;  4MMK A;  3OS1 A;  2DTH A;  1YP5 A;  3F70 A;  2DVJ A;  2VKN A;  3E2U A;  4LRG A;  1PSF A;  2JJ9 A;  2NWM A;  1NPR A;  3EG0 A;  1ZBJ A;  5BT4 A;  3NTH A;  4JZ3 A;  1JQQ A;  5C87 A;  4IUU A;  3THK A;  4DOV A;  2JTM A;  5GAN 3;  5H1U A;  2COW A;  4QEW A;  2PTK A;  1FMK A;  3CD6 T;  3DB3 A;  2CSQ A;  2W10 A;  4Z1S A;  5LL6 S;  4Y03 A;  2GF7 A;  4PJO G;  4IR3 A;  4HXJ A;  2CZ0 B;  2WAC A;  1O9S A;  3D1D A;  4CUT A;  2DVS A;  2R0Y A;  3FJP A;  3I9Q A;  1AOJ A;  2RS9 B;  3MUK A;  1UGP B;  2W0Z A;  3UVW A;  4J7F A;  5J0D A;  1VQ5 A;  2JM8 A;  2RK2 A;  3EFO A;  1MMN A;  4F7U G;  4M78 G;  3I56 Q;  4MR6 A;  5FE0 A;  2XDD A;  2YXY A;  4O75 A;  5EWV A;  1K8A C;  2JUF A;  2LMJ A;  1Q82 C;  3GIB A;  2C0I A;  4NUC A;  1M3B A;  1Z9Z A;  4WIV A;  2R0V A;  4YAB A;  2A28 A;  4NR7 A;  4KUD K;  1VQ8 Q;  1FYN A;  5I7Y A;  5C6S A;  5A82 A;  2AIR B;  1ZBX A;  4PLL A;  4RVR A;  3PIP A;  1YHQ A;  3M0U A;  2EBP A;  3ERR A;  3QSU A;  3QBY A;  4DBR A;  1KQS P;  5CR2 A;  3UA6 A;  3L2Q A;  4C0D B;  2AKK A;  3ME9 A;  2CGH A;  5FE8 A;  3CCU T;  4BW4 A;  2EQM A;  2A7Y A;  3VKG A;  1SEM A;  5LJ5 j;  1TWB A;  1YI2 Q;  1N8R C;  4M4Z A;  4C8Q B;  2RB6 A;  4LR6 A;  2EQJ A;  4BE0 A;  1NZ9 A;  4Z6I A;  2DF6 A;  2GFU A;  4EMK C;  1YIJ A;  3S3M A;  3G71 T;  3VRZ A;  3RNJ A;  1KQ2 A;  4AMC A;  2A36 A;  1VQP T;  5CUE A;  3TVT A;  5HQ6 A;  5CRM A;  1AHJ B;  2FYK A;  2NXB A;  1OV3 A;  2KRS A;  1NYF A;  2NUZ A;  5FE2 A;  3REA B;  3KXT A;  1AWW A;  3OSV A;  4M75 E;  2RK1 A;  3GBQ A;  3O33 A;  4TT2 A;  5LKX A;  5HCK A;  1OYX A;  3QZ5 B;  4JJD A;  5H85 A;  4YYD A;  3OBW A;  2YYN A;  4QSS A;  5E73 A;  2DVR A;  4A9J A;  4X9D A;  1VUB A;  1NBE B;  3L2Z A;  3LGL A;  3QUI A;  2QQA A;  1IHV A;  1C1A A;  4FYV B;  2QAZ A;  4Z93 A;  1VQ6 A;  4JRK A;  4CUR A;  1KD1 C;  1LOJ A;  1GXI E;  2KT1 A;  5HJC A;  5FG4 A;  5GAM h;  1M3C A;  2YRD A;  4NYW A;  3P8D A;  4LD6 A;  4XU1 A;  3A8G B;  4ATO A;  4MR5 A;  4PKC C;  2CYZ B;  4E7Z A;  4LDU A;  2YDL A;  1BI1 A;  1UJ0 A;  1ABO A;  4N4G A;  2XD0 A;  2OSS A;  3OA6 A;  5A0L A;  5GAN 2;  2ZGW A;  1UGQ B;  3HHT B;  3P5O A;  4XK8 E;  4PNO A;  1W4S A;  1M27 C;  4F7U E;  5EA1 A;  1X43 A;  2E6N A;  2JMA A;  1I1J A;  4J9H A;  1VQO Q;  1M2V A;  1GBR A;  3CME Q;  1FXX A;  3G7Z A;  4A4G A;  4Z1Q A;  2I0N A;  3UW9 A;  3EFS A;  3WVE B;  2QA4 A;  2M02 A;  2FO0 A;  5GMK l;  3EAE A;  2DRK A;  4HXS A;  5DKC A;  2R5M A;  2DXU A;  2VUB A;  1WHJ A;  4YAD A;  1YWO A;  4PJN A;  5F63 A;  3M4G A;  2OAW A;  1R0B G;  3VUZ A;  3A8H B;  2R58 A;  1YNZ A;  2X9H A;  4C8Q G;  1ZA2 B;  4HCB A;  3QJY A;  1X27 A;  4LUE A;  4XAX B;  1WQ7 A;  4OB0 B;  5EIC A;  4NR5 A;  4UYH A;  1MV3 A;  4DON A;  2A08 A;  5DY9 A;  3SVF A;  4FYX B;  2DXC A;  4J0S A;  3VJP A;  4WCI A;  2MCN A;  2EJN A;  3JB9 D;  5ACY A;  4KUL A;  4HXR A;  4AFU C;  5E9V A;  4JDS A;  4OGJ A;  5LUU A;  2YEL A;  1J3T A;  2GTO A;  1B34 A;  5EIS A;  5I22 A;  2DEU A;  2DFU A;  1VQK T;  4A9I A;  3TSZ A;  4RG8 A;  3OYE A;  3EG1 A;  4E47 A;  5D3S A;  4QKU A;  1YJ9 Q;  3JCM f;  5DFB A;  2NUT A;  1M8V A;  2D0Q B;  4LDX A;  4QR3 A;  4DBH A;  5HRX A;  4R0K A;  2DAT A;  3QZV A;  1GCP A;  3NFC A;  5GJW B;  4YH3 A;  4ZGE B;  1BI0 A;  3UV5 A;  3CC7 Q;  4C5G A;  4LYI A;  2EYW A;  4J6Y A;  4UIZ A;  2AKL A;  1NM7 A;  5I11 A;  4R56 A;  1N5Z A;  1VQ4 A;  5KTW A;  4ZN3 A;  1PWT A;  5FB1 A;  1AVZ C;  4Q0O A;  2KXD A;  4M7A B;  2AT1 B;  4CI0 C;  4PJO C;  2O31 A;  3CCV Q;  2BZ8 A;  1WQW A;  1SSH A;  3RES A;  1GCQ A;  2CSI A;  2E7O A;  2IG0 A;  3SWN A;  4YTL A;  5FU7 B;  5H1V A;  2GRC A;  4M77 D;  2MWP A;  5EVA A;  4JPB W;  5FB0 A;  1ZSZ B;  5J3B A;  2C06 A;  4QB3 A;  4M78 C;  2RQT A;  4PJO D;  4ANJ A;  2QQR A;  4JRQ A;  3HSB A;  1O75 A;  3MCA B;  2DX1 A;  5HEN A;  5CUB A;  4QC1 A;  4LUD A;  4HXL A;  3JCM V;  3S3O A;  3P1F A;  3BDL A;  3CPW A;  1P92 A;  2OTJ A;  3PVQ A;  1M1K C;  5KYX A;  4NOY A;  3OQ5 A;  5GMK e;  4C92 B;  2K79 A;  1QVP A;  2YUP A;  1RAI B;  3M55 A;  3KUF A;  4OB3 B;  3P1C A;  4Z89 A;  4AI6 A;  4QYD A;  3CCM Q;  1YJW T;  2DXT A;  5M9O A;  2G3R A;  4MR4 A;  5E9K A;  4GPJ A;  4LZ2 A;  2EW3 A;  4C8Q E;  5I29 A;  5LKT A;  1JJ2 A;  4A4E A;  1VQK Q;  1WA7 A;  3HRU A;  4TS8 A;  1DJ7 B;  2K2V A;  3JVL A;  3ZYU A;  3J81 E;  2YRV A;  4II1 A;  5C85 A;  2VV5 A;  4PL6 A;  5LJ1 A;  4A9O A;  4GBQ A;  2CH4 W;  3A1P A;  2L5E A;  4QUT A;  1X0J A;  4ME7 A;  5FRO A;  2LJ1 A;  5C0M A;  1TUG B;  2ATC B;  5HK0 A;  2RH2 A;  4MEN A;  3JCM b;  3OBY A;  1UFF A;  3CCJ Q;  2BKD N;  4HXM A;  2L3P A;  2O4X A;  1MHN A;  3E19 A;  3CCR T;  4N3W A;  3J7A F;  5G4S A;  3H8Z A;  2VWF A;  5D3R A;  5D0C A;  4XU3 A;  1XNI A;  4O6J A;  3RR6 A;  5CP5 A;  4HBX A;  4BB7 A;  4NL2 A;  1X6B A;  3CC4 A;  3MP6 A;  3JCM g;  3G4S T;  3CCS Q;  1WDX A;  2HKN A;  1X6O A;  1WXU A;  4M7A G;  1I8F A;  4A9F A;  1OX9 A;  5KH6 A;  5GAN f;  2D82 A;  1ZS5 A;  4QBM A;  2LX7 A;  4NR8 A;  5CO7 A;  5IHN A;  4UIV A;  1N72 A;  1WNL A;  3S6W A;  4XUB A;  1VIE A;  3ZBD A;  3GOX A;  2QEX Q;  1Y0M A;  1IRX A;  5CFW A;  4C0Z A;  2DL3 A;  5GAN 6;  3JB9 J;  4IR4 A;  2DD5 A;  4Q0N A;  3I35 A;  3PMI A;  5AD2 A;  1PUO A;  5F25 A;  4MEO A;  3SFM A;  2KGT A;  3VS7 A;  4C92 A;  4M7D C;  1RLQ C;  5AD3 A;  1H64 1;  3LWI A;  4BY6 B;  1FMV A;  5CCA A;  4J1P A;  4OB1 B;  4PFP A;  4AG2 C;  1V76 A;  2E3I A;  1M90 C;  5COI A;  5E3D A;  5CPE A;  2LNV A;  4RCB A;  4C0F A;  5CQX A;  2LDM A;  1M9S A;  9ATC B;  2B86 A;  4M7D D;  3CD6 A;  4A9L A;  4J9I A;  3OYM A;  3TSW A;  3G6E Q;  3QO3 A;  3CQT A;  4QZS A;  2FPD A;  3V7S A;  2XID A;  2K6D A;  4E2F B;  4EMK A;  4C0D C;  5FFV A;  1K0X A;  4CUS A;  4QVC A;  4J6X A;  2KY9 A;  3V8L A;  4Y28 E;  3KFV A;  2QDL A;  4FT4 A;  5DFD A;  1QCN A;  2MWO A;  3V8K A;  4E7K A;  2F69 A;  3D1B A;  2COZ A;  3U5O A;  5I88 A;  1RAE B;  3O8V A;  1QVG A;  4KT0 E;  4M75 B;  3JB9 F;  1RAA B;  3CXC A;  2EIF A;  4IIM A;  4Q5W A;  4YBT A;  3MJX A;  1BB9 A;  1PRL C;  1NPP A;  4F14 A;  2VXE A;  3JSC A;  2OUO A;  4TU6 A;  3JRZ A;  2LQN A;  2RHZ A;  2KK4 A;  2J05 A;  3P8H A;  5IBN A;  1TUC A;  3FIF A;  2MAM A;  4ELY C;  1WYX A;  4R55 A;  2DBK A;  3ZFJ A;  2XKO C;  5FRM A;  3OYJ A;  5IID A;  4QR4 A;  4CC7 A;  4KBM B;  5GMK h;  1PC0 A;  4UIU A;  4BAC A;  3OYN A;  2L85 A;  4HBV A;  1IO6 A;  1RI9 A;  5D3P A;  3RER A;  4O7C A;  2HAX A;  2M0Y A;  1BKB A;  3CCU A;  2LQK A;  3OW2 S;  1IRE B;  4MDX A;  2DMO A;  2QQ9 A;  1QLY A;  4OMN A;  5BT5 A;  1XQH A;  4DOW A;  3G0J A;  2DVQ A;  5CQ3 A;  2LT1 A;  3FC3 A;  1N9S A;  1UDL A;  1M4Z A;  2EGA A;  1WPY A;  2BUD A;  3SB2 A;  4PCI A;  2DVE A;  4M77 F;  5HY6 A;  2E1H A;  3OW2 A;  2F6N A;  1ZHI A;  3EFO B;  3G71 A;  3CPF A;  4D6W A;  5GAN g;  5ENG A;  5CQ8 A;  3HPW A;  4N0A A;  5GAM f;  1VQP A;  2QTX A;  1VQL Q;  2QG9 B;  4PJO F;  5CY9 A;  1WJR A;  3CCQ Q;  4BUG A;  5LJ3 f;  2R57 A;  5AT1 B;  3I56 T;  2CP6 A;  4ORZ A;  3TEE A;  2YUO A;  4L59 A;  1VQM Q;  2HSP A;  5CU8 A;  1Q81 C;  4PCE A;  3G1J A;  5CAI A;  2I7K A;  1VYU A;  5DLX A;  5E0R A;  3HFN A;  3MEV A;  1BIB A;  3RKX A;  2R10 A;  1SHG A;  2MIO A;  4C92 E;  4TYL A;  1Z9Q A;  4O72 A;  4JJB A;  1VQ8 T;  4QY4 A;  4J9E A;  2QAS A;  3ER0 A;  3AQA A;  1RAH B;  1A0N B;  2RFJ A;  5F1L A;  3NHN A;  5CRZ A;  2VAS A;  4E96 A;  4RG2 A;  3ULR B;  4WF2 A;  2YEM A;  3UWN A;  5D6X A;  1FMW A;  1TG0 A;  2SRC A;  4E7S A;  2D6F A;  1LVK A;  1N6A A;  2DL8 A;  4M75 G;  2K2M A;  2DK3 A;  2RJE A;  3A98 A;  1YI2 T;  2GQI A;  4NUE A;  4O77 A;  1GFC A;  2L5Q A;  2KRM A;  1Q7Y C;  1ZX6 A;  1JRI A;  4BDY A;  4Z88 A;  4Z8A A;  4B6M A;  4HVU A;  4ZNX A;  3UV4 A;  4HXK A;  2O88 A;  5I40 A;  3T9N A;  2LJ3 A;  3JV3 A;  5FRN A;  4LDF A;  5KTX A;  2DA9 A;  2DZ9 A;  1E6G A;  4QQ6 A;  4UYE A;  4X1V A;  1Q95 G;  3FDR A;  2K9G A;  5E9L A;  2KYB A;  4F3I A;  1U5S A;  1TH7 A;  3Q2E A;  4N4I A;  1ACM B;  2VVK A;  1WI7 A;  4M77 A;  3MXF A;  4JLG A;  4CL9 A;  3OB9 A;  4A54 A;  1BIA A;  1QWF A;  3X28 B;  2F2V A;  4UYF A;  2E4H A;  4CLB A;  2DVV A;  3OS0 A;  5FE7 A;  3EH1 A;  4C66 A;  2V8J A;  2RA2 A;  3NMZ C;  5CKF A;  1MNE A;  4PJM A;  2VXF A;  2QXF A;  3CMA Q;  1JSP B;  1KG1 A;  3SD4 A;  3JCM d;  2CT3 A;  4GLM A;  4HT8 A;  1M2O A;  2FSA A;  2JN0 A;  5L8U A;  4JZ4 A;  1T0J A;  3QJ6 A;  4Y92 A;  2KE9 A;  4JLI A;  1U1S A;  4M7A C;  2CP0 A;  4YAX A;  2X3W D;  1YJN Q;  3C95 A;  2GFA A;  4XTX A;  4KH0 B;  4O70 A;  2CZ1 B;  4YAT A;  1T3L A;  1NJI U;  4A9H A;  1VIF A;  1QQJ A;  1D09 B;  3R6O A;  3R6N A;  2L3R A;  5LJ5 f;  5FU7 C;  3CBM A;  3QWY A;  4QVZ A;  1BBZ A;  1GL5 A;  4AKN A;  4CFL A;  1ZSZ C;  2EQU A;  2LVM A;  4F17 A;  5GAO q;  4O7B A;  1KHC A;  2PNI A;  3DB4 A;  1M2V B;  5CQY A;  2WSE E;  2ZPH B;  1VQK A;  5GAM g;  3EGD A;  1VQO T;  3VV0 A;  5IG6 A;  3CME T;  2RHI A;  2KQW A;  1OZ2 A;  5GAO n;  3RDV A;  4DBF A;  4IOQ A;  5LJ3 g;  1T3S A;  4M7D F;  5DLZ A;  3TQ7 P;  4JS5 A;  2FPF A;  5GMK i;  1UUE A;  2LZ6 B;  2XDP A;  3PTA A;  2FRW A;  1W2B S;  4PFO A;  1E6I A;  4QQG A;  3NGP A;  4PLI A;  3ONI A;  2YSQ A;  4BDZ A;  2X3X D;  3CCE Q;  3OMG A;  5D6Y A;  4XU2 A;  1W2B A;  5KYW B;  2J7I A;  4FU6 A;  1WHL A;  3EG3 A;  3MB4 A;  4E6R A;  1VQ7 T;  1QVF S;  3CCL Q;  5CZG A;  2EFI A;  3U5L A;  4C0G A;  4V2S A;  2VYT A;  4Y91 A;  5ECA A;  7AT1 B;  4A4F A;  5F5Z A;  5FWC A;  4QYL A;  1QVF A;  3CCS A;  3I3J A;  2HNI A;  1GBQ A;  2PQW A;  5DKD A;  3UAT A;  1RI0 A;  2E64 A;  1Q86 R;  1B34 B;  4MZP A;  2ENM A;  5EC7 A;  3I55 Q;  2KMT A;  4XQ3 A;  1AD5 A;  2I8N A;  2YUQ A;  1RAB B;  2JVV A;  2DO3 A;  4L5G A;  5E9I A;  5DYU A;  5A83 A;  2P0K A;  5JWM A;  2NUT B;  2FZG B;  4J3I A;  5GAN 4;  2E5Q A;  1YJ9 T;  3BW1 A;  5FU6 C;  3QWX X;  3QDF A;  2DWW A;  4BW1 A;  2DL4 A;  2DYI A;  4PJL A;  4HBW A;  3OYG A;  3CC2 T;  1YIT Q;  2LCS A;  5EG2 A;  3U23 A;  1YJW A;  5KE3 A;  2MMP A;  5FG6 A;  3OYB A;  1JB0 E;  3CC7 T;  4M77 E;  2OJ2 A;  4NYX A;  2FRY A;  2DRM A;  8ATC B;  3QYG B;  4O5V A;  4DEX A;  2HSE B;  1KQ1 A;  1VQ9 Q;  3RMS A;  2RNA A;  3HKS A;  3CBP A;  1JEG A;  4M7D A;  1Y7X A;  3H0I A;  3PGG A;  1PSE A;  2RHU A;  4XTU A;  3LH0 A;  2LQW A;  2D1X A;  3LGF A;  5HEL A;  3OS5 A;  1SHF A;  3CCV T;  3SWN B;  3UF4 A;  3GF5 A;  4FW1 A;  4RTY A;  1TOV A;  3NTI A;  1PKS A;  4YYI A;  1G3Y A;  1N9R A;  1UTI A;  3RBB B;  5GAN d;  2H3E B;  5EV9 A;  3X24 B;  1OI1 A;  5DYC A;  5EM3 A;  5I80 A;  1UB4 A;  2YDW A;  4A9N A;  2DLP A;  2K3X A;  3OMC A;  4HXP A;  1ARK A;  5LJ5 g;  1YCS B;  5II2 A;  4O74 A;  3CCR A;  2CDT A;  1K9M U;  3IU6 A;  2DEQ A;  5KYX B;  1RL2 A;  1NLO C;  1VQ7 Q;  5FBX A;  5KYW A;  3QYH B;  1OOT A;  1ZLM A;  2FHD A;  4YC9 A;  5GAO l;  2RHX A;  2HDA A;  4HXO A;  3G4S A;  1WHK A;  1K73 U;  2P84 A;  2JTE A;  2MOX A;  1WLP B;  5I7X A;  1R0C B;  4DQ2 A;  3CCM T;  5F61 A;  3D7S B;  3LQJ A;  2BZX A;  4VUB A;  2D9E A;  5J39 A;  4ZTF A;  1KQS S;  2GNC A;  3DLM A;  1VQN Q;  1PD1 A;  2E3H A;  4M75 C;  4E7J A;  2O9S A;  2F5K A;  1H92 A;  5FDZ A;  1KQS A;  4KGZ B;  1KK7 A;  5IGL A;  5D3H A;  5HFQ A;  1OPL A;  2L2P A;  3CC2 Q;  1EFN A;  1MMG A;  5D3L A;  3LH5 A;  4BW2 A;  4LD9 K;  1C0M A;  2HBW A;  5L99 A;  2ESW A;  4PJJ A;  2O4X B;  5IGK A;  1TSF A;  2AHJ B;  3G0L A;  3CCJ T;  3OYA A;  5D6W A;  1QCO A;  5E9Y A;  3HME A;  4HA8 A;  2MK5 A;  2A37 A;  3QPH A;  1QCF A;  2KNB B;  5IXB A;  1VOM A;  1X69 A;  2LQ8 A;  5L97 A;  1PG5 B;  4YY6 A;  2FZK B;  1QKW A;  2MI6 A;  2VB6 A;  3IQL A;  5KYN A;  1WHM A;  3GLX A;  3CCS T;  4QW2 A;  1I81 A;  5L23 A;  3E1S A;  1AEY A;  2OAU A;  4OGI A;  4AT1 B;  5D25 A;  5ENB A;  3CPW S;  2K57 A;  4IIO A;  4LE9 A;  2KT8 A;  4IR5 A;  3PT9 A;  4J0R A;  5HQ7 A;  5DKH A;  2L89 A;  2EQK A;  1NJI R;  1E7O A;  3HL8 A;  4DBQ A;  3ZEH A;  2QEX T;  3M57 A;  2KI7 A;  5HEM A;  3VU3 C;  5IXF A;  4XU0 A;  2DM1 A;  3O36 A;  3M5A A;  4LYW A;  5GMK j;  3HMH A;  2HMA A;  1VQ5 Q;  3MET A;  3QXE B;  2FVU A;  2FG0 A;  3QKJ A;  3K2J A;  5EP7 A;  4M78 D;  4AKG A;  3H9N A;  4J6W A;  5DM7 R;  3D7C A;  4QEU A;  1MGQ A;  1JJ2 S;  1G5V A;  5DYA A;  3INZ A;  1G3S A;  3MKD A;  5EWW A;  3JCM c;  5IAY A;  2RI3 A;  2GGR A;  5GAM d;  5KCO A;  3OYL A;  4NXJ A;  5EU1 A;  5DLQ E;  4ZN1 A;  2NUP A;  2K3Y A;  1BI3 A;  5LJ3 d;  2RO1 A;  5L8R E;  4AG1 C;  4J9C A;  5I83 A;  2B8A A;  2V26 A;  4HCZ A;  3E9F A;  2HQE A;  4CRI A;  1D1B A;  2A3L A;  3MUL A;  1AWX A;  2O01 E;  1LJO A;  4EMK B;  3G6E T;  1VA7 A;  3TLP A;  4J9F A;  2CT4 A;  4HVW A;  2LTO A;  4J9B A;  1YHQ Q;  2Z0W A;  4BE1 A;  4WTO B;  5DW2 A;  1IXD A;  1SKU B;  1PM3 A;  5ENF A;  4FLP A;  4PY6 A;  4WHU A;  5LJ2 A;  4ZTJ A;  4TVR A;  4YBS A;  5FH6 A;  5IH2 A;  2CUB A;  4J8O A;  1RLP C;  3JCM P;  1MND A;  2M0O A;  2KYM A;  4OMM A;  2DET A;  3M0P A;  3I56 A;  2EJ9 A;  4FM4 B;  3GPL A;  1I5L A;  2YWW A;  1YIJ Q;  1KC8 R;  1T0H A;  3BFM A;  3UVY A;  2ZAE A;  4A4H A;  5CKD A;  2YW5 A;  5F62 A;  1BCO A;  4XUA A;  3OYI A;  2EKO A;  5GMK m;  4A9K A;  4CFK A;  1VQ8 A;  5F1H A;  3M58 A;  4YY4 A;  4OMP A;  1UGS B;  2DTO A;  2E5K A;  3PFS A;  2J6O A;  3SEM A;  4ALH A;  3CEY A;  2V1R A;  1WXT A;  5KU3 A;  2JS0 A;  4QSW A;  4FYY B;  5AYF A;  2OTL T;  4OUF A;  5F3A A;  1FWZ A;  5ENJ A;  3IU5 A;  1M5Q 1;  3DWY A;  2DYB A;  3EGX A;  1YI2 A;  1QKX A;  4IUR A;  4YYK A;  4TT4 A;  5L8T A;  1VQ6 Q;  1IGU A;  3JVM A;  2KRO A;  3HRS A;  2JS2 A;  2F2W A;  4HKE A;  4C92 G;  3JVJ A;  1K9A A;  3OYC A;  4YYN A;  2XIC A;  1CKB A;  3M59 A;  2H3J A;  5GAN e;  5CQ4 A;  1I4K 1;  4L6V 5;  5IHI A;  1VQL T;  4K11 A;  2K3B A;  3L2U A;  5A5Q A;  2RQR A;  5CUD A;  3CCQ T;  2LC4 A;  3KBG A;  1WIE A;  4PKL A;  4EPC A;  3O34 A;  3EHQ A;  3JAM E;  3BY7 A;  1BCM A;  2RMO A;  5J26 A;  1VQM T;  1K9M R;  2ROT A;  4XY8 A;  3OYD A;  3TRE A;  1QVG S;  2YHT A;  3MP1 A;  4ZW1 A;  2WP1 A;  4OMO A;  4C67 A;  5LJ5 d;  1I5O B;  5D24 A;  3I5R A;  3CXC S;  1G3T A;  1K76 A;  1HD3 A;  1MUZ A;  5KO4 A;  1NYG A;  1ZSG A;  2EYX A;  5IHK A;  4C8Q C;  4BI3 A;  5DY7 A;  1PCX A;  4O7E A;  1UG1 A;  2HZY A;  3M0T A;  3U5P A;  4NRC A;  1BU1 A;  2FEI A;  2QA4 Q;  4KV1 A;  1K73 R;  4RUG A;  3I55 A;  3VUB A;  4PK4 A;  2DIG A;  2X4X A;  5CIU A;  2E7N A;  2MF2 A;  1OUL A;  2LCL A;  3VKI A;  4RTX A;  5HK3 A;  1WUM A;  4J9G A;  4OB2 B;  4AKH A;  1OU8 A;  4BW3 A;  1Q86 U;  3U5N A;  4QSQ A;  4C8Q D;  4YK0 A;  1XJW B;  1WXB A;  1H8K A;  3AT1 B;  2KAF A;  1M1F A;  1HSQ A;  4RTV A;  3PE0 A;  2EJF A;  4IUQ A;  4IR6 A;  1D3B B;  4TU4 A;  2EWN A;  2EYZ A;  4M75 F;  2DD4 A;  1MV0 B;  5C8G A;  4QST A;  5LKZ A;  4JS4 A;  2OTL Q;  1VQO A;  2JW4 A;  2RNX A;  3H41 A;  2WSF E;  3SHW A;  2DKW A;  5CTL A;  3CME A;  5TB6 A;  4M77 B;  5IT9 E;  4UYD A;  3JCM X;  2AK5 A;  3RKY A;  3L2W A;  4UYF B;  4F16 A;  4PJO B;  3L42 A;  5FH8 A;  4XTV A;  1M1K R;  2KR3 A;  1BYM A;  2YT6 A;  3LJW A;  5JI8 A;  3MEA A;  3A8L B;  2FZC B;  3DKM A;  2P4R A;  2QTV A;  3OYK A;  2JM9 A;  1ZUU A;  2MPX C;  4GLK A;  5CQA A;  3CMA T;  2V8I A;  1N27 A;  1RAG B;  4JRI A;  1UGV A;  4N4F A;  2LT4 A;  3U5J A;  3QDR B;  5D3N A;  5AME A;  4ESR A;  4AKI A;  5CQ5 A;  1VQ7 A;  5E3G A;  2ZPI B;  2KDS A;  2ECZ A;  2M51 A;  1YJN T;  1GCQ C;  5F2P A;  3CBO A;  5A85 A;  1VQ4 Q;  3SWN C;  1TXQ A;  4XTW A;  1AZE A;  3Q2F A;  1QW1 A;  1PHT A;  1LNX A;  2IIM A;  4EDU A;  4F7U F;  4M78 F;  3FLG A;  3OY9 A;  1YCY A;  2RHY A;  2XG8 D;  4X34 A;  1TS9 A;  3EGU A;  4LDY A;  4XY9 A;  2L84 A;  2BZY A;  3JB9 G;  2XI9 A;  2L3Q A;  3EGD B;  4KGV B;  4Z02 A;  4JUV A;  2C0T A;  4NQN A;  5IGM A;  1VQN A;  3VRY A;  5BT3 A;  2E41 A;  5CKB A;  1YJ9 A;  3OS2 A;  2R0S A;  5C89 A;  1QMC A;  4X2I A;  5LJ3 e;  2BIV A;  5AMF A;  5HM0 A;  3UPU A;  1RUW A;  5CQ6 A;  2EQI A;  3HMF A;  5EI4 A;  4FYW B;  2XDB A;  2PUO B;  4FW2 A;  1WJQ A;  3CC2 A;  1WZO A;  3O35 A;  2M16 A;  3U5M A;  4B9X A;  2BTT A;  3X25 B;  2OTJ Q;  2JXB A;  1Y57 A;  1I07 A;  4KRT A;  3CC7 A;  4UIY A;  1G3W A;  1I0C A;  2RJD A;  1H3Z A;  1D3B A;  3CCE T;  2M1H A;  4PFZ A;  2RD1 A;  3VS2 A;  5I2M A;  3JB9 I;  5KYY B;  2HQH A;  2O9V A;  2ZCF B;  5E7D A;  4OP0 A;  4A53 A;  3CCL T;  4MEP A;  3CCV A;  1K8A U;  2JNG A;  1GFD A;  4RKU E;  1Q82 U;  3RKW A;  3WVD B;  3O5Z A;  1CSK A;  4NRB A;  4XYA A;  3UT1 A;  3MB3 A;  1SSF A;  1G8X A;  3LX7 A;  4C5H A;  2JZ2 A;  4PJO A;  5GAN h;  2I2L A;  3SVG A;  2K5I A;  5HCL A;  5HKC A;  1UEC A;  3EHR A;  2D8J A;  2EYY A;  4M77 G; 
#chains in the Genus database with same CATH homology
 5EK9 A;  3I55 T;  5II1 A;  5ENH A;  3PIO A;  4TZ8 A;  1Y96 A;  5A2Q E;  4EMH A;  4LC2 A;  4QNS A;  2K4Y A;  1EQF A;  4F7U A;  4M78 A;  5LVQ A;  1N8R U;  1S72 T;  3C94 A;  4TTE A;  4RMO A;  4YYJ A;  4BE2 A;  2YQD A;  3CCM A;  2N9G A;  1YIT T;  2HQX A;  4TQN A;  1U8R A;  2P4T A;  3H6Z A;  4WHW A;  4FL6 A;  4M7D B;  4M7A D;  4BI4 A;  1VQ9 T;  1V29 B;  4E7H A;  3GNF B;  5CS8 A;  4O76 A;  5CK9 A;  2RI5 A;  4NS5 A;  4O7F A;  2HBP A;  4OGC A;  4C92 C;  4BD3 A;  3MO8 A;  3S92 A;  3N5B B;  2LSP B;  2CKK A;  5CKH A;  3V8J A;  3M9Q A;  3LQH A;  5A0G A;  4ZC9 A;  5FFW A;  2YLC A;  5CUC A;  2QI2 A;  5LJ5 e;  4QUU A;  3CCJ A;  3UVX A;  1BI2 A;  4QQD A;  1NJI C;  4C92 D;  3PNW C;  4J7I A;  1KD1 U;  3FEO A;  4RCC A;  2PUK B;  3A8O B;  3MEU A;  3P8B B;  3QHS A;  5A0D A;  4NR9 A;  3QII A;  1IZ6 A;  4LDW A;  3FKM X;  1NE8 A;  5GAN 5;  4MEQ A;  5F60 A;  5D26 A;  3M4Y A;  4BI8 B;  4C8Q F;  2D9T A;  3QG1 A;  1UEB A;  5ETD A;  4LZR A;  2E70 A;  3Q1J A;  2DXB A;  1KC8 U;  2FL7 A;  4NQM A;  1VQN T;  5GAN 8;  5FE1 A;  2QEX A;  2JTF A;  2LX9 A;  4NR4 A;  3MP8 A;  3L1A A;  1R8O B;  2VGM A;  3LW5 E;  2DAQ A;  4PJO E;  3JVK A;  4ZGD B;  4NYV A;  3A5Z B;  5LJ3 h;  4IKF A;  3DAI A;  2R5A A;  3G6E A;  2OO1 A;  1Y07 A;  4M7D G;  2KVQ G;  4NL3 A;  4XTZ A;  3NXB A;  1KC8 C;  2E6Z A;  5A81 A;  4M78 E;  3QZT A;  1WUG A;  5FE5 A;  5CQT A;  4BY6 C;  5IN1 A;  4YBM A;  1X01 A;  4N0A C;  5ENI A;  4ZGJ B;  2XU8 A;  3JCM Q;  2CZ7 B;  4QR5 A;  1U1T A;  3JCM W;  4C8Q A;  5DX4 A;  3U5K A;  2WP2 A;  3OYF A;  3V7C A;  3LLR A;  5CVI A;  5GAN 7;  3X20 B;  3LXJ A;  1VQ5 T;  4N4H A;  1UGR B;  3S3N A;  4A9M A;  3AAD A;  1JBM A;  1X75 C;  4QSR A;  5IGN A;  4BJX A;  4PTB A;  2ZPF B;  2DPP B;  2E12 A;  4GY5 A;  4OVA A;  3UVD A;  3OYY A;  4LDV A;  3L2V A;  4UIW A;  4TZ2 A;  5EQ1 A;  3GNG A;  5I86 A;  3RIR A;  2RI2 A;  4UIT A;  1HXD A;  4MZM A;  2OTL A;  4C5E A;  4JJN K;  5C4Q A;  1YBY A;  5FG5 A;  5LKU A;  1YHQ T;  3FRN A;  1EIF A;  1K9M C;  5HQ5 A;  3URG A;  5FE4 A;  4M75 D;  1WJS A;  5KE2 A;  2Y4X A;  2L8D A;  2QQS A;  3P1E A;  2RJF A;  4O7A A;  3GG3 A;  1VQL A;  1K73 C;  3DLL A;  4BHW A;  5A5R A;  3CCQ A;  1M1K U;  4MZT A;  1YIJ T;  5KTU A;  3JCM e;  4ALG A;  4J5Y A;  1VQM A;  4MML A;  4M77 C;  2DJZ A;  4IUV A;  5A5S A;  5ENC A;  5LJ5 h;  4MR3 A;  1XOV A;  2KTB B;  5CGP A;  2F6J A;  4O78 A;  3AHU A;  2X4Y A;  4QSV A;  1M1G A;  4OGE A;  4QSP A;  1FX7 A;  3HRT A;  4M7A F;  5DW1 A;  5EGU A;  3HFO A;  3L2R A;  3O37 A;  4M7D E;  3TCJ A;  1KHI A;  4MDW A;  2Y4Y A;  3WXM B;  3NTK A;  4QC3 A;  2IVW A;  1F68 A;  1VQ6 T;  2ZPE B;  5H1T A;  2RI7 A;  5FH7 A;  2V8K A;  3LWH A;  5EWC A;  4A4K A;  5GAO r;  1WGS A;  2F5T X;  2M9U A;  2EYQ A;  4NRA A;  2E10 A;  5LJ0 A;  5FFY A;  5A5O A;  4C92 F;  4QEV A;  5I2S A;  4P5N A;  2NLU A;  3VYH B;  5I1Q A;  2ZPG B;  3FB9 A;  1ZQ1 A;  3VYG A;  3ASK A;  3LQI A;  1HK9 A;  5CQ7 A;  2PU9 B;  2QA4 T;  5HRW A;  2X35 A;  3CMA A;  5HFR A;  3M56 A;  4YYM A;  4IOO A;  3PMT A;  2RO0 A;  3UDC A;  2K5F A;  2GQV A;  3SDZ A;  2QQB A;  3JB9 H;  2RNW A;  2RM4 A;  3P1D A;  1YJN A;  3UV2 A;  5DFC A;  3J80 E;  1QP3 A;  3BDU A;  2JOY A;  1JM4 B;  2PVD B;  1OZ3 A;  3QZS A;  4J83 A;  5KHM A;  1Y71 A;  5FU6 B;  3A8M B;  2EAY A;  4M7A A;  4FIB A;  4HBY A;  1M90 U;  4X9C A;  3JCM J;  5G4R A;  3HP9 A;  4TT6 A;  2HD0 A;  5A5N A;  4YYG A;  2DIQ A;  4HXN A;  5ETB A;  5TCM A;  5GAO m;  2DZC A;  3RMQ A;  5D3J A;  3CCE A;  5A7C A;  5GAN j;  3C12 A;  4UYG A;  4B9W A;  2QDY B;  5CUG A;  4KV4 A;  3CCL A;  5EPS A;  4LYS A;  5KCH A;  4ZQL A;  2ZPB B;  2XK0 A;  5LVR A;  1VQ4 T;  4FT2 A;  5CKE A;  4CUU A;  2Y90 A;  4Z6H A;  4QSX A;  4OF1 A;  4E7L A;  5EPB A;  5L96 A;  4JRP A;  4E7I A;  2E3K A;  3C4S A;  2LRQ A;  3JCM h;  5EPR A;  4QVD A;  3QZ9 B;  5HRV A;  5ENE A;  4IUT A;  4PS5 A;  5D3T A;  4LZS A;  2YLB A;  1XTD A;  1S72 A;  4UIX A;  1YIT A;  5E74 A;  4ELZ C;  5F36 A;  2OTJ T;  3SVH A;  3EFR A;  4A9E A;  4NR6 A;  3S91 A;  4NUD A;  2X4W A;  5E9M A;  1VQ9 A;  4QSU A;  5DYX A;  3OSS C;  4CUP A;  3X26 B;  5FE3 A;  2KSS A;  1Q81 U;  3M54 A;  5D7X A;  2K5L A;  2PVG B;  3MQM A;  3RUX A;  2P0Q A;  5DLO A;  3MHX A;  3V7R A;  4KUI A;  2GCX A;  2X4J A;  2DKG A;  2DTI A;  1Q86 C;  5FLX E;  1Y96 B;  2VC8 A;  2LCC A;  4M7A E;  5L98 A;  2E65 A;  2CS7 A;  2YEK A;  2PVO B;  4F7U B;  4M78 B;  4HT9 A;  5FE6 A;  3RCW A;  3TU4 K;  1QP2 A;  2WSC E;  5A5P A;  2MJV B;  1Q7Y U;  5I21 A;  2P0P A;  3E9G A;  3GP8 A;  5EWD A;  4YYH A;  5I89 A;  4IOR A;  4XTY A;  3CC4 T;  4EMG A;  5EWH A;  4DA4 A;  4OMF B;  4KCX A;  5GAM e;  2VGN A;  5C7N A;  4FSX A;  5GAM j;  5CUA A;  2EJG A;  5HLS A;  4C5I A;  5LJ3 j;  3OYH A;  4YH4 A;  4CUQ A;  2CZ6 B;  2XHC A;  4M75 A;  4IUP A;  5K29 A;  2G4A A;  5GAO p;  2RNY A;  5FE9 A;  4UC4 A;  2FB7 A;  5DBM A;  2ZZD A;  4O71 A;  3LYI A;  2RJC A;  2H60 A;  3M53 A;  4HCC A;  4MMK A;  3OS1 A;  2DTH A;  3F70 A;  4LRG A;  1PSF A;  1NPR A;  5BT4 A;  3NTH A;  5C87 A;  4IUU A;  4DOV A;  2JTM A;  5GAN 3;  5H1U A;  4QEW A;  3CD6 T;  3DB3 A;  4Z1S A;  5LL6 S;  4Y03 A;  2GF7 A;  4PJO G;  4IR3 A;  2CZ0 B;  2WAC A;  1O9S A;  4CUT A;  2DVS A;  2R0Y A;  3FJP A;  2RS9 B;  3MUK A;  1UGP B;  4J7F A;  3UVW A;  5J0D A;  1VQ5 A;  2RK2 A;  4F7U G;  4M78 G;  4MR6 A;  5FE0 A;  2XDD A;  4O75 A;  5EWV A;  1K8A C;  2JUF A;  1Q82 C;  3GIB A;  4NUC A;  4WIV A;  2R0V A;  4YAB A;  4NR7 A;  4KUD K;  5I7Y A;  5C6S A;  5A82 A;  1ZBX A;  4PLL A;  4RVR A;  3PIP A;  1YHQ A;  3QSU A;  3QBY A;  5CR2 A;  3L2Q A;  4C0D B;  3ME9 A;  2CGH A;  5FE8 A;  3CCU T;  4BW4 A;  2EQM A;  2A7Y A;  1N8R C;  5LJ5 j;  4C8Q B;  2RB6 A;  4LR6 A;  2EQJ A;  4BE0 A;  1NZ9 A;  4Z6I A;  2GFU A;  4EMK C;  1YIJ A;  3S3M A;  3G71 T;  1KQ2 A;  1VQP T;  5CUE A;  5HQ6 A;  5CRM A;  1AHJ B;  2FYK A;  2NXB A;  5FE2 A;  3KXT A;  3OSV A;  4M75 E;  2RK1 A;  3O33 A;  4TT2 A;  5LKX A;  1OYX A;  3QZ5 B;  5H85 A;  4YYD A;  3OBW A;  2YYN A;  4QSS A;  5E73 A;  2DVR A;  4A9J A;  4X9D A;  1VUB A;  3L2Z A;  3LGL A;  3QUI A;  2QQA A;  4Z93 A;  1VQ6 A;  4JRK A;  4CUR A;  1KD1 C;  1LOJ A;  1GXI E;  5HJC A;  5FG4 A;  5GAM h;  4NYW A;  3P8D A;  4LD6 A;  4XU1 A;  3A8G B;  4MR5 A;  4PKC C;  2CYZ B;  4LDU A;  1BI1 A;  4N4G A;  2XD0 A;  2OSS A;  3OA6 A;  5A0L A;  5GAN 2;  2ZGW A;  1UGQ B;  3HHT B;  3P5O A;  4XK8 E;  4PNO A;  1W4S A;  4F7U E;  5EA1 A;  2E6N A;  1FXX A;  3G7Z A;  4A4G A;  4Z1Q A;  3UW9 A;  3EFS A;  3WVE B;  2QA4 A;  5GMK l;  3EAE A;  4HXS A;  5DKC A;  2R5M A;  2DXU A;  2VUB A;  4YAD A;  5F63 A;  3M4G A;  3VUZ A;  3A8H B;  2R58 A;  4C8Q G;  4HCB A;  3QJY A;  4XAX B;  1WQ7 A;  4OB0 B;  5EIC A;  4NR5 A;  4UYH A;  4DON A;  5DY9 A;  3SVF A;  2DXC A;  4J0S A;  3VJP A;  3JB9 D;  5ACY A;  4KUL A;  4HXR A;  5E9V A;  4JDS A;  4OGJ A;  5LUU A;  2YEL A;  1B34 A;  5EIS A;  1VQK T;  4A9I A;  4RG8 A;  3OYE A;  4E47 A;  5D3S A;  3JCM f;  5DFB A;  1M8V A;  2D0Q B;  4LDX A;  4QR3 A;  5HRX A;  2DAT A;  3QZV A;  3NFC A;  4YH3 A;  4ZGE B;  1BI0 A;  3UV5 A;  4C5G A;  4LYI A;  4J6Y A;  4UIZ A;  4R56 A;  1VQ4 A;  5KTW A;  4ZN3 A;  5FB1 A;  4Q0O A;  4M7A B;  4CI0 C;  4PJO C;  1WQW A;  3RES A;  2E7O A;  2IG0 A;  3SWN A;  4YTL A;  5FU7 B;  5H1V A;  2GRC A;  4M77 D;  2MWP A;  5EVA A;  5FB0 A;  5J3B A;  2C06 A;  4QB3 A;  4M78 C;  4PJO D;  2QQR A;  4JRQ A;  3HSB A;  1O75 A;  3MCA B;  5HEN A;  5CUB A;  4QC1 A;  4HXL A;  3JCM V;  3S3O A;  3P1F A;  3BDL A;  3CPW A;  1P92 A;  2OTJ A;  1M1K C;  4NOY A;  3OQ5 A;  5GMK e;  4C92 B;  1QVP A;  3M55 A;  4OB3 B;  3KUF A;  3P1C A;  4QYD A;  1YJW T;  2DXT A;  5M9O A;  2G3R A;  4MR4 A;  5E9K A;  4GPJ A;  4LZ2 A;  4C8Q E;  5I29 A;  5LKT A;  1JJ2 A;  4A4E A;  3HRU A;  4TS8 A;  1DJ7 B;  2K2V A;  3JVL A;  3ZYU A;  3J81 E;  2YRV A;  4II1 A;  5C85 A;  2VV5 A;  4PL6 A;  5LJ1 A;  4A9O A;  2L5E A;  4QUT A;  1X0J A;  4ME7 A;  5FRO A;  5C0M A;  5HK0 A;  2RH2 A;  4MEN A;  3JCM b;  3OBY A;  2BKD N;  4HXM A;  2O4X A;  1MHN A;  3E19 A;  3CCR T;  4N3W A;  3J7A F;  5G4S A;  3H8Z A;  5D3R A;  5D0C A;  4XU3 A;  1XNI A;  4O6J A;  5CP5 A;  4HBX A;  4BB7 A;  4NL2 A;  3CC4 A;  3MP6 A;  3JCM g;  3G4S T;  1X6O A;  4M7A G;  1I8F A;  4A9F A;  5KH6 A;  5GAN f;  2D82 A;  1ZS5 A;  4QBM A;  4NR8 A;  5CO7 A;  3S6W A;  4UIV A;  1N72 A;  1WNL A;  4XUB A;  1VIE A;  3ZBD A;  3GOX A;  5CFW A;  4C0Z A;  5GAN 6;  3JB9 J;  4IR4 A;  2DD5 A;  4Q0N A;  3PMI A;  5AD2 A;  5F25 A;  4MEO A;  3SFM A;  4C92 A;  4M7D C;  5AD3 A;  1H64 1;  3LWI A;  4BY6 B;  5CCA A;  4J1P A;  4OB1 B;  1M90 C;  5COI A;  5E3D A;  5CPE A;  2LNV A;  4RCB A;  4C0F A;  5CQX A;  2LDM A;  1M9S A;  4M7D D;  3CD6 A;  4A9L A;  3OYM A;  3QO3 A;  4QZS A;  3V7S A;  2XID A;  4EMK A;  4C0D C;  5FFV A;  4CUS A;  4QVC A;  4J6X A;  2KY9 A;  3V8L A;  4Y28 E;  3V8K A;  4FT4 A;  4E7K A;  5DFD A;  2MWO A;  2F69 A;  3U5O A;  5I88 A;  3O8V A;  1QVG A;  4KT0 E;  4M75 B;  3JB9 F;  3CXC A;  2EIF A;  4Q5W A;  4YBT A;  1NPP A;  2VXE A;  3JSC A;  2OUO A;  4TU6 A;  3JRZ A;  2RHZ A;  2KK4 A;  3P8H A;  5IBN A;  3FIF A;  2MAM A;  4ELY C;  4R55 A;  3ZFJ A;  2XKO C;  5FRM A;  3OYJ A;  5IID A;  4QR4 A;  4KBM B;  5GMK h;  4UIU A;  4BAC A;  3OYN A;  2L85 A;  4HBV A;  5D3P A;  3RER A;  4O7C A;  2HAX A;  1BKB A;  3CCU A;  2LQK A;  3OW2 S;  1IRE B;  4MDX A;  2QQ9 A;  5BT5 A;  1XQH A;  4DOW A;  3G0J A;  2DVQ A;  5CQ3 A;  2LT1 A;  3FC3 A;  1N9S A;  1M4Z A;  1WPY A;  2BUD A;  3SB2 A;  4PCI A;  2DVE A;  4M77 F;  5HY6 A;  2E1H A;  3OW2 A;  2F6N A;  1ZHI A;  3G71 A;  3CPF A;  4D6W A;  5GAN g;  5ENG A;  5CQ8 A;  3HPW A;  4N0A A;  5GAM f;  1VQP A;  2QTX A;  4PJO F;  5CY9 A;  1WJR A;  4BUG A;  5LJ3 f;  2R57 A;  3I56 T;  3TEE A;  4L59 A;  5CU8 A;  1Q81 C;  4PCE A;  5CAI A;  2I7K A;  5DLX A;  5E0R A;  3HFN A;  3MEV A;  1BIB A;  3RKX A;  2R10 A;  4C92 E;  4TYL A;  4O72 A;  1VQ8 T;  4QY4 A;  3ER0 A;  3AQA A;  2RFJ A;  5F1L A;  5CRZ A;  4E96 A;  4RG2 A;  4WF2 A;  2YEM A;  3UWN A;  5D6X A;  2D6F A;  1N6A A;  4M75 G;  2DK3 A;  2RJE A;  1YI2 T;  4NUE A;  4O77 A;  2L5Q A;  1Q7Y C;  1JRI A;  4BDY A;  3UV4 A;  4HXK A;  5I40 A;  3T9N A;  5FRN A;  4LDF A;  5KTX A;  2DZ9 A;  4QQ6 A;  4UYE A;  3FDR A;  5E9L A;  4F3I A;  1TH7 A;  3Q2E A;  4N4I A;  4M77 A;  3MXF A;  4JLG A;  4CL9 A;  3OB9 A;  4A54 A;  1BIA A;  3X28 B;  4UYF A;  4CLB A;  2DVV A;  3OS0 A;  5FE7 A;  4C66 A;  2V8J A;  2RA2 A;  5CKF A;  2VXF A;  2QXF A;  1JSP B;  1KG1 A;  3SD4 A;  3JCM d;  4HT8 A;  2FSA A;  2JN0 A;  5L8U A;  3QJ6 A;  4JLI A;  4M7A C;  1U1S A;  4YAX A;  3C95 A;  2GFA A;  4XTX A;  4O70 A;  2CZ1 B;  4YAT A;  1NJI U;  4A9H A;  1VIF A;  3R6O A;  2L3R A;  5LJ5 f;  5FU7 C;  3CBM A;  4QVZ A;  4AKN A;  4CFL A;  2EQU A;  2LVM A;  5GAO q;  4ATO A;  4O7B A;  1KHC A;  3DB4 A;  5CQY A;  2WSE E;  2ZPH B;  1VQK A;  5GAM g;  1VQO T;  3VV0 A;  5IG6 A;  3CME T;  2RHI A;  2KQW A;  1OZ2 A;  5GAO n;  4IOQ A;  5LJ3 g;  4M7D F;  5DLZ A;  4JS5 A;  5GMK i;  2XDP A;  3PTA A;  1W2B S;  1E6I A;  4QQG A;  4PLI A;  3ONI A;  4BDZ A;  3OMG A;  5D6Y A;  4XU2 A;  1W2B A;  4FU6 A;  3MB4 A;  1QVF S;  1VQ7 T;  5CZG A;  2EFI A;  3U5L A;  4C0G A;  4V2S A;  2VYT A;  4Y91 A;  4A4F A;  5F5Z A;  4QYL A;  1QVF A;  3CCS A;  3I3J A;  2HNI A;  2PQW A;  5DKD A;  1RI0 A;  2E64 A;  1B34 B;  4MZP A;  2KMT A;  4XQ3 A;  2I8N A;  2JVV A;  2DO3 A;  4L5G A;  5E9I A;  5DYU A;  5A83 A;  2P0K A;  5JWM A;  4J3I A;  5GAN 4;  2E5Q A;  1YJ9 T;  3BW1 A;  5FU6 C;  2DWW A;  4BW1 A;  4HBW A;  3OYG A;  3CC2 T;  5EG2 A;  1YJW A;  5KE3 A;  2MMP A;  5FG6 A;  3OYB A;  1JB0 E;  3CC7 T;  4M77 E;  4NYX A;  3QYG B;  4O5V A;  1KQ1 A;  3RMS A;  3HKS A;  3CBP A;  4M7D A;  1Y7X A;  3PGG A;  1PSE A;  2RHU A;  4XTU A;  3LH0 A;  3LGF A;  5HEL A;  3OS5 A;  3CCV T;  3SWN B;  3GF5 A;  3NTI A;  4YYI A;  1G3Y A;  1N9R A;  5GAN d;  5EV9 A;  3X24 B;  1OI1 A;  5DYC A;  5EM3 A;  5I80 A;  1UB4 A;  2YDW A;  4A9N A;  2K3X A;  3OMC A;  4HXP A;  5LJ5 g;  5II2 A;  4O74 A;  3CCR A;  1K9M U;  3IU6 A;  2DEQ A;  1RL2 A;  5FBX A;  3QYH B;  2FHD A;  4YC9 A;  5GAO l;  2RHX A;  4HXO A;  3G4S A;  1K73 U;  5I7X A;  4DQ2 A;  3CCM T;  5F61 A;  3LQJ A;  4VUB A;  2D9E A;  5J39 A;  4ZTF A;  1KQS S;  3DLM A;  4M75 C;  4E7J A;  2F5K A;  5FDZ A;  1KQS A;  5IGL A;  5D3H A;  5HFQ A;  5D3L A;  4BW2 A;  4LD9 K;  5L99 A;  2O4X B;  5IGK A;  2AHJ B;  3G0L A;  3CCJ T;  3OYA A;  5D6W A;  5E9Y A;  3HME A;  4HA8 A;  3QPH A;  2LQ8 A;  5L97 A;  4YY6 A;  2MI6 A;  3GLX A;  3CCS T;  4QW2 A;  1I81 A;  3E1S A;  2OAU A;  4OGI A;  5D25 A;  5ENB A;  3CPW S;  2K57 A;  4IR5 A;  3PT9 A;  4J0R A;  5HQ7 A;  5DKH A;  2L89 A;  2EQK A;  3HL8 A;  3ZEH A;  2QEX T;  3M57 A;  5HEM A;  3VU3 C;  4XU0 A;  3O36 A;  3M5A A;  4LYW A;  5GMK j;  3HMH A;  3MET A;  3QXE B;  2FVU A;  3QKJ A;  3K2J A;  5EP7 A;  4M78 D;  4J6W A;  5DM7 R;  3D7C A;  4QEU A;  1MGQ A;  1JJ2 S;  1G5V A;  5DYA A;  3INZ A;  1G3S A;  5EWW A;  3JCM c;  5IAY A;  2RI3 A;  5GAM d;  5KCO A;  3OYL A;  4NXJ A;  5EU1 A;  5DLQ E;  4ZN1 A;  2K3Y A;  1BI3 A;  5LJ3 d;  2RO1 A;  5L8R E;  5I83 A;  2B8A A;  4HCZ A;  3E9F A;  2HQE A;  4CRI A;  2A3L A;  3MUL A;  2O01 E;  1LJO A;  4EMK B;  3G6E T;  3TLP A;  2LTO A;  4BE1 A;  5DW2 A;  5ENF A;  4FLP A;  4PY6 A;  4WHU A;  5LJ2 A;  4ZTJ A;  4TVR A;  4YBS A;  5FH6 A;  4J8O A;  3JCM P;  2M0O A;  3I56 A;  2EJ9 A;  4FM4 B;  3GPL A;  1I5L A;  3BFM A;  3UVY A;  5CKD A;  4A4H A;  2YW5 A;  5F62 A;  4XUA A;  3OYI A;  2EKO A;  5GMK m;  4A9K A;  4CFK A;  1VQ8 A;  5F1H A;  3M58 A;  4YY4 A;  1UGS B;  2DTO A;  3PFS A;  4ALH A;  3CEY A;  5KU3 A;  4QSW A;  5AYF A;  2OTL T;  4OUF A;  5F3A A;  1FWZ A;  5ENJ A;  3IU5 A;  1M5Q 1;  3DWY A;  1YI2 A;  4IUR A;  4YYK A;  4TT4 A;  5L8T A;  3JVM A;  3HRS A;  4HKE A;  4C92 G;  3JVJ A;  3OYC A;  4YYN A;  2XIC A;  3M59 A;  2H3J A;  5GAN e;  5CQ4 A;  1I4K 1;  4L6V 5;  1VQL T;  3L2U A;  5A5Q A;  3CCQ T;  5CUD A;  2LC4 A;  3KBG A;  4PKL A;  4EPC A;  3O34 A;  3JAM E;  3BY7 A;  5J26 A;  1VQM T;  4XY8 A;  3OYD A;  3TRE A;  1QVG S;  2YHT A;  3MP1 A;  4ZW1 A;  2WP1 A;  4C67 A;  5LJ5 d;  3CXC S;  5D24 A;  1G3T A;  5KO4 A;  4C8Q C;  4BI3 A;  5DY7 A;  4O7E A;  3U5P A;  4NRC A;  4KV1 A;  3I55 A;  3VUB A;  2DIG A;  2X4X A;  5CIU A;  2E7N A;  2MF2 A;  2LCL A;  5HK3 A;  3VKI A;  1WUM A;  4OB2 B;  4BW3 A;  1Q86 U;  3U5N A;  4QSQ A;  4C8Q D;  4YK0 A;  2KAF A;  1M1F A;  2EJF A;  4IUQ A;  4IR6 A;  1D3B B;  4TU4 A;  2EWN A;  4M75 F;  2DD4 A;  5C8G A;  4QST A;  5LKZ A;  4JS4 A;  1VQO A;  2RNX A;  3CME A;  2WSF E;  5IT9 E;  2DKW A;  5CTL A;  5TB6 A;  4M77 B;  4UYD A;  3JCM X;  3RKY A;  3L2W A;  4UYF B;  4PJO B;  3L42 A;  5FH8 A;  4XTV A;  1BYM A;  3LJW A;  5JI8 A;  3MEA A;  3A8L B;  3DKM A;  3OYK A;  4GLK A;  5CQA A;  3CMA T;  2V8I A;  1N27 A;  4JRI A;  4N4F A;  2LT4 A;  3U5J A;  3QDR B;  5D3N A;  5AME A;  5CQ5 A;  1VQ7 A;  5E3G A;  2ZPI B;  2KDS A;  1YJN T;  5F2P A;  3CBO A;  5A85 A;  3SWN C;  4XTW A;  3Q2F A;  1QW1 A;  1LNX A;  4EDU A;  4F7U F;  4M78 F;  3FLG A;  3OY9 A;  1YCY A;  2RHY A;  2XG8 D;  4X34 A;  4LDY A;  4XY9 A;  2L84 A;  3JB9 G;  2XI9 A;  4Z02 A;  4JUV A;  4NQN A;  5IGM A;  1VQN A;  5BT3 A;  2E41 A;  5CKB A;  1YJ9 A;  3OS2 A;  2R0S A;  5C89 A;  5LJ3 e;  4X2I A;  2BIV A;  5AMF A;  5HM0 A;  3UPU A;  5CQ6 A;  3HMF A;  5EI4 A;  2XDB A;  2PUO B;  1WJQ A;  3CC2 A;  3O35 A;  2M16 A;  3U5M A;  4B9X A;  3X25 B;  3CC7 A;  4UIY A;  1G3W A;  2RJD A;  1H3Z A;  1D3B A;  3CCE T;  2M1H A;  2RD1 A;  5I2M A;  3JB9 I;  2ZCF B;  5E7D A;  4OP0 A;  4A53 A;  3CCL T;  4MEP A;  3CCV A;  1K8A U;  2JNG A;  4RKU E;  1Q82 U;  3RKW A;  3WVD B;  4NRB A;  4XYA A;  3UT1 A;  3MB3 A;  1SSF A;  3LX7 A;  4C5H A;  2JZ2 A;  4PJO A;  5GAN h;  2I2L A;  3SVG A;  2K5I A;  5HCL A;  5HKC A;  3MEW A;  4M77 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...