4N4IA

Crystal structure of the bromo-pwwp of the mouse zinc finger mynd-type containing 11 isoform alpha in complex with histone h3.3k36me3
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
192
Chain Sequence
NKQEMGTYLRFIVSRMKERAIDLVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAASAQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Zinc finger MYND domain-containing protein 11
total genus 65
structure length 192
sequence length 211
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4iA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4n4iA02
4MR4A 5CUCA 4BDZA 5HFRA 4YYGA 2YDWA 2BKDN 3FEOA 5D7XA 5L99A 4A9KA 3MQMA 4BD3A 3LLRA 4HXLA 5ACYA 4IUVA 4HXMA 5EPBA 3ZEHA 5CQ8A 5HRXA 2DVRA 4O7AA 5A7CA 4PS5A 3UVDA 5I7YA 5L98A 5C8GA 3G0LA 3H8ZA 5HRWA 4QB3A 2GFAA 5A5RA 3PMTA 4LYWA 5E74A 2X35A 4A4EA 5E9YA 3FLGA 5KE3A 5A83A 5EA1A 3MEAA 5BT4A 5FE1A 3SD4A 5FH6A 3NTIA 5DKHA 3SVGA 3RCWA 1KHCA 5BT5A 3MEVA 2GRCA 4QZSA 5FE3A 1OZ3A 4BACA 2E3KA 4LZ2A 4J0SA 2RNWA 2WP1A 5DYAA 3U5JA 3OYAA 5DFDA 5IBNA 2X4YA 4A9MA 5H1TA 4N4GA 2DAQA 5ENFA 4KCXA 4QQGA 5HRVA 5I89A 2DKWA 4UIVA 4UYFA 2L84A 5C89A 1N72A 2EFIA 4QEVA 5HQ7A 4YK0A 3U5OA 5DY7A 4OGJA 4QR5A 4ZC9A 4O77A 5E9IA 3MB4A 4X34A 4CFLA 4YABA 3EAEA 3DWYA 5FRNA 2I8NA 2RFJA 5HENA 5D25A 3S3MA 5D3RA 5F36A 5DX4A 3LJWA 5D3JA 4HXOA 4PLLA 5CUEA 5HM0A 3KUFA 4ZTJA 3DAIA 5DYXA 3QZVA 5E73A 4CRIA 2YW5A 4NQNA 2DVSA 5ENCA 2FHDA 2F6NA 5FBXA 3FKMX 4QSWA 4II1A 5HQ5A 3P5OA 4Z1SA 5HFQA 5A5QA 4YAXA 3QZSA 3PMIA 5EP7A 4BJXA 5JWMA 4TT6A 5ENIA 4QQDA 4C66A 3UVWA 2RJEA 3OYBA 5FDZA 1F68A 4NUEA 4UC4A 5D6WA 4A4FA 3P1CA 1N27A 4PL6A 4O71A 5E9KA 5F3AA 5LVQA 2DIGA 2RI2A 4NR9A 5J0DA 4B9WA 5CQAA 4UIZA 4IR4A 4A9HA 2F6JA 4N4HA 4TU6A 5IGNA 5C87A 5CU8A 1JM4B 2PQWA 3OYFA 4PLIA 4QEUA 5EVAA 4O7CA 2K3XA 4UYHA 5E0RA 5EWHA 3OS0A 3LX7A 4NYVA 4RVRA 4MR6A 5FB0A 5HQ6A 4A9NA 4BE1A 4MEQA 4HXKA 3MP8A 3AADA 5ETBA 5DW1A 5EI4A 2P0KA 5EV9A 3O33A 5DW2A 5F60A 4E7LA 3ASKA 2LTOA 4HXPA 4Z02A 5CIUA 4HXRA 3Q1JA 5L8UA 5EWDA 4QSPA 5CQ4A 4XUBA 5IGKA 5KE2A 4E7KA 4LRGA 2EQKA 4C5EA 5KCOA 4UIUA 2OO1A 4ALHA 5F2PA 5FB1A 4CL9A 5ENEA 4OVAA 2RNYA 2XK0A 4QYLA 5CRZA 5D6YA 5LUUA 1OI1A 3QKJA 2WACA 4NRAA 5CUAA 5I40A 5KCHA 4YY6A 3S92A 3OYGA 5K29A 5DLZA 2G3RA 5J26A 3NXBA 5CQ3A 1X0JA 5C6SA 2RI5A 1RI0A 4BE2A 3NTHA 4AKNA 5FH8A 4IR3A 3PFSA 5J39A 4J1PA 4FLPA 4QSTA 5DLXA 2E6NA 5H1UA 2YEKA 5TCMA 4BW2A 4NR4A 5DKDA 5E9LA 5F62A 2E5QA 4E7IA 5I83A 3CEYA 4Q5WA 2D9EA 5LJ0A 4C67A 5FFVA 2DVQA 5EU1A 2RJFA 5FE5A 4MENA 3TLPA 1WGSA 4EDUA 2L85A 2L89A 4YYHA 5A5SA 3M9QA 5HELA 5C4QA 3QZTA 5F61A 5KTXA 4TTEA 5DFBA 3OQ5A 3MO8A 4YYIA 5CRMA 4FL6A 3QIIA 4XY9A 2N9GA 2OUOA 4BW3A 3DLMA 4YC9A 2R5MA 4YH3A 5AMFA 3O8VA 5KU3A 5DKCA 4OGIA 3OS1A 3MB3A 4TT4A 5CUDA 4ALGA 4QSQA 5L8TA 4HBVA 4O7BA 3OYHA 2NLUA 5KTUA 2HQEA 4O7FA 4YYNA 5CGPA 5IN1A 2YQDA 4PTBA 2QQSA 5DYUA 3E9GA 2F5KA 4UITA 4CUSA 4WHUA 5CQ7A 4TZ8A 2GFUA 3U5KA 5FH7A 2DVVA 3META 2GF7A 3P8DA 4O78A 2RNXA 4WIVA 5FRMA 4NRCA 5LJ2A 2EQUA 5A82A 5I88A 3UVYA 2O4XA 3G0JA 3L2UA 4B9XA 3MP1A 5I29A 2MJVB 3SVHA 3LQHA 5ENJA 4Y03A 4GY5A 5DBMA 5FFYA 3HMFA 4O7EA 3UV2A 4LR6A 3OYEA 2RHZA 4L59A 4UYGA 4XY8A 5IIDA 4LZSA 5D26A 5A5OA 5C0MA 5COIA 1WUGA 3P1FA 4KV4A 4NYXA 3BDLA 3OS2A 4UIXA 3UVXA 4BW1A 2M1HA 5EQ1A 1WJQA 1EQFA 5KHMA 4DONA 4TS8A 2L8DA 5F1LA 4O74A 2R10A 5FE0A 3ONIA 4IOOA 5CQ6A 2RI3A 5ENGA 2M16A 4O76A 4IUPA 4QSUA 5E9VA 3O34A 2L5EA 2VYTA 2EQJA 4NR7A 4NXJA 4J0RA 4RG2A 2D82A 2DIQA 2RS9B 4IR6A 3LQJA 5EPRA 4NR5A 2IG0A 3C4SA 5KH6A 2E7OA 4UIYA 4HXSA 5G4RA 5FE9A 2DATA 1XNIA 2YRVA 2R0YA 5CQTA 4TQNA 4QSXA 2FSAA 2LRQA 4CURA 4YBSA 5M9OA 1H3ZA 3S91A 4CFKA 4E96A 5A85A 5IGLA 5HCLA 4LD6A 5G4SA 5CZGA 3LGLA 5FE6A 4YBTA 3OYIA 5E9MA 2I7KA 4N4IA 5CPEA 3DB4A 5D6XA 5D0CA 3O36A 2RO0A 4ZW1A 2LSPB 4A9LA 5CUBA 3SVFA 1OYXA 4QC1A 4C5GA 5BT3A 5LKZA 3S3OA 4C5HA 4QC3A 3GG3A 4CUPA 4HCZA 5ENBA 5D3HA 5FE7A 2NXBA 5AMEA 4YH4A 5FG6A 3PNWC 3LXJA 4GPJA 5I86A 5HEMA 2K3YA 3OYKA 2LDMA 3L2RA 4IOQA 1G5VA 3MP6A 3HMEA 3I3JA 1WJRA 2H60A 3L2WA 4O70A 2OSSA 2JTFA 4A9EA 3E9FA 3UV4A 3P1EA 5JI8A 3MEUA 4PCEA 1E6IA 4QUUA 2DWWA 3U5LA 2EKOA 4BHWA 2KTBB 4QY4A 5CTLA 4O72A 1ZS5A 4PKLA 4QUTA 4QW2A 3OMCA 1OZ2A 4YBMA 2BIVA 5KO4A 3OA6A 4LC2A 5A5PA 2YELA 1WJSA 3QJ6A 2R57A 4TU4A 4IUQA 4QSVA 5H85A 4QR3A 4ZTFA 3JVJA 5IG6A 5CY9A 5E3DA 3S3NA 4LYSA 4MEOA 2O4XB 3MULA 4YYDA 3U5NA 1MHNA 2R58A 3GOXA 5II2A 5AD3A 4QR4A 3K2JA 5ETDA 5LKUA 4QEWA 4TYLA 5DYCA 2HQXA 4UYEA 5D3LA 5EGUA 3L2VA 3UT1A 5EWVA 2D9TA 3UWNA 4A9IA 4YYKA 5FROA 3FC3A 4NR8A 4Z1QA 2X4XA 5L97A 4X2IA 5ENHA 4IR5A 5DFCA 4ZQLA 3H6ZA 4IURA 3UV5A 4MR3A 5EWCA 2X4WA 4TZ2A 5A81A 4YY4A 3FDRA 3NTKA 2EQMA 4UIWA 3AQAA 5FE2A 2WP2A 4TT2A 3L2QA 3Q2EA 4UYDA 4Z6HA 4CUQA 4IUUA 4O75A 4CUUA 4BDYA 4QSRA 2XDPA 4PY6A 2RI7A 2R5AA 4HBXA 5FE8A 2B8AA 3ME9A 3OYMA 2BUDA 5HLSA 5E7DA 2RO1A 5LKTA 5LVRA 2L3RA 2LVMA 4LDFA 5EISA 5F1HA 4CUTA 4N3WA 5IGMA 4YADA 4F3IA 4WHWA 4XUAA 5D3TA 4PCIA 4MR5A 5CFWA 2RJDA 5F5ZA 5H1VA 3UW9A 5D3PA 3IU6A 3LGFA 4NUDA 3JVLA 5LJ1A 2QQRA 3QBYA 3OYCA 5II1A 4BW4A 3OYNA 4LYIA 5KTWA 4YYJA 5EK9A 4NYWA 3O35A 4Z6IA 5E3GA 5CP5A 5D24A 4QSSA 4QBMA 4FU6A 3JVMA 4C5IA 5C7NA 4UYFB 5FG4A 4HXNA 2RHXA 3DB3A 4QYDA 1SSFA 3S6WA 4E7JA 4HBWA 5A5NA 1JSPB 5CUGA 4A9OA 1WUMA 5EPSA 3LYIA 4IKFA 4Z93A 2YYNA 4MEPA 5HJCA 3Q2FA 3O37A 4QNSA 5LKXA 2R0SA 3HMHA 4LZRA 4Q0NA 4YATA 2RHIA 5I80A 4E7HA 2YEMA 4A9JA 2CKKA 3OMGA 5D3NA 5EWWA 4BE0A 5D3SA 5EICA 3MEWA 3U5PA 2RJCA 4NR6A 2RHYA 3D7CA 3OYJA 3P8HA 5FG5A 3P1DA 3L42A 3OB9A 5I1QA 5FFWA 5CQ5A 4KV1A 5C85A 2M0OA 2RHUA 2MWOA 5FE4A 4YYMA 2G4AA 4NRBA 4A4HA 3U5MA 3IU5A 4A9FA 2R0VA 3JVKA 4XYAA 5F63A 3ZYUA 5EM3A 4QQ6A 5AD2A 3LH0A 4HBYA 4J3IA 3MUKA 4A4GA 2LCCA 4IORA 2MWPA 4IUTA 4NS5A 2E7NA 4QVZA 4NUCA 4Q0OA 5IAYA 5I7XA 3LQIA 5CS8A 4N4FA 4OUFA 5L96A 3OY9A 4NQMA 3OYDA 4CLBA 3F70A 2JZ2A 3MXFA 3OYLA 5F25A 5TB6A
chains in the Genus database with same CATH superfamily
5HFRA 1M90C 4YYGA 1YJWT 5L99A 4A9KA 3MQMA 1K1ZA 1K73U 1YI2T 4HXMA 4EIKA 2Z0WA 5HRXA 2DVRA 4O7AA 2RPNA 4P5NA 5L98A 3CC4T 5C8GA 1KIKA 2JNGA 5FU6B 2HSPA 4LYWA 4A4EA 5DM7R 2K4YA 1DJ7B 2K57A 4N0AC 2FL7A 5GANe 4JJDA 5FH6A 2F2XA 2ZGWA 4FCYA 3JCMb 3HTRA 2FPDA 3CCMA 1IREB 2NYSA 4J9CA 4J0SA 1M90U 1WYXA 4A9MA 1VOMA 5H1TA 4N4GA 2DAQA 3M5AA 4KCXA 2YRCA 1E6GA 5HRVA 2I0NA 4CC7A 2DKWA 1VQKT 2L84A 1ZSZB 3CCVT 2EFIA 4D8DA 4QEVA 5HQ7A 4F7UB 1QCNA 2V8KA 2XI9A 2ZPBB 3CCLA 4OB1B 4ZC9A 3A8MB 3C12A 5KYNA 3MB4A 4X34A 1TTHB 2AZVA 2EJFA 3M53A 1QWEA 1U1SA 4YABA 3EAEA 5FRNA 3CPFA 2ENMA 5D3RA 2YLBA 5F36A 2DL3A 3PE0A 1EZZB 2QA4T 1S72Q 1HSQA 1OQKA 5E73A 3JCMX 2DVSA 1GXIE 5FBXA 4Z1SA 5CAIA 1AVZC 4KUIA 3RDVA 5A5QA 2FPFA 5EP7A 1TUGB 4HVVA 5GMKh 1KC8C 4XTVA 3H9NA 2BTTA 1OOTA 4NUEA 1W6XA 3G4SA 5LVQA 3QDRB 1WZOA 1YWOA 1R0BG 4C92G 4A9HA 4UIZA 4IR4A 2ZPIB 1ZBXA 2ZCFB 4N4HA 4TU6A 2PQWA 2K6DA 3OBWA 3SEMA 3V8KA 4F7UA 5E0RA 5HCKA 1QLYA 3HRTA 5HQ6A 1IO6A 1WHJA 1VYTA 5ETBA 2L3PA 1SEMA 2P0KA 1Y96B 5EV9A 2BZ8A 5DW2A 5F60A 4Z88A 4E7LA 2LTOA 4HXRA 2CZ7B 4B6MA 2DD5A 1XOVA 2Y4YA 5EWDA 4QSPA 2A37A 1I0CA 3VS6A 3QJYA 4LRGA 4C5EA 2A0FB 4ALHA 3EFOA 1YITQ 5F2PA 4CL9A 4QYLA 2V1QA 1OU9A 3CBMA 5D6YA 1QQJA 4RTXA 5LUUA 3LWHA 1KG1A 1K8AU 2X4JA 4NRAA 4R0KA 3EG0A 4M77B 2DTHA 2K79A 3EGUA 5K29A 4J9HA 2DL8A 1D0YA 3QSUA 1YCSB 1RI9A 2H8HA 5C6SA 4AKNA 2DRKA 4OP0A 5DY9A 2E6NA 2YEKA 3R6OA 1HJDA 5DKDA 4E7IA 5I11A 5FWBA 3UA6A 2A3LA 1X2QA 5A0DA 5KYWA 5FFVA 5GANj 5FE5A 5CQXA 3TLPA 1UGSB 2E10A 2VXFA 1ACMB 3M9QA 5HELA 4EMHA 2CUDA 5F61A 3MO8A 5CRMA 2N9GA 3DLMA 2DPPB 4YC9A 1PNJA 4YH3A 5AMFA 5DKCA 3PGGA 1YFNA 4OGIA 1KC8U 5CUDA 4ALGA 3I55Q 2V1RA 3OYHA 1YBYA 2KROA 5KTUA 5GAMe 4O7FA 5AT1B 5CGPA 1HK9A 3V8JA 2QQSA 2HBPA 2JS0A 2IPOB 1M3BA 4TZ8A 5GAOp 5FH7A 2XDBA 4AFQC 3V7SA 1EIFA 2RNXA 4HCCA 2DK3A 4V2SA 2NUPA 2OAWA 1VUBA 3UVYA 4C0ZA 4C8QG 5ENJA 1WI7A 2DFUA 2RA2A 5DBMA 3HMFA 4O7EA 1VQ9A 4LR6A 1U06A 4M75C 3G4ST 5A5OA 2PZ1A 4KV4A 3BDLA 2DXTA 4XTXA 3QG1A 3OS2A 1G3WA 3I5SA 1VQLQ 4J9EA 2CP7A 1EX4A 4IOOA 2RN8A 4O76A 5E9VA 3O34A 1JBMA 4PJOD 5GAN4 3G71T 3E2UA 2DL4A 3LQJA 4NR5A 2YSQA 1MUZA 4C0DB 5KYYB 1YJWA 5FE9A 1YJNA 3JB9D 2DBMA 1XNIA 1QVGP 3KXTA 1K9MR 4M78E 1MNDA 2DYBA 5FU6C 2JM9A 4YBSA 5M9OA 4E96A 2A08A 3VYHB 5CZGA 3SFMA 4YBTA 1WNLA 5A2QE 3OYIA 3G6EA 2M9UA 1N8RC 2I7KA 2P4RA 5CPEA 2HDAA 2RO0A 3ULRB 3LWIA 5CUBA 3SVFA 3A8OB 4C5GA 5GAN5 3FJPA 3ERRA 5LKZA 4F7UG 4QC3A 3GG3A 3CCUT 4HCZA 4KULA 2PNIA 1UJ0A 2O01E 3PNWC 5AMEA 4C92F 5HK3A 1K9MC 2DLPA 3I3JA 1NPRA 4O70A 2OSSA 4AFUC 2DXUA 1Q7YR 3UV4A 3MEUA 1VQ6A 1VIEA 4GLKA 2JW4A 4PKLA 4M75G 1OZ2A 5KO4A 1WJSA 2R57A 2LT4A 4M77F 1X75C 4QR3A 4PJOE 3SHWA 4M77G 4M7AG 5IG6A 1I07A 5E3DA 3S3NA 3A8HB 2O4XB 2KT1A 3MULA 3GOXA 4OMLA 1ZLMA 3CCQQ 2YUQA 4QR4A 5ETDA 3JSCA 4PKCC 4PJMA 4QEWA 2KYBA 1D3BB 5D3LA 4M7DE 5EWVA 2BE9B 4A63B 2X4XA 5ENHA 1U3OA 4L5GA 3H6ZA 3N5BB 3M56A 4TZ2A 4YY4A 2E70A 4JJBA 2EQMA 1M8MA 3CBOA 5FE2A 3L2QA 2WP2A 4TT2A 3RESA 2MF2A 3QWXX 1Z9QA 3E19A 4CUUA 3NPFA 4QSRA 4ELZC 2ROTA 4XU3A 4AFZC 1YHQQ 2D0NA 1UTIA 1U8RA 2LVMA 3D1BA 1Q86C 4WTOB 1VQ6T 2XKOC 2XMFA 5D3TA 2CUBA 4Z89A 4MR5A 3EG9B 3OYYA 5H1VA 1OU8A 3IU6A 3BE3A 3LGFA 2QTXA 3GPLA 3TCJA 2COZA 2QQRA 5GAN2 2J6KA 1I8FA 1SHGA 3P8BB 3CCUA 2DD4A 1G3TA 2M51A 5D24A 4FT4A 4GLMA 4QBMA 2RK2A 5C7NA 2F1LA 1G8XA 2LQ8A 4HXNA 5IHKA 2DVEA 4Y91A 1FMWA 3VYGA 2PVOB 3Q2FA 2R0SA 4E7HA 3TU4K 2EIFA 1I81A 4JDSA 5EWWA 4BE0A 2OI3A 2LNHB 3MPUB 1NPPA 3X28B 2PVDB 4XU1A 2ESWA 3CXCP 1OX8A 3HRSA 1MV0B 1X43A 2DL7A 3G71A 5FG5A 1YJNQ 5FFWA 4JS4A 2RHUA 2M0OA 3UPUA 1YIJQ 2OTLT 4KT0E 2OTJA 5FE4A 2G4AA 1YNZA 2VWFA 2EAYA 2KYMA 4A9FA 3VS1A 3JVKA 4VUBA 4HBYA 1TOVA 2F2WA 3AT1B 4NS5A 1VQLA 4Q0OA 2QASA 5I7XA 1VQMT 1IB8A 1AWOA 4NQMA 2KR3A 4WCIA 2DYIA 2JZ2A 3HPWA 3I56T 1FX7A 3OYLA 3HHTB 1M27C 5CUCA 4PJOF 3RKWA 2YDWA 3MJXA 3PVLA 5D7XA 1VQ4Q 3FB9A 1QVFS 4PJOB 4BD3A 4HXLA 5EPBA 5A7CA 4PS5A 3UVDA 4O6JA 3JB9G 3H8ZA 4QB3A 1PM3A 3WVEB 2JUFA 4XU0A 4OGCA 5GJWB 2EYQA 4F14A 1VQ5Q 5FWCA 1M90R 5EA1A 3MEAA 5BT4A 4O5VA 3M0SA 2ED0A 4GBQA 4JRQA 3SVGA 1VQ5A 5LJ3e 3UA7A 3MEVA 4PFZA 1OZ3A 3CCJT 3A1PA 4LZ2A 3OW2P 3EFOB 2XHCA 5CKBA 5DYAA 1VQ8T 5IBNA 5DLQE 2QEXQ 1O9SA 1KD1C 1QKWA 4MMKA 1YI2Q 2KDSA 2MI6A 2L3SA 1AHJB 4YK0A 1QP2A 2EYWA 3VS3A 1JXMA 2AHJB 4FSSA 2D6FA 4CFLA 3DWYA 1M30A 2RFJA 3WVDB 3A98A 3SB2A 3LJWA 5GMKj 4HXOA 4FT2A 1ZHIA 3RR6A 1VQ8Q 3HL8A 3X24B 2FHDA 5ENCA 2F6NA 3I55A 3HP9A 4QSWA 1V1CA 4C8QE 5HQ5A 3P5OA 2LCLA 1SG5A 2DVJA 1KD1U 2F2VA 3PMIA 1NE8A 2DM1A 2ECZA 5ENIA 2KVQG 4C8QD 1GCPA 5CKHA 1F68A 1EFNA 3EG2A 5EG2A 5KYXB 3EHRA 5D6WA 3GBQA 3P1CA 2KXCA 1AD5A 2W10A 5F3AA 3CMAQ 5GAN8 1VQMQ 2DIGA 5IHNA 1KSWA 2X51A 1WA7A 3WXMB 2WSFE 4NR9A 3CMAA 3JCMQ 1MGQA 2F6JA 3CCRQ 5C87A 1D0XA 4PLIA 4O7CA 5LJ3d 3AHUA 1O75A 1JQQA 2LP5A 3OS0A 5KYUA 1AZEA 1LVKA 3LX7A 5EC7A 3I9QA 1PUOA 9ATCB 3L1AA 4MR6A 1UHFA 3PIOA 2KY9A 4HXKA 2HD0A 3MP8A 1S72A 1FMVA 5EI4A 4JRIA 1N8RR 5GANh 3O33A 2SRCA 2GNCA 3ASKA 4C8QB 5L8UA 1ZSZC 4M75E 4E7KA 2CP6A 2EQKA 1I5OB 5LJ3g 5KCOA 2OO1A 4FIBA 1VQ9T 4BUGA 4F16A 5ENEA 4M75D 4OVAA 2OTLQ 3I35A 5LJ3f 2RNYA 1OULA 1OI1A 2WACA 4ESRA 5KCHA 2YUOA 4M75F 3KFVA 1X0JA 1R77A 4C8QC 1RACB 1RI0A 4BE2A 3NTHA 2KBTA 2JM8A 4M7DF 2RMOA 3PFSA 5J39A 2EGCA 5DLXA 5H1UA 4BW2A 5TCMA 2FG0A 2ZPFB 4LXCA 5I83A 4XK8E 4LN2A 2PU9B 2DVQA 4FM4B 1VA7A 8ATCB 2HEQA 4RUGA 2YHTA 1IHVA 4EDUA 5LJ3j 1VQKA 4HKEA 3UATA 5C4QA 2HSEB 3QHSA 3R6NA 2CSQA 1RADB 1UGQB 2QDLA 1N9SA 4FL6A 1QCOA 4J5YA 2OUOA 1TS9A 2L0AA 3CC2A 2HBWA 3O8VA 2JS2A 4DA4A 4IIOA 2KE9A 3OS1A 1N5ZA 2FZKB 1Q82C 1UGRB 3MB3A 2HMAA 3I55T 4M7AA 4O7BA 2DEUA 4N0AA 1X6GA 1OV3A 2P0PA 4C92B 4YYNA 1TG0A 3VUBA 3VRYA 1NYFA 5IN1A 3SDZA 4WF2A 1E6HA 4UITA 1HD3A 1AZGB 3CC4A 4WHUA 4NL3A 5GMKe 1WXTA 3JCMh 4E7ZA 1UE9A 3U5KA 1QVFP 4LDWA 2KQWA 4DBQA 3P8DA 4O78A 3DKMA 3VU3C 1WQWA 5I88A 1TXQA 2O4XA 4ZN3A 3CMAT 4B9XA 3EG1A 1FMKA 1RAHB 5GAMj 4M78A 3SVHA 3LQHA 2DMOA 2MIOA 4GY5A 4RCBA 1Q7YC 5FFYA 4J6YA 2O88A 1YJ9T 3UV2A 3CCJA 3OYEA 3MKDA 1VQOA 3CCMQ 3M0PA 1N6AA 1IRXA 5C0MA 3JCMP 3QZ5B 3THKA 3HRUA 4AKHA 2A28A 4BW1A 2V8IA 5EQ1A 1WJQA 1HYOA 5KHMA 1GRIA 2VC8A 2YDLA 4RTUA 1PSEA 5F1LA 1ZUYA 3CCEA 5FE0A 5CQ6A 4HVWA 2MAMA 2L5EA 1J3TA 2XU8A 1UB4A 4NR7A 2D82A 2DIQA 5EPRA 3C4SA 3ZL7C 2FZCB 2YRDA 2R0YA 5CQTA 2ZAEA 4BI8B 4QSXA 1M2OA 3GNGA 1C0MA 2CGHA 5HCLA 3QPHA 5G4SA 4LD6A 3LGLA 1ZQ1A 2VGMA 3M0TA 3GIBA 2C06A 1V76A 3DB4A 5D6XA 1VQLT 3X26B 1RAEB 3EH2A 4ZW1A 3VKGA 2LSPB 2VVKA 1VYUA 2QEXA 3CCSQ 2VB6A 3CC7Q 2HCKA 3QZ9B 4HCBA 1Y07A 2LJ0A 4C5HA 4D8KA 5I22A 3CBPA 4EMGA 1BBZA 5D3HA 4LUEA 4YH4A 3LW5E 1VQ5T 2OTLA 3LXJA 1H92A 2QA4A 3V7CA 5I86A 3OSVA 5HEMA 2YXYA 2LDMA 3QYHB 4IOQA 2DJZA 3HMEA 3X20B 4IIMA 4JLIA 3L2WA 2JJ9A 2RQWA 1BI0A 3E9FA 3RKYA 4JRPA 1K9MU 4MZMA 5JI8A 4PCEA 2DWWA 2EKOA 3TVTA 4O72A 1ZS5A 1MMNA 4YBMA 1VQ4T 5A5PA 2YELA 3UF4A 3RMQA 2MK5A 5H85A 3JB9F 2MCNA 2CSIA 2J6OA 4YYDA 3U5NA 1MHNA 2FRWA 5FLXE 3G6EQ 6AT1B 5LKUA 2FB7A 4UYEA 2HQXA 2EJ9A 4J6WA 4A9IA 2ZPEB 3PTAA 1M1KC 3FC3A 2MOXA 5L97A 3V7RA 5DFCA 4ZQLA 3UV5A 4MR3A 2BZXA 3FDRA 3NTKA 4J7IA 1M2VB 4UIWA 2MPXC 4KBMB 1N8RU 4CUQA 2COYA 4BDYA 1ZA2B 2DILA 2XDPA 1SRMA 4PY6A 1ZUKA 2RI7A 2CREA 2SEMA 4R55A 3ME9A 4JJNK 2B8AA 1WLPB 1SKUB 2BUDA 5E7DA 5LVRA 3VS5A 2JT4A 1B34B 4CUTA 1BU1A 4N3WA 5IGMA 3M4GA 4F3IA 3QDFA 2HKQB 3HFOA 1BIBA 2AIRB 3M58A 4PFPA 1WQ7A 3UW9A 2P4TA 4EMKA 3CPWA 3JV3A 1KQ2A 3OYCA 1Q81U 2QXFA 3OYNA 5KTWA 5EK9A 4NYWA 1RAIB 2X3WD 1M1FA 1WDXA 1WX6A 2QQAA 2EGEA 1MMGA 3URGA 1T3SA 2RH2A 2WSCE 1PKSA 2RHXA 2DBKA 4NL2A 4QYDA 1SSFA 1JRIA 2DE0X 5A5NA 3SWNC 4Y92A 1K76A 1QKXA 2COWA 2CT3A 2W0ZA 4ZGJB 5CUGA 4A9OA 1M3AA 1GL5A 4QNSA 1KHIA 4MDXA 3HMHA 4YATA 2RQTA 5FU7C 1VQPT 1OX9A 2QTVA 4A9JA 2CKKA 1CKBA 1V29B 2GQVA 5LJ5d 2RHYA 4M75A 3P1DA 3OB9A 4OMNA 5I1QA 4KV1A 4AG1C 2E41A 5GAN6 4YYMA 4A4HA 5GJVB 1GBRA 1CSKA 3IU5A 2G6FX 2EVRA 5AD2A 4DBHA 4J3IA 3MUKA 3O5ZA 2MWPA 2LC4A 4J9GA 2EYYA 4QVZA 4ZNXA 1KQSA 1HXDA 3GF5A 2LCSA 5IAYA 1BI1A 4PJNA 4OUFA 5L96A 4KGVB 2RF0A 4AKIA 3G7ZA 4EPCA 1YJ9A 3OYDA 3M54A 2OJ2A 1VQ7T 3JCMW 5F25A 1X01A 1G83A 1YJNT 2BKDN 2HL5C 2QI2A 5GAMh 2XD0A 2K5IA 5ACYA 3ZEHA 1SF9A 5HK0A 3G0LA 5HRWA 2GFAA 1U5SA 3PMTA 2LJ1A 5E74A 2X35A 5FW9A 5LJ5g 1W2BP 5CCAA 3FLGA 5KE3A 5A83A 4RTVA 3SD4A 2AKKA 1VQ7Q 3NTIA 5A0GA 2JXBA 3RCWA 4C8QF 5BT5A 2J6FA 2VUBA 1NZ9A 2GRCA 4QZSA 2WSEE 1ARKA 2E65A 3H0HA 4BACA 4AKGA 2KRMA 3J7AF 1NEGA 2QA4Q 4M77A 4M75B 1BB9A 1VQNQ 1K73C 2EJNA 1IHWA 3HFNA 5ENFA 3NGPA 5I89A 2K7AA 3G6ET 3G1JA 1H3HA 2K3BA 5C89A 1M5Q1 2E5KA 4M7DC 5DY7A 4QR5A 3M59A 1BCOA 4QT7A 3M57A 1UGPB 1OPKA 1NG2A 2VGNA 4DEYA 1VQOQ 2RB6A 3EFSA 3LH5A 4M77D 2LMJA 3FRNA 2FEIA 4PJOC 5D25A 3S3MA 3TEEA 3CD6A 1UJYA 5D3JA 1KQSP 4PLLA 1YIJT 5CUEA 3DAIA 3QZVA 2YW5A 4NQNA 3CMEA 4II1A 3FKMX 2FRYA 4OMMA 4CC4B 4MZTA 4LDVA 1ZKRA 4HVUA 1K73R 3EGXA 3QZSA 1XTDA 4BJXA 4LD9K 4C66A 1VIFA 3INZA 3UVWA 3OYBA 1FXXA 4UC4A 3VJPA 4DOVA 2AKLA 4D6WA 4RTWA 2CT4A 4RCCA 2RI2A 1I5LA 5CQYA 1YP5A 5IGNA 2JTMA 5CU8A 2RNAA 3CCJQ 3CCRT 4C0GA 2CZ1B 4QEUA 5EVAA 1PCXA 3TSWA 3VS4A 2ZPHB 1S72T 4A53A 4DBRA 5GANd 2HZYA 2CDTA 2L2PA 4A9NA 3RKXA 4BE1A 4MEQA 3AADA 1NEBA 4Y28E 2A7YA 1VQ6Q 2KEAA 4HXPA 4Z02A 5CIUA 3Q1JA 4J7FA 4XUBA 5KE2A 1VYVA 4MDWA 4MMLA 4UIUA 2OX7A 4E47A 1D1BA 1PC0A 1JJ2P 3BFMA 2EYXA 3VKIA 5GANg 1WHLA 5CRZA 2Y4XA 3QO3A 5GANf 5CUAA 2KNBB 1VQNA 3JB9I 4QKUA 4YY6A 1AWJA 2PUOB 3OYGA 4XAXB 3VRZA 1TH7A 4C92E 5DLZA 2KAFA 3NXBA 1WIEA 2JMCA 4LDYA 5FH8A 4IR3A 1B7TA 2PTKA 4J1PA 2QK0A 4E2FB 4NR4A 5E9LA 5F62A 1UUEA 2E5QA 4Q5WA 2O31A 2D9EA 3MCAB 1T0JA 1VQ9Q 5EU1A 2A36A 2RJFA 4MENA 4JUVA 2LX9A 1NJIU 2L85A 1K4US 2L89A 3CCQA 3NHNA 4YYHA 3E1SA 5A5SA 2O9VA 2FO0A 5LJ5f 4TTEA 4YYIA 4J9BA 3QIIA 5LJ5j 1W2BA 5CK9A 2RQRA 2R5MA 5GMKi 5KU3A 1KK7A 2E12A 5LJ5e 2DERA 3CMET 1OEBA 1JB0E 4F04B 4YTLA 5L8TA 1AT1B 4EMKC 4HBVA 1PHTA 2NLUA 5CKFA 3H0IA 3RUXA 8AT1B 4LNPA 3ZFJA 1JEGA 2YQDA 1UEBA 2YUPA 2XDDA 3E9GA 1LCKA 4CUSA 2DA9A 1NJIC 2K2MA 1MNEA 3CCLQ 2GFUA 4FW2A 3T9NA 3META 3RBBB 2MYSA 4WIVA 2ATCB 3CCRA 3J81E 5A82A 2DXCA 3A8GB 1QCFA 4KGZB 3L2UA 5GAOm 1UGVA 4Z8AA 5I21A 2CS7A 4XU2A 4M77E 2K5LA 3CCMT 2RHZA 1NM7A 4L59A 1ABQA 1P92A 2LZ6B 1RAGB 1MMDA 1UFFA 5COIA 1WUGA 1QVPA 4NYXA 3C95A 5GAN7 1NYGA 2K5FA 3UVXA 4DQ2A 3V8LA 1EQFA 5I2SA 4DONA 4TS8A 3EGDA 4O74A 3H41A 4R56A 3ONIA 2KI7A 2RI3A 2ZZDA 2M16A 4IUPA 1AWWA 2VYTA 1YIJA 2EQJA 2OTJQ 2CH4A 2QG9B 4J0RA 4RG2A 4IR6A 2B86A 1UDLA 4K11A 2PUKB 2M02A 4UIYA 2K2VA 2DATA 2YRVA 1KJWA 2FSAA 4CURA 1VQ7A 1H3ZA 1X69A 1G2BA 5IGLA 1UHCA 4FSXA 4XTYA 1PWTA 2KRSA 1UG1A 5E9MA 2AZSA 4N4IA 3FJ5A 5D0CA 3O36A 2E3IA 4A9LA 4BB7A 1C6VX 4C92D 2JTEA 2QQBA 1OYXA 1D0ZA 1Y96A 5BT3A 3VUZA 2CP0A 4PNOA 5ENBA 2KGTA 3RNJA 2HQHA 1JU5C 3VV0A 5FE7A 1GFCA 1X27A 3CD6Q 3OYKA 1G5VA 3MP6A 1WJRA 1A0NB 4A9EA 5GAMf 1M8VA 2IVWA 2KTBB 4M77C 5CTLA 3OMCA 5GAMg 3OA6A 3D1DA 7AT1B 4QSVA 4ZTFA 3JVJA 4AFSC 5CY9A 4HT9A 4MEOA 4M7DA 2EW3A 5AD3A 1D09B 3EGDB 1ZSGA 1FWZA 2E6ZA 4AT1B 4KRTA 3L2VA 3UT1A 2NUTA 4Z1QA 4PJOA 4X2IA 5LL6S 4IR5A 1Y7XA 1ZUUA 1TUDA 3HKSA 5EWCA 2X4WA 3OW2S 2EGAA 2RM4A 3JCMf 4A4KA 3AQAA 2AT1B 1YCYA 3Q2EA 4UYDA 4O75A 4J9DA 4C92A 1GBQA 3JCMg 3JB9J 4PJJA 1TWBA 1MV3A 2R5AA 2EKHA 3CPWS 3NMZC 2RO1A 5LKTA 3QUIA 3GP8A 1NBEB 4LDFA 1QMCA 2GQIA 1NJIR 5EISA 5F1HA 1BK2A 5IHIA 2ROLA 4YADA 1RL2A 2HKNA 1JJ2A 2CZ0B 5GAOl 1BI3A 3OBYA 5CFWA 3U23A 3C0CA 2RJDA 5F5ZA 2EPDA 5D3PA 2LX7A 2XG8D 1OPLA 2D8JA 3JVLA 3I56A 5LJ1A 5FU7B 3PIPA 3QBYA 5II1A 3C94A 4BW4A 1VQMA 3X25B 5CR2A 1K8AC 4Z6IA 5E3GA 3OS5A 4ZGDB 5CP5A 3CCEQ 4QSSA 1QVGA 1KC8R 4JS5A 3JVMA 4C5IA 3CCUQ 2O2OA 5IT9E 3S6WA 3G71Q 1JSPB 2L5QA 2NUZA 1KHCA 4MEPA 5HJCA 3O37A 4LZRA 4Q0NA 5I80A 3GNFB 4J83A 2FPEA 2L3QA 3EH1A 5D3NA 2D8HA 5EICA 3M55A 3TREA 2LNVA 1M1KR 1SHFA 1YJWQ 3OYJA 2DZ9A 4J9IA 3P8HA 3J80E 5CQ5A 5C85A 2MWOA 4PFOA 4NRBA 2P84A 3JCMV 4CI0C 3JB9H 3CC7T 5F63A 3ZYUA 4QQ6A 1YN8A 3JAME 1IZ6A 4EMKB 4A4GA 2LCCA 5KYXA 5GAN3 1M4ZA 2K9GA 2GTOA 1K8AR 2E7NA 2H3EB 2GTJA 2LQWA 1AEYA 5CS8A 3BW1A 4PJLA 3OY9A 5GMKl 1D1CA 1ZSZA 3MXFA 4J6XA 1NLPC 4FYWB 4FYYB 2DEQA 5TB6A 4MR4A 4BDZA 2X9HA 4J9FA 2KSSA 4ME7A 2VV5A 3FEOA 4OMFB 1WHKA 4M78F 3LLRA 2ZPGB 1K9AA 3A8LB 1Y57A 4IUVA 1LNXA 1D3BA 4AG2C 3D7SB 5CQ8A 3UDCA 3QWYA 2YWWA 4OMPA 3CCSA 5I7YA 1U1TA 2Y90A 3CPWP 5A5RA 3JRZA 5L23A 4C8QA 2ABLA 5E9YA 1RAAB 2JMAA 1GFDA 2NWMA 1BI2A 1RLQC 3PVQA 2DZCA 2FZGB 1IXDA 3EG9A 5FE1A 1PD0A 1Q82U 2HL3A 5DKHA 1WHMA 2QDYB 4QVCA 5FE3A 2E3KA 2RNWA 2WP1A 3U5JA 3OYAA 4LDXA 1D1AA 5DFDA 4M7AF 1NLOC 2X4YA 4M7DG 4M7AB 4QQGA 1XQHA 3JCMd 4UIVA 4UYFA 4MZPA 3CCQT 1N72A 2J05A 3U5OA 2CP2A 4OGJA 1QP3A 3BDUA 5I2MA 4PJOG 4O77A 3DLLA 5E9IA 2VASA 2QGFB 2RK1A 3CXCA 2I8NA 5HENA 1M2VA 3REBB 4JZ3A 2XIDA 5DX4A 3MHXA 2YLCA 5HM0A 3KUFA 4ZTJA 2J7IA 5DYXA 4CRIA 3CCET 5HFQA 4LDUA 1Y71A 3I5RA 1B34A 4YAXA 1SPKA 2CZ6B 1VQNT 5JWMA 4TT6A 4QQDA 5GAMd 2RJEA 3EG3A 1KQSS 4KUDK 5FDZA 3OSSC 1Q81R 3BY7A 4A4FA 1N27A 1LJOA 4PL6A 4O71A 1I4K1 5E9KA 1VQOT 3IQLA 3VS2A 1K0XA 5GAOq 1M1KU 2C0OA 3VS0A 5J0DA 4B9WA 1IGUA 5CQAA 2KMTA 1JM4B 1Z9ZA 1Q82R 3M0QA 2E1HA 3OYFA 1TSFA 2E3HA 2K3XA 4UYHA 2CH4W 4KH1B 5EWHA 4A54A 4NYVA 4RVRA 5FB0A 3A5ZB 4TVRA 2KRNA 1CKAA 5DW1A 1B07A 1Y0MA 2EQIA 2QQ9A 5GAOr 5CQ4A 1QWFA 5IGKA 4M4ZA 4AMCA 4NOYA 5FB1A 1BYMA 5HKCA 4BY6B 1Q81C 2XK0A 3CC2T 2DRMA 1AWXA 3M4YA 2PVGB 3CQTA 3QKJA 2DKGA 4PK4A 5I40A 4F7UF 3S92A 1M9SA 1GCQA 2G3RA 5J26A 2GGRA 5CQ3A 1WFWA 2RI5A 4KH0B 1I1JA 3ZBDA 2LJ3A 1WXUA 2O9SA 2JN0A 3CD6T 4FLPA 4QSTA 1TUCA 3RMSA 3JCMJ 1AOJA 2AK5A 3CEYA 1KFZA 4BY6C 2EYZA 1G3YA 5LJ0A 3M0UA 1H8KA 4C67A 4M7DD 4F7UE 3I56Q 1X6BA 1X2KA 4XQ3A 1LPLA 4C92C 4QVDA 1WGSA 2CYZB 3CCVA 4ELYC 1F1BB 3TSZA 3QZTA 5KTXA 5DFBA 3OQ5A 4FYXB 4OB2B 1PRMC 1WXBA 4XY9A 4BW3A 1VQKQ 2X3XD 1ZA1B 4FYVB 2HAXA 4E7SA 4TT4A 5IH2A 3CMEQ 4QSQA 4M7DB 1YJ9Q 4RG8A 5AYFA 1PKTA 1RUWA 5GMKm 2HQEA 1W4SA 3REAB 4PTBA 3CC2Q 5DYUA 2F5KA 1BCMA 5A0LA 5IXFA 5CQ7A 4J8OA 2KXDA 5GAOn 5KYUB 4X1VA 2DVVA 2H3JA 2GF7A 1JO8A 3VS7A 5FRMA 1Q86U 4NRCA 5LJ2A 2EQUA 2MMPA 4BI4A 2E64A 1W1FA 3PT9A 3G0JA 2NUTB 5LJ3h 2RQVA 3EGXB 3MP1A 5I29A 1VQ8A 2MJVB 1E7OA 2DNUA 4Y03A 1K0SA 4RTTA 2OAUA 2DJQA 4UYGA 1W70A 3EFRA 3RIRA 4XY8A 5IIDA 3TQ7P 4M7AE 4LZSA 2BE7D 2JOYA 5D26A 1YITT 4XTUA 2J06A 3P1FA 2CP5A 5CVIA 4UIXA 1KQ1A 2KK4A 2LQKA 2M1HA 2F5TX 4FW1A 1SSHA 2L8DA 4OF1A 2DX1A 2R10A 4ZGEB 5ENGA 4QSUA 2LQNA 3QYGB 1JXOA 4HT8A 2F69A 3H0FA 4ANJA 4ATOA 4NXJA 4DOWA 3SWNA 2RS9B 5KH6A 2IG0A 1VQPQ 2E7OA 1PSFA 4HXSA 2QGGA 5G4RA 5KYWB 1Q7YU 4TQNA 4RKUE 4F17A 1RABB 2LRQA 4RTYA 3S91A 4CFKA 2GCXA 5A85A 1M3CA 2RD1A 2DXBA 5FE6A 4OGEA 1WPYA 4X9CA 4ZN1A 1SRLA 1WHHA 2DTIA 4OB0B 1N9RA 4C0FA 4QC1A 4M78G 3S3OA 5IXBA 4CUPA 1XJWB 4X9DA 1BIAA 5DLOA 2NXBA 5FG6A 2I2LA 2OTJT 4GPJA 4DEXA 1TU0B 2LT1A 3EHQA 2DO3A 2K3YA 4CC3A 3L2RA 1T3LA 4M78D 4DBFA 3G4SQ 1R0CB 2H60A 4L6V5 1B3QA 1ABOA 2JTFA 2C0TA 2D1XA 5CO7A 3P1EA 5HY6A 1FYNA 1E6IA 4QUUA 3U5LA 4BHWA 4QY4A 2KT8A 4QW2A 4QUTA 3CCLT 3CCST 2BIVA 4LC2A 4IUQA 3QJ6A 3SWNB 4TU4A 3VKHA 1MMAA 4CC2A 1G3SA 4C0DC 1JJ2S 4LYSA 1UECA 4HXJA 2R58A 2CP3A 5II2A 1T0HA 3CCVQ 2YUNA 4ORZA 3K2JA 4M7AC 1S1NA 2NUPB 5DYCA 4TYLA 2DF6A 5EGUA 2D9TA 3UWNA 4YYKA 5FROA 4NR8A 2EJGA 4IURA 1W2BS 1LOJA 2FYKA 4M7AD 5A81A 2VKNA 1QW1A 5J3BA 4RMOA 3HSBA 2P0QA 1PG5B 4XTWA 4Z6HA 4IUUA 2VXEA 1QVFA 3OW2A 2EWNA 3CC7A 3GLXA 1Q86R 3ER0A 4HBXA 5FE8A 3OYMA 2DETA 5HLSA 4M78B 3QXEB 2L3RA 1VQ4A 3CC4Q 1YI2A 3NFCA 2E4HA 4WHWA 4XUAA 1PD1A 4LUDA 1BKBA 4PCIA 4M78C 5D7UA 2V26A 3JCMc 5CKEA 5ECAA 2ED1A 3L2ZA 5CKDA 5KYYA 5L8RE 4NUDA 4KGXB 1ZX6A 1YWPA 2RQUA 4LYIA 4OB3B 4YYJA 3O35A 1PRLC 2M0YA 4RTZA 4FU6A 2QEXT 1RAFB 4JLGA 4UYFB 1Q95G 1YHQA 5FG4A 3CXCS 3DB3A 4AI6A 4E7JA 4HBWA 4XTZA 1WUMA 5EPSA 3LYIA 4IKFA 4Z93A 2YYNA 1M1GA 5LKXA 2QYZA 4HA8A 4JPBW 2D0QB 2RHIA 4JZ4A 3M0RA 2YEMA 3KBGA 3OMGA 2IIMA 3FIFA 4LE9A 5D3SA 3MEWA 2BZYA 3U5PA 1RLPC 1X6OA 2RJCA 1R8OB 4NR6A 4OMQA 3JCMe 3D7CA 4BI3A 1VQPA 3RERA 3L42A 2HNIA 1H641 2XICA 1QVGS 4HCKA 1GCQC 3U5MA 2C0IA 4JRKA 2R0VA 1ZBJA 4XYAA 5EM3A 1C1AA 1YHQT 3LH0A 2DL5A 2FVUA 1KD1R 4IORA 2V8JA 4IUTA 2EBPA 4OMOA 4JJCA 4NUCA 1YITA 2QAZA 3LQIA 2DTOA 2GBQA 4N4FA 1IGQA 4E6RA 4CLBA 3F70A 5LJ5h 1WHGA 2YT6A 2JVVA
chains in the Genus database with same CATH topology
5HFRA 1M90C 4YYGA 1YJWT 5L99A 4A9KA 3MQMA 1K73U 1YI2T 4HXMA 5HRXA 2DVRA 4O7AA 4P5NA 5L98A 3CC4T 5C8GA 2JNGA 5FU6B 4LYWA 4A4EA 5DM7R 2K4YA 1DJ7B 2K57A 4N0AC 2FL7A 5GANe 5FH6A 2ZGWA 3JCMb 3CCMA 1IREB 4J0SA 1M90U 4A9MA 5H1TA 4N4GA 2DAQA 3M5AA 4KCXA 5HRVA 2DKWA 1VQKT 2L84A 3CCVT 2EFIA 4QEVA 5HQ7A 4F7UB 2V8KA 2XI9A 2ZPBB 3CCLA 4OB1B 4ZC9A 3A8MB 3C12A 3MB4A 4X34A 3M53A 2EJFA 1U1SA 4YABA 3EAEA 5FRNA 3CPFA 5D3RA 2YLBA 5F36A 2QA4T 3JCMX 5E73A 2DVSA 1GXIE 5FBXA 4Z1SA 5CAIA 4KUIA 5A5QA 5EP7A 5GMKh 1KC8C 4XTVA 4NUEA 3G4SA 5LVQA 3QDRB 4C92G 4A9HA 4UIZA 4IR4A 2ZPIB 1ZBXA 2ZCFB 4N4HA 4TU6A 2PQWA 3OBWA 3V8KA 4F7UA 5E0RA 3HRTA 5HQ6A 5ETBA 2P0KA 1Y96B 5EV9A 5DW2A 5F60A 4E7LA 2LTOA 4HXRA 2CZ7B 2DD5A 1XOVA 2Y4YA 5EWDA 4QSPA 3QJYA 4LRGA 4C5EA 4ALHA 5F2PA 4CL9A 4QYLA 3CBMA 5D6YA 5LUUA 3LWHA 1KG1A 1K8AU 2X4JA 4NRAA 4M77B 2DTHA 5K29A 3QSUA 5C6SA 4AKNA 4OP0A 5DY9A 2E6NA 2YEKA 3R6OA 5DKDA 4E7IA 2A3LA 5A0DA 5FFVA 5GANj 5FE5A 5CQXA 3TLPA 1UGSB 2E10A 2VXFA 3M9QA 5HELA 4EMHA 5F61A 3MO8A 5CRMA 2N9GA 3DLMA 2DPPB 4YC9A 4YH3A 5AMFA 5DKCA 3PGGA 4OGIA 1KC8U 5CUDA 4ALGA 3OYHA 1YBYA 5KTUA 5GAMe 4O7FA 5CGPA 1HK9A 3V8JA 2QQSA 2HBPA 4TZ8A 5GAOp 5FH7A 2XDBA 3V7SA 1EIFA 2RNXA 4HCCA 2DK3A 4V2SA 1VUBA 3UVYA 4C0ZA 4C8QG 5ENJA 2RA2A 5DBMA 3HMFA 4O7EA 1VQ9A 4LR6A 4M75C 3G4ST 5A5OA 4KV4A 3BDLA 2DXTA 4XTXA 3QG1A 3OS2A 1G3WA 4IOOA 4O76A 5E9VA 3O34A 1JBMA 4PJOD 5GAN4 3G71T 3LQJA 4NR5A 4C0DB 1YJWA 5FE9A 1YJNA 3JB9D 1XNIA 3KXTA 4M78E 5FU6C 4YBSA 5M9OA 4E96A 3VYHB 5CZGA 3SFMA 4YBTA 1WNLA 5A2QE 3OYIA 3G6EA 2M9UA 1N8RC 2I7KA 5CPEA 2RO0A 3LWIA 5CUBA 3SVFA 3A8OB 4C5GA 5GAN5 3FJPA 5LKZA 4F7UG 4QC3A 3GG3A 3CCUT 4HCZA 4KULA 2O01E 3PNWC 5AMEA 4C92F 5HK3A 1K9MC 3I3JA 1NPRA 4O70A 2OSSA 2DXUA 3UV4A 3MEUA 1VQ6A 1VIEA 4GLKA 4PKLA 4M75G 1OZ2A 5KO4A 1WJSA 2R57A 2LT4A 4M77F 1X75C 4QR3A 4PJOE 4M7AG 4M77G 5IG6A 5E3DA 3S3NA 3A8HB 2O4XB 3MULA 3GOXA 4QR4A 5ETDA 3JSCA 4PKCC 4QEWA 1D3BB 5D3LA 4M7DE 5EWVA 2X4XA 5ENHA 4L5GA 3H6ZA 3N5BB 3M56A 4TZ2A 4YY4A 2E70A 2EQMA 3CBOA 5FE2A 3L2QA 2WP2A 4TT2A 3RESA 2MF2A 3E19A 4CUUA 4QSRA 4ELZC 4XU3A 1U8RA 2LVMA 1Q86C 1VQ6T 2XKOC 5D3TA 4MR5A 3OYYA 5H1VA 3IU6A 3LGFA 2QTXA 3GPLA 3TCJA 2QQRA 5GAN2 1I8FA 3P8BB 3CCUA 1G3TA 2DD4A 5D24A 4FT4A 4QBMA 2RK2A 5C7NA 2LQ8A 4HXNA 2DVEA 4Y91A 3VYGA 2PVOB 3Q2FA 2R0SA 4E7HA 3TU4K 2EIFA 1I81A 4JDSA 5EWWA 4BE0A 3X28B 1NPPA 4XU1A 2PVDB 3HRSA 3G71A 5FG5A 5FFWA 4JS4A 2RHUA 2M0OA 3UPUA 2OTLT 4KT0E 2OTJA 5FE4A 2G4AA 2EAYA 4A9FA 3JVKA 4VUBA 4HBYA 4NS5A 1VQLA 4Q0OA 5I7XA 1VQMT 4NQMA 3HPWA 2JZ2A 3I56T 1FX7A 3OYLA 3HHTB 5CUCA 4PJOF 3RKWA 2YDWA 5D7XA 3FB9A 1QVFS 4PJOB 4BD3A 4HXLA 5EPBA 5A7CA 4PS5A 3UVDA 4O6JA 3JB9G 3H8ZA 4QB3A 3WVEB 2JUFA 4XU0A 4OGCA 2EYQA 5EA1A 3MEAA 5BT4A 4O5VA 4JRQA 3SVGA 1VQ5A 5LJ3e 3MEVA 1OZ3A 3CCJT 4LZ2A 2XHCA 5CKBA 5DYAA 1VQ8T 5IBNA 5DLQE 1O9SA 1KD1C 4MMKA 2KDSA 2MI6A 1AHJB 4YK0A 1QP2A 2AHJB 2D6FA 4CFLA 3DWYA 2RFJA 3WVDB 3SB2A 3LJWA 5GMKj 4HXOA 4FT2A 1ZHIA 3HL8A 3X24B 2FHDA 5ENCA 2F6NA 3I55A 3HP9A 4QSWA 4C8QE 5HQ5A 3P5OA 2LCLA 1KD1U 3PMIA 1NE8A 5ENIA 2KVQG 4C8QD 5CKHA 1F68A 5EG2A 5D6WA 3P1CA 5F3AA 5GAN8 2DIGA 3WXMB 2WSFE 4NR9A 3CMAA 3JCMQ 1MGQA 2F6JA 5C87A 4PLIA 4O7CA 5LJ3d 3AHUA 1O75A 3OS0A 3LX7A 3L1AA 4MR6A 3PIOA 2KY9A 4HXKA 2HD0A 3MP8A 1S72A 5EI4A 4JRIA 5GANh 3O33A 3ASKA 4C8QB 5L8UA 4M75E 4E7KA 2EQKA 5LJ3g 5KCOA 2OO1A 4FIBA 1VQ9T 4BUGA 5ENEA 4M75D 4OVAA 5LJ3f 2RNYA 1OI1A 2WACA 5KCHA 4M75F 1X0JA 4C8QC 1RI0A 4BE2A 3NTHA 4M7DF 3PFSA 5J39A 5DLXA 5H1UA 4BW2A 5TCMA 2ZPFB 5I83A 4XK8E 2PU9B 2DVQA 4FM4B 2YHTA 4EDUA 5LJ3j 1VQKA 4HKEA 5C4QA 3QHSA 1UGQB 1N9SA 4FL6A 4J5YA 2OUOA 3CC2A 3O8VA 4DA4A 3OS1A 1Q82C 1UGRB 3MB3A 3I55T 4M7AA 4O7BA 4N0AA 2P0PA 4C92B 4YYNA 3VUBA 5IN1A 3SDZA 4WF2A 4UITA 3CC4A 4WHUA 4NL3A 5GMKe 3JCMh 3U5KA 4LDWA 2KQWA 3P8DA 4O78A 3DKMA 3VU3C 1WQWA 5I88A 2O4XA 4ZN3A 3CMAT 4B9XA 5GAMj 4M78A 3SVHA 3LQHA 4GY5A 4RCBA 1Q7YC 5FFYA 4J6YA 1YJ9T 3UV2A 3CCJA 3OYEA 1VQOA 1N6AA 5C0MA 3JCMP 3QZ5B 3HRUA 4BW1A 2V8IA 5EQ1A 1WJQA 5KHMA 2VC8A 1PSEA 5F1LA 3CCEA 5FE0A 5CQ6A 2MAMA 2L5EA 2XU8A 1UB4A 4NR7A 2D82A 2DIQA 5EPRA 3C4SA 2R0YA 5CQTA 4BI8B 4QSXA 3GNGA 2CGHA 5HCLA 3QPHA 5G4SA 4LD6A 3LGLA 1ZQ1A 2VGMA 3GIBA 2C06A 3DB4A 5D6XA 1VQLT 3X26B 4ZW1A 2LSPB 2QEXA 3QZ9B 4HCBA 1Y07A 4C5HA 3CBPA 4EMGA 5D3HA 4YH4A 3LW5E 1VQ5T 2OTLA 3LXJA 2QA4A 3V7CA 5I86A 3OSVA 5HEMA 2LDMA 3QYHB 4IOQA 2DJZA 3HMEA 3X20B 4JLIA 3L2WA 1BI0A 3E9FA 3RKYA 4JRPA 1K9MU 4MZMA 5JI8A 4PCEA 2DWWA 2EKOA 4O72A 1ZS5A 4YBMA 1VQ4T 5A5PA 2YELA 3RMQA 5H85A 3JB9F 4YYDA 3U5NA 1MHNA 5FLXE 5LKUA 2FB7A 4UYEA 2HQXA 2EJ9A 4J6WA 4A9IA 2ZPEB 3PTAA 1M1KC 3FC3A 5L97A 3V7RA 5DFCA 4ZQLA 3UV5A 4MR3A 3FDRA 3NTKA 4J7IA 4UIWA 4KBMB 1N8RU 4CUQA 4BDYA 2XDPA 4PY6A 2RI7A 4R55A 4JJNK 3ME9A 2B8AA 2BUDA 5E7DA 5LVRA 1B34B 4CUTA 4N3WA 5IGMA 3M4GA 4F3IA 3HFOA 1BIBA 3M58A 1WQ7A 3UW9A 2P4TA 4EMKA 3CPWA 1KQ2A 3OYCA 1Q81U 2QXFA 3OYNA 5KTWA 5EK9A 4NYWA 1M1FA 2QQAA 3URGA 2RH2A 2WSCE 2RHXA 4NL2A 4QYDA 1SSFA 1JRIA 3SWNC 5A5NA 4ZGJB 5CUGA 4A9OA 4QNSA 1KHIA 4MDXA 3HMHA 4YATA 5FU7C 1VQPT 4A9JA 2CKKA 1V29B 2GQVA 5LJ5d 2RHYA 4M75A 3P1DA 3OB9A 5I1QA 4KV1A 5GAN6 2E41A 4YYMA 4A4HA 3IU5A 5AD2A 4J3IA 3MUKA 2MWPA 2LC4A 4QVZA 1KQSA 1HXDA 3GF5A 5IAYA 1BI1A 4OUFA 5L96A 4EPCA 3G7ZA 1YJ9A 3OYDA 3M54A 1VQ7T 3JCMW 5F25A 1X01A 1YJNT 2BKDN 2QI2A 5GAMh 2XD0A 2K5IA 5ACYA 3ZEHA 5HK0A 3G0LA 5HRWA 2GFAA 3PMTA 5LJ5g 5E74A 2X35A 5CCAA 3FLGA 5KE3A 5A83A 3SD4A 3NTIA 5A0GA 3RCWA 4C8QF 5BT5A 2VUBA 1NZ9A 2GRCA 4QZSA 2WSEE 2E65A 4BACA 3J7AF 4M77A 4M75B 1K73C 3HFNA 5ENFA 5I89A 3G6ET 5C89A 1M5Q1 4M7DC 5DY7A 4QR5A 3M59A 3M57A 1UGPB 2VGNA 2RB6A 3EFSA 4M77D 3FRNA 4PJOC 5D25A 3S3MA 3TEEA 3CD6A 5D3JA 4PLLA 1YIJT 5CUEA 3DAIA 3QZVA 2YW5A 4NQNA 3CMEA 4II1A 3FKMX 4MZTA 4LDVA 3QZSA 1XTDA 4BJXA 4LD9K 4C66A 1VIFA 3INZA 3UVWA 3OYBA 1FXXA 4UC4A 3VJPA 4DOVA 4D6WA 4RCCA 2RI2A 1I5LA 5CQYA 5IGNA 2JTMA 5CU8A 3CCRT 4C0GA 2CZ1B 4QEUA 5EVAA 2ZPHB 1S72T 4A53A 5GANd 4A9NA 3RKXA 4BE1A 4MEQA 3AADA 4Y28E 2A7YA 4HXPA 4Z02A 5CIUA 3Q1JA 4J7FA 4XUBA 5KE2A 4MDWA 4MMLA 4UIUA 4E47A 3BFMA 3VKIA 5GANg 5CRZA 2Y4XA 3QO3A 5GANf 5CUAA 1VQNA 3JB9I 4YY6A 2PUOB 3OYGA 4XAXB 1TH7A 4C92E 5DLZA 2KAFA 3NXBA 4LDYA 5FH8A 4IR3A 4J1PA 4NR4A 5E9LA 5F62A 2E5QA 4Q5WA 2D9EA 3MCAB 5EU1A 2RJFA 4MENA 4JUVA 2LX9A 1NJIU 2L85A 2L89A 3CCQA 4YYHA 3E1SA 5A5SA 5LJ5f 4TTEA 4YYIA 3QIIA 5LJ5j 1W2BA 5CK9A 2R5MA 5GMKi 5KU3A 2E12A 5LJ5e 3CMET 1JB0E 4YTLA 5L8TA 4EMKC 4HBVA 2NLUA 5CKFA 3RUXA 3ZFJA 2YQDA 1UEBA 2XDDA 3E9GA 4CUSA 1NJIC 2GFUA 3T9NA 3META 4WIVA 3CCRA 3J81E 5A82A 2DXCA 3A8GB 3L2UA 5GAOm 5I21A 2CS7A 4XU2A 4M77E 2K5LA 3CCMT 2RHZA 4L59A 1P92A 5COIA 1WUGA 1QVPA 4NYXA 3C95A 5GAN7 2K5FA 3UVXA 4DQ2A 3V8LA 1EQFA 5I2SA 4DONA 4TS8A 4O74A 4R56A 3ONIA 2RI3A 2ZZDA 2M16A 4IUPA 2VYTA 1YIJA 2EQJA 4J0RA 4RG2A 4IR6A 2PUKB 4UIYA 2K2VA 2DATA 2YRVA 2FSAA 4CURA 1VQ7A 1H3ZA 5IGLA 4FSXA 4XTYA 5E9MA 4N4IA 5D0CA 3O36A 4A9LA 4BB7A 4C92D 2QQBA 1OYXA 1Y96A 5BT3A 3VUZA 4PNOA 5ENBA 3VV0A 5FE7A 3OYKA 1G5VA 3MP6A 1WJRA 4A9EA 5GAMf 1M8VA 2IVWA 2KTBB 4M77C 5CTLA 3OMCA 5GAMg 3OA6A 4QSVA 4ZTFA 3JVJA 5CY9A 4HT9A 4MEOA 4M7DA 5AD3A 1FWZA 2E6ZA 3L2VA 3UT1A 4Z1QA 4PJOA 4X2IA 5LL6S 4IR5A 1Y7XA 3HKSA 5EWCA 2X4WA 3OW2S 2RM4A 4A4KA 3JCMf 3AQAA 1YCYA 3Q2EA 4UYDA 4O75A 4C92A 3JCMg 3JB9J 2R5AA 3CPWS 2RO1A 5LKTA 3QUIA 3GP8A 4LDFA 5EISA 5F1HA 4YADA 1RL2A 1JJ2A 2CZ0B 5GAOl 1BI3A 3OBYA 5CFWA 2RJDA 5F5ZA 5D3PA 2XG8D 3JVLA 3I56A 5LJ1A 5FU7B 3PIPA 3QBYA 5II1A 3C94A 4BW4A 1VQMA 3X25B 5CR2A 1K8AC 4Z6IA 5E3GA 3OS5A 4ZGDB 5CP5A 4QSSA 1QVGA 4JS5A 3JVMA 4C5IA 5IT9E 3S6WA 1JSPB 2L5QA 1KHCA 4MEPA 5HJCA 3O37A 4LZRA 4Q0NA 5I80A 3GNFB 4J83A 5D3NA 5EICA 3M55A 3TREA 2LNVA 3OYJA 2DZ9A 3P8HA 3J80E 5CQ5A 5C85A 2MWOA 4NRBA 3JCMV 4CI0C 3JB9H 3CC7T 5F63A 3ZYUA 4QQ6A 3JAME 1IZ6A 4EMKB 4A4GA 2LCCA 5GAN3 1M4ZA 2E7NA 5CS8A 3BW1A 3OY9A 5GMKl 3MXFA 4J6XA 2DEQA 5TB6A 4MR4A 4BDZA 2KSSA 4ME7A 2VV5A 3FEOA 4OMFB 4M78F 3LLRA 2ZPGB 3A8LB 4IUVA 1LNXA 1D3BA 5CQ8A 3UDCA 3CCSA 5I7YA 1U1TA 2Y90A 5A5RA 3JRZA 4C8QA 5E9YA 1BI2A 2DZCA 5FE1A 1Q82U 5DKHA 2QDYB 4QVCA 5FE3A 2E3KA 2RNWA 2WP1A 3U5JA 3OYAA 4LDXA 5DFDA 4M7AF 2X4YA 4M7DG 4M7AB 4QQGA 1XQHA 3JCMd 4UIVA 4UYFA 4MZPA 3CCQT 1N72A 3U5OA 4OGJA 1QP3A 3BDUA 5I2MA 4PJOG 4O77A 3DLLA 5E9IA 2RK1A 3CXCA 2I8NA 5HENA 2XIDA 5DX4A 3MHXA 2YLCA 5HM0A 3KUFA 4ZTJA 5DYXA 4CRIA 3CCET 5HFQA 4LDUA 1Y71A 1B34A 4YAXA 2CZ6B 1VQNT 5JWMA 4TT6A 4QQDA 5GAMd 2RJEA 1KQSS 4KUDK 5FDZA 3OSSC 3BY7A 4A4FA 1N27A 1LJOA 4PL6A 4O71A 1I4K1 5E9KA 1VQOT 5GAOq 1M1KU 5J0DA 4B9WA 5CQAA 2KMTA 1JM4B 3OYFA 2E1HA 2K3XA 4UYHA 5EWHA 4A54A 4NYVA 4RVRA 5FB0A 3A5ZB 4TVRA 5DW1A 2QQ9A 5GAOr 5CQ4A 5IGKA 4NOYA 5FB1A 1BYMA 5HKCA 4BY6B 1Q81C 2XK0A 3CC2T 3M4YA 2PVGB 3QKJA 2DKGA 5I40A 4F7UF 3S92A 1M9SA 2G3RA 5J26A 5CQ3A 2RI5A 3ZBDA 2JN0A 3CD6T 4FLPA 4QSTA 3JCMJ 3RMSA 3CEYA 4BY6C 1G3YA 5LJ0A 4C67A 4M7DD 4F7UE 4XQ3A 4C92C 4QVDA 1WGSA 2CYZB 3CCVA 4ELYC 3QZTA 5KTXA 5DFBA 3OQ5A 4OB2B 4XY9A 4BW3A 2HAXA 4TT4A 4QSQA 4M7DB 4RG8A 5AYFA 5GMKm 2HQEA 1W4SA 4PTBA 5DYUA 2F5KA 5A0LA 5CQ7A 4J8OA 5GAOn 2DVVA 2H3JA 2GF7A 5FRMA 1Q86U 4NRCA 5LJ2A 2EQUA 2MMPA 4BI4A 2E64A 3PT9A 3G0JA 5LJ3h 3MP1A 5I29A 1VQ8A 2MJVB 4Y03A 2OAUA 3EFRA 4UYGA 3RIRA 4XY8A 5IIDA 4M7AE 4LZSA 2JOYA 1YITT 5D26A 4XTUA 3P1FA 5CVIA 4UIXA 1KQ1A 2KK4A 2LQKA 2M1HA 2F5TX 2L8DA 4OF1A 2R10A 4ZGEB 5ENGA 4QSUA 3QYGB 4HT8A 2F69A 4ATOA 4NXJA 4DOWA 3SWNA 2RS9B 5KH6A 2IG0A 2E7OA 1PSFA 4HXSA 5G4RA 1Q7YU 4TQNA 4RKUE 2LRQA 3S91A 4CFKA 2GCXA 5A85A 2RD1A 2DXBA 5FE6A 4OGEA 1WPYA 4X9CA 4ZN1A 2DTIA 4OB0B 1N9RA 4C0FA 4QC1A 4M78G 3S3OA 4CUPA 4X9DA 1BIAA 5DLOA 2NXBA 5FG6A 2I2LA 2OTJT 4GPJA 2LT1A 2DO3A 2K3YA 3L2RA 4M78D 2H60A 4L6V5 2JTFA 5CO7A 3P1EA 5HY6A 1E6IA 4QUUA 3U5LA 4BHWA 4QW2A 4QY4A 4QUTA 3CCLT 3CCST 2BIVA 4LC2A 4IUQA 3QJ6A 3SWNB 4TU4A 1G3SA 4C0DC 1JJ2S 4LYSA 2R58A 5II2A 3K2JA 4M7AC 5DYCA 4TYLA 5EGUA 2D9TA 3UWNA 4YYKA 5FROA 4NR8A 2EJGA 4IURA 1W2BS 1LOJA 2FYKA 4M7AD 5A81A 1QW1A 5J3BA 4RMOA 3HSBA 2P0QA 4XTWA 4Z6HA 4IUUA 2VXEA 1QVFA 3OW2A 2EWNA 3CC7A 3GLXA 3ER0A 4HBXA 5FE8A 3OYMA 5HLSA 4M78B 3QXEB 2L3RA 1VQ4A 1YI2A 3NFCA 4WHWA 4XUAA 1BKBA 4PCIA 4M78C 3JCMc 5CKEA 3L2ZA 5CKDA 5L8RE 4NUDA 4LYIA 4OB3B 4YYJA 3O35A 4FU6A 2QEXT 4JLGA 4UYFB 1YHQA 5FG4A 3CXCS 3DB3A 4E7JA 4HBWA 4XTZA 1WUMA 5EPSA 3LYIA 4IKFA 4Z93A 2YYNA 1M1GA 5LKXA 4HA8A 2D0QB 2RHIA 2YEMA 3KBGA 3OMGA 3FIFA 5D3SA 3MEWA 3U5PA 3JCMe 1X6OA 2RJCA 1R8OB 4NR6A 3D7CA 4BI3A 1VQPA 3RERA 3L42A 2HNIA 1H641 2XICA 1QVGS 3U5MA 4JRKA 2R0VA 4XYAA 5EM3A 1YHQT 3LH0A 2FVUA 4IORA 2V8JA 4IUTA 4NUCA 1YITA 3LQIA 2DTOA 4N4FA 4CLBA 3F70A 5LJ5h 2JVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR4 A;  5CUC A;  4BDZ A;  5HFR A;  4YYG A;  2YDW A;  2BKD N;  3FEO A;  5D7X A;  5L99 A;  4A9K A;  3MQM A;  4BD3 A;  3LLR A;  4HXL A;  5ACY A;  4IUV A;  4HXM A;  5EPB A;  3ZEH A;  5CQ8 A;  5HRX A;  2DVR A;  4O7A A;  5A7C A;  4PS5 A;  3UVD A;  5I7Y A;  5L98 A;  5C8G A;  3G0L A;  3H8Z A;  5HRW A;  4QB3 A;  2GFA A;  5A5R A;  3PMT A;  4LYW A;  5E74 A;  2X35 A;  4A4E A;  5E9Y A;  3FLG A;  5KE3 A;  5A83 A;  5EA1 A;  3MEA A;  5BT4 A;  5FE1 A;  3SD4 A;  5FH6 A;  3NTI A;  5DKH A;  3SVG A;  3RCW A;  1KHC A;  5BT5 A;  3MEV A;  2GRC A;  4QZS A;  5FE3 A;  1OZ3 A;  4BAC A;  2E3K A;  4LZ2 A;  4J0S A;  2RNW A;  2WP1 A;  5DYA A;  3U5J A;  3OYA A;  5DFD A;  5IBN A;  2X4Y A;  4A9M A;  5H1T A;  4N4G A;  2DAQ A;  5ENF A;  4KCX A;  4QQG A;  5HRV A;  5I89 A;  2DKW A;  4UIV A;  4UYF A;  2L84 A;  5C89 A;  1N72 A;  2EFI A;  4QEV A;  5HQ7 A;  4YK0 A;  3U5O A;  5DY7 A;  4OGJ A;  4QR5 A;  4ZC9 A;  4O77 A;  5E9I A;  3MB4 A;  4X34 A;  4CFL A;  4YAB A;  3EAE A;  3DWY A;  5FRN A;  2I8N A;  2RFJ A;  5HEN A;  5D25 A;  3S3M A;  5D3R A;  5F36 A;  5DX4 A;  3LJW A;  5D3J A;  4HXO A;  4PLL A;  5CUE A;  5HM0 A;  3KUF A;  4ZTJ A;  3DAI A;  5DYX A;  3QZV A;  5E73 A;  4CRI A;  2YW5 A;  4NQN A;  2DVS A;  5ENC A;  2FHD A;  2F6N A;  5FBX A;  3FKM X;  4QSW A;  4II1 A;  5HQ5 A;  3P5O A;  4Z1S A;  5HFQ A;  5A5Q A;  4YAX A;  3QZS A;  3PMI A;  5EP7 A;  4BJX A;  5JWM A;  4TT6 A;  5ENI A;  4QQD A;  4C66 A;  3UVW A;  2RJE A;  3OYB A;  5FDZ A;  1F68 A;  4NUE A;  4UC4 A;  5D6W A;  4A4F A;  3P1C A;  1N27 A;  4PL6 A;  4O71 A;  5E9K A;  5F3A A;  5LVQ A;  2DIG A;  2RI2 A;  4NR9 A;  5J0D A;  4B9W A;  5CQA A;  4UIZ A;  4IR4 A;  4A9H A;  2F6J A;  4N4H A;  4TU6 A;  5IGN A;  5C87 A;  5CU8 A;  1JM4 B;  2PQW A;  3OYF A;  4PLI A;  4QEU A;  5EVA A;  4O7C A;  2K3X A;  4UYH A;  5E0R A;  5EWH A;  3OS0 A;  3LX7 A;  4NYV A;  4RVR A;  4MR6 A;  5FB0 A;  5HQ6 A;  4A9N A;  4BE1 A;  4MEQ A;  4HXK A;  3MP8 A;  3AAD A;  5ETB A;  5DW1 A;  5EI4 A;  2P0K A;  5EV9 A;  3O33 A;  5DW2 A;  5F60 A;  4E7L A;  3ASK A;  2LTO A;  4HXP A;  4Z02 A;  5CIU A;  4HXR A;  3Q1J A;  5L8U A;  5EWD A;  4QSP A;  5CQ4 A;  4XUB A;  5IGK A;  5KE2 A;  4E7K A;  4LRG A;  2EQK A;  4C5E A;  5KCO A;  4UIU A;  2OO1 A;  4ALH A;  5F2P A;  5FB1 A;  4CL9 A;  5ENE A;  4OVA A;  2RNY A;  2XK0 A;  4QYL A;  5CRZ A;  5D6Y A;  5LUU A;  1OI1 A;  3QKJ A;  2WAC A;  4NRA A;  5CUA A;  5I40 A;  5KCH A;  4YY6 A;  3S92 A;  3OYG A;  5K29 A;  5DLZ A;  2G3R A;  5J26 A;  3NXB A;  5CQ3 A;  1X0J A;  5C6S A;  2RI5 A;  1RI0 A;  4BE2 A;  3NTH A;  4AKN A;  5FH8 A;  4IR3 A;  3PFS A;  5J39 A;  4J1P A;  4FLP A;  4QST A;  5DLX A;  2E6N A;  5H1U A;  2YEK A;  5TCM A;  4BW2 A;  4NR4 A;  5DKD A;  5E9L A;  5F62 A;  2E5Q A;  4E7I A;  5I83 A;  3CEY A;  4Q5W A;  2D9E A;  5LJ0 A;  4C67 A;  5FFV A;  2DVQ A;  5EU1 A;  2RJF A;  5FE5 A;  4MEN A;  3TLP A;  1WGS A;  4EDU A;  2L85 A;  2L89 A;  4YYH A;  5A5S A;  3M9Q A;  5HEL A;  5C4Q A;  3QZT A;  5F61 A;  5KTX A;  4TTE A;  5DFB A;  3OQ5 A;  3MO8 A;  4YYI A;  5CRM A;  4FL6 A;  3QII A;  4XY9 A;  2N9G A;  2OUO A;  4BW3 A;  3DLM A;  4YC9 A;  2R5M A;  4YH3 A;  5AMF A;  3O8V A;  5KU3 A;  5DKC A;  4OGI A;  3OS1 A;  3MB3 A;  4TT4 A;  5CUD A;  4ALG A;  4QSQ A;  5L8T A;  4HBV A;  4O7B A;  3OYH A;  2NLU A;  5KTU A;  2HQE A;  4O7F A;  4YYN A;  5CGP A;  5IN1 A;  2YQD A;  4PTB A;  2QQS A;  5DYU A;  3E9G A;  2F5K A;  4UIT A;  4CUS A;  4WHU A;  5CQ7 A;  4TZ8 A;  2GFU A;  3U5K A;  5FH7 A;  2DVV A;  3MET A;  2GF7 A;  3P8D A;  4O78 A;  2RNX A;  4WIV A;  5FRM A;  4NRC A;  5LJ2 A;  2EQU A;  5A82 A;  5I88 A;  3UVY A;  2O4X A;  3G0J A;  3L2U A;  4B9X A;  3MP1 A;  5I29 A;  2MJV B;  3SVH A;  3LQH A;  5ENJ A;  4Y03 A;  4GY5 A;  5DBM A;  5FFY A;  3HMF A;  4O7E A;  3UV2 A;  4LR6 A;  3OYE A;  2RHZ A;  4L59 A;  4UYG A;  4XY8 A;  5IID A;  4LZS A;  5D26 A;  5A5O A;  5C0M A;  5COI A;  1WUG A;  3P1F A;  4KV4 A;  4NYX A;  3BDL A;  3OS2 A;  4UIX A;  3UVX A;  4BW1 A;  2M1H A;  5EQ1 A;  1WJQ A;  1EQF A;  5KHM A;  4DON A;  4TS8 A;  2L8D A;  5F1L A;  4O74 A;  2R10 A;  5FE0 A;  3ONI A;  4IOO A;  5CQ6 A;  2RI3 A;  5ENG A;  2M16 A;  4O76 A;  4IUP A;  4QSU A;  5E9V A;  3O34 A;  2L5E A;  2VYT A;  2EQJ A;  4NR7 A;  4NXJ A;  4J0R A;  4RG2 A;  2D82 A;  2DIQ A;  2RS9 B;  4IR6 A;  3LQJ A;  5EPR A;  4NR5 A;  2IG0 A;  3C4S A;  5KH6 A;  2E7O A;  4UIY A;  4HXS A;  5G4R A;  5FE9 A;  2DAT A;  1XNI A;  2YRV A;  2R0Y A;  5CQT A;  4TQN A;  4QSX A;  2FSA A;  2LRQ A;  4CUR A;  4YBS A;  5M9O A;  1H3Z A;  3S91 A;  4CFK A;  4E96 A;  5A85 A;  5IGL A;  5HCL A;  4LD6 A;  5G4S A;  5CZG A;  3LGL A;  5FE6 A;  4YBT A;  3OYI A;  5E9M A;  2I7K A;  4N4I A;  5CPE A;  3DB4 A;  5D6X A;  5D0C A;  3O36 A;  2RO0 A;  4ZW1 A;  2LSP B;  4A9L A;  5CUB A;  3SVF A;  1OYX A;  4QC1 A;  4C5G A;  5BT3 A;  5LKZ A;  3S3O A;  4C5H A;  4QC3 A;  3GG3 A;  4CUP A;  4HCZ A;  5ENB A;  5D3H A;  5FE7 A;  2NXB A;  5AME A;  4YH4 A;  5FG6 A;  3PNW C;  3LXJ A;  4GPJ A;  5I86 A;  5HEM A;  2K3Y A;  3OYK A;  2LDM A;  3L2R A;  4IOQ A;  1G5V A;  3MP6 A;  3HME A;  3I3J A;  1WJR A;  2H60 A;  3L2W A;  4O70 A;  2OSS A;  2JTF A;  4A9E A;  3E9F A;  3UV4 A;  3P1E A;  5JI8 A;  3MEU A;  4PCE A;  1E6I A;  4QUU A;  2DWW A;  3U5L A;  2EKO A;  4BHW A;  2KTB B;  4QY4 A;  5CTL A;  4O72 A;  1ZS5 A;  4PKL A;  4QUT A;  4QW2 A;  3OMC A;  1OZ2 A;  4YBM A;  2BIV A;  5KO4 A;  3OA6 A;  4LC2 A;  5A5P A;  2YEL A;  1WJS A;  3QJ6 A;  2R57 A;  4TU4 A;  4IUQ A;  4QSV A;  5H85 A;  4QR3 A;  4ZTF A;  3JVJ A;  5IG6 A;  5CY9 A;  5E3D A;  3S3N A;  4LYS A;  4MEO A;  2O4X B;  3MUL A;  4YYD A;  3U5N A;  1MHN A;  2R58 A;  3GOX A;  5II2 A;  5AD3 A;  4QR4 A;  3K2J A;  5ETD A;  5LKU A;  4QEW A;  4TYL A;  5DYC A;  2HQX A;  4UYE A;  5D3L A;  5EGU A;  3L2V A;  3UT1 A;  5EWV A;  2D9T A;  3UWN A;  4A9I A;  4YYK A;  5FRO A;  3FC3 A;  4NR8 A;  4Z1Q A;  2X4X A;  5L97 A;  4X2I A;  5ENH A;  4IR5 A;  5DFC A;  4ZQL A;  3H6Z A;  4IUR A;  3UV5 A;  4MR3 A;  5EWC A;  2X4W A;  4TZ2 A;  5A81 A;  4YY4 A;  3FDR A;  3NTK A;  2EQM A;  4UIW A;  3AQA A;  5FE2 A;  2WP2 A;  4TT2 A;  3L2Q A;  3Q2E A;  4UYD A;  4Z6H A;  4CUQ A;  4IUU A;  4O75 A;  4CUU A;  4BDY A;  4QSR A;  2XDP A;  4PY6 A;  2RI7 A;  2R5A A;  4HBX A;  5FE8 A;  2B8A A;  3ME9 A;  3OYM A;  2BUD A;  5HLS A;  5E7D A;  2RO1 A;  5LKT A;  5LVR A;  2L3R A;  2LVM A;  4LDF A;  5EIS A;  5F1H A;  4CUT A;  4N3W A;  5IGM A;  4YAD A;  4F3I A;  4WHW A;  4XUA A;  5D3T A;  4PCI A;  4MR5 A;  5CFW A;  2RJD A;  5F5Z A;  5H1V A;  3UW9 A;  5D3P A;  3IU6 A;  3LGF A;  4NUD A;  3JVL A;  5LJ1 A;  2QQR A;  3QBY A;  3OYC A;  5II1 A;  4BW4 A;  3OYN A;  4LYI A;  5KTW A;  4YYJ A;  5EK9 A;  4NYW A;  3O35 A;  4Z6I A;  5E3G A;  5CP5 A;  5D24 A;  4QSS A;  4QBM A;  4FU6 A;  3JVM A;  4C5I A;  5C7N A;  4UYF B;  5FG4 A;  4HXN A;  2RHX A;  3DB3 A;  4QYD A;  1SSF A;  3S6W A;  4E7J A;  4HBW A;  5A5N A;  1JSP B;  5CUG A;  4A9O A;  1WUM A;  5EPS A;  3LYI A;  4IKF A;  4Z93 A;  2YYN A;  4MEP A;  5HJC A;  3Q2F A;  3O37 A;  4QNS A;  5LKX A;  2R0S A;  3HMH A;  4LZR A;  4Q0N A;  4YAT A;  2RHI A;  5I80 A;  4E7H A;  2YEM A;  4A9J A;  2CKK A;  3OMG A;  5D3N A;  5EWW A;  4BE0 A;  5D3S A;  5EIC A;  3MEW A;  3U5P A;  2RJC A;  4NR6 A;  2RHY A;  3D7C A;  3OYJ A;  3P8H A;  5FG5 A;  3P1D A;  3L42 A;  3OB9 A;  5I1Q A;  5FFW A;  5CQ5 A;  4KV1 A;  5C85 A;  2M0O A;  2RHU A;  2MWO A;  5FE4 A;  4YYM A;  2G4A A;  4NRB A;  4A4H A;  3U5M A;  3IU5 A;  4A9F A;  2R0V A;  3JVK A;  4XYA A;  5F63 A;  3ZYU A;  5EM3 A;  4QQ6 A;  5AD2 A;  3LH0 A;  4HBY A;  4J3I A;  3MUK A;  4A4G A;  2LCC A;  4IOR A;  2MWP A;  4IUT A;  4NS5 A;  2E7N A;  4QVZ A;  4NUC A;  4Q0O A;  5IAY A;  5I7X A;  3LQI A;  5CS8 A;  4N4F A;  4OUF A;  5L96 A;  3OY9 A;  4NQM A;  3OYD A;  4CLB A;  3F70 A;  2JZ2 A;  3MXF A;  3OYL A;  5F25 A;  5TB6 A; 
#chains in the Genus database with same CATH topology
 5HFR A;  1M90 C;  4YYG A;  1YJW T;  5L99 A;  4A9K A;  3MQM A;  1K1Z A;  1K73 U;  1YI2 T;  4HXM A;  4EIK A;  2Z0W A;  5HRX A;  2DVR A;  4O7A A;  2RPN A;  4P5N A;  5L98 A;  3CC4 T;  5C8G A;  1KIK A;  2JNG A;  5FU6 B;  2HSP A;  4LYW A;  4A4E A;  5DM7 R;  2K4Y A;  1DJ7 B;  2K57 A;  4N0A C;  2FL7 A;  5GAN e;  4JJD A;  5FH6 A;  2F2X A;  2ZGW A;  4FCY A;  3JCM b;  3HTR A;  2FPD A;  3CCM A;  1IRE B;  2NYS A;  4J9C A;  4J0S A;  1M90 U;  1WYX A;  4A9M A;  1VOM A;  5H1T A;  4N4G A;  2DAQ A;  3M5A A;  4KCX A;  2YRC A;  1E6G A;  5HRV A;  2I0N A;  4CC7 A;  2DKW A;  1VQK T;  2L84 A;  1ZSZ B;  3CCV T;  2EFI A;  4D8D A;  4QEV A;  5HQ7 A;  4F7U B;  1QCN A;  2V8K A;  2XI9 A;  2ZPB B;  3CCL A;  4OB1 B;  4ZC9 A;  3A8M B;  3C12 A;  5KYN A;  3MB4 A;  4X34 A;  1TTH B;  2AZV A;  2EJF A;  3M53 A;  1QWE A;  1U1S A;  4YAB A;  3EAE A;  5FRN A;  3CPF A;  2ENM A;  5D3R A;  2YLB A;  5F36 A;  2DL3 A;  3PE0 A;  1EZZ B;  2QA4 T;  1S72 Q;  1HSQ A;  1OQK A;  5E73 A;  3JCM X;  2DVS A;  1GXI E;  5FBX A;  4Z1S A;  5CAI A;  1AVZ C;  4KUI A;  3RDV A;  5A5Q A;  2FPF A;  5EP7 A;  1TUG B;  4HVV A;  5GMK h;  1KC8 C;  4XTV A;  3H9N A;  2BTT A;  1OOT A;  4NUE A;  1W6X A;  3G4S A;  5LVQ A;  3QDR B;  1WZO A;  1YWO A;  1R0B G;  4C92 G;  4A9H A;  4UIZ A;  4IR4 A;  2ZPI B;  1ZBX A;  2ZCF B;  4N4H A;  4TU6 A;  2PQW A;  2K6D A;  3OBW A;  3SEM A;  3V8K A;  4F7U A;  5E0R A;  5HCK A;  1QLY A;  3HRT A;  5HQ6 A;  1IO6 A;  1WHJ A;  1VYT A;  5ETB A;  2L3P A;  1SEM A;  2P0K A;  1Y96 B;  5EV9 A;  2BZ8 A;  5DW2 A;  5F60 A;  4Z88 A;  4E7L A;  2LTO A;  4HXR A;  2CZ7 B;  4B6M A;  2DD5 A;  1XOV A;  2Y4Y A;  5EWD A;  4QSP A;  2A37 A;  1I0C A;  3VS6 A;  3QJY A;  4LRG A;  4C5E A;  2A0F B;  4ALH A;  3EFO A;  1YIT Q;  5F2P A;  4CL9 A;  4QYL A;  2V1Q A;  1OU9 A;  3CBM A;  5D6Y A;  1QQJ A;  4RTX A;  5LUU A;  3LWH A;  1KG1 A;  1K8A U;  2X4J A;  4NRA A;  4R0K A;  3EG0 A;  4M77 B;  2DTH A;  2K79 A;  3EGU A;  5K29 A;  4J9H A;  2DL8 A;  1D0Y A;  3QSU A;  1YCS B;  1RI9 A;  2H8H A;  5C6S A;  4AKN A;  2DRK A;  4OP0 A;  5DY9 A;  2E6N A;  2YEK A;  3R6O A;  1HJD A;  5DKD A;  4E7I A;  5I11 A;  5FWB A;  3UA6 A;  2A3L A;  1X2Q A;  5A0D A;  5KYW A;  5FFV A;  5GAN j;  5FE5 A;  5CQX A;  3TLP A;  1UGS B;  2E10 A;  2VXF A;  1ACM B;  3M9Q A;  5HEL A;  4EMH A;  2CUD A;  5F61 A;  3MO8 A;  5CRM A;  2N9G A;  3DLM A;  2DPP B;  4YC9 A;  1PNJ A;  4YH3 A;  5AMF A;  5DKC A;  3PGG A;  1YFN A;  4OGI A;  1KC8 U;  5CUD A;  4ALG A;  3I55 Q;  2V1R A;  3OYH A;  1YBY A;  2KRO A;  5KTU A;  5GAM e;  4O7F A;  5AT1 B;  5CGP A;  1HK9 A;  3V8J A;  2QQS A;  2HBP A;  2JS0 A;  2IPO B;  1M3B A;  4TZ8 A;  5GAO p;  5FH7 A;  2XDB A;  4AFQ C;  3V7S A;  1EIF A;  2RNX A;  4HCC A;  2DK3 A;  4V2S A;  2NUP A;  2OAW A;  1VUB A;  3UVY A;  4C0Z A;  4C8Q G;  5ENJ A;  1WI7 A;  2DFU A;  2RA2 A;  5DBM A;  3HMF A;  4O7E A;  1VQ9 A;  4LR6 A;  1U06 A;  4M75 C;  3G4S T;  5A5O A;  2PZ1 A;  4KV4 A;  3BDL A;  2DXT A;  4XTX A;  3QG1 A;  3OS2 A;  1G3W A;  3I5S A;  1VQL Q;  4J9E A;  2CP7 A;  1EX4 A;  4IOO A;  2RN8 A;  4O76 A;  5E9V A;  3O34 A;  1JBM A;  4PJO D;  5GAN 4;  3G71 T;  3E2U A;  2DL4 A;  3LQJ A;  4NR5 A;  2YSQ A;  1MUZ A;  4C0D B;  5KYY B;  1YJW A;  5FE9 A;  1YJN A;  3JB9 D;  2DBM A;  1XNI A;  1QVG P;  3KXT A;  1K9M R;  4M78 E;  1MND A;  2DYB A;  5FU6 C;  2JM9 A;  4YBS A;  5M9O A;  4E96 A;  2A08 A;  3VYH B;  5CZG A;  3SFM A;  4YBT A;  1WNL A;  5A2Q E;  3OYI A;  3G6E A;  2M9U A;  1N8R C;  2I7K A;  2P4R A;  5CPE A;  2HDA A;  2RO0 A;  3ULR B;  3LWI A;  5CUB A;  3SVF A;  3A8O B;  4C5G A;  5GAN 5;  3FJP A;  3ERR A;  5LKZ A;  4F7U G;  4QC3 A;  3GG3 A;  3CCU T;  4HCZ A;  4KUL A;  2PNI A;  1UJ0 A;  2O01 E;  3PNW C;  5AME A;  4C92 F;  5HK3 A;  1K9M C;  2DLP A;  3I3J A;  1NPR A;  4O70 A;  2OSS A;  4AFU C;  2DXU A;  1Q7Y R;  3UV4 A;  3MEU A;  1VQ6 A;  1VIE A;  4GLK A;  2JW4 A;  4PKL A;  4M75 G;  1OZ2 A;  5KO4 A;  1WJS A;  2R57 A;  2LT4 A;  4M77 F;  1X75 C;  4QR3 A;  4PJO E;  3SHW A;  4M77 G;  4M7A G;  5IG6 A;  1I07 A;  5E3D A;  3S3N A;  3A8H B;  2O4X B;  2KT1 A;  3MUL A;  3GOX A;  4OML A;  1ZLM A;  3CCQ Q;  2YUQ A;  4QR4 A;  5ETD A;  3JSC A;  4PKC C;  4PJM A;  4QEW A;  2KYB A;  1D3B B;  5D3L A;  4M7D E;  5EWV A;  2BE9 B;  4A63 B;  2X4X A;  5ENH A;  1U3O A;  4L5G A;  3H6Z A;  3N5B B;  3M56 A;  4TZ2 A;  4YY4 A;  2E70 A;  4JJB A;  2EQM A;  1M8M A;  3CBO A;  5FE2 A;  3L2Q A;  2WP2 A;  4TT2 A;  3RES A;  2MF2 A;  3QWX X;  1Z9Q A;  3E19 A;  4CUU A;  3NPF A;  4QSR A;  4ELZ C;  2ROT A;  4XU3 A;  4AFZ C;  1YHQ Q;  2D0N A;  1UTI A;  1U8R A;  2LVM A;  3D1B A;  1Q86 C;  4WTO B;  1VQ6 T;  2XKO C;  2XMF A;  5D3T A;  2CUB A;  4Z89 A;  4MR5 A;  3EG9 B;  3OYY A;  5H1V A;  1OU8 A;  3IU6 A;  3BE3 A;  3LGF A;  2QTX A;  3GPL A;  3TCJ A;  2COZ A;  2QQR A;  5GAN 2;  2J6K A;  1I8F A;  1SHG A;  3P8B B;  3CCU A;  2DD4 A;  1G3T A;  2M51 A;  5D24 A;  4FT4 A;  4GLM A;  4QBM A;  2RK2 A;  5C7N A;  2F1L A;  1G8X A;  2LQ8 A;  4HXN A;  5IHK A;  2DVE A;  4Y91 A;  1FMW A;  3VYG A;  2PVO B;  3Q2F A;  2R0S A;  4E7H A;  3TU4 K;  2EIF A;  1I81 A;  4JDS A;  5EWW A;  4BE0 A;  2OI3 A;  2LNH B;  3MPU B;  1NPP A;  3X28 B;  2PVD B;  4XU1 A;  2ESW A;  3CXC P;  1OX8 A;  3HRS A;  1MV0 B;  1X43 A;  2DL7 A;  3G71 A;  5FG5 A;  1YJN Q;  5FFW A;  4JS4 A;  2RHU A;  2M0O A;  3UPU A;  1YIJ Q;  2OTL T;  4KT0 E;  2OTJ A;  5FE4 A;  2G4A A;  1YNZ A;  2VWF A;  2EAY A;  2KYM A;  4A9F A;  3VS1 A;  3JVK A;  4VUB A;  4HBY A;  1TOV A;  2F2W A;  3AT1 B;  4NS5 A;  1VQL A;  4Q0O A;  2QAS A;  5I7X A;  1VQM T;  1IB8 A;  1AWO A;  4NQM A;  2KR3 A;  4WCI A;  2DYI A;  2JZ2 A;  3HPW A;  3I56 T;  1FX7 A;  3OYL A;  3HHT B;  1M27 C;  5CUC A;  4PJO F;  3RKW A;  2YDW A;  3MJX A;  3PVL A;  5D7X A;  1VQ4 Q;  3FB9 A;  1QVF S;  4PJO B;  4BD3 A;  4HXL A;  5EPB A;  5A7C A;  4PS5 A;  3UVD A;  4O6J A;  3JB9 G;  3H8Z A;  4QB3 A;  1PM3 A;  3WVE B;  2JUF A;  4XU0 A;  4OGC A;  5GJW B;  2EYQ A;  4F14 A;  1VQ5 Q;  5FWC A;  1M90 R;  5EA1 A;  3MEA A;  5BT4 A;  4O5V A;  3M0S A;  2ED0 A;  4GBQ A;  4JRQ A;  3SVG A;  1VQ5 A;  5LJ3 e;  3UA7 A;  3MEV A;  4PFZ A;  1OZ3 A;  3CCJ T;  3A1P A;  4LZ2 A;  3OW2 P;  3EFO B;  2XHC A;  5CKB A;  5DYA A;  1VQ8 T;  5IBN A;  5DLQ E;  2QEX Q;  1O9S A;  1KD1 C;  1QKW A;  4MMK A;  1YI2 Q;  2KDS A;  2MI6 A;  2L3S A;  1AHJ B;  4YK0 A;  1QP2 A;  2EYW A;  3VS3 A;  1JXM A;  2AHJ B;  4FSS A;  2D6F A;  4CFL A;  3DWY A;  1M30 A;  2RFJ A;  3WVD B;  3A98 A;  3SB2 A;  3LJW A;  5GMK j;  4HXO A;  4FT2 A;  1ZHI A;  3RR6 A;  1VQ8 Q;  3HL8 A;  3X24 B;  2FHD A;  5ENC A;  2F6N A;  3I55 A;  3HP9 A;  4QSW A;  1V1C A;  4C8Q E;  5HQ5 A;  3P5O A;  2LCL A;  1SG5 A;  2DVJ A;  1KD1 U;  2F2V A;  3PMI A;  1NE8 A;  2DM1 A;  2ECZ A;  5ENI A;  2KVQ G;  4C8Q D;  1GCP A;  5CKH A;  1F68 A;  1EFN A;  3EG2 A;  5EG2 A;  5KYX B;  3EHR A;  5D6W A;  3GBQ A;  3P1C A;  2KXC A;  1AD5 A;  2W10 A;  5F3A A;  3CMA Q;  5GAN 8;  1VQM Q;  2DIG A;  5IHN A;  1KSW A;  2X51 A;  1WA7 A;  3WXM B;  2WSF E;  4NR9 A;  3CMA A;  3JCM Q;  1MGQ A;  2F6J A;  3CCR Q;  5C87 A;  1D0X A;  4PLI A;  4O7C A;  5LJ3 d;  3AHU A;  1O75 A;  1JQQ A;  2LP5 A;  3OS0 A;  5KYU A;  1AZE A;  1LVK A;  3LX7 A;  5EC7 A;  3I9Q A;  1PUO A;  9ATC B;  3L1A A;  4MR6 A;  1UHF A;  3PIO A;  2KY9 A;  4HXK A;  2HD0 A;  3MP8 A;  1S72 A;  1FMV A;  5EI4 A;  4JRI A;  1N8R R;  5GAN h;  3O33 A;  2SRC A;  2GNC A;  3ASK A;  4C8Q B;  5L8U A;  1ZSZ C;  4M75 E;  4E7K A;  2CP6 A;  2EQK A;  1I5O B;  5LJ3 g;  5KCO A;  2OO1 A;  4FIB A;  1VQ9 T;  4BUG A;  4F16 A;  5ENE A;  4M75 D;  4OVA A;  2OTL Q;  3I35 A;  5LJ3 f;  2RNY A;  1OUL A;  1OI1 A;  2WAC A;  4ESR A;  5KCH A;  2YUO A;  4M75 F;  3KFV A;  1X0J A;  1R77 A;  4C8Q C;  1RAC B;  1RI0 A;  4BE2 A;  3NTH A;  2KBT A;  2JM8 A;  4M7D F;  2RMO A;  3PFS A;  5J39 A;  2EGC A;  5DLX A;  5H1U A;  4BW2 A;  5TCM A;  2FG0 A;  2ZPF B;  4LXC A;  5I83 A;  4XK8 E;  4LN2 A;  2PU9 B;  2DVQ A;  4FM4 B;  1VA7 A;  8ATC B;  2HEQ A;  4RUG A;  2YHT A;  1IHV A;  4EDU A;  5LJ3 j;  1VQK A;  4HKE A;  3UAT A;  5C4Q A;  2HSE B;  3QHS A;  3R6N A;  2CSQ A;  1RAD B;  1UGQ B;  2QDL A;  1N9S A;  4FL6 A;  1QCO A;  4J5Y A;  2OUO A;  1TS9 A;  2L0A A;  3CC2 A;  2HBW A;  3O8V A;  2JS2 A;  4DA4 A;  4IIO A;  2KE9 A;  3OS1 A;  1N5Z A;  2FZK B;  1Q82 C;  1UGR B;  3MB3 A;  2HMA A;  3I55 T;  4M7A A;  4O7B A;  2DEU A;  4N0A A;  1X6G A;  1OV3 A;  2P0P A;  4C92 B;  4YYN A;  1TG0 A;  3VUB A;  3VRY A;  1NYF A;  5IN1 A;  3SDZ A;  4WF2 A;  1E6H A;  4UIT A;  1HD3 A;  1AZG B;  3CC4 A;  4WHU A;  4NL3 A;  5GMK e;  1WXT A;  3JCM h;  4E7Z A;  1UE9 A;  3U5K A;  1QVF P;  4LDW A;  2KQW A;  4DBQ A;  3P8D A;  4O78 A;  3DKM A;  3VU3 C;  1WQW A;  5I88 A;  1TXQ A;  2O4X A;  4ZN3 A;  3CMA T;  4B9X A;  3EG1 A;  1FMK A;  1RAH B;  5GAM j;  4M78 A;  3SVH A;  3LQH A;  2DMO A;  2MIO A;  4GY5 A;  4RCB A;  1Q7Y C;  5FFY A;  4J6Y A;  2O88 A;  1YJ9 T;  3UV2 A;  3CCJ A;  3OYE A;  3MKD A;  1VQO A;  3CCM Q;  3M0P A;  1N6A A;  1IRX A;  5C0M A;  3JCM P;  3QZ5 B;  3THK A;  3HRU A;  4AKH A;  2A28 A;  4BW1 A;  2V8I A;  5EQ1 A;  1WJQ A;  1HYO A;  5KHM A;  1GRI A;  2VC8 A;  2YDL A;  4RTU A;  1PSE A;  5F1L A;  1ZUY A;  3CCE A;  5FE0 A;  5CQ6 A;  4HVW A;  2MAM A;  2L5E A;  1J3T A;  2XU8 A;  1UB4 A;  4NR7 A;  2D82 A;  2DIQ A;  5EPR A;  3C4S A;  3ZL7 C;  2FZC B;  2YRD A;  2R0Y A;  5CQT A;  2ZAE A;  4BI8 B;  4QSX A;  1M2O A;  3GNG A;  1C0M A;  2CGH A;  5HCL A;  3QPH A;  5G4S A;  4LD6 A;  3LGL A;  1ZQ1 A;  2VGM A;  3M0T A;  3GIB A;  2C06 A;  1V76 A;  3DB4 A;  5D6X A;  1VQL T;  3X26 B;  1RAE B;  3EH2 A;  4ZW1 A;  3VKG A;  2LSP B;  2VVK A;  1VYU A;  2QEX A;  3CCS Q;  2VB6 A;  3CC7 Q;  2HCK A;  3QZ9 B;  4HCB A;  1Y07 A;  2LJ0 A;  4C5H A;  4D8K A;  5I22 A;  3CBP A;  4EMG A;  1BBZ A;  5D3H A;  4LUE A;  4YH4 A;  3LW5 E;  1VQ5 T;  2OTL A;  3LXJ A;  1H92 A;  2QA4 A;  3V7C A;  5I86 A;  3OSV A;  5HEM A;  2YXY A;  2LDM A;  3QYH B;  4IOQ A;  2DJZ A;  3HME A;  3X20 B;  4IIM A;  4JLI A;  3L2W A;  2JJ9 A;  2RQW A;  1BI0 A;  3E9F A;  3RKY A;  4JRP A;  1K9M U;  4MZM A;  5JI8 A;  4PCE A;  2DWW A;  2EKO A;  3TVT A;  4O72 A;  1ZS5 A;  1MMN A;  4YBM A;  1VQ4 T;  5A5P A;  2YEL A;  3UF4 A;  3RMQ A;  2MK5 A;  5H85 A;  3JB9 F;  2MCN A;  2CSI A;  2J6O A;  4YYD A;  3U5N A;  1MHN A;  2FRW A;  5FLX E;  3G6E Q;  6AT1 B;  5LKU A;  2FB7 A;  4UYE A;  2HQX A;  2EJ9 A;  4J6W A;  4A9I A;  2ZPE B;  3PTA A;  1M1K C;  3FC3 A;  2MOX A;  5L97 A;  3V7R A;  5DFC A;  4ZQL A;  3UV5 A;  4MR3 A;  2BZX A;  3FDR A;  3NTK A;  4J7I A;  1M2V B;  4UIW A;  2MPX C;  4KBM B;  1N8R U;  4CUQ A;  2COY A;  4BDY A;  1ZA2 B;  2DIL A;  2XDP A;  1SRM A;  4PY6 A;  1ZUK A;  2RI7 A;  2CRE A;  2SEM A;  4R55 A;  3ME9 A;  4JJN K;  2B8A A;  1WLP B;  1SKU B;  2BUD A;  5E7D A;  5LVR A;  3VS5 A;  2JT4 A;  1B34 B;  4CUT A;  1BU1 A;  4N3W A;  5IGM A;  3M4G A;  4F3I A;  3QDF A;  2HKQ B;  3HFO A;  1BIB A;  2AIR B;  3M58 A;  4PFP A;  1WQ7 A;  3UW9 A;  2P4T A;  4EMK A;  3CPW A;  3JV3 A;  1KQ2 A;  3OYC A;  1Q81 U;  2QXF A;  3OYN A;  5KTW A;  5EK9 A;  4NYW A;  1RAI B;  2X3W D;  1M1F A;  1WDX A;  1WX6 A;  2QQA A;  2EGE A;  1MMG A;  3URG A;  1T3S A;  2RH2 A;  2WSC E;  1PKS A;  2RHX A;  2DBK A;  4NL2 A;  4QYD A;  1SSF A;  1JRI A;  2DE0 X;  5A5N A;  3SWN C;  4Y92 A;  1K76 A;  1QKX A;  2COW A;  2CT3 A;  2W0Z A;  4ZGJ B;  5CUG A;  4A9O A;  1M3A A;  1GL5 A;  4QNS A;  1KHI A;  4MDX A;  3HMH A;  4YAT A;  2RQT A;  5FU7 C;  1VQP T;  1OX9 A;  2QTV A;  4A9J A;  2CKK A;  1CKB A;  1V29 B;  2GQV A;  5LJ5 d;  2RHY A;  4M75 A;  3P1D A;  3OB9 A;  4OMN A;  5I1Q A;  4KV1 A;  4AG1 C;  2E41 A;  5GAN 6;  4YYM A;  4A4H A;  5GJV B;  1GBR A;  1CSK A;  3IU5 A;  2G6F X;  2EVR A;  5AD2 A;  4DBH A;  4J3I A;  3MUK A;  3O5Z A;  2MWP A;  2LC4 A;  4J9G A;  2EYY A;  4QVZ A;  4ZNX A;  1KQS A;  1HXD A;  3GF5 A;  2LCS A;  5IAY A;  1BI1 A;  4PJN A;  4OUF A;  5L96 A;  4KGV B;  2RF0 A;  4AKI A;  3G7Z A;  4EPC A;  1YJ9 A;  3OYD A;  3M54 A;  2OJ2 A;  1VQ7 T;  3JCM W;  5F25 A;  1X01 A;  1G83 A;  1YJN T;  2BKD N;  2HL5 C;  2QI2 A;  5GAM h;  2XD0 A;  2K5I A;  5ACY A;  3ZEH A;  1SF9 A;  5HK0 A;  3G0L A;  5HRW A;  2GFA A;  1U5S A;  3PMT A;  2LJ1 A;  5E74 A;  2X35 A;  5FW9 A;  5LJ5 g;  1W2B P;  5CCA A;  3FLG A;  5KE3 A;  5A83 A;  4RTV A;  3SD4 A;  2AKK A;  1VQ7 Q;  3NTI A;  5A0G A;  2JXB A;  3RCW A;  4C8Q F;  5BT5 A;  2J6F A;  2VUB A;  1NZ9 A;  2GRC A;  4QZS A;  2WSE E;  1ARK A;  2E65 A;  3H0H A;  4BAC A;  4AKG A;  2KRM A;  3J7A F;  1NEG A;  2QA4 Q;  4M77 A;  4M75 B;  1BB9 A;  1VQN Q;  1K73 C;  2EJN A;  1IHW A;  3HFN A;  5ENF A;  3NGP A;  5I89 A;  2K7A A;  3G6E T;  3G1J A;  1H3H A;  2K3B A;  5C89 A;  1M5Q 1;  2E5K A;  4M7D C;  5DY7 A;  4QR5 A;  3M59 A;  1BCO A;  4QT7 A;  3M57 A;  1UGP B;  1OPK A;  1NG2 A;  2VGN A;  4DEY A;  1VQO Q;  2RB6 A;  3EFS A;  3LH5 A;  4M77 D;  2LMJ A;  3FRN A;  2FEI A;  4PJO C;  5D25 A;  3S3M A;  3TEE A;  3CD6 A;  1UJY A;  5D3J A;  1KQS P;  4PLL A;  1YIJ T;  5CUE A;  3DAI A;  3QZV A;  2YW5 A;  4NQN A;  3CME A;  4II1 A;  3FKM X;  2FRY A;  4OMM A;  4CC4 B;  4MZT A;  4LDV A;  1ZKR A;  4HVU A;  1K73 R;  3EGX A;  3QZS A;  1XTD A;  4BJX A;  4LD9 K;  4C66 A;  1VIF A;  3INZ A;  3UVW A;  3OYB A;  1FXX A;  4UC4 A;  3VJP A;  4DOV A;  2AKL A;  4D6W A;  4RTW A;  2CT4 A;  4RCC A;  2RI2 A;  1I5L A;  5CQY A;  1YP5 A;  5IGN A;  2JTM A;  5CU8 A;  2RNA A;  3CCJ Q;  3CCR T;  4C0G A;  2CZ1 B;  4QEU A;  5EVA A;  1PCX A;  3TSW A;  3VS4 A;  2ZPH B;  1S72 T;  4A53 A;  4DBR A;  5GAN d;  2HZY A;  2CDT A;  2L2P A;  4A9N A;  3RKX A;  4BE1 A;  4MEQ A;  3AAD A;  1NEB A;  4Y28 E;  2A7Y A;  1VQ6 Q;  2KEA A;  4HXP A;  4Z02 A;  5CIU A;  3Q1J A;  4J7F A;  4XUB A;  5KE2 A;  1VYV A;  4MDW A;  4MML A;  4UIU A;  2OX7 A;  4E47 A;  1D1B A;  1PC0 A;  1JJ2 P;  3BFM A;  2EYX A;  3VKI A;  5GAN g;  1WHL A;  5CRZ A;  2Y4X A;  3QO3 A;  5GAN f;  5CUA A;  2KNB B;  1VQN A;  3JB9 I;  4QKU A;  4YY6 A;  1AWJ A;  2PUO B;  3OYG A;  4XAX B;  3VRZ A;  1TH7 A;  4C92 E;  5DLZ A;  2KAF A;  3NXB A;  1WIE A;  2JMC A;  4LDY A;  5FH8 A;  4IR3 A;  1B7T A;  2PTK A;  4J1P A;  2QK0 A;  4E2F B;  4NR4 A;  5E9L A;  5F62 A;  1UUE A;  2E5Q A;  4Q5W A;  2O31 A;  2D9E A;  3MCA B;  1T0J A;  1VQ9 Q;  5EU1 A;  2A36 A;  2RJF A;  4MEN A;  4JUV A;  2LX9 A;  1NJI U;  2L85 A;  1K4U S;  2L89 A;  3CCQ A;  3NHN A;  4YYH A;  3E1S A;  5A5S A;  2O9V A;  2FO0 A;  5LJ5 f;  4TTE A;  4YYI A;  4J9B A;  3QII A;  5LJ5 j;  1W2B A;  5CK9 A;  2RQR A;  2R5M A;  5GMK i;  5KU3 A;  1KK7 A;  2E12 A;  5LJ5 e;  2DER A;  3CME T;  1OEB A;  1JB0 E;  4F04 B;  4YTL A;  5L8T A;  1AT1 B;  4EMK C;  4HBV A;  1PHT A;  2NLU A;  5CKF A;  3H0I A;  3RUX A;  8AT1 B;  4LNP A;  3ZFJ A;  1JEG A;  2YQD A;  1UEB A;  2YUP A;  2XDD A;  3E9G A;  1LCK A;  4CUS A;  2DA9 A;  1NJI C;  2K2M A;  1MNE A;  3CCL Q;  2GFU A;  4FW2 A;  3T9N A;  3MET A;  3RBB B;  2MYS A;  4WIV A;  2ATC B;  3CCR A;  3J81 E;  5A82 A;  2DXC A;  3A8G B;  1QCF A;  4KGZ B;  3L2U A;  5GAO m;  1UGV A;  4Z8A A;  5I21 A;  2CS7 A;  4XU2 A;  4M77 E;  2K5L A;  3CCM T;  2RHZ A;  1NM7 A;  4L59 A;  1ABQ A;  1P92 A;  2LZ6 B;  1RAG B;  1MMD A;  1UFF A;  5COI A;  1WUG A;  1QVP A;  4NYX A;  3C95 A;  5GAN 7;  1NYG A;  2K5F A;  3UVX A;  4DQ2 A;  3V8L A;  1EQF A;  5I2S A;  4DON A;  4TS8 A;  3EGD A;  4O74 A;  3H41 A;  4R56 A;  3ONI A;  2KI7 A;  2RI3 A;  2ZZD A;  2M16 A;  4IUP A;  1AWW A;  2VYT A;  1YIJ A;  2EQJ A;  2OTJ Q;  2CH4 A;  2QG9 B;  4J0R A;  4RG2 A;  4IR6 A;  2B86 A;  1UDL A;  4K11 A;  2PUK B;  2M02 A;  4UIY A;  2K2V A;  2DAT A;  2YRV A;  1KJW A;  2FSA A;  4CUR A;  1VQ7 A;  1H3Z A;  1X69 A;  1G2B A;  5IGL A;  1UHC A;  4FSX A;  4XTY A;  1PWT A;  2KRS A;  1UG1 A;  5E9M A;  2AZS A;  4N4I A;  3FJ5 A;  5D0C A;  3O36 A;  2E3I A;  4A9L A;  4BB7 A;  1C6V X;  4C92 D;  2JTE A;  2QQB A;  1OYX A;  1D0Z A;  1Y96 A;  5BT3 A;  3VUZ A;  2CP0 A;  4PNO A;  5ENB A;  2KGT A;  3RNJ A;  2HQH A;  1JU5 C;  3VV0 A;  5FE7 A;  1GFC A;  1X27 A;  3CD6 Q;  3OYK A;  1G5V A;  3MP6 A;  1WJR A;  1A0N B;  4A9E A;  5GAM f;  1M8V A;  2IVW A;  2KTB B;  4M77 C;  5CTL A;  3OMC A;  5GAM g;  3OA6 A;  3D1D A;  7AT1 B;  4QSV A;  4ZTF A;  3JVJ A;  4AFS C;  5CY9 A;  4HT9 A;  4MEO A;  4M7D A;  2EW3 A;  5AD3 A;  1D09 B;  3EGD B;  1ZSG A;  1FWZ A;  2E6Z A;  4AT1 B;  4KRT A;  3L2V A;  3UT1 A;  2NUT A;  4Z1Q A;  4PJO A;  4X2I A;  5LL6 S;  4IR5 A;  1Y7X A;  1ZUU A;  1TUD A;  3HKS A;  5EWC A;  2X4W A;  3OW2 S;  2EGA A;  2RM4 A;  3JCM f;  4A4K A;  3AQA A;  2AT1 B;  1YCY A;  3Q2E A;  4UYD A;  4O75 A;  4J9D A;  4C92 A;  1GBQ A;  3JCM g;  3JB9 J;  4PJJ A;  1TWB A;  1MV3 A;  2R5A A;  2EKH A;  3CPW S;  3NMZ C;  2RO1 A;  5LKT A;  3QUI A;  3GP8 A;  1NBE B;  4LDF A;  1QMC A;  2GQI A;  1NJI R;  5EIS A;  5F1H A;  1BK2 A;  5IHI A;  2ROL A;  4YAD A;  1RL2 A;  2HKN A;  1JJ2 A;  2CZ0 B;  5GAO l;  1BI3 A;  3OBY A;  5CFW A;  3U23 A;  3C0C A;  2RJD A;  5F5Z A;  2EPD A;  5D3P A;  2LX7 A;  2XG8 D;  1OPL A;  2D8J A;  3JVL A;  3I56 A;  5LJ1 A;  5FU7 B;  3PIP A;  3QBY A;  5II1 A;  3C94 A;  4BW4 A;  1VQM A;  3X25 B;  5CR2 A;  1K8A C;  4Z6I A;  5E3G A;  3OS5 A;  4ZGD B;  5CP5 A;  3CCE Q;  4QSS A;  1QVG A;  1KC8 R;  4JS5 A;  3JVM A;  4C5I A;  3CCU Q;  2O2O A;  5IT9 E;  3S6W A;  3G71 Q;  1JSP B;  2L5Q A;  2NUZ A;  1KHC A;  4MEP A;  5HJC A;  3O37 A;  4LZR A;  4Q0N A;  5I80 A;  3GNF B;  4J83 A;  2FPE A;  2L3Q A;  3EH1 A;  5D3N A;  2D8H A;  5EIC A;  3M55 A;  3TRE A;  2LNV A;  1M1K R;  1SHF A;  1YJW Q;  3OYJ A;  2DZ9 A;  4J9I A;  3P8H A;  3J80 E;  5CQ5 A;  5C85 A;  2MWO A;  4PFO A;  4NRB A;  2P84 A;  3JCM V;  4CI0 C;  3JB9 H;  3CC7 T;  5F63 A;  3ZYU A;  4QQ6 A;  1YN8 A;  3JAM E;  1IZ6 A;  4EMK B;  4A4G A;  2LCC A;  5KYX A;  5GAN 3;  1M4Z A;  2K9G A;  2GTO A;  1K8A R;  2E7N A;  2H3E B;  2GTJ A;  2LQW A;  1AEY A;  5CS8 A;  3BW1 A;  4PJL A;  3OY9 A;  5GMK l;  1D1C A;  1ZSZ A;  3MXF A;  4J6X A;  1NLP C;  4FYW B;  4FYY B;  2DEQ A;  5TB6 A;  4MR4 A;  4BDZ A;  2X9H A;  4J9F A;  2KSS A;  4ME7 A;  2VV5 A;  3FEO A;  4OMF B;  1WHK A;  4M78 F;  3LLR A;  2ZPG B;  1K9A A;  3A8L B;  1Y57 A;  4IUV A;  1LNX A;  1D3B A;  4AG2 C;  3D7S B;  5CQ8 A;  3UDC A;  3QWY A;  2YWW A;  4OMP A;  3CCS A;  5I7Y A;  1U1T A;  2Y90 A;  3CPW P;  5A5R A;  3JRZ A;  5L23 A;  4C8Q A;  2ABL A;  5E9Y A;  1RAA B;  2JMA A;  1GFD A;  2NWM A;  1BI2 A;  1RLQ C;  3PVQ A;  2DZC A;  2FZG B;  1IXD A;  3EG9 A;  5FE1 A;  1PD0 A;  1Q82 U;  2HL3 A;  5DKH A;  1WHM A;  2QDY B;  4QVC A;  5FE3 A;  2E3K A;  2RNW A;  2WP1 A;  3U5J A;  3OYA A;  4LDX A;  1D1A A;  5DFD A;  4M7A F;  1NLO C;  2X4Y A;  4M7D G;  4M7A B;  4QQG A;  1XQH A;  3JCM d;  4UIV A;  4UYF A;  4MZP A;  3CCQ T;  1N72 A;  2J05 A;  3U5O A;  2CP2 A;  4OGJ A;  1QP3 A;  3BDU A;  5I2M A;  4PJO G;  4O77 A;  3DLL A;  5E9I A;  2VAS A;  2QGF B;  2RK1 A;  3CXC A;  2I8N A;  5HEN A;  1M2V A;  3REB B;  4JZ3 A;  2XID A;  5DX4 A;  3MHX A;  2YLC A;  5HM0 A;  3KUF A;  4ZTJ A;  2J7I A;  5DYX A;  4CRI A;  3CCE T;  5HFQ A;  4LDU A;  1Y71 A;  3I5R A;  1B34 A;  4YAX A;  1SPK A;  2CZ6 B;  1VQN T;  5JWM A;  4TT6 A;  4QQD A;  5GAM d;  2RJE A;  3EG3 A;  1KQS S;  4KUD K;  5FDZ A;  3OSS C;  1Q81 R;  3BY7 A;  4A4F A;  1N27 A;  1LJO A;  4PL6 A;  4O71 A;  1I4K 1;  5E9K A;  1VQO T;  3IQL A;  3VS2 A;  1K0X A;  5GAO q;  1M1K U;  2C0O A;  3VS0 A;  5J0D A;  4B9W A;  1IGU A;  5CQA A;  2KMT A;  1JM4 B;  1Z9Z A;  1Q82 R;  3M0Q A;  2E1H A;  3OYF A;  1TSF A;  2E3H A;  2K3X A;  4UYH A;  2CH4 W;  4KH1 B;  5EWH A;  4A54 A;  4NYV A;  4RVR A;  5FB0 A;  3A5Z B;  4TVR A;  2KRN A;  1CKA A;  5DW1 A;  1B07 A;  1Y0M A;  2EQI A;  2QQ9 A;  5GAO r;  5CQ4 A;  1QWF A;  5IGK A;  4M4Z A;  4AMC A;  4NOY A;  5FB1 A;  1BYM A;  5HKC A;  4BY6 B;  1Q81 C;  2XK0 A;  3CC2 T;  2DRM A;  1AWX A;  3M4Y A;  2PVG B;  3CQT A;  3QKJ A;  2DKG A;  4PK4 A;  5I40 A;  4F7U F;  3S92 A;  1M9S A;  1GCQ A;  2G3R A;  5J26 A;  2GGR A;  5CQ3 A;  1WFW A;  2RI5 A;  4KH0 B;  1I1J A;  3ZBD A;  2LJ3 A;  1WXU A;  2O9S A;  2JN0 A;  3CD6 T;  4FLP A;  4QST A;  1TUC A;  3RMS A;  3JCM J;  1AOJ A;  2AK5 A;  3CEY A;  1KFZ A;  4BY6 C;  2EYZ A;  1G3Y A;  5LJ0 A;  3M0U A;  1H8K A;  4C67 A;  4M7D D;  4F7U E;  3I56 Q;  1X6B A;  1X2K A;  4XQ3 A;  1LPL A;  4C92 C;  4QVD A;  1WGS A;  2CYZ B;  3CCV A;  4ELY C;  1F1B B;  3TSZ A;  3QZT A;  5KTX A;  5DFB A;  3OQ5 A;  4FYX B;  4OB2 B;  1PRM C;  1WXB A;  4XY9 A;  4BW3 A;  1VQK Q;  2X3X D;  1ZA1 B;  4FYV B;  2HAX A;  4E7S A;  4TT4 A;  5IH2 A;  3CME Q;  4QSQ A;  4M7D B;  1YJ9 Q;  4RG8 A;  5AYF A;  1PKT A;  1RUW A;  5GMK m;  2HQE A;  1W4S A;  3REA B;  4PTB A;  3CC2 Q;  5DYU A;  2F5K A;  1BCM A;  5A0L A;  5IXF A;  5CQ7 A;  4J8O A;  2KXD A;  5GAO n;  5KYU B;  4X1V A;  2DVV A;  2H3J A;  2GF7 A;  1JO8 A;  3VS7 A;  5FRM A;  1Q86 U;  4NRC A;  5LJ2 A;  2EQU A;  2MMP A;  4BI4 A;  2E64 A;  1W1F A;  3PT9 A;  3G0J A;  2NUT B;  5LJ3 h;  2RQV A;  3EGX B;  3MP1 A;  5I29 A;  1VQ8 A;  2MJV B;  1E7O A;  2DNU A;  4Y03 A;  1K0S A;  4RTT A;  2OAU A;  2DJQ A;  4UYG A;  1W70 A;  3EFR A;  3RIR A;  4XY8 A;  5IID A;  3TQ7 P;  4M7A E;  4LZS A;  2BE7 D;  2JOY A;  5D26 A;  1YIT T;  4XTU A;  2J06 A;  3P1F A;  2CP5 A;  5CVI A;  4UIX A;  1KQ1 A;  2KK4 A;  2LQK A;  2M1H A;  2F5T X;  4FW1 A;  1SSH A;  2L8D A;  4OF1 A;  2DX1 A;  2R10 A;  4ZGE B;  5ENG A;  4QSU A;  2LQN A;  3QYG B;  1JXO A;  4HT8 A;  2F69 A;  3H0F A;  4ANJ A;  4ATO A;  4NXJ A;  4DOW A;  3SWN A;  2RS9 B;  5KH6 A;  2IG0 A;  1VQP Q;  2E7O A;  1PSF A;  4HXS A;  2QGG A;  5G4R A;  5KYW B;  1Q7Y U;  4TQN A;  4RKU E;  4F17 A;  1RAB B;  2LRQ A;  4RTY A;  3S91 A;  4CFK A;  2GCX A;  5A85 A;  1M3C A;  2RD1 A;  2DXB A;  5FE6 A;  4OGE A;  1WPY A;  4X9C A;  4ZN1 A;  1SRL A;  1WHH A;  2DTI A;  4OB0 B;  1N9R A;  4C0F A;  4QC1 A;  4M78 G;  3S3O A;  5IXB A;  4CUP A;  1XJW B;  4X9D A;  1BIA A;  5DLO A;  2NXB A;  5FG6 A;  2I2L A;  2OTJ T;  4GPJ A;  4DEX A;  1TU0 B;  2LT1 A;  3EHQ A;  2DO3 A;  2K3Y A;  4CC3 A;  3L2R A;  1T3L A;  4M78 D;  4DBF A;  3G4S Q;  1R0C B;  2H60 A;  4L6V 5;  1B3Q A;  1ABO A;  2JTF A;  2C0T A;  2D1X A;  5CO7 A;  3P1E A;  5HY6 A;  1FYN A;  1E6I A;  4QUU A;  3U5L A;  4BHW A;  4QY4 A;  2KT8 A;  4QW2 A;  4QUT A;  3CCL T;  3CCS T;  2BIV A;  4LC2 A;  4IUQ A;  3QJ6 A;  3SWN B;  4TU4 A;  3VKH A;  1MMA A;  4CC2 A;  1G3S A;  4C0D C;  1JJ2 S;  4LYS A;  1UEC A;  4HXJ A;  2R58 A;  2CP3 A;  5II2 A;  1T0H A;  3CCV Q;  2YUN A;  4ORZ A;  3K2J A;  4M7A C;  1S1N A;  2NUP B;  5DYC A;  4TYL A;  2DF6 A;  5EGU A;  2D9T A;  3UWN A;  4YYK A;  5FRO A;  4NR8 A;  2EJG A;  4IUR A;  1W2B S;  1LOJ A;  2FYK A;  4M7A D;  5A81 A;  2VKN A;  1QW1 A;  5J3B A;  4RMO A;  3HSB A;  2P0Q A;  1PG5 B;  4XTW A;  4Z6H A;  4IUU A;  2VXE A;  1QVF A;  3OW2 A;  2EWN A;  3CC7 A;  3GLX A;  1Q86 R;  3ER0 A;  4HBX A;  5FE8 A;  3OYM A;  2DET A;  5HLS A;  4M78 B;  3QXE B;  2L3R A;  1VQ4 A;  3CC4 Q;  1YI2 A;  3NFC A;  2E4H A;  4WHW A;  4XUA A;  1PD1 A;  4LUD A;  1BKB A;  4PCI A;  4M78 C;  5D7U A;  2V26 A;  3JCM c;  5CKE A;  5ECA A;  2ED1 A;  3L2Z A;  5CKD A;  5KYY A;  5L8R E;  4NUD A;  4KGX B;  1ZX6 A;  1YWP A;  2RQU A;  4LYI A;  4OB3 B;  4YYJ A;  3O35 A;  1PRL C;  2M0Y A;  4RTZ A;  4FU6 A;  2QEX T;  1RAF B;  4JLG A;  4UYF B;  1Q95 G;  1YHQ A;  5FG4 A;  3CXC S;  3DB3 A;  4AI6 A;  4E7J A;  4HBW A;  4XTZ A;  1WUM A;  5EPS A;  3LYI A;  4IKF A;  4Z93 A;  2YYN A;  1M1G A;  5LKX A;  2QYZ A;  4HA8 A;  4JPB W;  2D0Q B;  2RHI A;  4JZ4 A;  3M0R A;  2YEM A;  3KBG A;  3OMG A;  2IIM A;  3FIF A;  4LE9 A;  5D3S A;  3MEW A;  2BZY A;  3U5P A;  1RLP C;  1X6O A;  2RJC A;  1R8O B;  4NR6 A;  4OMQ A;  3JCM e;  3D7C A;  4BI3 A;  1VQP A;  3RER A;  3L42 A;  2HNI A;  1H64 1;  2XIC A;  1QVG S;  4HCK A;  1GCQ C;  3U5M A;  2C0I A;  4JRK A;  2R0V A;  1ZBJ A;  4XYA A;  5EM3 A;  1C1A A;  1YHQ T;  3LH0 A;  2DL5 A;  2FVU A;  1KD1 R;  4IOR A;  2V8J A;  4IUT A;  2EBP A;  4OMO A;  4JJC A;  4NUC A;  1YIT A;  2QAZ A;  3LQI A;  2DTO A;  2GBQ A;  4N4F A;  1IGQ A;  4E6R A;  4CLB A;  3F70 A;  5LJ5 h;  1WHG A;  2YT6 A;  2JVV A; 
#chains in the Genus database with same CATH homology
 5HFR A;  1M90 C;  4YYG A;  1YJW T;  5L99 A;  4A9K A;  3MQM A;  1K73 U;  1YI2 T;  4HXM A;  5HRX A;  2DVR A;  4O7A A;  4P5N A;  5L98 A;  3CC4 T;  5C8G A;  2JNG A;  5FU6 B;  4LYW A;  4A4E A;  5DM7 R;  2K4Y A;  1DJ7 B;  2K57 A;  4N0A C;  2FL7 A;  5GAN e;  5FH6 A;  2ZGW A;  3JCM b;  3CCM A;  1IRE B;  4J0S A;  1M90 U;  4A9M A;  5H1T A;  4N4G A;  2DAQ A;  3M5A A;  4KCX A;  5HRV A;  2DKW A;  1VQK T;  2L84 A;  3CCV T;  2EFI A;  4QEV A;  5HQ7 A;  4F7U B;  2V8K A;  2XI9 A;  2ZPB B;  3CCL A;  4OB1 B;  4ZC9 A;  3A8M B;  3C12 A;  3MB4 A;  4X34 A;  3M53 A;  2EJF A;  1U1S A;  4YAB A;  3EAE A;  5FRN A;  3CPF A;  5D3R A;  2YLB A;  5F36 A;  2QA4 T;  3JCM X;  5E73 A;  2DVS A;  1GXI E;  5FBX A;  4Z1S A;  5CAI A;  4KUI A;  5A5Q A;  5EP7 A;  5GMK h;  1KC8 C;  4XTV A;  4NUE A;  3G4S A;  5LVQ A;  3QDR B;  4C92 G;  4A9H A;  4UIZ A;  4IR4 A;  2ZPI B;  1ZBX A;  2ZCF B;  4N4H A;  4TU6 A;  2PQW A;  3OBW A;  3V8K A;  4F7U A;  5E0R A;  3HRT A;  5HQ6 A;  5ETB A;  2P0K A;  1Y96 B;  5EV9 A;  5DW2 A;  5F60 A;  4E7L A;  2LTO A;  4HXR A;  2CZ7 B;  2DD5 A;  1XOV A;  2Y4Y A;  5EWD A;  4QSP A;  3QJY A;  4LRG A;  4C5E A;  4ALH A;  5F2P A;  4CL9 A;  4QYL A;  3CBM A;  5D6Y A;  5LUU A;  3LWH A;  1KG1 A;  1K8A U;  2X4J A;  4NRA A;  4M77 B;  2DTH A;  5K29 A;  3QSU A;  5C6S A;  4AKN A;  4OP0 A;  5DY9 A;  2E6N A;  2YEK A;  3R6O A;  5DKD A;  4E7I A;  2A3L A;  5A0D A;  5FFV A;  5GAN j;  5FE5 A;  5CQX A;  3TLP A;  1UGS B;  2E10 A;  2VXF A;  3M9Q A;  5HEL A;  4EMH A;  5F61 A;  3MO8 A;  5CRM A;  2N9G A;  3DLM A;  2DPP B;  4YC9 A;  4YH3 A;  5AMF A;  5DKC A;  3PGG A;  4OGI A;  1KC8 U;  5CUD A;  4ALG A;  3OYH A;  1YBY A;  5KTU A;  5GAM e;  4O7F A;  5CGP A;  1HK9 A;  3V8J A;  2QQS A;  2HBP A;  4TZ8 A;  5GAO p;  5FH7 A;  2XDB A;  3V7S A;  1EIF A;  2RNX A;  4HCC A;  2DK3 A;  4V2S A;  1VUB A;  3UVY A;  4C0Z A;  4C8Q G;  5ENJ A;  2RA2 A;  5DBM A;  3HMF A;  4O7E A;  1VQ9 A;  4LR6 A;  4M75 C;  3G4S T;  5A5O A;  4KV4 A;  3BDL A;  2DXT A;  4XTX A;  3QG1 A;  3OS2 A;  1G3W A;  4IOO A;  4O76 A;  5E9V A;  3O34 A;  1JBM A;  4PJO D;  5GAN 4;  3G71 T;  3LQJ A;  4NR5 A;  4C0D B;  1YJW A;  5FE9 A;  1YJN A;  3JB9 D;  1XNI A;  3KXT A;  4M78 E;  5FU6 C;  4YBS A;  5M9O A;  4E96 A;  3VYH B;  5CZG A;  3SFM A;  4YBT A;  1WNL A;  5A2Q E;  3OYI A;  3G6E A;  2M9U A;  1N8R C;  2I7K A;  5CPE A;  2RO0 A;  3LWI A;  5CUB A;  3SVF A;  3A8O B;  4C5G A;  5GAN 5;  3FJP A;  5LKZ A;  4F7U G;  4QC3 A;  3GG3 A;  3CCU T;  4HCZ A;  4KUL A;  2O01 E;  3PNW C;  5AME A;  4C92 F;  5HK3 A;  1K9M C;  3I3J A;  1NPR A;  4O70 A;  2OSS A;  2DXU A;  3UV4 A;  3MEU A;  1VQ6 A;  1VIE A;  4GLK A;  4PKL A;  4M75 G;  1OZ2 A;  5KO4 A;  1WJS A;  2R57 A;  2LT4 A;  4M77 F;  1X75 C;  4QR3 A;  4PJO E;  4M7A G;  4M77 G;  5IG6 A;  5E3D A;  3S3N A;  3A8H B;  2O4X B;  3MUL A;  3GOX A;  4QR4 A;  5ETD A;  3JSC A;  4PKC C;  4QEW A;  1D3B B;  5D3L A;  4M7D E;  5EWV A;  2X4X A;  5ENH A;  4L5G A;  3H6Z A;  3N5B B;  3M56 A;  4TZ2 A;  4YY4 A;  2E70 A;  2EQM A;  3CBO A;  5FE2 A;  3L2Q A;  2WP2 A;  4TT2 A;  3RES A;  2MF2 A;  3E19 A;  4CUU A;  4QSR A;  4ELZ C;  4XU3 A;  1U8R A;  2LVM A;  1Q86 C;  1VQ6 T;  2XKO C;  5D3T A;  4MR5 A;  3OYY A;  5H1V A;  3IU6 A;  3LGF A;  2QTX A;  3GPL A;  3TCJ A;  2QQR A;  5GAN 2;  1I8F A;  3P8B B;  3CCU A;  1G3T A;  2DD4 A;  5D24 A;  4FT4 A;  4QBM A;  2RK2 A;  5C7N A;  2LQ8 A;  4HXN A;  2DVE A;  4Y91 A;  3VYG A;  2PVO B;  3Q2F A;  2R0S A;  4E7H A;  3TU4 K;  2EIF A;  1I81 A;  4JDS A;  5EWW A;  4BE0 A;  3X28 B;  1NPP A;  4XU1 A;  2PVD B;  3HRS A;  3G71 A;  5FG5 A;  5FFW A;  4JS4 A;  2RHU A;  2M0O A;  3UPU A;  2OTL T;  4KT0 E;  2OTJ A;  5FE4 A;  2G4A A;  2EAY A;  4A9F A;  3JVK A;  4VUB A;  4HBY A;  4NS5 A;  1VQL A;  4Q0O A;  5I7X A;  1VQM T;  4NQM A;  3HPW A;  2JZ2 A;  3I56 T;  1FX7 A;  3OYL A;  3HHT B;  5CUC A;  4PJO F;  3RKW A;  2YDW A;  5D7X A;  3FB9 A;  1QVF S;  4PJO B;  4BD3 A;  4HXL A;  5EPB A;  5A7C A;  4PS5 A;  3UVD A;  4O6J A;  3JB9 G;  3H8Z A;  4QB3 A;  3WVE B;  2JUF A;  4XU0 A;  4OGC A;  2EYQ A;  5EA1 A;  3MEA A;  5BT4 A;  4O5V A;  4JRQ A;  3SVG A;  1VQ5 A;  5LJ3 e;  3MEV A;  1OZ3 A;  3CCJ T;  4LZ2 A;  2XHC A;  5CKB A;  5DYA A;  1VQ8 T;  5IBN A;  5DLQ E;  1O9S A;  1KD1 C;  4MMK A;  2KDS A;  2MI6 A;  1AHJ B;  4YK0 A;  1QP2 A;  2AHJ B;  2D6F A;  4CFL A;  3DWY A;  2RFJ A;  3WVD B;  3SB2 A;  3LJW A;  5GMK j;  4HXO A;  4FT2 A;  1ZHI A;  3HL8 A;  3X24 B;  2FHD A;  5ENC A;  2F6N A;  3I55 A;  3HP9 A;  4QSW A;  4C8Q E;  5HQ5 A;  3P5O A;  2LCL A;  1KD1 U;  3PMI A;  1NE8 A;  5ENI A;  2KVQ G;  4C8Q D;  5CKH A;  1F68 A;  5EG2 A;  5D6W A;  3P1C A;  5F3A A;  5GAN 8;  2DIG A;  3WXM B;  2WSF E;  4NR9 A;  3CMA A;  3JCM Q;  1MGQ A;  2F6J A;  5C87 A;  4PLI A;  4O7C A;  5LJ3 d;  3AHU A;  1O75 A;  3OS0 A;  3LX7 A;  3L1A A;  4MR6 A;  3PIO A;  2KY9 A;  4HXK A;  2HD0 A;  3MP8 A;  1S72 A;  5EI4 A;  4JRI A;  5GAN h;  3O33 A;  3ASK A;  4C8Q B;  5L8U A;  4M75 E;  4E7K A;  2EQK A;  5LJ3 g;  5KCO A;  2OO1 A;  4FIB A;  1VQ9 T;  4BUG A;  5ENE A;  4M75 D;  4OVA A;  5LJ3 f;  2RNY A;  1OI1 A;  2WAC A;  5KCH A;  4M75 F;  1X0J A;  4C8Q C;  1RI0 A;  4BE2 A;  3NTH A;  4M7D F;  3PFS A;  5J39 A;  5DLX A;  5H1U A;  4BW2 A;  5TCM A;  2ZPF B;  5I83 A;  4XK8 E;  2PU9 B;  2DVQ A;  4FM4 B;  2YHT A;  4EDU A;  5LJ3 j;  1VQK A;  4HKE A;  5C4Q A;  3QHS A;  1UGQ B;  1N9S A;  4FL6 A;  4J5Y A;  2OUO A;  3CC2 A;  3O8V A;  4DA4 A;  3OS1 A;  1Q82 C;  1UGR B;  3MB3 A;  3I55 T;  4M7A A;  4O7B A;  4N0A A;  2P0P A;  4C92 B;  4YYN A;  3VUB A;  5IN1 A;  3SDZ A;  4WF2 A;  4UIT A;  3CC4 A;  4WHU A;  4NL3 A;  5GMK e;  3JCM h;  3U5K A;  4LDW A;  2KQW A;  3P8D A;  4O78 A;  3DKM A;  3VU3 C;  1WQW A;  5I88 A;  2O4X A;  4ZN3 A;  3CMA T;  4B9X A;  5GAM j;  4M78 A;  3SVH A;  3LQH A;  4GY5 A;  4RCB A;  1Q7Y C;  5FFY A;  4J6Y A;  1YJ9 T;  3UV2 A;  3CCJ A;  3OYE A;  1VQO A;  1N6A A;  5C0M A;  3JCM P;  3QZ5 B;  3HRU A;  4BW1 A;  2V8I A;  5EQ1 A;  1WJQ A;  5KHM A;  2VC8 A;  1PSE A;  5F1L A;  3CCE A;  5FE0 A;  5CQ6 A;  2MAM A;  2L5E A;  2XU8 A;  1UB4 A;  4NR7 A;  2D82 A;  2DIQ A;  5EPR A;  3C4S A;  2R0Y A;  5CQT A;  4BI8 B;  4QSX A;  3GNG A;  2CGH A;  5HCL A;  3QPH A;  5G4S A;  4LD6 A;  3LGL A;  1ZQ1 A;  2VGM A;  3GIB A;  2C06 A;  3DB4 A;  5D6X A;  1VQL T;  3X26 B;  4ZW1 A;  2LSP B;  2QEX A;  3QZ9 B;  4HCB A;  1Y07 A;  4C5H A;  3CBP A;  4EMG A;  5D3H A;  4YH4 A;  3LW5 E;  1VQ5 T;  2OTL A;  3LXJ A;  2QA4 A;  3V7C A;  5I86 A;  3OSV A;  5HEM A;  2LDM A;  3QYH B;  4IOQ A;  2DJZ A;  3HME A;  3X20 B;  4JLI A;  3L2W A;  1BI0 A;  3E9F A;  3RKY A;  4JRP A;  1K9M U;  4MZM A;  5JI8 A;  4PCE A;  2DWW A;  2EKO A;  4O72 A;  1ZS5 A;  4YBM A;  1VQ4 T;  5A5P A;  2YEL A;  3RMQ A;  5H85 A;  3JB9 F;  4YYD A;  3U5N A;  1MHN A;  5FLX E;  5LKU A;  2FB7 A;  4UYE A;  2HQX A;  2EJ9 A;  4J6W A;  4A9I A;  2ZPE B;  3PTA A;  1M1K C;  3FC3 A;  5L97 A;  3V7R A;  5DFC A;  4ZQL A;  3UV5 A;  4MR3 A;  3FDR A;  3NTK A;  4J7I A;  4UIW A;  4KBM B;  1N8R U;  4CUQ A;  4BDY A;  2XDP A;  4PY6 A;  2RI7 A;  4R55 A;  4JJN K;  3ME9 A;  2B8A A;  2BUD A;  5E7D A;  5LVR A;  1B34 B;  4CUT A;  4N3W A;  5IGM A;  3M4G A;  4F3I A;  3HFO A;  1BIB A;  3M58 A;  1WQ7 A;  3UW9 A;  2P4T A;  4EMK A;  3CPW A;  1KQ2 A;  3OYC A;  1Q81 U;  2QXF A;  3OYN A;  5KTW A;  5EK9 A;  4NYW A;  1M1F A;  2QQA A;  3URG A;  2RH2 A;  2WSC E;  2RHX A;  4NL2 A;  4QYD A;  1SSF A;  1JRI A;  3SWN C;  5A5N A;  4ZGJ B;  5CUG A;  4A9O A;  4QNS A;  1KHI A;  4MDX A;  3HMH A;  4YAT A;  5FU7 C;  1VQP T;  4A9J A;  2CKK A;  1V29 B;  2GQV A;  5LJ5 d;  2RHY A;  4M75 A;  3P1D A;  3OB9 A;  5I1Q A;  4KV1 A;  5GAN 6;  2E41 A;  4YYM A;  4A4H A;  3IU5 A;  5AD2 A;  4J3I A;  3MUK A;  2MWP A;  2LC4 A;  4QVZ A;  1KQS A;  1HXD A;  3GF5 A;  5IAY A;  1BI1 A;  4OUF A;  5L96 A;  4EPC A;  3G7Z A;  1YJ9 A;  3OYD A;  3M54 A;  1VQ7 T;  3JCM W;  5F25 A;  1X01 A;  1YJN T;  2BKD N;  2QI2 A;  5GAM h;  2XD0 A;  2K5I A;  5ACY A;  3ZEH A;  5HK0 A;  3G0L A;  5HRW A;  2GFA A;  3PMT A;  5LJ5 g;  5E74 A;  2X35 A;  5CCA A;  3FLG A;  5KE3 A;  5A83 A;  3SD4 A;  3NTI A;  5A0G A;  3RCW A;  4C8Q F;  5BT5 A;  2VUB A;  1NZ9 A;  2GRC A;  4QZS A;  2WSE E;  2E65 A;  4BAC A;  3J7A F;  4M77 A;  4M75 B;  1K73 C;  3HFN A;  5ENF A;  5I89 A;  3G6E T;  5C89 A;  1M5Q 1;  4M7D C;  5DY7 A;  4QR5 A;  3M59 A;  3M57 A;  1UGP B;  2VGN A;  2RB6 A;  3EFS A;  4M77 D;  3FRN A;  4PJO C;  5D25 A;  3S3M A;  3TEE A;  3CD6 A;  5D3J A;  4PLL A;  1YIJ T;  5CUE A;  3DAI A;  3QZV A;  2YW5 A;  4NQN A;  3CME A;  4II1 A;  3FKM X;  4MZT A;  4LDV A;  3QZS A;  1XTD A;  4BJX A;  4LD9 K;  4C66 A;  1VIF A;  3INZ A;  3UVW A;  3OYB A;  1FXX A;  4UC4 A;  3VJP A;  4DOV A;  4D6W A;  4RCC A;  2RI2 A;  1I5L A;  5CQY A;  5IGN A;  2JTM A;  5CU8 A;  3CCR T;  4C0G A;  2CZ1 B;  4QEU A;  5EVA A;  2ZPH B;  1S72 T;  4A53 A;  5GAN d;  4A9N A;  3RKX A;  4BE1 A;  4MEQ A;  3AAD A;  4Y28 E;  2A7Y A;  4HXP A;  4Z02 A;  5CIU A;  3Q1J A;  4J7F A;  4XUB A;  5KE2 A;  4MDW A;  4MML A;  4UIU A;  4E47 A;  3BFM A;  3VKI A;  5GAN g;  5CRZ A;  2Y4X A;  3QO3 A;  5GAN f;  5CUA A;  1VQN A;  3JB9 I;  4YY6 A;  2PUO B;  3OYG A;  4XAX B;  1TH7 A;  4C92 E;  5DLZ A;  2KAF A;  3NXB A;  4LDY A;  5FH8 A;  4IR3 A;  4J1P A;  4NR4 A;  5E9L A;  5F62 A;  2E5Q A;  4Q5W A;  2D9E A;  3MCA B;  5EU1 A;  2RJF A;  4MEN A;  4JUV A;  2LX9 A;  1NJI U;  2L85 A;  2L89 A;  3CCQ A;  4YYH A;  3E1S A;  5A5S A;  5LJ5 f;  4TTE A;  4YYI A;  3QII A;  5LJ5 j;  1W2B A;  5CK9 A;  2R5M A;  5GMK i;  5KU3 A;  2E12 A;  5LJ5 e;  3CME T;  1JB0 E;  4YTL A;  5L8T A;  4EMK C;  4HBV A;  2NLU A;  5CKF A;  3RUX A;  3ZFJ A;  2YQD A;  1UEB A;  2XDD A;  3E9G A;  4CUS A;  1NJI C;  2GFU A;  3T9N A;  3MET A;  4WIV A;  3CCR A;  3J81 E;  5A82 A;  2DXC A;  3A8G B;  3L2U A;  5GAO m;  5I21 A;  2CS7 A;  4XU2 A;  4M77 E;  2K5L A;  3CCM T;  2RHZ A;  4L59 A;  1P92 A;  5COI A;  1WUG A;  1QVP A;  4NYX A;  3C95 A;  5GAN 7;  2K5F A;  3UVX A;  4DQ2 A;  3V8L A;  1EQF A;  5I2S A;  4DON A;  4TS8 A;  4O74 A;  4R56 A;  3ONI A;  2RI3 A;  2ZZD A;  2M16 A;  4IUP A;  2VYT A;  1YIJ A;  2EQJ A;  4J0R A;  4RG2 A;  4IR6 A;  2PUK B;  4UIY A;  2K2V A;  2DAT A;  2YRV A;  2FSA A;  4CUR A;  1VQ7 A;  1H3Z A;  5IGL A;  4FSX A;  4XTY A;  5E9M A;  4N4I A;  5D0C A;  3O36 A;  4A9L A;  4BB7 A;  4C92 D;  2QQB A;  1OYX A;  1Y96 A;  5BT3 A;  3VUZ A;  4PNO A;  5ENB A;  3VV0 A;  5FE7 A;  3OYK A;  1G5V A;  3MP6 A;  1WJR A;  4A9E A;  5GAM f;  1M8V A;  2IVW A;  2KTB B;  4M77 C;  5CTL A;  3OMC A;  5GAM g;  3OA6 A;  4QSV A;  4ZTF A;  3JVJ A;  5CY9 A;  4HT9 A;  4MEO A;  4M7D A;  5AD3 A;  1FWZ A;  2E6Z A;  3L2V A;  3UT1 A;  4Z1Q A;  4PJO A;  4X2I A;  5LL6 S;  4IR5 A;  1Y7X A;  3HKS A;  5EWC A;  2X4W A;  3OW2 S;  2RM4 A;  4A4K A;  3JCM f;  3AQA A;  1YCY A;  3Q2E A;  4UYD A;  4O75 A;  4C92 A;  3JCM g;  3JB9 J;  2R5A A;  3CPW S;  2RO1 A;  5LKT A;  3QUI A;  3GP8 A;  4LDF A;  5EIS A;  5F1H A;  4YAD A;  1RL2 A;  1JJ2 A;  2CZ0 B;  5GAO l;  1BI3 A;  3OBY A;  5CFW A;  2RJD A;  5F5Z A;  5D3P A;  2XG8 D;  3JVL A;  3I56 A;  5LJ1 A;  5FU7 B;  3PIP A;  3QBY A;  5II1 A;  3C94 A;  4BW4 A;  1VQM A;  3X25 B;  5CR2 A;  1K8A C;  4Z6I A;  5E3G A;  3OS5 A;  4ZGD B;  5CP5 A;  4QSS A;  1QVG A;  4JS5 A;  3JVM A;  4C5I A;  5IT9 E;  3S6W A;  1JSP B;  2L5Q A;  1KHC A;  4MEP A;  5HJC A;  3O37 A;  4LZR A;  4Q0N A;  5I80 A;  3GNF B;  4J83 A;  5D3N A;  5EIC A;  3M55 A;  3TRE A;  2LNV A;  3OYJ A;  2DZ9 A;  3P8H A;  3J80 E;  5CQ5 A;  5C85 A;  2MWO A;  4NRB A;  3JCM V;  4CI0 C;  3JB9 H;  3CC7 T;  5F63 A;  3ZYU A;  4QQ6 A;  3JAM E;  1IZ6 A;  4EMK B;  4A4G A;  2LCC A;  5GAN 3;  1M4Z A;  2E7N A;  5CS8 A;  3BW1 A;  3OY9 A;  5GMK l;  3MXF A;  4J6X A;  2DEQ A;  5TB6 A;  4MR4 A;  4BDZ A;  2KSS A;  4ME7 A;  2VV5 A;  3FEO A;  4OMF B;  4M78 F;  3LLR A;  2ZPG B;  3A8L B;  4IUV A;  1LNX A;  1D3B A;  5CQ8 A;  3UDC A;  3CCS A;  5I7Y A;  1U1T A;  2Y90 A;  5A5R A;  3JRZ A;  4C8Q A;  5E9Y A;  1BI2 A;  2DZC A;  5FE1 A;  1Q82 U;  5DKH A;  2QDY B;  4QVC A;  5FE3 A;  2E3K A;  2RNW A;  2WP1 A;  3U5J A;  3OYA A;  4LDX A;  5DFD A;  4M7A F;  2X4Y A;  4M7D G;  4M7A B;  4QQG A;  1XQH A;  3JCM d;  4UIV A;  4UYF A;  4MZP A;  3CCQ T;  1N72 A;  3U5O A;  4OGJ A;  1QP3 A;  3BDU A;  5I2M A;  4PJO G;  4O77 A;  3DLL A;  5E9I A;  2RK1 A;  3CXC A;  2I8N A;  5HEN A;  2XID A;  5DX4 A;  3MHX A;  2YLC A;  5HM0 A;  3KUF A;  4ZTJ A;  5DYX A;  4CRI A;  3CCE T;  5HFQ A;  4LDU A;  1Y71 A;  1B34 A;  4YAX A;  2CZ6 B;  1VQN T;  5JWM A;  4TT6 A;  4QQD A;  5GAM d;  2RJE A;  1KQS S;  4KUD K;  5FDZ A;  3OSS C;  3BY7 A;  4A4F A;  1N27 A;  1LJO A;  4PL6 A;  4O71 A;  1I4K 1;  5E9K A;  1VQO T;  5GAO q;  1M1K U;  5J0D A;  4B9W A;  5CQA A;  2KMT A;  1JM4 B;  3OYF A;  2E1H A;  2K3X A;  4UYH A;  5EWH A;  4A54 A;  4NYV A;  4RVR A;  5FB0 A;  3A5Z B;  4TVR A;  5DW1 A;  2QQ9 A;  5GAO r;  5CQ4 A;  5IGK A;  4NOY A;  5FB1 A;  1BYM A;  5HKC A;  4BY6 B;  1Q81 C;  2XK0 A;  3CC2 T;  3M4Y A;  2PVG B;  3QKJ A;  2DKG A;  5I40 A;  4F7U F;  3S92 A;  1M9S A;  2G3R A;  5J26 A;  5CQ3 A;  2RI5 A;  3ZBD A;  2JN0 A;  3CD6 T;  4FLP A;  4QST A;  3JCM J;  3RMS A;  3CEY A;  4BY6 C;  1G3Y A;  5LJ0 A;  4C67 A;  4M7D D;  4F7U E;  4XQ3 A;  4C92 C;  4QVD A;  1WGS A;  2CYZ B;  3CCV A;  4ELY C;  3QZT A;  5KTX A;  5DFB A;  3OQ5 A;  4OB2 B;  4XY9 A;  4BW3 A;  2HAX A;  4TT4 A;  4QSQ A;  4M7D B;  4RG8 A;  5AYF A;  5GMK m;  2HQE A;  1W4S A;  4PTB A;  5DYU A;  2F5K A;  5A0L A;  5CQ7 A;  4J8O A;  5GAO n;  2DVV A;  2H3J A;  2GF7 A;  5FRM A;  1Q86 U;  4NRC A;  5LJ2 A;  2EQU A;  2MMP A;  4BI4 A;  2E64 A;  3PT9 A;  3G0J A;  5LJ3 h;  3MP1 A;  5I29 A;  1VQ8 A;  2MJV B;  4Y03 A;  2OAU A;  3EFR A;  4UYG A;  3RIR A;  4XY8 A;  5IID A;  4M7A E;  4LZS A;  2JOY A;  1YIT T;  5D26 A;  4XTU A;  3P1F A;  5CVI A;  4UIX A;  1KQ1 A;  2KK4 A;  2LQK A;  2M1H A;  2F5T X;  2L8D A;  4OF1 A;  2R10 A;  4ZGE B;  5ENG A;  4QSU A;  3QYG B;  4HT8 A;  2F69 A;  4ATO A;  4NXJ A;  4DOW A;  3SWN A;  2RS9 B;  5KH6 A;  2IG0 A;  2E7O A;  1PSF A;  4HXS A;  5G4R A;  1Q7Y U;  4TQN A;  4RKU E;  2LRQ A;  3S91 A;  4CFK A;  2GCX A;  5A85 A;  2RD1 A;  2DXB A;  5FE6 A;  4OGE A;  1WPY A;  4X9C A;  4ZN1 A;  2DTI A;  4OB0 B;  1N9R A;  4C0F A;  4QC1 A;  4M78 G;  3S3O A;  4CUP A;  4X9D A;  1BIA A;  5DLO A;  2NXB A;  5FG6 A;  2I2L A;  2OTJ T;  4GPJ A;  2LT1 A;  2DO3 A;  2K3Y A;  3L2R A;  4M78 D;  2H60 A;  4L6V 5;  2JTF A;  5CO7 A;  3P1E A;  5HY6 A;  1E6I A;  4QUU A;  3U5L A;  4BHW A;  4QW2 A;  4QY4 A;  4QUT A;  3CCL T;  3CCS T;  2BIV A;  4LC2 A;  4IUQ A;  3QJ6 A;  3SWN B;  4TU4 A;  1G3S A;  4C0D C;  1JJ2 S;  4LYS A;  2R58 A;  5II2 A;  3K2J A;  4M7A C;  5DYC A;  4TYL A;  5EGU A;  2D9T A;  3UWN A;  4YYK A;  5FRO A;  4NR8 A;  2EJG A;  4IUR A;  1W2B S;  1LOJ A;  2FYK A;  4M7A D;  5A81 A;  1QW1 A;  5J3B A;  4RMO A;  3HSB A;  2P0Q A;  4XTW A;  4Z6H A;  4IUU A;  2VXE A;  1QVF A;  3OW2 A;  2EWN A;  3CC7 A;  3GLX A;  3ER0 A;  4HBX A;  5FE8 A;  3OYM A;  5HLS A;  4M78 B;  3QXE B;  2L3R A;  1VQ4 A;  1YI2 A;  3NFC A;  4WHW A;  4XUA A;  1BKB A;  4PCI A;  4M78 C;  3JCM c;  5CKE A;  3L2Z A;  5CKD A;  5L8R E;  4NUD A;  4LYI A;  4OB3 B;  4YYJ A;  3O35 A;  4FU6 A;  2QEX T;  4JLG A;  4UYF B;  1YHQ A;  5FG4 A;  3CXC S;  3DB3 A;  4E7J A;  4HBW A;  4XTZ A;  1WUM A;  5EPS A;  3LYI A;  4IKF A;  4Z93 A;  2YYN A;  1M1G A;  5LKX A;  4HA8 A;  2D0Q B;  2RHI A;  2YEM A;  3KBG A;  3OMG A;  3FIF A;  5D3S A;  3MEW A;  3U5P A;  3JCM e;  1X6O A;  2RJC A;  1R8O B;  4NR6 A;  3D7C A;  4BI3 A;  1VQP A;  3RER A;  3L42 A;  2HNI A;  1H64 1;  2XIC A;  1QVG S;  3U5M A;  4JRK A;  2R0V A;  4XYA A;  5EM3 A;  1YHQ T;  3LH0 A;  2FVU A;  4IOR A;  2V8J A;  4IUT A;  4NUC A;  1YIT A;  3LQI A;  2DTO A;  4N4F A;  4CLB A;  3F70 A;  5LJ5 h;  2JVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...