4N4QA

Crystal structure of n-acetylneuraminate lyase from mycoplasma synoviae, crystal form ii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
293
Chain Sequence
b'HNFDKFKGLFPAMVTPFTKDGKLHKAGVKEVVNFLVEKQKVDGIYITGSTGEFLLLSFEDKKEVMKLVAEANAGRVTLIAQIGSLNIEETKELAKLAKELKYDAISAITPYYYNFSFNETHHYYEEISKAADIPMLIYYLPQLAGVSTDQFGKLLEIKNVIGSKYGATDLFAFERLMSKYPDKLFMFAWDEALAMGLTMGAKGFIGSTYNVNAKGANAIIKAWEANDKEAVMKLTHTYNDYVLDLISKGLMQSLKAIMRLHGVDAGYTRKPFWRYEDEEIKKHAEFITDKYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate lyase
molecule tags Lyase
source organism Mycoplasma synoviae
publication title GroEL/ES Chaperonin Modulates the Mechanism and Accelerates the Rate of TIM-Barrel Domain Folding.
pubmed doi rcsb
total genus 106
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n4qA00
3NPWA 3GK0A 4I7UA 4UTMA 1JUBA 1SFJA 3THQA 4EIVA 3LRMA 3PR2A 4M7TA 4CNOA 3EX1A 5AOUA 3NAVA 2CW6A 3BLEA 4TR9A 1X7FA 1YYAA 2BZNA 2ZTKA 4QIUA 3IVSA 5BMWA 4LOCA 2Y7DA 2Q3OA 1EWDA 1JCJA 1DJNA 3FS2A 4BI7A 1XI3A 1TCDA 5A5WA 2YSWA 3PY2A 1W5MA 3GZ3A 5L6UA 4RKAA 4RXGA 1QPNA 4HNTA 4LVBA 5LNVA 1JJKA 4A3UA 4UC5A 4AF0B 5J5RA 1H7WA 2TMDA 5KZMA 3W7DA 3W87A 4N9DA 4GUIA 1H7NA 3KXQA 5G2WA 2V5LA 3INPA 5AC6A 4EF8A 3C8FA 1CX9A 4ZQRA 3MHUA 3TH6A 4IJBA 3IEBA 1VH7A 4E38A 3UY8A 1ZENA 1ZHAA 3PVFA 3B0UX 4PCFA 3DFTA 3PAJA 3RFAA 2OT0A 3CB8A 4AWUA 4ZL1A 4N4PA 4MFDA 4RZ4A 1OFOA 4QQ3A 1F74A 3C2VA 3IIOA 3GDRA 3LHWA 1TTPA 2IQTA 2J88A 3O07A 5IM51 3Q37A 3UQNA 4JD4A 2WNZA 3SR7A 3M5YA 1KFJA 3CIWA 1P0NA 2B7NA 4LTSA 5ABTA 4LV9A 4ORIA 2QEZA 1FCVA 1VYPX 3P8IA 5DY3A 3TA6A 5DY2A 2Y85A 3KFTA 3LBCA 2ZZ4A 3DU0A 4E2BA 3S5NA 4FNPA 4K39A 3G1AA 1SU5A 4IXXA 3W88A 4PC8A 4CNNA 1G7UA 3DXIA 1Z48A 2J9ZA 2QAPA 3EEGA 4NJKA 3RNDA 5EMUA 4ORMA 5DCDA 3OG3A 2LLEA 4O0KA 4O4VA 3UNDA 3M5XA 1UASA 3IGXA 3S9YA 2Y70A 3P84A 4FXRA 4AEOA 1FWRA 3M47A 3KOFA 3OVQA 4JTHA 3LV6A 4AH7A 1KFCA 1XDLA 1XXXA 2ZA2A 1S5VA 4R33A 5EBUA 2A7PA 3QMSA 1F05A 1RVGA 1ADOA 3BGJA 2Y7GA 3OA3A 4O13A 5GVJA 4FNSA 1GT8A 2PRHA 3G1YA 4KFPA 4Q33A 1H51A 3MP3A 1KFBA 1LBMA 4HSOA 1PE1A 3NZRA 4FF7A 4OQVA 3S5OA 3G3DA 3W7HA 1U5JA 2QKFA 3F03K 4PA8A 3CC1A 1D3HA 3M5VA 4BR1A 3I65A 5CKSA 4WZHA 4LVDA 1ME9A 1FBAA 1TPWA 1XUZA 4DO5A 3CQ0A 4LS2A 3NA8A 3DI1A 1EUNA 1KFEA 4Y9AA 4HHPA 4K37A 4DEFA 2Y88A 4HNVA 4X22A 3QPZA 1TRDA 1TPC1 4N9CA 4BFAA 3P5ZA 3MI6A 1YADA 3PUOA 3S1WA 3LTYA 3GX9A 2CLLA 3A5FA 3L66A 2Y61A 2FPVA 4FO4A 2QCDB 3O16A 4L4LA 3NL6A 1FWTA 1F7BA 1AW1A 3DH7A 5U4NA 4CQ9A 4FIRA 4LVFA 3JRKA 4HNNA 1IXNA 1G69A 1OK6A 3OHIA 3SI9A 3G8EA 1UCWA 3KAOA 1GVRA 4M6PA 1XM3A 2V30A 3CWNA 5MHBA 4O15A 1ME8A 5D38A 2QCDA 3MP4A 1SZGA 1VCFA 1LORA 3F1QA 4UR7A 1W31A 4K8HA 8TIMA 1FDYA 5TQLA 3QQ1A 2JKPA 2QJHA 2FQIA 4ZQPA 2TSYA 1XC4A 4KWWA 5L9FA 1OJXA 3QJAA 2AAMA 2A21A 1TJPA 3N73A 1QO2A 3JR2A 3BPWA 3BG3A 1ML1A 2NX9A 3BGGA 4Z1DA 1KTCA 2TYSA 3DKJA 3NQAA 3M7WA 3EB2A 3M43A 3MHFA 3W7IA 1WYIA 1H62A 3UZ5A 4JYDA 2BSLA 3PWAA 3TROA 3G22A 4HN4A 4AAJA 1B4EA 2KZHA 3O15A 2ZZ7A 1XBZA 4UNKA 1TTIA 3WJYA 1OYBA 2W0UA 3L65A 1T96A 4LS1A 4O57A 4TIMA 1UUMA 3PF3A 2ABAA 3ATYA 4M5PA 1J5TA 1FCQA 1NAL1 4I7VA 2DP3A 3QYQA 2AGKA 1Z42A 3LI1A 3SGZA 4YXGA 4O19A 1L6WA 3PUDA 4JY9A 2AQWA 3F4NA 4Z1BA 3V75A 3MP5A 2WQPA 1T8XA 1JQXA 4K6AA 4BF9A 3GB6A 2WSYA 3GKFA 1KA9F 1L6SA 1LRNA 1BEUA 1SSDA 3LRLA 1W5PA 3TFXA 1QCWA 3U6WA 4K38A 2CZDA 3F4WA 3O6YX 3L2IA 1YDVA 3NQMA 4O1CA 2BX7A 3QMRA 4LVGA 4Z1AA 1K7EA 4NXKA 3B04A 4MJZA 3UY7A 1LLWA 2VC6A 4K36A 3EX3A 5LNWA 1H7OA 4GUHA 2DORA 4DPPA 3OIXA 3O05A 3PB0A 4L4MA 3KVMA 4UMAA 5G2HA 2A6NA 1JUEA 2CU0A 3OVPA 1D9EA 3EKZA 3UPBA 4ADTA 4IMEA 4K8EA 4NNCA 2A7NA 4LC6A 1GEQA 2GJLA 5HR6A 2P1FA 4IXHA 1JRCA 3NQVA 4UNLA 5FF3A 2DZSA 4MY1A 4CCCA 4JTEA 1R30A 1TV5A 2J6XA 4FX7A 5CPLA 3WJWA 1F73A 3TQ0A 4U4MA 1LBFA 2E6AA 2B7OA 2XFWA 3UXDA 2EGZA 5BMXA 3TXZA 2ATSA 2QDHA 1DBTA 4MIMA 4AHOA 4AHPA 2QR6A 3QQ0A 3R8RA 5DELA 1IIGA 4UMBA 3TKFA 3UPWA 1G4TA 1X6UA 3T78A 3UWVA 1LRQA 5FF2A 2QCEA 1GVFA 2YW3A 3O1NA 4LY8A 3HQ1A 4GFSA 1G67A 4MY8A 3ZFHA 1OG0A 1KM0A 3L21A 4XKYB 3E0IA 3MUXA 1KLYA 3C2FA 3S1XA 3G1HA 4UFLA 4NJGA 3NNTA 2E09A 1OFDA 3G8RA 3WK3A 4RV8A 2DZXA 1W3NA 4XQ6A 1QPQA 1SW7A 1SPQA 3FLUA 3UWYA 3NZ1A 3GKAA 4X9SA 2Y63A 4HPXA 1YPFA 1JCLA 1B57A 1I2RA 2QCHA 4UTJA 3KRUA 5CPNA 3PBUA 1M5WA 3W72A 4UTIA 1AL7A 4ZQOA 1LTDA 4JN6A 3PULA 3IGUA 3TW7A 5AFDA 2CLFA 2C14A 4R34A 3GLCA 4DELA 4ONVA 3U2OA 2BTMA 1RQHA 4WY0B 5CPMA 1G4EA 4KFNA 4ZQNA 2FB3A 4PEKA 3S5ZA 1GTEA 5AHNA 4ADUA 4FHAA 4TMBA 4IX2A 3TIMA 4A29A 3G1XA 3DENA 1R47A 1H7XA 2E6FA 3G1VA 4DBEA 2H8ZA 3LV5A 1QWGA 3W7QA 3SECA 3CTLA 2ZRUA 5IBXA 1KFLA 1I2OA 1GJPA 4R53A 3A21A 3TR2A 2X1UA 3S5YA 3TC6A 3SJ3A 3QRHA 3IVUA 2HS6A 5I3FA 2Y89A 3I7RA 3BLIA 3HG3A 5EPDA 4HIBA 2V5BA 1LOSA 4MFEA 5DLCA 1KW1A 1TPEA 1VGAA 3N19B 3GXNA 4UUIA 3JS3A 3W1MA 5CZSA 2GQAA 1KTNA 5AYYA 4BK9A 3EXSA 3I6RA 4N9BA 4R7JA 4O1AA 4OT7A 2Q8LA 3QW3A 4WD0A 5TIMA 4FNTA 2NLIA 1QAPA 4JR5A 4UCGA 4ZVJA 4DO6A 2CZ5A 2ZZ2A 3W1PA 3HPXA 1SUXA 3KX6A 3LCFA 4ZQMA 4Z0JA 1I2PA 3HPZA 4JY8A 5D33A 5AHEA 2YR1A 2E6DA 4J9JA 2PRMA 3LCXA 3N2XA 3LTSA 3LXBA 2NUWA 4PL1A 3W7EA 4OU1A 2H6RA 2ZFAA 3NM1A 4M7SA 2A2IA 2EAWA 5BW6A 5G1YA 3U8GA 4LU0A 5E93A 4RJEA 3VI2A 3PS7A 3WK0A 3DAQA 1VRDA 3E9AA 2X1TA 1YXDA 1Q6QA 1XKYA 2F7FA 1EP3A 1WQ5A 1K7FA 2D73A 3PB2A 3M44A 1JULA 2C19A 5KINA 3CPRA 1LZOA 1PHQA 2TPSA 1LYXA 4HNUA 1CI1A 1LOQA 4FNQA 4ALDA 1O94A 3PUEA 5F2LA 4GJ1A 3FJLA 4MYXA 4GNJA 1LRTA 4UXDA 4IMCA 4NVTA 4CQAA 1SO3A 1QNVA 2CLMA 3TSBA 5FEWA 2Z6JA 4JX5A 1Q45A 3LCLA 5CZJA 1Q3NA 1FXQA 1GPWA 1FDJA 2ZYFA 2RDWA 3R2GA 4Y8FA 2GVLA 5H91A 1LP6A 1N55A 4PFMA 1TJRA 4HKPA 3TNOA 4FNUA 4UTTA 4UTHA 4LV4A 5G2IA 3ZWTA 3I7SA 1TPH1 4NJIA 5D02A 2QCMA 3A9IA 3MYOA 4GRSA 2O7QA 3L5LA 2P10A 5T26A 4QNWA 3M1ZA 3LXCA 4RXFA 4TO8A 4O1BA 1TREA 3VFLA 3MO7A 2CLOA 4UMCA 4BWLA 3M16A 4O4WA 1PV8A 3ZWSA 1A5AA 1GVSA 1DORA 1NSJA 1UJPA 3T44A 1FQ0A 4DO4A 4NQ1A 2OJPA 3EWXA 3GAYA 3VE9A 4CCDA 3GDTA 3NPVA 5EL1A 4FX8A 5C2XA 4AWSA 4P2VA 2EKCA 3TMLA 1O60A 3DFSA 4PL2A 4X2RA 2Z2UA 2H3DA 1KTBA 4O53A 4AB4A 1YDOA 4AHQA 5D32A 5C54A 2PC4A 1RPXA 1W8SA 1WXJA 3BV4A 1VCGA 2V2DA 3C3NA 2B7QA 2E68A 3A24A 4EWND 3B05A 3LHVA 4LNYA 2YX0A 3QW4B 3GXTA 2ZRWA 4M6VA 5HJLA 1HTIA 3G3MA 3G1SA 2ZZ5A 2VEPA 3V1PA 2QCGA 3HG2A 3M6YA 3TSMA 4OWGA 1S5TA 3PG9A 2EHHA 3NOEA 1R2TA 4GBUA 4GXMA 1T0OA 5F4XA 3W2UA 1EA0A 3ZR4A 3WJZA 2NX1A 2VELA 1FUYA 1ZNNA 3C0JA 2PE4A 2JGYA 5CSSA 2Q3RA 4UTUA 1NF0A 4JS3A 2C6QA 4IGHA 3SGUA 1S3HA 5K9DA 3R5EA 3UWQA 5K7JA 1DHPA 1AMKA 3WJSA 3W84A 5F4SA 4UFIA 2W79A 5LHEA 3NQGA 1X1OA 4IPJA 2C15A 3LCIA 3NO5A 3W2KA 4AF0A 2CFFA 1FWSA 2R14A 4IQLA 3W1XA 4O0ZA 3W07A 4ZMGA 4NUWA 3NR0A 3S0CA 2EPHA 3SSJA 3P61A 5G4EA 1P5BA 1PVNA 2X2GA 3QH2A 4BWLC 3O8AA 2FDSA 5F4WA 2CLEA 1SR9A 3EX4A 4IX0A 3I7QA 2C13A 5CZTA 1I2NA 2B7PA 3YPIA 1L2UA 2XN0A 1T99A 2R91A 1R46A 3N9SA 1KM2A 2DZTA 3RMJA 1MZHA 1RQEA 4JTFA 3TSDA 1GTHA 1OHLA 5AHMA 3G1FA 1MXSA 1GVOA 5D2VA 3LXAA 2QAFA 4NZFA 1NFBA 4DF0A 4NJJA 2VFIA 1AW2A 4LS0A 2V8ZA 2R94A 3MI2A 2DJXA 3W7KA 3HPSA 4GUGA 3LHTA 5C55A 3TE9A 4E0CA 5KTLA 3EWYA 3UZJA 1JCMP 4MLRA 1O5KA 4NNAA 5I3IA 1I2QA 1NF7A 4RLIA 3W7OA 2OZ0A 4YCPA 3NQFA 1VYRA 4A2RA 3NPXA 1O5XA 3BARA 3P81A 3ATZA 1M7PA 1W0MA 2YCEA 3GIYA 1GYLA 1TSIA 1XFBA 2X16A 5BRBA 2DJLA 3W6YA 4I9AA 3B0PA 5A8GA 3TMQA 5C6MA 1PL9A 3USBA 3BO9A 3DZ1A 3PBWA 4BI6A 2GUUA 2P0OA 1IXPA 2CLKA 3W2MA 3H55A 2YYUA 4FB7A 2ZZ3A 1IGSA 2G5WA 1GVQA 2ATMA 3QEZA 5F2IA 4YMZA 1OFAA 3GYEA 4UFJA 1VS1A 1EEPA 1C8VA 2B4GA 3W2JA 1I4NA 4EVZA 1W56A 1ONRA 4YCOA 1PCWA 3BW4A 1BWLA 5FESA 3W73A 3W7MA 4O50A 4LRTA 4N6FA 2NWRA 2QF7A 2W6RA 1MEIA 2NV2A 3DBPA 3SIZA 5HUPA 1LROA 3TU9A 2A1YA 1MO0A 1TPVA 1HFBA 3OEXA 4JX6A 1J4EA 1H1YA 1L6YA 2VFFA 1MSSA 3DHFA 5G5IA 1HO4A 3B8DA 1KM5A 3LERA 4NX5A 4PODA 3NQ2A 1GZGA 3P8JA 1J2WA 3QMTA 3NQ6A 4O8RA 2FLIA 4IMGA 1IF2A 1V5XA 1WX0A 3SZ8A 4WJEA 1X8FA 1KLZA 3KVJA 1LLZA 1TV7A 4IOTA 3FA5A 5FEZA 3ABQA 3C61A 1Q6LA 3QC3A 4IWWA 1N7KA 1LBLA 3BG9A 5D37A 3NQDA 4O14A 4LT9A 1TPB1 5CGQA 5CPOA 4NT0A 3O06A 2I14A 2ISSA 3FIGA 4OE7A 3HGOA 3NVTA 4IMFA 1GG0A 4A2SA 2G97A 4MKNA 4AWTA 3CEPA 2ZRVA 2Q8ZA 1RV8A 5FF0A 1YXCA 5HWNA 3NQ8A 4MY9A 3P74A 2XN1A 4UTLA 2VOMA 1HUVA 4RX0A 5AHFA 2VFHA 1DQXA 1K8XA 1WA3A 2FIQA 1BWKA 1KFKA 1DOSA 1FWNA 5HWMA 4FIQA 3IIXA 2DZPA 1SZEA 4MVAA 3TV8A 4JDBA 4XUGA 2V2CA 1TV8A 1C9DA 4CLMA 1ICQA 2B0MA 4JX4A 3FFSA 3WK1A 3MHGA 2X30A 1RZMA 4JTUA 3N3MA 2YDAA 4GUFA 4LUIA 3VE7A 3GR8A 3NGJA 3T4CA 3GVGA 2YZRA 1WDWA 5C5YA 1DKWA 3OVRA 2VEIA 3W86A 1VJIA 3SY5A 2HSAA 4QITA 1FY6A 4XTIA 5D09A 5D04C 2QCLA 4LRSA 3LHYA 1ZAJA 3CM4A 3LX9A 4OHQA 5CG7A 3L0GA 4MZ1A 1QOQA 2HMCA 3B0VC 2H90A 1WAUA 4QISA 1PCKA 1O95A 1C29A 4E2DA 5E1QA 4LWWA 1SO5A 4AXKA 4GC4A 2I9EA 4IPIA 1VZWA 4HPJA 3GNDA 3W7PA 2Y7FA 3DFQA 3W2LA 1QOPA 3GAKA 1BTMA 3C6CA 4C1LA 4O11A 4BI5A 4A22A 3ELFA 3M9YA 5F1VA 2Z1BA 3NG3A 1E51A 4JNMA 2ZDRA 1KBJA 3LCWA 5AHLA 2ZZ1A 2J9XA 3W3OA 5K4ZA 2Y62A 3ABRA 5I3GA 1JVNA 2F84A 2Z6IA 4JIPA 4A21A 3DHDA 3W71A 3TFCA 1ZAIA 3DGRA 3HB9A 4JTJA 3UXAA 1FCBA 4LC8A 1H7RA 1ZALA 1OYCA 4Y6GA 3D0CA 1Y0EA 4AMAA 4DXVA 3L9CA 5D2WA 2ABBA 4OV4A 2WJZA 4S2BA 5HNRA 1GG1A 2A7RA 1OYAA 2FFCA 2ISWA 3C52A 3BG5A 3LM7A 1FX6A 3G0SA 3HMJG 3LOTA 3DFPA 4CNPA 1TQJA 1WV2A 2E5DA 1KM6A 5H2ZA 3Q94A 4WOZA 1W5OA 1WBHA 1Z41A 4W9TA 3WJXA 2ZRXA 1A53A 4WOQA 3RLVA 2XN2A 3LI0A 1CW2A 3TJXA 4WXYA 3TAOA 5HWJA 1A5CA 3CT7A 2VFGA 3C2EA 1QR7A 3PSVA 1K02A 3UWUA 1Q6OA 4TX9A 1THFD 2HTMA 5BOOA 2JGQA 2YFNA 3R89A 5LNSA 2E77A 4QNEA 4UR8A 1IXQA 3STEA 3W7JA 4TU1A 5LNUA 5AYXA 5EY5A 3IRDA 4Q4KA 1ZFJA 2WSQA 1VC4A 4K7VA 1LDCA 1H1ZA 3A22A 4H3DA 1TB3A 3W83A 1AK5A 3W1QA 3N34A 4JTLA 1YXYA 3P67A 1XBXA 4B5NA 3GDMA 4XBSA 3FYOA 3BW3A 2TRSA 4WY0F 1AW5A 2QJIA 1OFBA 5DBTA 4X3ZA 5SWUA 3E12A 4NX0A 1JCYA 5KZEA 4O17A 4OBTA 5LHFA 4MUZA 1G4PA 2FPYA 1VLWA 4N9EA 1TTJA 2NUXA 2V81A 4C1KA 5EA9A 2GQ8A 5G4WA 1W37A 2QUTA 1KM1A 2ISVA 2VXNA 2C0AA 5U7SA 2QJGA 3UD6A 1OF6A 2FTPA 3O6CA 4LW7A 4P61A 1U83A 3GR7A 3G1DA 2V2HA 3G0XA 1ICPA 1GQNA 4JTKA 1TTQA 5DCBA 2G95A 5EKYA 5BNKA 2WO5A 3CIXA 1X1ZA 1O4UA 5LGZA 3H54A 4Y96A 1XDMA 1VCVA 4MLJA 4G1KA 3ANYA 2V82A 1W5QA 2ZTJA 1XCFA 4ZQCA 4XKYA 1ZAHA 2RKXA 1XUUA 1TQXA 1EWEA 5DN1A 1WBJA 3FOKA 3SFKA 1A5SA 1SQ7A 3EKLA 3S6DA 1W54A 4CQ8A 3MMTA 4JYEA 3S1UA 2GVJA 3QM3A 2OT1A 4UTTC 3W7LA 5FF7A 5E0KA 3FYPA 2YGYA 3EX6A 2VKZG 3G18A 4O18A 1G6CA 1F6KA 1NEYA 3C4UA 3S1VA 2CLHA 3AJXA 2Y6ZA 2H8XA 1FDZA 2YPIA 1PS9A 2YW4A 4M6QA 3EWWA 3NEVA 3T55A 3N2MA 4CCEA 1B4KA 1VYSX 3IIVA 3QSTA 3W9ZA 1KM3A 4NXSA 3WK2A 2WKJA 1EP1A 2X1SA 5I3KA 3QPYA 2UV8G 2DZWA 4H4IA 3NXFA 4Y90A 3W70A 4Z08A 1F6PA 3C56A 1TPFA 1VPXA 3IVTA 4JDYA 2QCCA 5F1UA 3R12A 1SO4A 3ABSA 2RDUA 4O54A 1IXOA 3C2OA 3HOJA 4OGZA 3W1RA 4DPQA 2E5CA 3Q2DA 4DQWA 2NZLA 1I45A 3A23A 3MWAA 4JEQA 3EWUA 3LTPA 5HUOA 4FX6M 1LM1A 4YLWA 3C2RA 4HSNA 2RHGA 2VENA 1KBIA 3NM3A 3HF3A 3PG8A 3TJLA 2CLIA 1TPDA 2NXGA 5K2ZA 3KHJA 3W74A 1AL8A 5CSRA 1ZCOA 3CEUA 3VCRA 3BW2A 3MBDA 2QDGA 2QCNA 1YTKA 3L0KA 3B4UA 5HINA 4YWIA 3QZEA 5AB3A 2WV8A 5LNRA 3EX2A 5I3JA 3L0NA 3W85A 2JBMA 3OBKA 3P82A 1W1ZA 2NWSA 1P1XA 3W1AA 3HGJA 3LHUA 1VR6A 5FEXA 1V7YA 1R2SA 4LUJA 2ZZ6A 1SSGA 4O10A 2EF9A 4JTSA 1I8JA 2JK2A 2WNNA 3HGSA 2BWGA 3IIPA 3PBVA 2NXIA 5FI8A 1NVMA 4GE8A 5IBXC 4K7YA 4O16A 2ZA1A 3TK7A 3NDOA 1H7PA 1F2JA 1K03A 1Z44A 1Q6RA 4YL2A 1EX5A 4IMDA 4LVAA 3BLFA 5D2XA 3LGEA 5I3HA 3W7RA 2ZA3A 4UFHA 4I7WA 3ABOA 3RK8A 2E1DA 1GOXA 3CLMA 1MEWA 3L5MA 3MYPA 1JCXA 1QMLA 4IUOA 5DCEA 3TX9A 3HO8A 3T7VA 3UYCA 4WX2A 1EIXA 1W5NA 3STGA 2WNQA 2A4AA 1VLIA 3NL3A 3LRKA 2OMAA 2DZUA 4JTTA 1OABA 4EF9A 5F2MA 1K8ZA 5AN7A 4UFKA 2A85A 2ZRYA 1SZNA 1GYNA 1M6JA 4S2CA 3E96A 1DJQA 3DKLA 1OFRA 2C1HA 4WXZA 4O28A 5D30A 3L5AA 3HGRA 3P62A 3HBLA 1SO6A 5D2YA 3HJZA 3STCA 1KM4A 5FF4A 5CZ0A 5HULA 2VFDA 3W2NA 2PURA 3O63A 4FNRA 2PCQA 2C3ZA 3TDFA 5TBOA 5KSWA 1JQVA 4JXCA 5LZLA 3VNDA 2A0NA 2QUVA 3WFAA 3M41A 4EOUA 3MJYA 4QJ1A 1K7XA 2A5HA 4ML9A 4QAIA 4OV9A 3CWOX 1L9WA 1H5YA 1SFLA 3S42A 1K8YA 1DQWA 1KV8A 1D3GA 3AO0A 3LB0A 1S5WA 4ZZ9A 5D03A 5J5DA 4JTGA 2VFEA 3NQEA 1OX6A 1RQBA 4O12A 3QF0A 4N2YA 1JRBA 3G0UA 2GJNA 3QFEA 3W1LA 1YDNA 5DXXA 1OK4A 3L68A 4KWVA 3MBFA 4Q32A 4WQ6A 2VEMA 3TAKA 3NYZA 3B03A 5LKYA 1RD5A 2YFOA 1W3TA 1FWWA 3P80A 4NNBA 1QFEA 4RCXA 2NUYA 1G4SA 1HL2A 1K3UA 5LSMA 4FXSA 3UWZA 3P60A 2E5BA 4XZ9A 3PBYA 3P5YA 4POCA 2R8WA 2QCFA 5G1TA 1VQTA 1H61A 2Y7EA 1ZJIA 3P7YA 3TUUA 3A5VA 1JR1A 4NU7A 3W23A 1YPIA 4MJMA 1TIMA 5KZDA 3RLUA 4XWUA 2C16A 4ADSA 4XBKA 5AC8A 4KKXA 1XBYA 2GOUA 3UWWA 3G24A 5HR7A 4S1FA 3W1TA 1QPRA 4JICA 3H53A 3W1UA 1QO5A 3RU6A 4MZ8A 3NL2A 1FCUA 3L67A 4MZYA 4Z1CA 2ALDA 2C18A 3HIJA 3E02A 2X1RA 2BXVA 2J24A 1F5ZA 1R2RA 2JKAA 3PM6A 1OVDA 2QUUA 4DBDA 4N6EA 4O1DA 1DL3A 2OCZA 1JUKA 1WOBA 2JKEA 3QSRA 3T40A 2RDTA 3M0ZA 1OFPA 6TIMA 1JCNA 3BVJA 2J9YA 1XL9A 3RF9A 5FEPA 3E49A 3EWBX 2H3BA 2FJKA 4JGDA 4U28A 5HQEA 1YTEA 5K9CA 3TCEA 3FEMA 3EXRA 3HG4A 1EB3A 1H60A 1IIHA 3FJ6A 3NPUA 2ZCGA 3B06A 3NL5A 4QSHA 3CU2A 3CHVA 5LGXA 3N14A 3IV3A 2V9DA 3GNNA 4DF2A 4KFOA 3IIZA 4ICNA 2YYTA 1LCOA 4TMCA 2PRLA 2GPTA 3EWZA 1XBVA 1ME7A 2GVGA 4MYAA 2DU2A 1A50A 2RFGA 1H50A 3W22A 2J27A 1SW0A 2HS8A 1H63A 4XTDA 4RZ5A 1SZFA 3TC7A 1ICSA 1OF8A 3W76A 5KITA 1UBSA 3R13A 3THAA 2WOQA 4UTWA 3DI0A 1OX4A 2V0TA 1OX4B 1PIIA 1DVJA 3KRSA 4GUJA 1YLVA 3Q58A 5AC7A 4JTIA 1B3OA 3GXPA 4UFMA 3S8HA 2I1OA 1YTDA 1LOLA 3STFA 1F76A 1OX5A 3HG5A 2WSRA 3DFNA 5AYZA 1M7OA 2ZQ0A 2DZVA 3K30A 3NQ7A 1A5BA 4HT3A 3EXTA 4MPQA 3GDKA 1HG3A 3LBMA 3MW7A 1HO1A 3O6DA 1OFQA 2FB2A 1QPOA 4JIQA 1P0KA 2A6LA 3IGSA 3TQVA 2ZBTA 2WPBA 3NQCA 1UB3A 5KMYA 3FKKA 3LDVA 3TXVA 3KVLA 2CZFA 5D05A 2CWNA 4DF1A 3LLDA 1VHNA 2RH9A 1BKSA 4D2JA 1TRIA 1EUAA 3TW6A 3W7GA 4N4QA 1KV5A 3SW6A 2Z0IA 3W7NA 3FKRA 4N02A 4RK8A 1TMHA 3LCGA 1B9BA 1PHWA 2O7SA 6ALDA 2NV1A 3VKJA 2BLEA 5AHIA 4WUIA 4JYFA 2GQ9A 2ZRZA 1EPXA 4PTNA 3W1NA 4FEZA 1SW3A 5K9XA 4QM1A 1TPUA 2CZEA 2G96A 3LLFA 1VHCA 5EYWA 1OFEA 5K4XA 1ALDA 4GWEA 1GWJA 5K3VA 1QDSA 4M19A 1RR2A 1N8FA 1P4CA 1AG1O 4UTKA 4MOZA 4UTWC 5D2TA 1UUOA 5DBUA 3PSWA 4PH6A 1FXPA 1EP2A 3BK0A 1TYGA 4UIOA 1WOAA 4H6KA 3ZS4A 2NXHA 3KVKA 4NZJA 2YXGA 3PC0A 2VEKA 1ZY9A 3I68A 3W75A 1DV7A 2E6YA 4NJHA 5F2GA 1W3IA 4RZ6A 5DXYA 4Z0SA 4RR4A 1TO3A 3M5ZA 2NX3A 1G7VA 7TIMA 2FPTA 3N9RA 3GDLA 1MEHA 3LHZA 3TQKA 3W7CA 4WY0A 4AVFA 3DFOA 2OX1A 3MI3A 3KRZA 4O52A 5HMSA 3LCHA
chains in the Genus database with same CATH superfamily
3BJSA 1EJTC 4M7TA 2QJJA 2INFA 1P1MA 1PX3A 4UQDA 3MJMA 5BMWA 1AQ0A 1JZ3A 1DJNA 1RA0A 3HU7A 3PY2A 3EDEA 4RKAA 1QPNA 4HNTA 1VFFA 2POZA 4HCDA 1UKOA 4UOZA 4AF0B 1CB2A 3ZJKA 3CL7A 3B9DA 2OYLA 1PKNA 4N9DA 1W17A 2WWCA 3CAVA 4GUIA 1TV2A 5G2WA 3INPA 4XVDA 1E1CB 3VIKA 1XLBA 3UJ2A 3MHUA 1PZ2A 3GVVA 2FFIA 5I07A 3P3BA 3PWIA 3VNKA 3B0UX 4ZE5A 1HZYA 5CGTA 2Q01A 1I75A 3TYDA 1ODUA 2FZNA 4MFDA 1JF6A 4RZ4A 1RLDA 1E40A 3IIOA 3LHWA 1TTPA 2C79A 1UR4A 1IT8A 1UR9A 1V3MA 3TA9A 3UQNA 4JD4A 3ID7A 4XO7A 1A49A 1RCOB 3M5YA 3CIWA 1JFHA 5ABTA 3BOLA 3TA6A 3PJTA 1R3YA 4E2BA 3S5NA 4K39A 3G1AA 4IXXA 3W88A 1E1EA 3QN3A 1KGWA 1RK6A 1NOWA 1V02E 3QGKC 4Q7NA 4LEFA 1FH9A 3GTNA 2YA0A 4D6CA 1L8PA 2F61A 3IGXA 4H83A 3E0WA 1W6TA 4CVUA 3P84A 4FXRA 4AEOA 2NQHA 3TYCA 3IUDA 2DUAA 3QFWA 3OZOA 2D69A 1OD0A 4L9XA 1CXEA 1GKPA 1XDLA 2I5IA 2BGQA 1S5VA 4KRZA 5E6ZA 3DYMA 1YKWA 4D1JA 3VOCA 2Z2BA 1P48A 3OA3A 4O13A 5GVJA 1GT8A 3G1YA 5IFTA 4KFPA 4Q33A 4S3DA 2RGLA 1QUMA 1EJWC 1LBMA 4HSOA 3SUSA 3G2GA 4QP0A 3LA4A 3G3DA 3W7HA 4NRSA 4PA8A 3CC1A 1D3HA 3M5VA 3I65A 1GKQA 4HK7A 3WF4A 1ME9A 1TPWA 1R9YA 1ECQA 3NA8A 1WKEA 4PGLA 1EUNA 1IEXA 3QV9A 4W85A 4HNVA 3H23A 3PPCA 3QKEA 4N9CA 1JXKA 1PTGA 3GBDA 4XAGA 3S1WA 2IPGA 3U48A 3SAZA 3O16A 1CGWA 1F7BA 3OJGA 1VKFA 3T6CA 3S9IA 4DJEA 5BXPA 1IXNA 3OHIA 2Y5JA 4UWMA 2GK1A 1XM3A 2V30A 1Q2SA 2REQB 3U5YA 1SZGA 1X96A 3F1QA 4PULA 1W31A 1S5MA 4ROPA 4S3JA 1US3A 3GIPA 3OU8A 5TQLA 1OC7A 4ZBCA 2QJHA 2FQIA 3H70A 4AD3A 1QHZA 2QPSA 1MVYA 2AAMA 3N73A 1QO2A 3VD9A 3FAWA 1VF8A 1XLJA 2NX9A 4Z1DA 1KTCA 3DKJA 3M7WA 1Q7MA 4A35A 1E6ZA 1WYIA 1C8XA 1ZPTA 4MHBA 2W27A 5BRQA 4EPEC 3G22A 4HA4A 2KZHA 1ZCCA 1OYBA 4KEMA 4QCEA 2W0UA 4O57A 4FA3A 3GDBA 3PZMA 4TIMA 3O3RA 1JD9A 4P7LA 4RNIA 1HX0A 1UPPA 3UA4A 2UY4A 3NURA 2ISDA 3W02A 3VMPA 4V2XA 3RX2A 3WMLA 4X0VA 2AGKA 3PUDA 1MXGA 3WF2A 1J6PA 3V18A 4K8GA 3MP5A 5AYBA 2FVMA 1LRNA 2R9RA 3N9KA 4KBXA 4KERA 3EAUA 4M82A 3UZYA 3U6WA 1BTCA 5AZ1A 3O6YX 3WEOA 1M9HA 4GFIA 4LVGA 3CNYA 4NXKA 4MJZA 5A8PA 4DJEC 4D6DA 4F0HA 2HJPA 2DORA 5G2HA 2PPGA 4UZSA 3UPBA 4ADTA 4K8EA 1M68A 2DVXA 4W88A 4AIEA 3S6OA 4NNCA 1GEQA 4OBRA 4YYFA 3W29A 3NQVA 4UNLA 5FF3A 4NP7A 2WVUA 2MNRA 3MCMA 4Q4MA 4W89A 1TV5A 3VNZA 3W4RA 4FX7A 3S4TA 2OZ8A 2WCSA 3TQ0A 5CC7A 4U4MA 2B7OA 4ZO7A 1OC5A 4JNZA 2ONEA 3TXZA 2QDHA 4MIMA 1F6YA 3QQ0A 5DELA 2VGIA 3LM3A 2HVNA 2PTYA 3TKFA 3U4AA 1X6UA 3UWVA 4C6MA 4NAEA 4C6QA 4HCHA 3DC8A 3A13A 3O1NA 4FXJA 1PB0A 2IKJA 3HQ1A 1WDPA 3EKGA 4RDVA 4MY8A 4V27A 3E0IA 2EG7A 3NNTA 2E09A 4GCXA 4RV8A 2WZEA 3UWYA 3GHUA 2VR2A 3GKAA 2DT2A 4AZHA 1H09A 3UR2A 4UTJA 1PPIA 2NV9A 3KRUA 5CPNA 1E9ZB 1M5WA 4KW2A 1LTDA 3TCSA 5DMMA 2CLFA 3RRXA 2C14A 3OBEA 1OQFA 4ONVA 2BTMA 2BMBA 3BUVA 5CPMA 3CAQA 1S2VA 4ZQNA 2FB3A 1B1YA 4QEHA 1KWGA 1KNWA 5AHNA 3KBMA 4IX2A 3TIMA 2Y4SA 2E6FA 4C5ZA 2J7GA 3B3DA 1REQA 5MKGB 5HDRA 4RE4A 3CZJA 1UKPA 1HF6A 1AUSL 4R53A 3FAXA 3A21A 4B90A 2WSPA 3S5YA 1V02A 2PDMA 2IS7A 4JTDA 2QMJA 1M01A 4C1NA 3WFZA 1PDYA 3C0SA 2V5BA 1CGYA 1Q8JA 4P7NA 4MFEA 2QYGA 3CASA 1VGAA 3EYPA 4WDUA 4LAOA 3QQWA 1AD1A 4GH3A 1Q5MA 4LQ1A 4I6KA 3W1MA 5CZSA 2GQAA 1KTNA 4TVCA 2O56A 3C0QA 1JEZA 3VGFA 3RLGA 1GQIA 4N9BA 1VB9A 4KEZA 3NO3A 4J3SA 2GLKA 4OT7A 1EIBA 4WD0A 4UCGA 2CZ5A 4DB7A 1AJ2A 3UR5A 2PTWA 5DRCA 4J28A 3HPZA 5D33A 3I3BA 3FY1A 1BKHA 3TC3A 3DG3A 1QU4A 4XSMA 6CGTA 2C71A 4OTKA 4H6EA 1FKXA 3LXBA 4US5A 3W7EA 4OU1A 3GVRA 3MV11 2PF8A 5A6TC 2PDWA 4DZAA 4WLCA 2OOFA 3TTSA 2WMKA 3U8GA 4LU0A 2P53A 4EK7A 1KB3A 4A8NA 3PS7A 2P3ZA 5JH1A 3E9AA 4KQNA 1EOMA 1RY8A 3Q67A 2D73A 2WHMA 3PB2A 1UWTA 2ZE0A 1QXLA 4DJDA 3CPRA 4DN1A 1LZOA 4PMYA 3S3GA 1J8VA 1LYXA 3E1F1 4FNQA 1NDZA 5F2LA 2EJ1A 3FJLA 1U1UA 1XLIA 2W92A 3EOUA 1UD4A 3TVAA 3ITCA 3QVQA 1UKSA 2YZ5A 1Q3NA 4MADA 4ACYA 1GPWA 5A69A 1R7AA 5GJMA 1N55A 2WWDA 2YL8A 4L61A 2VCCA 3TNOA 4FNUA 4ZO9A 4LV4A 3I7SA 3HN3A 1RP9A 2PAJA 4YWSA 1M7XA 3RPMA 4JL2A 2GDVA 4Q8PA 2FMOA 3MO7A 1R0MA 3ITVA 1MW1A 3WQ4A 2VQUA 3ZWSA 2Q6ZA 4MKVA 1NSJA 1UJPA 4RW3A 4NQ1A 2OJPA 1QNOA 1RLCL 3GAYA 3VE9A 3VMOA 3GDTA 5E70A 4ERGA 5EL1A 4PSPA 5HMEA 4GG9A 4P2VA 2CLPA 2F2HA 3HURA 4PL2A 1XD1A 1DXFA 2H3DA 4Z2LA 3T05A 1UWIA 1RPXA 1WXJA 3AZTA 2YCKX 4BZYA 2B7QA 4EWND 1X6LA 1UYQA 3B9EA 4XK2A 2YX0A 3UCDA 1KRMA 3KWSA 4M6VA 1HTIA 3G3MA 3PBGA 4HU3A 3AHYA 4BF5A 2Z24A 3PTKA 2DUXA 3O0FA 2EHHA 3I4KA 5F4XA 3HQNA 1UD5A 3W2UA 2WPGA 1EA0A 3WNKA 4G5DA 3SRHA 2VELA 1FUYA 2PDNA 3K1GA 1IZKA 3R0DA 2ZX8A 3KOWA 2O9OA 1AH3A 4IGHA 4GZ7A 3SGUA 3FV9A 3UWQA 1ZP3A 5K7JA 4IJCA 3W84A 5LHEA 1O68A 2PDXA 4QE5A 3NO5A 2Q8XA 2PDGA 2VCBA 2GYIA 4DO7A 1JAEA 2R14A 3KDNA 3NR0A 3GTIA 1XG4A 2J7EA 4W8LA 3SSJA 3P61A 5G4EA 1P5BA 4CUCA 1JZ5A 5F4WA 2CLEA 5FAJA 3EX4A 3KBNA 4MMWA 4Y9OA 3NDZA 2VT0A 1L2UA 4IISA 1WNOA 2XYLA 1R46A 2WZTA 2WHLA 4HYWA 2J7HA 1RQEA 1DWIM 4JTFA 1OHLA 5AHMA 3B0YA 5D2VA 4R9XA 4AZIA 2CWXA 2Z25A 3EPOA 5C70A 3UGRA 4G7EB 3D6NA 1QK0A 2V8ZA 4XB3A 2R94A 1VAHA 4GUGA 3LHTA 3TE9A 4RE2A 4MLRA 1O5KA 2E25A 4NNAA 4AZCA 4R88A 4GY1A 5FJPA 2OZ0A 3A64A 5REQB 3NPXA 5BWFA 3E6EA 1M7PA 1W0MA 2YCEA 1J18A 4B5XA 2R1KA 2Z27A 4LYQA 4CD4A 1XFBA 4M1BA 1DWFM 3W6YA 1PWLA 4H2HA 1XLMA 5C6MA 4LAUA 1PL9A 4KRTA 3BO9A 3IUHA 2W61A 3VC6A 1TMLA 1IGSA 2XDFA 1W8GA 5F2IA 3GYEA 4BQ5A 3LENA 3ABXA 3BW4A 1U1JA 4LY4A 2GUYA 3AIUA 3B97A 4N6FA 4TTUA 2NWRA 3T09A 2QF7A 2W6RA 3DN5A 1MEIA 3TW9A 3SIZA 1F3WA 1LROA 2V68A 4NL1A 4X2PA 2CKRA 4QQUA 1L6YA 1TWDA 2PP3A 2VFFA 3DHFA 4M81A 2WW5A 4NX5A 1GVEA 4XD5A 2Y8UA 4GX9A 3RCYA 1V5XA 1X8FA 1KLZA 3KVJA 1TV7A 2PCEA 1OCBA 3C61A 5I5RA 1L2QA 1LBLA 3BG9A 2DSVA 1EXBA 1XYLA 3R0UA 5CPOA 1RY0A 2QIIA 1X39A 1UQYA 4Q3MA 1CDGA 2QGHA 1EKOA 3BMVA 2AAAA 4ZTXA 2VDIA 2WNWA 1C9WA 2VL4A 3CEPA 1K9DA 1RV8A 2WCGA 3F4DA 5AHFA 1HUVA 3E74A 4RX0A 1U30A 2FIQA 1BWKA 2FHBA 4DLFA 1FWNA 3A3XA 4FIQA 1TX2A 3IIXA 2DZPA 4MVAA 4XV0A 1EGMA 1ICQA 3FFSA 1KD0A 3WK1A 3N12A 4PMZA 3N3MA 1WXZA 5HOSA 1I1WA 4LUIA 3GR8A 3NGJA 2QQ6A 1YE4A 3R0KA 5C5YA 4K2SA 3OVRA 1VJIA 4CEUC 4QITA 4XTIA 5D09A 4IGNA 5D04C 5ABEA 4K68A 2A3AA 2GGGA 1VFLA 4MZ1A 1QOQA 3KBSA 4HZ6A 3E0VA 3VKCA 1NY1A 1UR2A 4OFCA 1V93A 4AXKA 4GC4A 3NEHA 3USZA 3W7PA 2GOKA 4GGHA 3DFQA 3W2LA 4C7FA 1FFRA 4BI5A 4L4PA 4A22A 1B9ZA 2PDPA 4QJ4B 2FDMA 2Z1BA 3NG3A 3LCWA 4MB1A 4AZ6A 3KBWA 1JVNA 4XX6A 4A21A 3G6MA 3VA8A 3DHDA 3TFCA 3QLLA 3DGRA 6REQB 3WCZA 1O66A 1I0BA 4NZ3A 1FCBA 3VNYA 2VDGA 4WDXA 1OYCA 2CBIA 1Y0EA 4EPDC 2DZBA 3L9CA 5D2WA 4C6OA 4S2BA 5HNRA 2A7RA 4QE1A 3W26A 2PC8A 3DG6A 3HMJG 3LOTA 4CNPA 2NVCA 4YNGA 1ZU8A 5H2ZA 1NELA 3OLGA 4GI4A 2R6OA 2PDBA 4W9TA 3LY0A 3VIGA 3RLVA 5JIPA 1P7TA 2HK0A 3V3WA 2VFGA 3C2EA 3OYZA 3VUSA 4OZOA 1W1B1 3H26A 4HMEA 1VFUA 2HTMA 3GVWA 4HHHA 3SQMA 4FS9A 4M51A 4UR8A 1IXQA 3STEA 3W7JA 4BY3A 3M0IA 4XVEA 2X41A 1LDCA 1H1ZA 3W83A 3WH9A 3CZGA 3SN4A 4JTLA 3EMQA 2VVSA 3P67A 4M0XA 4C7GA 1DHKA 5LXEA 3MDWA 3BW3A 3QV8A 4WY0F 3GFXA 1BGGA 3E12A 4O17A 5LHFA 2FPYA 2D20A 1TTJA 3GG8A 1SZRA 5EA9A 4DUWA 1T8QA 2ISVA 2VXNA 1JAKA 3T9PA 1DE5A 1JYVA 2AKMA 2QJGA 1AZ1A 3GHSA 3G1DA 1RBLA 3PJXA 1YQ2A 4PB4A 5A1AA 4X0NA 1POJA 2G95A 2WO5A 1X1ZA 1O4UA 3S2NA 3H54A 2J7BA 4RPPA 4G1KA 2V82A 4U2YA 2ZTJA 3CUGA 1O6IA 3OA5A 1ZAHA 1XUUA 4XAZA 1M3UA 5DN1A 3SFKA 1W54A 4JYEA 3U2ZA 2EKGA 4S3FA 2GVJA 3ITGA 4D72A 1W91A 1S46A 2PU0A 4UTTC 1BQCA 2O9RA 1E4MM 2OWWA 3RRAA 1F6KA 1S1PA 2BB0A 3EPNA 3S1VA 3AJXA 2Y6ZA 3HPAA 5D9OA 1FDZA 3P0XA 2YW4A 4M6QA 3T55A 3N2MA 2OTDA 1B4KA 1VYSX 4JN7A 1OIMA 1EP1A 4Q8OA 2QGYA 4FOJA 3QPYA 4HPHA 3UG5A 1E6PA 2VDHA 1XGEA 1X6NA 3KCJA 3MKKA 1EJ7L 2VEGA 3UBPC 2E9BA 1F6PA 1M41A 4C7DA 3WQDA 1TPFA 5F1UA 1K6AA 3R12A 3ABSA 1XQKA 1IXOA 1VBUA 3UESA 1PUDA 4DPQA 4LFYA 2E5CA 2DSWA 3Q65A 3Q2DA 2FJUB 1XIMA 2PTXA 5HUOA 4FX6M 3FHAA 2NQJA 4E8DA 5GNYA 3KS6A 2D2OA 3VPLA 2VENA 2ZUVA 2FZ9A 3TJLA 1V6YA 3LEPA 5K2ZA 4C6JA 1AL8A 5CSRA 4LAMA 2PBGA 4PCSA 2QDGA 1XLEA 3O2LA 4QDMA 5AB3A 1JZ6A 2QDDA 3EX2A 4NILA 3L0NA 3VIHA 1PX8A 3P82A 1W1ZA 2D3NA 3B8TA 1EQPA 3W1AA 3MUIA 3HGJA 1Z6KA 3GU1A 1SSGA 4PRRA 4D6EA 2HRWA 1L6FA 3IIPA 5T91A 5FI8A 3LQGA 1HNYA 3LU2A 3LSBA 3VOFA 4YL2A 5D2XA 3BAYA 3LGEA 3VXGA 2B31A 2E1DA 3R7MA 3VD5A 4M8UA 3HO8A 4Q4PA 3UYCA 4KCWA 1W5NA 1W3JA 3S9ZA 4HA0A 3NL3A 2AL2B 2OMAA 3VCCA 7XIMA 4W4QA 4BCEA 1BHGA 4EF9A 2V3DA 3URAA 4DI9A 2BHZA 5DRIA 1CECA 2A85A 2ZRYA 3WLNA 4S2CA 3DKLA 2F6UA 2GSEA 4ROQA 3N6HA 1MRAA 2AOSA 1A0DA 2XU2A 1XRTA 2FZDA 3HGRA 3HBLA 5D2YA 2NQLA 4L7ZA 4JIHA 1SYTA 3TDFA 3Q4DA 1JQVA 2WB5A 4JXCA 1UP3A 1I60A 1K7XA 1Q4WA 3GHRA 1H5YA 1SFLA 2X0HA 1K8YA 1KV8A 4FF5A 3AO0A 1S5WA 3BZGA 4RZBA 1B54A 3TEVA 2W67A 4JTGA 1E0XA 1JZ2A 3WF1A 3NQEA 3H2MA 5I79A 4N2YA 2IXVA 3APTA 3G0UA 5I7GA 2PDIA 2WLYA 1EQCA 3IJDA 2WVSA 3RO8A 4Q32A 1TR9A 2VEMA 3NSMA 4QJ3B 2YFOA 3T07A 4NNBA 4URIA 4HHMA 4RCXA 5GJNA 2NUYA 4PUMA 1LF1A 3L4UA 4BHYA 4W5UA 3PBYA 4FP1A 1PKMA 2NLYA 3PJWA 1A3XA 1R8LA 3P5YA 4NY2A 1LWHA 3AOFA 1XD0A 3C0LA 5EFDA 2XVGA 4KPLA 1JR1A 3GH4A 4MJMA 3RLUA 2HWGA 4ADSA 1MW0A 1XBYA 3I10A 3JZEA 1HKWA 2W3ZA 4S1FA 3AIRA 1QPRA 3AHZA 4JICA 1IWAA 3W1UA 4AZBA 3NL2A 4MZYA 2C18A 3HIJA 2G3FA 1TE1A 2XH0A 5EBAA 4WR3A 4Q8WA 1F5ZA 1PEZA 2JKAA 1D7FA 1OVDA 3IJ7A 2QUUA 1DL3A 2OCZA 4D8ZA 2WKLA 2RDTA 3WNOA 3M0ZA 2ACUA 3SCPA 6TIMA 4M1RA 3BVJA 2J9YA 4DJFD 1QNQA 2WM1A 3SCOA 3FVDA 1LWJA 4Q4OA 5I23A 1G01A 3TJ4A 4CCZA 4MKSA 3SM0A 4U28A 3BSHA 2E0PA 1EF3A 3EXRA 3TYUA 4ZTYA 3WDHA 1H60A 4YS1A 3NPUA 5CH9A 4IP7A 3WMSA 4DVOA 3KTSA 2EG8A 2YB1A 3MMUA 2WJFA 1RH9A 3QXBA 4TMCA 3DYOA 4HD5A 2W4XA 3ECQA 4DUVA 1P6WA 1XBVA 3PZVA 1ME7A 3S5SA 1A50A 2RFGA 5GPRA 2PWDA 3RU8X 2J27A 1SW0A 3KP1A 1UG6A 3MUY1 3WQ8A 2Y24A 3SCTA 4AZGA 1SZFA 5AKQA 1OF8A 3VNIA 3W76A 4J2PA 3XISA 1R3TA 1XIEA 4DLMA 2ZC1A 2WOQA 4IT1A 4GKTA 5E0FA 4PMQA 4UZUA 4DAFA 3AQUA 1MW3A 4F0LA 3VMNA 1DVJA 5JVLA 2DIKA 1B3OA 3H4XA 1IV8A 4MB3A 3H12A 4AU0A 4JFTA 1UWAA 1E43A 1K1DA 2Y0FA 2DZVA 1UWUA 4HT3A 3OW1A 4L1WA 2EPOA 8XIAA 4BEQA 4IF2A 4B9YA 1UPMB 1QPOA 4PBGA 2DVTA 4LBSA 2PA6A 3IARA 2WPBA 4AXNA 3FKKA 3LDVA 2Z1SA 4HNCA 1OCJA 3TOPA 4ZE4A 2CZFA 4Q4SA 5I2UA 4W87A 2CWNA 4DF1A 1VHNA 3UXIA 3STPA 4JKMA 1EUAA 3TW6A 1V7AA 1V3JA 2FTYA 2Z1KA 3W7NA 4RK8A 2XH2A 1JZ4A 4AYGA 2O7SA 4D8LA 2NV1A 2BLEA 2X42A 4QS6A 2OXNA 5DQPA 1NH6A 5H6HA 1EPXA 1ZJHA 3PTQA 5TF0A 4PTNA 3N6QA 2ZICA 1T7LA 4EXAA 5H8UA 2YLLA 4PTXA 5EYWA 1GPFA 3PZTA 1E0WA 4CEXC 2PLCA 4PUDA 1QDSA 3VKBA 1N8FA 4AUBA 4HSHA 4Z2KA 4MOZA 5D2TA 3TN6A 3PSWA 4PH6A 1FXPA 2D3LA 1TYGA 4GZIA 1BXNA 1I0DA 1WOAA 3O9NA 5DEZA 1KQYA 2VEKA 3RITA 3UZWA 2X0YA 3I68A 4KWUA 4OKDA 1JGIA 4HHLA 4FI4A 1DV7A 1T40A 2WMJA 4H9MA 2V63A 1KXVA 4LH8A 3B8SA 4WF7A 1G7VA 3AHTA 1RXOB 4GYFA 3GFYA 4FK9A 3GDLA 3TQKA 3TYBA 1QNPA 3LQLA 3W7CA 4AVFA 4L6OA 2OX1A 3TNBA 3SN1A 3NPWA 4UTMA 3THQA 4EIVA 2PFHA 3GXDA 3AHXA 5CJMA 3NAVA 4TR9A 1X7FA 1YYAA 2BZNA 5ABHA 1B3WA 1DJIA 1W3LA 1EWDA 3IGHX 1XI3A 1DEDA 1JZ8A 2PP1A 3AS0A 4IFRA 2WMGA 3T2PA 1C8YA 3GZ3A 5L6UA 3S2JA 4RXGA 4Y7EA 1R86A 1OIFA 1VBHA 3EOEA 4V28A 1P6BA 4GO9A 1S3TC 4A3UA 4C90A 4H19A 4LUTA 3ES7A 3SUWA 5KZMA 1FA2A 3H7UA 3AC0A 5CBJA 3UJEA 1KRAC 1F9CA 2RUSA 5I09A 3KXQA 3PJUA 4BF7A 1C92A 1CX9A 4ZQRA 4C6KA 3TH6A 4IJBA 3IEBA 1H2JA 1VH7A 3DFYA 4E38A 2E3ZA 3LNMA 4UR9A 3M7SA 1US0A 3AU2A 4DZ5A 4ZXLA 2TODA 3N2BA 4QQ3A 3SO7A 3H2FA 3JVAA 1FP8A 2ZXDA 2Z00A 4H9TA 3MO4A 2IQTA 2J88A 3O07A 1RBOB 5IDZA 2ZXQA 3HFYA 3Q37A 1MZRA 5CEWA 3SR7A 3KRBA 1KFJA 1UD8A 2W5FA 4LTSA 8A3HA 2XTKA 4ORIA 4KGLA 1FCVA 4H7VA 5DY3A 3KFTA 3UGVA 5IHSA 1GORA 1G7UA 3DXIA 3MA8A 5I0DA 1H0GA 1EC9A 3EEGA 5EMUA 3FYYA 3VAVA 2I57A 4ORMA 5DCDA 4O4VA 3UNDA 1KCLA 1UASA 4PTDA 2Y70A 4NZCA 2NQZA 4N0RA 1FWRA 5M5DA 3SURA 3LV6A 4R33A 3QMSA 1LLOA 2BASA 2VO5A 4H41A 3T08A 3U0HA 3DEQA 4FNSA 1H51A 1G1YA 1KFBA 7ENLA 4G7FA 1V6UA 4OQVA 3S5OA 3UERA 2XJ7A 3DYPA 3GU2A 1EC7A 3CV6A 4L65A 2JF7A 4GY0A 4DO5A 1FWHC 4LS2A 3WNPA 4DEFA 1YEYA 3AROA 2Y88A 3SGGA 2ZX9A 1CEOA 5H8MA 2ZXBA 4BFAA 1KO0A 1PXGA 3P5ZA 4GQ0A 1YADA 3A5FA 3L66A 2Y61A 4FO4A 2REQA 1CXLA 1E56A 1CXIA 1AW1A 3DH7A 1XH1A 1SMAA 3JRKA 1UCWA 3EOOA 3OVGA 1YW1A 7REQA 1ME8A 1BVNP 3BJFA 1AJZA 1VCFA 3MQTA 1LORA 1ZBVA 5A8NA 4K8HA 8TIMA 2OELA 2JKPA 3U5UA 4L1XA 5L9FA 1NIUA 1IQ8A 1TJPA 1C7SA 4XKMA 3JR2A 3K5XA 3WQWA 3N15A 4JQ4A 2VX6A 1R38A 3N1AA 1H62A 2XSXA 4JYDA 3PWAA 4AAJA 1FHDA 2ZZ7A 5DMLA 2FGLA 2X7VA 3WJYA 2OFJA 3L65A 1VBRA 2GQ3A 2XGZA 1UUMA 3M4HA 5D8ZA 2ABAA 3BOFA 5E0CA 1ZBCA 2ODOA 4DY1A 4I7VA 1A5OC 3GTFA 3WD0A 3V16A 3AS2A 4ZSTA 3LI1A 3SGZA 4O19A 3WFLA 3SCVA 3FCPA 3V75A 3OTRA 1T8XA 1JQXA 4QRNA 4WGXA 2WSYA 1KA9F 1L6SA 1ZGDA 4MDPA 1W5PA 3BSGA 2X05A 3GW0A 2CZDA 1FRBA 3L2IA 1OT2A 1EO7A 1K7EA 1TJ1A 4XAYA 3B04A 1LLWA 2FVKA 2VC6A 5LNWA 1H7OA 4DBSA 1JCTA 3MWCA 3OIXA 1MUCA 3URQA 3EWDA 1VBJA 1UR1A 4QE4A 4H6RA 4CNTA 3NSXA 1B5TA 2PU1A 2PB1A 3VINA 2P1FA 2DZSA 3CUJA 4MY1A 3CPUA 3AXMA 4CCCA 4JTEA 2HV5A 3B4YA 5B7ZA 4EXBA 3SCQA 4J2MA 1XRSA 4IIDA 2ATSA 4FOUA 1F8MA 5DANA 4AHPA 2QR6A 4JCLA 3KUMA 6ENLA 4PR4A 2ZKMX 4H8UA 1G4TA 1BPLB 3T78A 5FF2A 1XX1A 4MAVA 1GVFA 2YW3A 1XIBA 5HPCA 3UCCA 1WE5A 2XFFA 4GFSA 3PPFA 4XAFA 5FJUA 4WKAA 2B81A 3ZFHA 4F2TA 1OG0A 1KM0A 5BRPA 3CZLA 3AIEA 4HOZA 4NJGA 3SQSA 3ZXWA 1V6WA 4CQDA 3G8RA 4GKLA 4XQ6A 3QYSA 1SW7A 5EB8A 2BV9A 3QGAC 5A8QA 4U2ZA 3CAKA 2Y63A 4DYEA 2I9UA 3THUA 4HPXA 1YPFA 1JCLA 3PK7A 1B57A 3CB3A 4UTIA 2DSKA 3VK5A 1AL7A 2A3HA 4JN6A 4LNCA 3GNPA 5AFDA 1LWIA 1O12A 1ZZMA 4D71A 1QATA 2D0GA 4FALA 2HXUA 3BANA 2ACQA 3DCPA 3QR3A 3GXMA 4YTQA 2OX4A 3S5ZA 1GTEA 1BYDA 3CZ8A 4FHAA 2DW6A 4IQJA 2R24A 1R47A 1H7XA 2H8ZA 1EOKA 3BURA 2J75A 3GQYA 1QWGA 1OWQA 2FTWA 3UJSA 2VI0A 2XIIA 3MVIA 4F0MA 3OP2A 3TN3A 3TR2A 3L4YA 1NWUA 9XIAA 5B80A 1XLAA 1VRXA 2Y89A 5I3FA 1UA7A 2DEPA 1NWRA 3WBEA 4YHEA 1GOKA 2FH6A 2YBTA 3ONBA 5HNTA 5DLCA 1KW1A 4R7WA 5C8BB 2A79A 1S2WA 1VD6A 1AQMA 4PBFA 2I17A 3WENA 3E38A 1PDZA 3MU7A 1DXIA 4BK9A 3ITOA 3I6RA 1NWTA 4EKJA 3FHQA 4O1AA 3TR9A 4DI8A 3GXIA 4K3ZA 4RL3A 5HQMA 1UOZA 2OWCA 3DX5A 2MANA 5JUVA 4QCFA 4Z0JA 2NQ5A 3CYJA 4U3AA 9CGTA 2PSNA 3LCXA 3NIYA 3KOZA 1Q63A 3WL0A 1HKKA 3V4BA 2I56A 3CTTA 1XLLA 1BGAA 4M7SA 3MSDA 2A2IA 3CL6A 1QRQA 3J7HA 4CNSA 4NZ4A 4KEUA 1P0BA 1FP9A 4RJEA 1Q6EA 3VI2A 4WKHA 3WK0A 3DAQA 1VRDA 4ZEPA 1H5VA 2X1TA 1OM0A 2VURA 1OEPA 2WMFA 1WQ5A 1K7FA 1XICA 5HMFA 1JULA 2C19A 4ERAA 3VIFA 3CZKA 1UP0A 1ELSA 4XBJA 2XVLA 1CI1A 1O94A 4MYXA 1LRTA 3S83A 1OGBA 1SO3A 1H0IA 4PTVA 2CLMA 4UQCA 5FEWA 2Z6JA 2YJQA 1Q45A 5CZJA 3GRIA 1DWGM 2EPLX 3H2EA 1FXQA 2GJXA 2RDWA 5CSUA 3EZ4A 4BQ3A 4P8UA 3QC0A 5C7HA 1TJRA 4HKPA 4AY8A 4UTHA 3ZWTA 5DF0A 1V6VA 4GNVA 2QCMA 2VJXA 5T26A 4O1BA 1KR0A 3NYDA 3VD3A 2CLOA 1JDCA 4UMCA 3WD4A 4YYCA 1A5AA 1Y7VA 3TN4A 3NFUA 1BAGA 4HJWA 3A12A 4FR6A 1HJVA 3T0DA 1F61A 4CCDA 2HPIA 3WD3A 1ONXA 4AWSA 4OUIA 3LGDA 3TMLA 5FJJA 4GBDA 1PYMA 2F8QA 4O53A 2PC4A 4J3XA 4K1WA 1TA3B 1UJQA 5DFAA 3C3NA 2WBKA 4P5UA 3B05A 4E4UA 3LHVA 4LNYA 3T4WA 2ZRWA 4PUNA 4JQAA 2ZZ5A 4ZSUA 3V1PA 3HG2A 1HQTA 1WPCA 3TJIA 4CD7A 2KX9A 1ISVA 3AYSA 1POKA 3PG9A 3RR4A 1U2YA 4GXMA 1GNXA 3F4CA 4GIRA 3C0JA 4JHOA 2Q3RA 3ZM8A 4W7VA 4IUGA 2C6QA 2BOGX 4PFHA 5BCAA 4IPJA 3LCIA 4F2UA 3W2KA 4AF0A 2XG9A 4O0ZA 2EPHA 2Y1HA 4MNJA 3BQ6A 3P2VA 4EAMA 3KL5A 1NP0A 2FDSA 1E71M 1SR9A 2ANUA 1GZJA 2BG5A 5HXMA 3SRKA 5A6SA 3KBVA 1RALA 5ECUA 3YPIA 2XN0A 1UP2A 3W24A 5CBBA 3KWXA 3N9SA 3OHMB 4NKCA 2PBOA 1MXSA 4WIWA 3GU9A 4AZCB 1GVYA 4DHGA 1B2YA 2VFIA 4CN1A 1MUWA 4LS0A 4RNHA 3HPSA 3WUEA 4ZFMA 2ICSA 5C55A 4LAZA 1WO2A 4HNOA 4U10A 1QT1A 5I3IA 1IZCA 2DQXA 5A6JA 4RLIA 1H1NA 4DZIA 3AJ7A 4A2RA 3ATZA 1E6SM 1GHRA 3GIYA 4LUYA 1GYLA 1VFSA 2Z29A 5BRBA 2DJLA 4I9AA 4MTVA 3TMQA 5CC6A 2JALA 3FXYA 3USBA 4AY7A 3DZ1A 2P0OA 2AMXA 1E3ZA 2CLKA 3K13A 5HK4A 3IJ9A 3M07A 5C9XA 4P8VA 1KGUA 5HATA 4YMZA 1OFAA 3DESA 4UFJA 3BAIA 1VS1A 4LJ3A 4Q8QA 2B4GA 3W2JA 4H04A 4NZ1A 7PTDA 1ONRA 3WLKX 1G5AA 1PCWA 4CVWA 1BWLA 2VZTA 1E73M 4O50A 2XHYA 4W86A 3HFTA 5TNVA 4ES4A 3RM8A 5HUPA 3OBAA 2YDSA 2PWHA 4PCTA 1MO0A 1SJAA 3H21A 3QR0A 1HFBA 5I3DA 5G5IA 1IHIA 1HO4A 4JQ2A 1BSIA 1ZTVA 4DBUA 3NQ2A 1GZGA 3P8JA 4F66A 2J78A 3SRDA 3K4AA 4KETA 3MB9A 1IF2A 3GS6A 3WQOA 4YVPA 1WX0A 1GCYA 3SZ8A 1VENA 2AL2A 3FA5A 3ARVA 2V6AA 3VGBA 1U22A 4PTWA 1J0HA 4IWWA 4MWAA 2CXEA 3V35A 5D37A 3NQDA 1W2VA 2BXYA 4O14A 3LUTA 4LT9A 1DJYA 5CGQA 1W1TA 4NT0A 3O06A 5CC5A 3FIGA 2E1WA 1V03A 4GVGA 4I9MA 2AL1A 4A2SA 3U2CA 3VKAA 2MUCA 3TLLA 1UBPC 2ZRVA 2Q8ZA 4B3KA 2HVMA 4DWSD 5FF0A 5HWNA 2BS9A 1PX4A 4H7ZA 3KEHA 2VRQA 1RJRA 4XISA 1DQXA 1K8XA 1DOSA 1XLHA 1SZEA 1RPKA 2VX7A 4JDBA 3CS2A 1UD2A 3FA4A 4E2VA 1TV8A 3CO4A 4CLMA 2F6XA 5EMKA 2X30A 4HN8A 2J25A 2EO7A 3R79A 4GUFA 3T4CA 2YZRA 1WDWA 1DKWA 1XYFA 3UT0A 3SY5A 1DE6A 1EGZA 2HSAA 2QCLA 3AYVA 5IRPA 4HCLA 4LRSA 1HJWA 4QHRA 2BFGA 4OHQA 5CG7A 1NFGA 2YL6A 2DT1A 4QISA 2ZX6A 1PCKA 4QR6A 1O95A 1C29A 4E2DA 2QV5A 1K6WA 4B5SA 1XLDA 1XP3A 4G7EA 4IPIA 4ZO8A 3GNDA 1SM9A 3KOYA 1VJZA 5FCZA 3C6CA 5ECVA 1V6XA 3EDJA 2BY2A 1XIDA 4H6QA 3ELFA 2W91A 1E51A 3ICJA 4JNMA 2ZDRA 4MB5A 3ZSTA 2PUZA 4FR1A 3DERA 2QLYA 3ABRA 2F84A 3IAQA 1WB0A 4JIPA 4HK5A 2BGNE 4Y9NA 2GUBA 4I90A 3HB9A 4JTJA 3UXAA 1OCQA 3T0BA 5C7VA 3TN5A 1ZBWA 3VNLA 1QNSA 4R85A 4DXVA 2OGYA 2ABBA 5A95A 2A3CA 1GG1A 1OYAA 1PKLA 4FZIA 3WBWA 2XH4A 2ISWA 4IQEA 3C52A 3BG5A 1FX6A 2DFAA 4I5UA 3G0SA 2VWSA 4YTSA 3GW3A 3Q94A 3VDHA 3SJNA 4KESA 3QHMA 1WBHA 3ANVA 3KTCA 3KL3A 3WJXA 2WHJA 4NAEB 1A53A 4WOQA 3L7RA 1VIZA 3IJQA 3LK6A 1H4PA 3LI0A 1U5HA 4WXYA 3WNLA 5HWJA 1A5CA 3RLHA 4GC3A 1QR7A 3PSVA 3FW6A 2X09A 2ZUSA 3UWUA 2QXWA 1Q6OA 1R9ZA 1UIOA 2JGQA 2J8FA 1X97A 1ZS2A 2E77A 4TU1A 3T42A 4F9DA 4A3RA 4IG2A 1DJZA 4XUYA 4Q4KA 3F2BA 2WSQA 2HZGA 1VC4A 2D2GA 3A22A 1TB3A 4H3DA 2ZVIA 1AK5A 1AFSA 1ITQA 3N34A 1AVAA 4F40A 2YCLB 4LUTB 4GISA 3WL1A 4B5NA 3GDMA 2SFPA 3FYOA 2WC4A 1T5AA 4QEEA 3HPFA 3XINA 1J11A 4X3ZA 1EFZA 4Q7IA 2BDQA 2J6VA 1D3CA 4OBTA 4MUZA 1G4PA 1VLWA 4N9EA 4RNFA 4C1KA 2NUXA 2V81A 4F48A 3MKVA 1A4LA 2GQ8A 1V08A 2QUTA 2P8CA 9XIMA 1XIIA 2C0AA 5CC3A 2FTPA 3O6CA 3H2CA 1K9TA 3EMCA 4YVVA 2GDQA 3RUBL 1ITUA 3G0XA 1GQNA 1F8IA 4Y9PA 1S38A 2DSUA 3L2MA 4PB5A 4H8VA 1V3HA 4Y2WA 1E4LA 3RXZA 5EKYA 4Q8VA 3SFWA 5BNKA 3A6OA 1JDDA 2J8TA 5LGZA 3GBEA 2JF6A 4MLJA 3ANYA 1D8CA 2AMGA 2NT1A 4ZQCA 1FWCC 5FIPA 1TQXA 3FOKA 3UR8A 2ZUMA 1CENA 3S1UA 4TV6A 3W7LA 5E0KA 3VZYA 3FYPA 3G18A 4AG0A 1OSEA 4P8WA 2DPEA 2H8XA 3QPEA 1WZKA 2INZA 4CCEA 3QSTA 1L0PA 4NXSA 4NRRA 5MF5A 2W63A 3U3HA 2E8ZA 5I3KA 4QJ5B 1LG1A 4O8AA 4B9ZA 2E40A 1KXQA 1JFXA 2DZWA 2BVWA 4XD6A 1A4MA 4Y90A 4Z08A 1VPXA 4JDYA 1GOQA 2WKGA 2RDUA 4O54A 1OC6A 2C8NA 3C2OA 3VIPA 7CGTA 2PS2A 2OKTA 2NZLA 1VFTA 3MWAA 4JEQA 3TP4A 3VIMA 3GH5A 3EWUA 4S39A 1FHLA 2EJAA 1TJ2A 1LM1A 5G4HC 3PZIA 1UR0A 3TZFA 2EBNA 4LF1A 2FYMA 2ZUWA 3UPMA 4L9YA 2O4QA 1Q6DA 3B8UA 1XLKA 1DJGA 3II1A 4V33A 3WLOA 7ODCA 3AWNA 3KHJA 3W74A 2R1MA 3HV9A 4R3UA 7REQB 2YCJA 3BW2A 3ARXA 2QCNA 3AUJA 1YTKA 3B4UA 4YWIA 3QTGA 4ZO6A 5I3JA 2E9MA 3ZVHB 3LPFA 4GZJA 3AZSA 2OSWA 1V3IA 3LHUA 1VR6A 1V7YA 2ZZ6A 2OVLA 4JBRA 3I6TA 2EF9A 4JTSA 2E4TA 2JK2A 2WNNA 3BE7A 1BVZA 1NVMA 2PP0A 4K7YA 2ZA1A 3BMXA 1K03A 3K4DA 3IJLA 1D2KA 4FLQA 3RK8A 1HN1A 2G3JA 1WKDA 1MEWA 3L5MA 3MYPA 1QMLA 4IUOA 3W25A 3EA2A 3VIOA 3ISIX 3MSGA 5IFPA 3FJNA 4JTTA 3OQ8A 2GK1B 5BOEA 5F2MA 3OZYA 3MMWA 3E96A 3RJXA 1EA9C 1OFRA 2UY5A 4KH2A 2C1HA 4O28A 1UROA 5D30A 1AMYA 4A8IA 3NUKA 3V0SA 1KM4A 5HULA 5XIMA 2PURA 3O63A 3BH4A 3PTMA 2PCQA 2C3ZA 4FNRA 3RJYA 3H22A 5TBOA 3WLSA 5KSWA 3VNDA 2JEPA 2QUVA 3VOJA 3WFAA 1E1CA 1S2UA 3WLIA 4S3EA 1EDTA 1LG2A 1CXFA 3AIVA 4R5EA 3WQGA 1S5NA 1DQWA 4OECA 1D3GA 2ADAA 4GZEA 2XGBA 3WUGA 2JE8A 1QPKA 1SJCA 3GM8A 1RQBA 4O12A 4MUPA 3K8LA 1B31A 3DG7A 2NSXA 5DXXA 3HJEA 3WYZA 4Q8UA 4WQ6A 5JU6A 5LKYA 4X63A 4PN2A 2ZC8A 2XVNA 3GG0A 3PBMA 1G4SA 1HL2A 4FXSA 1N8IA 5JBEA 3L4WA 3TYEA 3P60A 3WLHA 3CQKA 3WF3A 4KGJA 1VQTA 2FZMA 3QKZA 3BGAA 3OLEA 3VABA 4GQBA 3W23A 4NU7A 4CD5A 5KZDA 4C6NA 5T8GA 2P5NA 1OBAA 4XWUA 4HMNA 4NAFA 2C16A 2D0HA 3VFCA 1X98A 3GFZA 3G24A 2ZX5A 1TE6A 2FKPA 3QBUA 1E5NA 2F6KA 1AZ2A 1MNZA 5AC4A 3H53A 4U5IA 3RU6A 4QFUA 3RPDA 3CQHA 3LMYA 4W8AA 4V1XA 1JYXA 1IT7A 3GUWA 1CXKA 1A3HA 2IMRA 2ZUUA 2J24A 3A4AA 4FOKA 4PYSA 1R2RA 5A2BA 3PM6A 4I3GA 1R6WA 1I1XA 1V0KA 4N6EA 1RCXB 1WOBA 1UWQA 2UY2A 3OZPA 3V5FA 1TJ0A 1PZ0A 4HB7A 1C8QA 1GW9A 3FDGA 2E7FA 2IUZA 4Z2GA 1DWAM 4UTFA 3S2LA 4QX4A 2FJKA 4ZENA 3AXIA 5CGMA 2J4GA 2XM2A 5HQEA 3W37A 1YTEA 5K9CA 3CMGA 3FEMA 3MANA 3FJ6A 1XIFA 3WKZA 4QXIA 1SFSA 1EJRC 4IM4A 4KIRA 3BCJA 1N82A 2IW0A 3N14A 1V51A 5C2GA 3GNNA 3IIZA 4ICNA 3VKDA 1LCOA 4IPPA 3TOYA 1A0EA 4DNHA 2RAGA 3EWZA 3R58A 2GVGA 3MC5A 1H50A 2WJDA 1R85A 1GHSA 4M24A 3RG6A 1FWJC 3MPGA 5KITA 4GQQA 1WUEA 3LBOA 3VYLA 2GWGA 3VM7A 4JZ5A 4UTWA 1E6QM 1J10A 1A5NC 1TWWA 3V7PA 4ATDA 3Q58A 5AC7A 1XPGA 3PZQA 3QGVA 4I6VA 4JFVA 1GYMA 1JNDA 2I1OA 1YTDA 1CCWB 1LOLA 3RIKA 1HJUA 3STFA 1TWZA 3OLIA 4B16A 3DFNA 5AYZA 5D4YA 2WBGA 3ZSSA 1FWEC 2QVHA 2OG9A 3N4EA 1GW1A 3EXTA 4M56A 1PIFA 4XZIA 3LBMA 3WH7A 3MUCA 2YL9A 3AMCA 3O6DA 2FB2A 3N13A 4JIQA 1F3EA 1DPMA 4DIAA 3NQBA 3IGSA 2ZBTA 2W9MA 2GVEA 1EYEA 1E0UA 2IQ0A 4L9ZA 4D2JA 2WC3A 3MY9A 3V1HA 4F0RA 3W7GA 4N4QA 3SW6A 3WNMA 1W3KA 2Z0IA 4N02A 3BL3A 4MNLA 1PHWA 5A6KA 4AZ7A 5JH2A 1Y8BA 6ALDA 3KZPA 4JYFA 4HP5A 1X38A 1RJQA 1O1HA 2BP1A 4QG8A 3W1NA 2QPUA 2IXUA 3FA3A 4QM1A 2O55A 3BICA 1TPUA 4MAZA 3LLFA 5K4XA 4RDWA 1ALDA 3MZ2A 1VFHA 4XG1A 1GWJA 1EYWA 3D46A 3UP8A 1UC4A 1FH7A 4JIRA 1AG1O 4UTKA 4UTWC 1UUOA 1CGVA 4AEEA 4EX4A 1YNPA 2A3EA 1EP2A 3BK0A 1NARA 4UIOA 3B8VA 3E2SA 4H6KA 3ZS4A 1P6CA 3PC0A 2CETA 1ZY9A 2Y8VA 4A3YA 2FGZA 2E6YA 5DXYA 4RZ6A 5CCZA 1Q2RA 3N9RA 1VBGA 3LS9A 1TIWA 3FXGA 5M3WA 3MI3A 2WMIA 3BLDA 3SCUA 3KRZA 1WP6A 3LCHA 1PZ3A 1UZ4A 3GK0A 1KKOA 4D6GA 4CNOA 3EX1A 3NXLA 2FMNA 4QIUA 1PIGA 2ACSA 1XSJA 2Y7DA 3N4AA 4H7CA 1PZ1A 2Q3OA 1TWIA 4XZLX 1TCDA 3EBVA 2V38A 1UUQA 4D6FA 4INFA 1W5MA 1J0KA 3ME3A 2P76A 3MCOA 1LL7A 2Q02A 4LVBA 5LNVA 2EPMX 1JJKA 2OEJA 3LYEA 5J5RA 1Q6GA 2YA1A 2AQVA 1XDJA 3W87A 1MYRA 4JFWA 2V5LA 5AC6A 2UWFA 1WXYA 3C8FA 3OB8A 1E3XA 2ASHA 4C6LA 3VDBA 3UY8A 1ZENA 2PLJA 3PVFA 2Q71A 3ARQA 1DTUA 3CB8A 5FA5A 3M6DA 4AWUA 4ZL1A 3SY1A 4N4PA 2E67A 1OFOA 3EOLA 2V67A 4O1EA 4Z1YA 1KR1A 4W5ZA 3GO2A 4PTMA 4LCSA 5FL1A 2PODA 1P0NA 1TG7A 3N29A 4LV9A 3TTOA 3CO8A 3AALA 5DY2A 3S2CA 2Y85A 2G3IA 2ZZ4A 3S46A 3VD7A 1MRQA 1GJUA 1SU5A 4EACA 4PC8A 4CNNA 4B5WA 4RV3A 3FDKA 3NSNA 2VTFA 3RNDA 1EH9A 5HNUA 3GUGA 4QROA 2HK1A 2LLEA 3FGCB 4ACZB 3M5XA 3KBJA 3S9YA 2QUNA 1J0IA 3N18A 1KBLA 4JTHA 3TWAA 5LIYX 1XXXA 2ZA2A 5EBUA 2A7PA 1DXEA 3GXFA 3BGJA 3VOGA 3KP0A 4DUXA 1S39A 2PRHA 2FHFA 1MUMA 4X61A 3MP3A 1K9EA 3NZRA 4FF7A 2VC7A 2NW0A 3WQFA 3F03K 2V5CA 4Z2HA 1TX0A 3KLLA 4BR1A 1PTDA 5CKSA 4WZHA 1XGZA 3CQ0A 4GIEA 4Y9AA 2OZ3A 3DC0A 4HHPA 4LBRA 1XG3A 4MF4A 3QPZA 1TRDA 3AXXA 4KCTA 3MI6A 1PWMA 1TV3A 1JPDX 3PUOA 3MT1A 3CMFA 1Y5VA 3V5OA 3S2MA 2D22A 3T2OA 5LA0A 4L4LA 3NL6A 1UQZA 1MXDA 5U4NA 4ZB5A 1O5QA 4QLJA 4LVFA 1P0DA 3SI9A 4DWSC 2NVDA 1GZ1A 4CN4A 1GVRA 4HA3A 1OT1A 1RBAA 4M6PA 1QW8A 3CWNA 1OZQA 4O15A 5IDIA 3N11A 4S38A 3I3DA 2QCDA 3UWEA 3MP4A 4P7QA 5ABFA 4C6IA 1UWSA 3ZLFA 4FMVA 1V0NA 4ZQPA 2TSYA 4KWWA 1V77A 1OJXA 3QJAA 3WLPA 4R9OA 3BG3A 2R1PA 3BGGA 4J27A 3NQAA 3EB2A 1ISXA 2DH3A 1BRLB 4H8NA 3W53A 4ZCWA 3UZ5A 2BSLA 4HN4A 1OY0A 3O15A 3WELA 1XBZA 3GNXA 1Q66A 3UYIA 1J0JA 4LS1A 2WZMA 1MQQA 3MTWA 1Z3NA 1BYAA 1PBGA 3WLJA 4M5PA 1J5TA 1FCQA 2DP3A 3EDDA 3G5EA 3NJ3A 4XIAA 3QYQA 5I78A 1Z42A 4YXGA 1SJBA 1L6WA 4JY9A 2ISFA 4Z1BA 5AVHA 2ZADA 1DIKA 4BF9A 4H8HA 1BEUA 1SSDA 3LRLA 5I06A 3I4EA 1QCWA 4K38A 3BDKA 2D2HA 2QV4A 5HAOA 4IFOA 3QTPA 4DM2A 1M65A 2DSZA 1I9CB 3NQMA 2BX7A 3QMRA 1W9DM 4C6DA 2PZ0A 2VOTA 3UY7A 4UNIA 7A3HA 2WVVB 4GUHA 1CGXA 1DJWA 2WQDA 3O05A 3PB0A 3KVMA 4UMAA 5H1WA 3OVPA 1J93A 4IMEA 1EHNA 3WNNA 2A7NA 2D1ZA 2V3EA 2QZRA 3WD1A 4IIHA 3F5KA 3AU6A 2GJLA 4BQ2A 5HJYA 1JRCA 2C1IA 4CQCA 1EL3A 2HROA 1KFWA 5D9PA 4B92A 4D6HA 2J6XA 1TVLA 1UH2A 2PWFA 2PDHA 3RGTA 1BVWA 4DWSA 3OO2A 2EGZA 4ZOEA 3U9IA 3RAOA 1UR8A 1DBTA 3CJPA 4AHOA 3H6OA 4F0KA 1M7JA 2F9RA 3GG7A 4C1NB 1LRQA 4AD1A 1XYCA 2QCEA 4C6FA 3P93A 2OZTA 3CV2A 4KEVA 1TR1A 3B9AA 1G67A 3IUIA 3L21A 4XKYB 2JIWA 3GNOA 4CU6A 3MUXA 1KLYA 3C2FA 4UB9A 3S1XA 3T0CA 2WLZA 2E8YA 4LEQA 4UFLA 4JQ3A 1H3GA 3WK3A 2DZXA 1W3NA 1SPQA 3VX0A 5JBFA 1IEQA 3OPSA 2C7FA 4OOZA 2CITA 2HBXA 3PBUA 5GNXA 3IGUA 3PULA 3TW7A 4LANA 3UR7A 4R34A 1J79A 5FKYA 3GVQA 3REQB 1IEWA 1ONEA 4WY0B 1MWOA 1G4EA 4D6IA 1O1ZA 4PEKA 2QNEA 3PZ9A 3MV01 4TMBA 3WLQA 4A29A 3G1XA 3DENA 5DO8A 3G1VA 4DBEA 3LV5A 1XLGA 3W7QA 4HYRA 4HBKA 3BTNA 3SECA 5IBXA 3MSYA 1GJPA 3WDJA 3O6AA 3TC6A 3SJ3A 3QRHA 4PEEA 2HS6A 4WVXA 3I7RA 1ECEA 2WCAA 1JXJA 3HG3A 1TZZA 4MPKA 1C91A 3AIBA 1LOSA 1RD6A 3AIWA 4IHCA 1TPEA 3FEQA 4J3WA 3GXNA 4HJFA 4AW7A 4HMDA 2FH8A 5CXPA 4GPNA 1XINA 1N8WA 2PDLA 5AYYA 2OKOA 3EXSA 4JTAA 1FOBA 5I6SA 1JPIA 5BU6A 5J04A 5FOOA 2VGBA 2Q8LA 3KE0A 5TIMA 5JIWA 1BSLA 1QNRA 3RO6A 3VVGA 1QAPA 4JR5A 4ZVJA 4YTTA 1A0CA 5GJPA 3XIMA 4ZQMA 1I2PA 4E5TA 4JY8A 3HM7A 5AHEA 2BXZA 2GJPA 4G9PA 2PRMA 2V5KA 3LTSA 1XSKA 3VIIA 3GC5A 2C0HA 3RM4A 4PL1A 3G6LA 4I9TA 3TTYA 1ZLPA 2H6RA 4CD8A 2ZFAA 3KL0A 3LD5A 2EAWA 5DMYA 4GY7A 1KRBC 1JG9A 1YPXA 2RJGA 2VHLA 5BW6A 2CXGA 5G1YA 3NDYA 2BGSA 1E4IA 3VIJA 3W0KA 3G1RA 4AIBA 1VJSA 3CV7A 3CL8A 4IPNB 1Q6QA 1XKYA 1EP3A 1XC6A 3M44A 1CWYA 2WMHA 1P43A 4WKFA 1HIZA 2PLKA 3BC9A 5M2FX 2CNCA 1GOOA 1XGDA 3Q45A 1R3SA 1W32A 3PUEA 3E5BA 4GJ1A 1WDDA 4GNJA 4UXDA 4CQAA 2OGJA 3TSBA 4AX7A 1XYMA 1WZLA 1A5UA 4CU8A 2J13A 2D24A 2ZYFA 1FDJA 4Y8FA 3R2GA 2GVLA 3VTRA 4HU8A 4PFMA 3VKKA 4GVFA 3RMEA 4JPGA 1W1YA 3A9IA 3MYOA 4GRSA 2CHOA 3UJRA 3L5LA 4QNWA 1J9YA 1RVKA 4TO8A 1TREA 2P0IA 2XZ9A 1UWRA 2BOFX 3RDKA 4R27A 1XISA 2HNHA 3WBXA 3M16A 4BWLA 2YDQA 1HP5A 1F3TA 3NO1A 5HMDA 1P0EA 1US2A 2BOEX 1GVSA 4US6A 1R9XA 4DX3A 5I03A 1FQ0A 4GVHA 4DO4A 4GMEA 3EWXA 4NF7A 2YCLA 2QT3A 4FX8A 2EKCA 4LXFA 3RCMA 1O60A 3DFSA 4Q8NA 3U57A 4X2RA 3EA1A 4IG2B 1ISYA 1RCQA 2PD9A 4ATWA 4AHQA 5D32A 1W8SA 1PYFA 4YTUA 2IQDA 2E68A 1PJ9A 3A24A 2O9TA 1RJPA 1HGYA 3GXTA 3QW4B 5HJLA 3AFBA 3G1SA 3PTDA 3ZR5A 4XO6A 4JFUA 2VEPA 4JTCA 5A6MA 2QCGA 2ACRA 3BXWA 3M6YA 3TSMA 3VDGA 1S5TA 1B0IA 1EJVC 4RDYA 3NOEA 3RHGA 4GBUA 1T0OA 1B3YA 5GQBA 3WJZA 2NX1A 2CHNA 1V6TA 2PE4A 2GSJA 3GZAA 4UTUA 4LYKA 1NF0A 3NZGA 5K9DA 4IP4A 1DHPA 4EANA 1HL8A 5F4SA 4UFIA 2W79A 3NQGA 1X1OA 3ZO9A 4EWJA 1UW9A 1EZWA 1NOFA 4IQLA 4ZMGA 4NUWA 1EJUC 1OB0A 5BXTA 1EHAA 3KDOA 4JKLA 1DP0A 3F2CA 1Z89A 1PVNA 2X2GA 3QH2A 4BWLC 1Q7ZA 4AMCA 4E8GA 4IX0A 3I7QA 2C13A 2XZ7A 5CZTA 2UZ9A 1KCXA 3MUAA 5LIWX 2B7PA 2QMKA 3GTXA 3GC4A 2R91A 4L5ZA 1E72M 5DT7A 1KM2A 2DZTA 3RMJA 1MZHA 3R11A 3TSDA 1GTHA 4TX6A 1RP8A 3T8LA 1GVOA 4TVUA 3LXAA 2QAFA 4NZFA 3VNJA 2C1GA 4EPBC 4UQBA 1NFBA 4DF0A 4NJJA 1O7AA 5T9CE 1K70A 2CIPA 1PKYA 3JU2A 3K1DA 3MI2A 1A80A 1LT8A 4PBEA 4HZ7A 2FZBA 4E0CA 5KTLA 3EWYA 3UZJA 4C6PA 3TTQA 1IZJA 4CN6A 3W38A 1NF7A 4YCPA 1GGOA 3NQFA 3CUXA 4J35A 2I16A 4IH3A 3D3AA 1TSIA 1XV8A 2X16A 1UC5A 3ZLGA 3VDCA 3B0PA 5A8GA 3CWHA 1DIEA 1J5SA 4DWSB 2GUUA 1Z9AA 1IXPA 3MCNA 1NU5A