4N4QA

Crystal structure of n-acetylneuraminate lyase from mycoplasma synoviae, crystal form ii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
293
Chain Sequence
HNFDKFKGLFPAMVTPFTKDGKLHKAGVKEVVNFLVEKQKVDGIYITGSTGEFLLLSFEDKKEVMKLVAEANAGRVTLIAQIGSLNIEETKELAKLAKELKYDAISAITPYYYNFSFNETHHYYEEISKAADIPMLIYYLPQLAGVSTDQFGKLLEIKNVIGSKYGATDLFAFERLMSKYPDKLFMFAWDEALAMGLTMGAKGFIGSTYNVNAKGANAIIKAWEANDKEAVMKLTHTYNDYVLDLISKGLMQSLKAIMRLHGVDAGYTRKPFWRYEDEEIKKHAEFITDKYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GroEL/ES Chaperonin Modulates the Mechanism and Accelerates the Rate of TIM-Barrel Domain Folding.
pubmed doi rcsb
source organism Mycoplasma synoviae
molecule tags Lyase
molecule keywords Acylneuraminate lyase
total genus 106
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n4qA00
3TXZA 1N8FA 1NF0A 5D30A 4UTWC 2A0NA 3UWVA 1XBXA 4FX8A 3WFAA 3NPUA 2OJPA 4XQ6A 1I4NA 4FNQA 3NA8A 4ZVJA 3DFPA 1L9WA 2LLEA 5DCDA 1KLZA 2A7NA 4J9JA 3BG3A 4LV4A 3TAOA 4AF0A 4MYAA 5HWMA 1B9BA 4MY9A 5I3KA 3M1ZA 2EPHA 2Y70A 3BPWA 3S5YA 1ZJIA 4FIQA 1ONRA 2JKEA 3R89A 3LGEA 4BF9A 3IEBA 3QEZA 2A2IA 2QCLA 3WJSA 3G0SA 2Y6ZA 3GVGA 1YTKA 2ZTKA 1S5VA 5FF4A 4O12A 1QCWA 3F4WA 3BARA 2XN1A 3TW7A 5A8GA 1KFKA 1HG3A 1TRIA 4CQ9A 1W5OA 3FA5A 1GQNA 3HG2A 3TMLA 3ZWSA 4E38A 2V9DA 3MUXA 4WY0F 2NXGA 2DZXA 2ZRWA 3S1XA 5C6MA 2DZVA 3O05A 3QMTA 4JTKA 5U7SA 1Q6QA 5K4ZA 1FDJA 3CM4A 4O53A 3HPSA 4NZFA 1D3GA 2RFGA 3KXQA 3NQMA 2TSYA 1ZNNA 2V5BA 1W0MA 1XCFA 3W2LA 4JTSA 1FXPA 4BFAA 3EKZA 3C61A 5DELA 4U4MA 3MBFA 2X1SA 4XKYA 4RZ5A 4LVGA 2VFGA 3EX3A 1W5QA 4NJKA 2Y61A 3VFLA 2V5LA 4PL1A 4UC5A 1CW2A 2WPBA 3N2XA 4LS1A 4YCOA 3W2UA 4M19A 4LT9A 3TCEA 1TB3A 2WSRA 2H8ZA 3LDVA 3CHVA 4K7YA 1LTDA 4CCDA 5HR7A 5DY2A 3W7GA 1GEQA 3C52A 1KTBA 3C56A 1H7RA 3FJLA 3GDRA 4KWVA 1YDNA 2BWGA 5AC8A 5F4SA 1KFLA 3ATYA 3NQEA 1JUBA 1THFD 5KZMA 2EAWA 1GVSA 2ABAA 4BR1A 3W70A 3UWWA 1SUXA 3EX6A 4ML9A 1GT8A 3CT7A 3PUDA 4JN6A 3TJXA 1MEIA 1Q6OA 4K39A 1W31A 3BK0A 1XUUA 3GAYA 5HUPA 2FLIA 4IUOA 1JCYA 3M41A 3VCRA 4ADUA 1TPFA 4AH7A 4FO4A 1MEHA 4DBEA 2YX0A 3A21A 1AL8A 2FIQA 1I2RA 3UY7A 4GXMA 5BOOA 3R12A 3FYPA 3L67A 4DQWA 4FNTA 1ZAIA 3G1DA 2VKZG 3A22A 3SJ3A 5KMYA 2B7QA 3NPVA 2DZUA 5CZSA 2CLLA 1IF2A 3DAQA 4N9DA 2FPYA 4O16A 1N55A 3OA3A 3EKLA 3CWOX 3W1TA 1OFBA 1R30A 3Q2DA 4BWLA 3PVFA 2FPVA 3W74A 3FFSA 3P5ZA 3PR2A 3I7QA 5DY3A 2NWRA 3UQNA 3P80A 3NQVA 3M9YA 4K6AA 1K3UA 2PE4A 4XZ9A 3SY5A 2JGQA 5HINA 2E6AA 4UTMA 3T44A 4IMDA 1JCMP 3L5MA 5F2LA 2QCDA 3G1AA 3HQ1A 1T8XA 5AHEA 1KM3A 2A5HA 3TR2A 4WZHA 1S5WA 3P7YA 1NFBA 4IX2A 3W1LA 1IXNA 1LOQA 4AXKA 3WK0A 2QDHA 2E6DA 1AL7A 4MVAA 3GDLA 2TYSA 3MI3A 3W83A 3TQKA 2EGZA 3DFNA 1GVRA 3LXAA 1ICQA 1IIGA 1VRDA 2BSLA 1SO4A 2R14A 3MHGA 3FLUA 3W2NA 5TBOA 3W1PA 3SI9A 2Y7FA 3OBKA 1F05A 2B7NA 3MP5A 1WV2A 1ICPA 2BLEA 2Z1BA 2Y7DA 3TH6A 3LTYA 5G4EA 2A1YA 3QFEA 1LRNA 3ELFA 5L6UA 3N9RA 1RQBA 1ZALA 3GXPA 3LHTA 2H8XA 2C16A 1WBHA 5DCBA 1W8SA 3AJXA 3G1YA 4Y6GA 1SZNA 3KHJA 4JTUA 2ZZ5A 1LDCA 1S3HA 2ZA3A 4O54A 4UTTC 1LROA 4UTWA 1XBVA 4K8HA 3T55A 1PS9A 5KTLA 1Y0EA 1WXJA 3FIGA 1FCQA 2V0TA 3ZFHA 4PODA 4RXFA 1F6PA 1GVOA 2HTMA 2GJNA 1QAPA 4QJ1A 1LM1A 2Q3OA 2J27A 3M7WA 1F76A 2Y89A 4LS0A 5CPMA 3V75A 2GUUA 2ZZ7A 2ZZ3A 4TIMA 1OFOA 4MFEA 1RQHA 1HL2A 3G1XA 3S5ZA 2GVLA 3BGGA 1I8JA 1QOQA 4CCCA 1O60A 5LNSA 1XKYA 4HNUA 3TFCA 1M6JA 2GQ8A 1G6CA 2JBMA 3PULA 4WY0B 1TIMA 2OMAA 4XUGA 3W73A 3BV4A 5KZDA 2GPTA 4AB4A 3W7MA 1KTCA 5CZTA 4NX5A 5IBXC 4YWIA 4JTLA 1FXQA 1G67A 1S5TA 4FXSA 4DF2A 3LV6A 3MMTA 3A23A 3N3MA 4O1BA 1N7KA 3B03A 3GDTA 4L4MA 4PEKA 2YDAA 1CX9A 3W7IA 1F6KA 3EWUA 3W85A 1UUOA 3NM1A 4AWTA 1TTQA 2YW4A 4N9BA 3MBDA 1LRQA 4AMAA 2PRLA 3W23A 1EP1A 3E9AA 4JTIA 2VFIA 1X1OA 3KRUA 4Z1BA 1L6WA 1K8ZA 1GVFA 3HG3A 2A6NA 1DORA 2OZ0A 4H3DA 4MUZA 3SECA 1F7BA 1HFBA 1TPB1 3MP4A 2V2CA 5D02A 4LOCA 2B0MA 2NUWA 2F7FA 1SQ7A 1VR6A 1JUKA 4HKPA 3GR8A 3S9YA 1ALDA 4FXRA 4O1AA 3BLIA 4RJEA 3O8AA 1KM1A 4CCEA 3Q37A 3MYPA 2Z0IA 5C54A 2FJKA 1VYRA 1KFBA 5H91A 4EIVA 5LNVA 3N2MA 3W3OA 3NZ1A 1M7PA 1TREA 3NQ2A 4QISA 4MLJA 2QCCA 5AHNA 2O7SA 2QJIA 2Y62A 3L2IA 1FCVA 1W3IA 2P0OA 1VQTA 4Y90A 1A53A 1DKWA 1FQ0A 4WQ6A 5G1TA 1YLVA 5G2WA 4MY8A 1H51A 4GBUA 1GYNA 2A4AA 5EA9A 4PA8A 4JYEA 1T99A 4E2BA 4MKNA 3SGZA 4DXVA 1QFEA 5HWJA 1GTEA 2NWSA 1LYXA 1EP2A 1UASA 1C29A 5I3JA 1EPXA 4FNRA 1JULA 4UTUA 4NJIA 2PRHA 2R94A 1FWWA 4G1KA 2QCNA 4JTFA 1TPEA 3EXRA 4AAJA 3M47A 4CNOA 4E0CA 3TV8A 1H5YA 3LTSA 4IMCA 1JUEA 4X3ZA 3S6DA 4Q32A 3UZ5A 3T4CA 3W7RA 2X1TA 1JCNA 4UFJA 4AWSA 2A7PA 5T26A 5AYYA 1VZWA 4RZ6A 5D03A 3CPRA 3G22A 3STFA 3EX2A 4GUGA 5CSRA 5LGZA 3MWAA 4DF1A 5AHIA 3NEVA 1X1ZA 4UTLA 2J9YA 2ALDA 1IGSA 1F74A 1DQXA 2Z2UA 1EP3A 1QO2A 5J5DA 3TUUA 3GLCA 5LNWA 3HF3A 2P1FA 3W75A 3YPIA 3LRMA 4UMCA 1DVJA 1WA3A 5FEXA 3WK3A 5TQLA 1Q6LA 2VFHA 4EOUA 1OX4A 4I9AA 5LHFA 3NG3A 1A5CA 2CLEA 2OT1A 3NL2A 3BLEA 1T0OA 2DU2A 3H54A 4QIUA 3O63A 3JRKA 3NQ8A 3CIWA 4OE7A 1V7YA 5D05A 3HGRA 1TMHA 3TNOA 5F4WA 3NL5A 4EVZA 1H7WA 1LBMA 4IJBA 2A6LA 3HJZA 2JKPA 1KV5A 3I65A 4MZYA 3CB8A 3FOKA 2WNZA 3W7NA 3PWAA 3THQA 4CQ8A 5KSWA 3TIMA 1QNVA 3LCLA 1AMKA 1YDOA 4IGHA 1SU5A 4AHQA 5AHMA 3TQ0A 4RV8A 3VE9A 3LXBA 1TPC1 3QMSA 4QNWA 2R91A 1DBTA 4O15A 5AB3A 2WNQA 1MZHA 2ZRZA 1WAUA 1OX4B 1GVQA 1XC4A 3M6YA 2V82A 3FKRA 3S5NA 4K36A 3S0CA 3O1NA 4O0KA 4IMEA 3LLDA 4HSNA 4LY8A 4M7SA 3IRDA 5EPDA 4ZQOA 1EUAA 5FI8A 2V8ZA 3NM3A 2WSQA 5FEPA 3LERA 1H61A 3UXAA 3CTLA 1EUNA 3UWUA 5C55A 2NXIA 3FKKA 2NXHA 2NV1A 3C3NA 2I9EA 1KM5A 2Y7GA 3SW6A 4WOZA 3BLFA 4MOZA 4JX4A 3W7PA 3W7QA 1FDZA 1O5KA 4W9TA 4P61A 1HO4A 3DFOA 5AC7A 1XXXA 3EWYA 1VLIA 2ISWA 3HBLA 2B7PA 3QF0A 4MJMA 2B7OA 3G0UA 3G1FA 1IXOA 4O0ZA 1EWDA 3LHUA 1ML1A 1SO3A 5D32A 2WSYA 1J5TA 2TPSA 3MI6A 4RR4A 1OYCA 4M7TA 4CNNA 3KOFA 2ZRYA 2DJLA 3IIXA 2EF9A 3I7SA 3N34A 3TXVA 4RLIA 4IPJA 4RKAA 1MO0A 3UPWA 4XKYB 3W9ZA 3MYOA 1K03A 4Z1CA 4AWUA 3NL6A 3ABOA 2QAPA 5EMUA 1TJPA 3UWYA 3LI1A 4JTEA 3P81A 2X16A 1PE1A 1OG0A 4YLWA 3EXTA 3LHVA 5K9DA 4UFMA 4TU1A 4N9CA 1PCWA 4MZ1A 1DHPA 3G1HA 2ZCGA 3GDMA 2C1HA 4UR7A 3IIVA 4XTDA 1SSGA 3P60A 4DELA 3A5VA 4QAIA 2YR1A 3ZWTA 3OVQA 3NYZA 2YPIA 2NX9A 4UTJA 4NUWA 5CPNA 1SZGA 3L0NA 1HO1A 3PG9A 2J88A 1OK6A 1TO3A 3M5ZA 3CC1A 3IIZA 1K02A 1KBJA 2OCZA 1PL9A 3B0PA 1KW1A 3GKAA 3M0ZA 3GXTA 3OEXA 4TO8A 2YFOA 1TQJA 3PB2A 1VCVA 4AHPA 1QMLA 4BI6A 5E93A 2HS6A 3TKFA 2Y85A 3TK7A 5F2MA 1H7NA 3FJ6A 4NZJA 1MEWA 4ADTA 5DXYA 3W7KA 1I2NA 1SW7A 4M5PA 5LKYA 3U2OA 3PUEA 1A5AA 4OV9A 1PV8A 1IIHA 2H90A 3W72A 1OFRA 4LS2A 1EB3A 2H6RA 5AOUA 4OV4A 5F4XA 4Z0JA 2YYTA 4NXKA 1DJNA 5D04C 3STGA 5DBTA 4IXHA 1UBSA 4GE8A 5DBUA 3W7OA 3W84A 3DKJA 1H62A 1OX6A 3L5AA 1R2SA 3DBPA 1TPUA 3DXIA 1KA9F 3BO9A 4JGDA 1ZFJA 4O8RA 4LVFA 1G69A 3I7RA 3HG4A 3GDKA 1JRCA 3W1RA 1NEYA 4JTJA 4XBSA 4OHQA 1OHLA 2ZFAA 3HPXA 1YTEA 4TMBA 2GQ9A 1DOSA 1V5XA 5MHBA 1KBIA 4AEOA 5AYZA 3W87A 3JR2A 3QC3A 1VGAA 2QR6A 5CPOA 1ZENA 1VJIA 4N02A 4JDBA 3A9IA 1OYAA 1UB3A 5HQEA 3KFTA 1B4KA 4E2DA 4LVDA 3C6CA 1RQEA 2FTPA 3VKJA 4FX7A 2BZNA 3LXCA 2C13A 4A2SA 1QO5A 3HGJA 4HSOA 5I3HA 3GB6A 4OGZA 2YZRA 3VI2A 1OK4A 3T7VA 2E77A 4A29A 3P8JA 1J2WA 5LHEA 5HR6A 3C2RA 2VFFA 2Z6IA 2W79A 2ZYFA 3LBMA 4MFDA 3QPYA 4UFIA 3W1QA 2BTMA 3MP3A 4WD0A 2AQWA 1A5SA 1BWKA 2A85A 1JCXA 1ICSA 3BG9A 4LRTA 3IGSA 1A50A 3IIPA 1XI3A 3W1XA 4MYXA 4UUIA 1GOXA 1WQ5A 1H50A 2ATSA 1JR1A 2WKJA 4K7VA 3CEPA 4ZQMA 2QAFA 4X9SA 3TAKA 5BRBA 3W86A 4K8EA 1K7XA 3LCFA 5CZJA 4Z1DA 2QJHA 4HN4A 1H63A 4A2RA 4GUHA 3DI0A 2V2DA 2W6RA 5I3GA 2C14A 4PTNA 1DQWA 3PBWA 4MY1A 4M6PA 3LCIA 1D3HA 3IGUA 4UXDA 1H1ZA 4NQ1A 4WX2A 4DF0A 2CZFA 3O16A 4LUIA 4QNEA 5F1VA 4IMFA 4O1CA 1Q45A 3BGJA 1TPDA 2GQAA 2RDWA 3LX9A 3EXSA 3WJXA 4IQLA 1AW2A 4I7VA 2DZTA 3RF9A 2J24A 2ZRVA 3TROA 3GZ3A 4DO5A 4YCPA 3KVKA 1XBYA 2QJGA 2WJZA 1BKSA 5FF7A 4WXZA 5AYXA 1TSIA 3GYEA 3NO5A 3CLMA 1SZFA 3IVSA 2FQIA 2C0AA 1OFQA 3A5FA 3W7JA 4IXXA 4WJEA 2NX3A 1HTIA 3TA6A 4JY8A 2Z6JA 3R13A 3HO8A 1YTDA 1W3NA 2YGYA 2PCQA 4NVTA 1B3OA 1LLWA 3BG5A 4Z08A 4HPXA 3GNDA 3LV5A 3QQ0A 1KM4A 5DCEA 2G96A 1YXDA 2DJXA 1Q3NA 4JX5A 1JQXA 2YFNA 3WJYA 1YPIA 4WUIA 3UY8A 2BXVA 2RH9A 2QUUA 3DHFA 3W22A 4WXYA 2CW6A 3EB2A 4GNJA 3VNDA 4JTHA 2NUXA 1M7OA 4BI5A 4CQAA 4TR9A 1NF7A 4Q4KA 5CPLA 5FF3A 3STCA 3O15A 2CU0A 4O4VA 2C6QA 4NNBA 2NUYA 4RCXA 3O07A 4ZQPA 4XBKA 1VYSX 1YXYA 4CLMA 5F2IA 3DFTA 4PFMA 3W7HA 2CZ5A 2I1OA 2Y7EA 1X7FA 3DKLA 5CSSA 1L2UA 2VENA 2ISVA 3DZ1A 4NU7A 4MIMA 1RVGA 2XN2A 1U5JA 4FF7A 3CWNA 2FB3A 5A5WA 1NAL1 1OVDA 1H7XA 4OU1A 1LOSA 1TV7A 3PY2A 1P0KA 2IQTA 4PC8A 2DORA 3I68A 4U28A 4DBDA 3L68A 3KAOA 4RK8A 3C4UA 3LHWA 4B5NA 4GRSA 1IXPA 4JXCA 4FEZA 1X6UA 1O94A 3MW7A 3P8IA 5I3FA 1EA0A 3NOEA 3DFQA 1ZY9A 5HULA 1SO5A 4UIOA 3RLUA 2YXGA 2PRMA 1OYBA 2PURA 4JD4A 4S2CA 1BWLA 1TJRA 3WJZA 1FY6A 4HNNA 1FBAA 3R8RA 1EX5A 2E5BA 1TCDA 2D73A 3W1MA 3HGSA 1EWEA 3TQVA 2DZSA 3KRZA 3CU2A 3IIOA 5BMWA 1K8YA 3W76A 2Q3RA 3G8RA 1I2QA 4ZQNA 4RXGA 4ADSA 1ZAHA 4NJHA 3W1NA 2FB2A 4C1LA 3M5VA 3NAVA 3WK1A 3TX9A 4JICA 3ZS4A 3W1UA 4N6FA 3QZEA 3W2KA 2AGKA 3F4NA 4JTTA 4WOQA 4R34A 3W2MA 3NQFA 1A5BA 1W37A 4LC8A 5FESA 4N4PA 2ISSA 3P84A 4UTHA 4ONVA 3P82A 4M6VA 1J4EA 1SW3A 4GUJA 5AC6A 5AHLA 1XFBA 2TMDA 2CLKA 2R8WA 3UXDA 4O11A 4IMGA 3E02A 3PSVA 1JVNA 2ZZ6A 2C18A 4UFHA 1G4TA 3GXNA 3NQ6A 4JIPA 4LRSA 3TW6A 5LNRA 1YXCA 1BTMA 3L66A 4O1DA 2Q8ZA 3LTPA 4LW7A 1E51A 5KZEA 1OFEA 4LNYA 1GJPA 3S8HA 1GG0A 4TX9A 3GK0A 2NLIA 1XDMA 2YSWA 1JQVA 4UNLA 3RU6A 3UWZA 2G97A 2QCFA 5DN1A 2B4GA 4UFLA 3L0GA 3CEUA 4LVAA 3DU0A 5BMXA 3PF3A 2F84A 1ZAJA 1XUZA 2KZHA 4UTKA 1TTPA 1PHWA 3D0CA 5C2XA 3M44A 3WK2A 1R2TA 3LLFA 3B05A 3E12A 4JIQA 3LRKA 2WO5A 3NGJA 2CLIA 4HNVA 5D38A 2V81A 4JDYA 4JEQA 3NZRA 3BW4A 5CGQA 5EY5A 1M5WA 2X1RA 2RKXA 3PBYA 5IBXA 3R2GA 5HWNA 1LORA 3BW3A 1FWSA 2XN0A 2JGYA 1SFJA 1LCOA 3NR0A 1TV5A 3TMQA 2RHGA 1LOLA 2OT0A 4BI7A 4HHPA 5EKYA 3NVTA 4NXSA 3LB0A 4POCA 3P74A 3BVJA 3S1VA 3UZJA 1ME9A 3DHDA 1IXQA 2ZZ1A 1TPWA 3W88A 1OF6A 1G4PA 1W54A 3LBCA 4GUFA 4LV9A 4UMAA 1TYGA 7TIMA 1Z42A 3G3MA 3NQ7A 1SZEA 2UV8G 3T78A 1PCKA 3QRHA 2E6YA 3W07A 3T40A 5F1UA 4PCFA 2V30A 4Y9AA 3O6DA 4Z1AA 4FHAA 4A22A 3TE9A 1D9EA 1TRDA 5K9CA 1SFLA 3LHZA 1L6SA 4KFPA 5D33A 1RPXA 4IX0A 6ALDA 1VCGA 3GX9A 3KRSA 3MHFA 4R53A 1LBFA 2VFDA 3W1AA 2HS8A 1FUYA 4ORIA 1GWJA 4XWUA 1FX6A 1FWRA 1GTHA 1G7UA 1W56A 4ZMGA 4OQVA 1K7FA 1KFEA 3Q94A 2VEPA 3W71A 1QWGA 3TFXA 5D2TA 4LWWA 3C0JA 3E96A 1O4UA 1K7EA 3NQCA 1VLWA 4HT3A 4O17A 4Z0SA 1HUVA 1F2JA 5K9XA 3W7EA 4HPJA 2X1UA 3I6RA 2WQPA 5LGXA 4YL2A 2CLMA 1OFDA 2ATMA 3G1SA 2FPTA 2QF7A 1WBJA 3IVTA 2NV2A 2ZDRA 1FDYA 3ABRA 1VHNA 1GZGA 4EF8A 3QJAA 1LLZA 3PS7A 3OHIA 5CZ0A 5HNRA 1WOBA 5D09A 2ZQ0A 3C2VA 3UNDA 3O6YX 3F03K 4O10A 3SSJA 1JJKA 1EEPA 4AF0B 3PUOA 1I2PA 1UUMA 2ZBTA 2A7RA 4FNPA 1JCJA 3DI1A 2VFEA 4BK9A 3L65A 5G2IA 4OT7A 1FCUA 3NQGA 2YW3A 1Z41A 1KFJA 1I2OA 4AHOA 3QPZA 1VYPX 3SR7A 1B4EA 3TSDA 3B8DA 3QSTA 3LCXA 8TIMA 4BWLC 3LRLA 1VCFA 5CKSA 3LCGA 2V2HA 1XL9A 3IGXA 4JR5A 4KFOA 4M6QA 2GVJA 3TC7A 3QQ1A 3THAA 4FNSA 3QSRA 1F73A 3FS2A 4ZQCA 1FWNA 3AO0A 1TTJA 4UR8A 3WJWA 4KKXA 2ZA2A 5AN7A 2WOQA 5KITA 1QOPA 4LC6A 1Z48A 4O19A 3PB0A 3N14A 1AG1O 3N73A 1EIXA 3UPBA 3M43A 4UTIA 2J6XA 4IOTA 3LOTA 4ZZ9A 4FIRA 3HPZA 3QYQA 3NPWA 4NX0A 1QPOA 1B57A 1CI1A 1G4SA 3PBUA 2JKAA 2QCGA 2QKFA 2YCEA 4DEFA 5J5RA 3RLVA 4NJJA 1F5ZA 1P0NA 4NJGA 3NDOA 4ALDA 2E5DA 5ABTA 5K2ZA 1GYLA 3N9SA 4GFSA 4MLRA 1G7VA 3SGUA 3ATZA 2H3DA 4WY0A 4PH6A 3IVUA 4ZQRA 3RK8A 5D2YA 5LSMA 4NNCA 3OVRA 4MPQA 1X8FA 5K7JA 3TJLA 1ZCOA 4ZL1A 4LUJA 2HSAA 3FYOA 4UMBA 4HNTA 3L9CA 3ABSA 1PHQA 3O06A 3S5OA 4UNKA 2QCHA 4MJZA 4DO6A 3LCHA 3B0VC 3DH7A 1H7PA 4R7JA 1FCBA 5TIMA 1P1XA 2HMCA 4HIBA 5AHFA 2O7QA 2BX7A 3L21A 1OFPA 4QQ3A 2G95A 1GG1A 4JNMA 1ADOA 2VXNA 4GJ1A 3PM6A 3C2OA 2ZZ4A 3PSWA 5F2GA 5BNKA 3LHYA 2ZZ2A 3LM7A 5IM51 5FEWA 1SW0A 1PIIA 3LCWA 4GUIA 5H2ZA 3W7DA 4O4WA 2AAMA 5EL1A 1XDLA 5DXXA 2VOMA 3QH2A 5K3VA 1LBLA 2DZWA 3M5YA 3V1PA 4DPQA 5FEZA 3E49A 2E09A 3S1WA 4C1KA 3JS3A 1W5NA 4AVFA 1W1ZA 1YPFA 3ANYA 3EWZA 3K30A 4JX6A 4FB7A 4A21A 3NPXA 3KVLA 4N4QA 1QDSA 5K4XA 2DP3A 4S2BA 3P62A 5E1QA 1MXSA 1OX5A 2QCDB 1PVNA 4A3UA 4X22A 4FX6M 1WX0A 1P5BA 1W5PA 5AFDA 1ME8A 3H55A 5KINA 1DV7A 4IPIA 2ZA1A 2EHHA 1R47A 3S1UA 4UTTA 3G0XA 1XM3A 3DENA 4O57A 3VE7A 3B4UA 3QW3A 3G1VA 4CNPA 3NQAA 4X2RA 5DLCA 4LU0A 2Y88A 2H3BA 4ICNA 4NNAA 3W7CA 5BW6A 1MSSA 3KX6A 2FFCA 3P67A 1WDWA 1BEUA 3O6CA 1KFCA 5G1YA 3PAJA 5HMSA 3QM3A 4UFKA 4Q33A 4O28A 3HMJG 1YDVA 1JCLA 5U4NA 3ABQA 1GPWA 3NXFA 1C9DA 5D2XA 2VC6A 1VH7A 4I7UA 1OJXA 1VC4A 4O18A 6TIMA 3NL3A 3MHUA 4XTIA 2C19A 2VEKA 3G3DA 3SIZA 2TRSA 3C8FA 2CZDA 1TQXA 4GWEA 2QUVA 3NNTA 3MO7A 2E1DA 1W3TA 2OX1A 3G8EA 3OIXA 3TU9A 1C8VA 4P2VA 3W7LA 3OG3A 2CZEA 3GIYA 3STEA 5L9FA 3QW4B 3N19B 2CLOA 3P5YA 5LNUA 1OFAA 2XFWA 1T96A 2QUTA 3PBVA 4MZ8A 1QPRA 1VPXA 3ZR4A 5LZLA 4QSHA 5C5YA 4S1FA 1I45A 5EYWA 2JK2A 1QR7A 3M5XA 2ZTJA 3PC0A 2X30A 3MJYA 1O95A 5HJLA 1RR2A 3A24A 3FEMA 1YADA 3NQDA 2ZRXA 3DGRA 4RZ4A 1H7OA 4O50A 3W2JA 2I14A 2C3ZA 3HOJA 1RD5A 3HB9A 3RMJA 3SZ8A 2VEIA 5EBUA 3R5EA 3TSBA 4FNUA 3EX1A 3G24A 3IV3A 4N9EA 1H60A 4OWGA 4JYFA 1TV8A 3H53A 1Q6RA 5FF2A 1W5MA 1DJQA 2RDUA 3L0KA 1SR9A 3RNDA 4RX0A 1U83A 3SFKA 2VELA 4KWWA 4EWND 2E5CA 1YYAA 2PC4A 2VEMA 2G5WA 2X2GA 5D2VA 2NZLA 3PG8A 1WYIA 1TPH1 5FF0A 5G4WA 3GR7A 2A21A 4JYDA 3U8GA 4O14A 2C15A 1H1YA 1WOAA 4IWWA 3TDFA 1QPQA 5GVJA 3W6YA 3MI2A 3USBA 1OF8A 2Q8LA 4DO4A 3OVPA 1LP6A 3B04A 3P61A 3G18A 4ORMA 3BW2A 4LVBA 1SSDA 1NVMA 2QDGA 4O52A 4Y8FA 3UWQA 4Y96A 1AK5A 1AW1A 1KV8A 5G5IA 2RDTA 2P10A 3GKFA 4JS3A 3Q58A 2CLHA 4R33A 3UD6A 4GC4A 1LZOA 4H6KA 3UYCA 3CIXA 4N6EA 4D2JA 1Z44A 3F1QA 1FWTA 1G4EA 2NX1A 3HIJA 1R2RA 3INPA 2EKCA 4N2YA 2GJLA 2WNNA 3KVJA 1XBZA 1KM0A 3DFSA 3C2FA 1AW5A 2FDSA 3LI0A 1RV8A 5CG7A 4QITA 2CWNA 1VS1A 1O5XA 4JTGA 4YXGA 1TTIA 5HUOA 1KTNA 4K37A 1DL3A 4QM1A 2YYUA 1KM2A 2J9ZA 3S42A 5SWUA 2GVGA 1L6YA 3TSMA 4I7WA 3GNNA 3RFAA 1LRTA 3B0UX 1QPNA 3EWBX 3U6WA 4YMZA 2J9XA 1UCWA 1TPVA 1SPQA 1VHCA 2QEZA 3EWXA 3L5LA 4EF9A 3QMRA 3HG5A 1R46A 1JRBA 3B06A 2DZPA 2ZRUA 1UJPA 1K8XA 1NSJA 2E6FA 3C2EA 4DPPA 3GAKA 2CFFA 3M16A 4LTSA 5D2WA 1ME7A 4KFNA 2Y63A 2ABBA 3CQ0A 2W0UA 3E0IA 4OBTA 1KLYA 4NT0A 1OABA 5G2HA 4TMCA 3KVMA 5D37A 3TC6A 3EX4A 5I3IA 3EWWA 1SO6A 2E68A 1RZMA 4H4IA 1P4CA 3EEGA 2CLFA 4UCGA 1KM6A 5E0KA 2WV8A 4L4LA 1ZHAA 2QCMA 4O13A 2GOUA 4PL2A 2QCEA 4JY9A 3HGOA 4K38A
chains in the Genus database with same CATH superfamily
3TXZA 4DJEA 4B90A 2A0NA 4PUDA 3UWVA 3R0KA 4WCJA 3NA8A 4KIRA 1L9WA 5DCDA 1HKIA 2A7NA 1UKQA 1CGVA 1W1PA 4AF0A 3ARQA 2WCAA 3PNUA 4FMVA 1O7AA 3WQVA 4S3EA 3BPWA 3VYLA 1ONRA 3ITXA 3JVAA 4EXQA 3R6IA 4HHMA 3K2GA 3QEZA 4IJCA 5D8WA 4H2CA 4MJ2A 1YTKA 5FF4A 5HATA 3BARA 1E56A 5A8GA 1KFKA 3GM8A 4CQ9A 4CQCA 2J7GA 4P8VA 1OG6A 3MUXA 4WY0F 2NXGA 3DBNA 4MF4A 4F0MA 1R3SA 3O05A 1B3ZA 3MSYA 4JTKA 3ITGA 5K4ZA 3EB3A 3TTSA 3CM4A 4GYFA 5DEZA 4O53A 4P5UA 2C1IA 3KXQA 2WJDA 1IWBA 2ADAA 3E5BA 1W0MA 1P0BA 2WM1A 1HVQA 2AMXA 1IZJA 1QI2A 1DIDA 3C61A 4FLRA 2GJRA 1F9CA 2VFGA 5C70A 2Y61A 1SFTA 2QUMA 3C0LA 2V5LA 1UZHA 1GQJA 1CW2A 4NP7A 3SRDA 3ARYA 2G3FA 1P7TA 4M0XA 4M19A 3MZ2A 1ONWA 3QHOA 1TB3A 5A1AA 2PDPA 3LDVA 3ARWA 4CCDA 4MM1A 1MW1A 4EPEC 4KWVA 3AWOA 1SMDA 5F4SA 3UVIA 1KFLA 2ASHA 2FHCA 1POKA 1JUBA 3N4AA 5KZMA 2I56A 1L6FA 1GVSA 2ABAA 1XHGA 1PZ1A 1C8XA 2F8QA 2QJJA 1FWCC 1BG4A 3UWWA 1SUXA 3EX6A 3W25A 1Q6OA 1GCYA 4ZCWA 5C9WA 3GAYA 2MANA 5A8NA 4GIEA 3LPGA 3RXZA 3M41A 5CPTA 3E6EA 1WZAA 2J7DA 2W5FA 2YX0A 1YE6A 2ZICA 3MDWA 3P14A 2FGBA 3FYPA 3L67A 5CGTA 4FNTA 3RN6A 1DJGA 5KMYA 2WZHA 3NPVA 2DZUA 1WDQA 4GQQA 3DAQA 4N9DA 5I6SA 2J4GA 1VBGA 1DP0A 3OA3A 3EKLA 4BWLA 3NCOA 3PVFA 3L23A 1H5VA 3AIRA 3M9YA 1EBHA 4WDXA 1K3UA 1Q13A 4ZO9A 3SY5A 1EL3A 3OLGA 3E0LA 1BKHA 2E6AA 3D3FA 2GLKA 3KTXA 1YIXA 2WSPA 4UTMA 3EDFA 5ABFB 4XIMA 1IQ8A 2XM2A 1XRVA 2RGMA 4L9YA 3ABXA 2VRQA 1NFBA 4H7ZA 3W1LA 1QASA 4AXKA 2E6DA 4L6HA 2XM1A 3KBMA 1W9VA 1M41A 2DPEA 2JF7A 1DHKA 2BGQA 1ICQA 1VRDA 2BSLA 4C7FA 4BHYA 3FLUA 2PU1A 1A80A 3W2NA 5TBOA 3OBKA 1JAKA 1F05A 4JCLA 3VIGA 3MP5A 1RD6A 1PEZA 2Y7DA 1JPIA 4WDTA 3SCUA 4LB4A 4WLCA 1EQCA 4OECA 2ZXBA 1VFOA 2X0YA 1AMYA 2FZ9A 3UG3A 3GXPA 2J8GA 2C16A 3OLEA 2PWUA 4LUSA 4XD6A 4HMNA 1SZNA 2ZZ5A 3LM3A 2J13A 4UTTC 1QK0A 4PBEA 4UTWA 2OODA 3T55A 5ENLA 5KTLA 1Y0EA 1CBGA 2POTA 4LAUA 2P5NA 3FIGA 1GVOA 2HTMA 5E0CA 3VOHA 1QAPA 3VD5A 3EEZA 4QJ1A 3OG2A 1QBBA 3V75A 2ZZ3A 3LY0A 1V6TA 3MC5A 2GVLA 3BGGA 1I8JA 1QOQA 1FHLA 3WLRA 2MUCA 4N7QA 1TA3B 4HNUA 3A3HA 1O12A 1G6CA 4JQ3A 1MQQA 3ZSSA 2OMAA 4S3CA 2PGFA 3W73A 3AYVA 5M17A 3VNKA 4Q8MA 5CZTA 3CUZA 3CBWA 1G67A 3UXIA 3MMTA 3N3MA 3GDTA 2XSAA 4L4MA 3AUJA 1R85A 3W7IA 1F6KA 3GUWA 5AKQA 4B92A 1UUOA 4IL0A 4DJFD 1QVBA 4AMAA 2GUYA 1BTCA 1X1OA 1SR0A 1K8ZA 2A6NA 2OZ0A 4HNCA 1ZJBA 1WDRA 4ERAA 3MP4A 2V2CA 4LOCA 2OLSA 4JKMA 2B0MA 5ABHA 1VR6A 5HXMA 3AS2A 3GR8A 1ALDA 2OQYA 3NJ3A 4GK8A 3KL0A 1B54A 2FJKA 4EIVA 3FJ4A 3N2MA 4E3VA 2ZC8A 5BZAA 2Q6ZA 3NZ1A 6CGTA 4MLJA 1GJWA 2O7SA 3HFYA 5AHNA 2QJIA 2Y62A 3SCQA 3GH7A 1A3XA 4CU7A 3VILA 3HA1A 1YLVA 4MY8A 1H51A 3S83A 1GYNA 1V93A 4E8CA 4JYEA 4F2TA 1T99A 3SGZA 1K9EA 1WNOA 5CH9A 2NWSA 4M24A 4AXNA 1JULA 3FA4A 4LYQA 4UOJA 2PRHA 2UY5A 1FWWA 3OVGA 2VCAA 3RCMA 4G1KA 2NQZA 4MPKA 4JTFA 5C9UA 2NVCA 3M47A 4CNOA 4E0CA 2WMIB 4X3ZA 2BY0A 4PGLA 1IEIA 4C6BA 3N6JA 4XVEA 5RUBA 2CETA 2A7PA 1ADDA 4HK7A 3V0SA 5H1WA 3MTWA 5AYYA 1G1YA 5D03A 1R86A 3EX2A 4GUGA 3OGSA 2DZAA 4GX8A 1B30A 4UTLA 4Z2LA 3GNXA 4NIRA 4KRZA 2GK1B 5DF0A 4L80A 1FFRA 1EP3A 1QO2A 3GLCA 3W75A 2GDVA 3IJ9A 3MDUA 1WA3A 3GW3A 4EOUA 4H19A 3QY8A 4DRSA 1XIBA 1EBGA 4PYSA 2DU2A 3TTYA 1GONA 1HX0A 3L2MA 2RJHA 4E5TA 1FHUA 3NL5A 1JZ6A 4PRTA 2A3EA 4EVZA 1Q7QA 1LG2A 1CGTA 1KV5A 3REQA 4A35A 3J7HA 4W87A 3W37A 3AMLA 1XX1A 1S1PA 1ZJAA 4F2UA 3W7NA 3CO4A 1P6WA 3TIMA 1QNVA 4ACYA 3WQ6A 1E1FA 1G5AA 1Q6FA 2CIPA 3NTYA 4RV8A 3TQ0A 3A64A 8RUCA 1FRBA 1WAUA 1XC4A 2ZUTA 2HDJA 2V82A 4K36A 3A3XA 4O0KA 3IRDA 5EPDA 2PDIA 1EUAA 3CTLA 1EUNA 2Z2BA 3FKKA 2NXHA 2NV1A 1TJ2A 4MAVA 3A12A 4M8UA 2HCVA 4P61A 4W9TA 3DFOA 4NAFB 4AFYA 1XXXA 4GQ0A 1Q2SA 1U30A 3TJ4A 2GVEA 1B0IA 1VLIA 4RE0A 1AH4A 4L6DA 3U3HA 3FCPA 4H8HA 1IXOA 1EWDA 3LHUA 1UH4A 3CUHA 5D32A 2FTWA 1J5TA 3QR0A 3MI6A 4FR6A 4GIYA 4GVFA 4A3YA 4IPJA 1ZBWA 1E5JA 1R38A 4LY4A 2ZVIA 2QAPA 1C91A 1R9XA 2X16A 1PE1A 3EXTA 4GIAA 2FZBA 5K9DA 4TU1A 4N9CA 3VZZA 3VZXA 3G1HA 1M3UA 1VB9A 3GDMA 5BU6A 5CJMA 1SSGA 4ZTXA 2I5GA 4K1WA 1SZGA 3L0NA 4NKCA 7PTDA 1OK6A 2HE8A 3QC0A 4JEJA 3WH7A 1AODA 4FS9A 1E9YB 1F3XA 3CC1A 3IIZA 1K02A 2PTZA 3GNRA 2E67A 3OEXA 3HQOA 3KOWA 3ZR5A 1TQJA 2Y1HA 4NYUA 3TK7A 3H7UA 4GYJA 4ADTA 1T8QA 5DXYA 1I2NA 1SW7A 3TTEA 1US2A 3RGTA 3NO1A 2XVKA 3W26A 1CDGA 4WEVX 4LS2A 1EB3A 5F4XA 4Z0JA 5DBTA 4D6FA 2GJPA 2OO0A 1XYCA 4ZB0A 1V3HA 2Z7GA 3VIOA 1E5NA 1QRQA 3LNMA 1J8VA 3BO9A 4X63A 2PLCA 1HJWA 1NOWA 1FHDA 4LVFA 3OJGA 3HG4A 1VFSA 1OB0A 2Q71A 4JTJA 1XRSA 1UQYA 4GYKA 2J62A 1HN1A 5CJ5A 1UBPC 3MWCA 4NASA 5B7ZA 4RV3A 2CZVA 1KBIA 3KUMA 5AYZA 4MWAC 3W87A 3QC3A 4KESA 2QR6A 3K4AA 2RAGA 3L4UA 4F0LA 2OYMA 2V3DA 2OR2A 3RX2A 4AX7A 5CBJA 2ZX6A 4FX7A 2ZC1A 1EDTA 1DJWA 2D2JA 3NWRA 2IKJA 4I5XA 3HGJA 4CEUC 3VNZA 1OK4A 2E77A 3LMYA 2OG9A 3P8JA 3N2OA 3GTFA 1J2WA 3C2RA 4FA3A 4IM4A 4WKAA 1ZL1A 2W79A 2ZE3A 4ZEPA 2WZEA 4MFDA 3BLLA 4MGGA 4DXXA 4HOWA 1UOKA 2BTMA 3MP3A 4JAWA 2YB1A 3WNPA 3IIPA 2GSJA 2Z1WA 4UUIA 1JFXA 2ATSA 2WKJA 4K7VA 4LAOA 4P7LA 1R0MA 2FKPA 1DJIA 1E9ZB 4ZQMA 1N2VA 5BRBA 3KCLA 1X97A 3LCFA 1FWGC 1CLXA 1B2YA 3GU2A 5DQPA 4GUHA 4WDWA 5HJXA 1DXIA 5I3GA 2C14A 3PBWA 4MY1A 3IGUA 3O2LA 4DF0A 1NQ6A 3QLDA 4IMFA 3CB3A 3LX9A 2DH3A 4DJDA 4LGXA 3WJXA 3F4VA 3GZAA 4I7VA 2DZTA 4S23A 4YCPA 1RCXB 1TUXA 5C7VA 1CWYA 1XBYA 5C7HA 2WJZA 1BKSA 1TA3A 3BLPX 4X61A 4L7ZA 3GYEA 3IVSA 4HTBA 4W7WA 4P7NA 1OFQA 3W7JA 4Z42C 4WJEA 3VDCA 1E3XA 1HTIA 3PTDA 1V3LA 3BQ6A 3QHNA 4QSFA 1K4HA 1W1A1 3GVQA 4NVTA 1B3OA 4GXPA 2C91A 1UWAA 3GW0A 1LUCA 2O92A 3V5OA 1E0VA 2G96A 4IL2A 1PX3A 4JX5A 3URQA 3WJYA 3GVVA 3UY8A 2BXVA 3QQWA 4NHVA 3DHFA 4W8AA 3IRSA 3W22A 1XLLA 1W2PA 4GNJA 4LYPA 4D9PA 4QLKA 1M03A 2FYMA 1O6IA 4BI5A 1NF7A 1XWYA 4M56A 3GBDA 3STCA 2CU0A 3W00A 1XH2A 1BXCA 3LYEA 3UZXA 3CL7A 4XBKA 5DMLA 1RBOB 3W7HA 2WMHA 2Y7EA 2VZOA 1AQMA 4I9JA 1VD6A 2PDUA 3DKLA 5CSSA 1W1VA 1L2UA 7A3HA 4M81A 3W28A 2PDLA 1CXEA 4FF7A 3TZNA 2DVUA 1QU4A 1NAL1 1LOSA 1UYQA 2X0HA 3LEPA 3I68A 4HOZA 3C4UA 2GZXA 1LQ2A 3M0JA 1E6PA 1F6YA 4FEZA 3RIKA 3KM8A 3UGRA 1O94A 3MW7A 1W6TA 2W63A 1Q66A 1SO5A 3T8LA 2GGEA 4Q7IA 1BWLA 1E9LA 3CNYA 4EP8C 1S2TA 4JZ5A 3QR3A 1MZRA 2XDFA 2DZSA 4HYWA 1FA2A 3CU2A 3VCCA 3IIOA 5BMWA 1P1MA 1K8YA 1NH6A 3K4DA 3BAJA 4GKTA 4W8LA 4RXGA 3VIFA 4I8YA 4C1LA 2MNRA 2YDRA 4ACZB 4QTGA 1U5HA 3W2KA 2XH4A 2VX5A 3W2MA 5M5DA 1A5BA 1ZBKA 4JOMA 1W37A 5FESA 5BXSA 4N4PA 2ISSA 2ICSA 5I23A 3AIVA 2XZ7A 4GUJA 3CV6A 1HZYA 1NELA 2WM0A 1L6GA 2DIKA 4Z1YA 5AC4A 1QHZA 4V15A 1QNPA 1XIFA 4LUYA 2C18A 1B1YA 4JIPA 3TW6A 1YXCA 3WF2A 2VGGA 5EMLA 1JD9A 4XAZA 4LNYA 1GG0A 2HQAA 2NLIA 2V67A 3T0AA 2YSWA 2Z7KA 3U0HA 3MVIA 2G97A 2PDBA 3KBWA 2OGJA 1BQGA 2V5CA 3CAVA 2F84A 2KZHA 1NIUA 1CLKA 1TTPA 5C2XA 1QNRA 1R2TA 2G3IA 1E73M 3JU2A 3NGJA 3U2EA 4KQNA 4AMCA 3CJPA 2V81A 4JEQA 1MFVA 2A3BA 3RHGA 2XISA 4QGCA 2YL5A 1RJPA 1M5WA 4GNVA 3PBYA 4D6EA 5C8BB 5IBXA 3R2GA 1I1WA 4BF7A 2JGYA 1HVXA 1DEDA 3UG5A 5EKYA 3NVTA 3WG6A 5JXQA 3M0LA 3ENLA 1LLOA 3UJSA 1XPYA 4JFTA 1ME9A 1B31A 4UQEA 1MXDA 3RM4A 3T8QA 1E0WA 2FHFA 3LBCA 4UMAA 1Z42A 1I9CB 3T78A 2AL2B 3QRHA 5F1UA 3AU2A 2OQLA 4FHAA 3GG8A 2CPUA 3TE9A 1D9EA 1M01A 1B3WA 4DZAA 3LHZA 1L6SA 5D33A 1A5UA 1F61A 2F6UA 2Y8VA 2V5KA 3WEZA 3H2MA 2AQOA 2V5DA 3GX9A 5BXTA 3MHFA 4R53A 1EHAA 2VFDA 1FUYA 3APYA 4XAYA 3R11A 1ECQA 3KDOA 3PUGA 1FWRA 3LG3A 4ZMGA 4OQVA 1K7FA 1KFEA 3RITA 3B0XA 1QWGA 1JGMA 3II1A 1YNQA 1A3HA 1K7EA 2PDGA 3NQCA 4FALA 3TYAA 4GVIA 4LCRA 4HZMA 4E2VA 2ATMA 3G1SA 2FPTA 1P0DA 3H23A 3JUGA 1Q8AA 1S2CA 1FHVA 3ABRA 4AD4A 3W6LA 3OHIA 5HNRA 4R9XA 4QLLA 4LNCA 3C2YA 4PMRA 5CCZA 3WKZA 4JFWA 1EGVA 4G7EA 3SCPA 4AF0B 1EFZA 1I2PA 2A7RA 2FMNA 1U1HA 3AZRA 3RO6A 5G2IA 4OT7A 2XIQA 1FCUA 3ITLA 3I4EA 4OVXA 2YW3A 4QEEA 1I2OA 3OGVA 1GUVA 1VYPX 3LPPA 1B4EA 2G4JA 3GC4A 3QSTA 3UR2A 4FXFA 4AZCA 3WLQA 4QJ4B 1XG4A 5CKSA 3QY7A 1XL9A 3IGXA 4JR5A 4KFOA 4ZB2A 4M6QA 4NSBA 4ZOCA 3WNLA 2WVVA 4I6KA 2GVJA 3TC7A 3QQ1A 4DN1A 5BXPA 1F73A 1FWNA 2FMOA 4UR8A 3QV6A 2ZA2A 3ARVA 3A4AA 1KNWA 3ZT6A 1QOPA 3WD2A 4C6FA 2VC7A 4IFKB 1REQB 1UC5A 4G7EB 1UZ1A 1GOQA 3UPBA 4KCWA 5H8MA 3FHAA 2ZX9A 3LOTA 4F9JA 4FIRA 2HVNA 3WN6A 1AFSA 1X8CA 1CI1A 3PBUA 2JKAA 5M2FX 5LIYX 1TG7A 3KZSA 3RDKA 2PLMA 3W53A 1F5ZA 4ZSUA 3L2LA 4IPLA 1J0IA 1XS2A 5ABTA 1PB0A 5T8GA 4MLRA 1V6YA 3SGUA 1GJUA 3ATZA 1DWGM 4W86A 2H3DA 4W8BA 4WY0A 3M0XA 3IVUA 2VX6A 3RK8A 5D2YA 1ZP4A 3VD3A 2P53A 5AC5A 3OQ8A 1MW2A 6PTDA 4OUEA 3S5OA 4PMVA 3WH5A 3DYOA 2UY2A 3WD1A 3GVWA 3DG6A 5MKGB 3LCHA 2PDWA 1H7PA 3PWGA 5TIMA 1UZDA 1XIDA 3AIQA 5I07A 2QNEA 1XYZA 2G95A 5I5RA 3VX0A 1GG1A 4JNMA 4GJ1A 4W7UA 5F2GA 2ZZ4A 2XGIA 2Z1XA 2ZZ2A 1PDYA 2BGNE 4YS1A 3W7DA 4TXEA 4C90A 5K3VA 1GKPA 4A8IA 5FEZA 3BAIA 2E09A 3FSTA 4MKSA 3JS3A 3P6LA 3CAWA 5A6MA 1V03A 1YPFA 1TX2A 3EWZA 4F0SA 2PDXA 2R1NA 3NPXA 2P8BA 3GFYA 4N4QA 1H1NA 2EJAA 1TR9A 1ZRQA 4TVDA 1T40A 1PVNA 1J12A 5M1TA 2CBJA 1WX0A 1P5BA 1FH8A 1W5PA 1W91A 5AFDA 1OADA 1TVLA 3H55A 4NG3A 2ZA1A 4AY8A 3OGRA 4UTTA 3BJSA 4KW2A 3DENA 3I3BA 3AISA 3NQAA 2Y88A 2H3BA 4ICNA 3W7CA 3MJMA 2FFCA 3AIUA 5G1YA 4UTFA 4Q33A 3A3WA 4S3KA 3HMJG 3QZAA 3EOEA 2VC6A 1X96A 1OJXA 3GQYA 3NDZA 2OSYA 3KWXA 4RW3A 2XFRA 2VEKA 3G3DA 3KLLA 2TRSA 1HGYA 3RX4A 3T6CA 1TQXA 3TLQA 2QUVA 2FZ8A 3MO7A 4WGHA 7REQB 1R3WA 1W3TA 2OX1A 3G8EA 1G01A 2VQUA 2DSZA 2OKTA 4KEMA 4QJ5B 3B97A 3PJTA 2Y4SA 3O9NA 3N19B 3R1ZA 3P5YA 4HTYA 4HU0A 3W24A 2XFWA 1A4LA 4IUGA 5GJNA 4MZ8A 3DDMA 3HM7A 1VPXA 5GJPA 4JQ4A 1HJUA 1C7SA 5LZLA 3OLIA 4D6IA 3GS6A 2YA2A 4QSHA 2J66A 3KBJA 2GFTA 1E0XA 1IYXA 1S38A 2BY1A 4GJIA 3VM7A 2X30A 1O95A 5FL0A 3A24A 3DGBA 3DGRA 2WMKA 3WBAA 5GQBA 2QGYA 1RD5A 4FLQA 3TSBA 3G24A 1F3EA 1OWQA 4MKVA 4ES4A 1IHIA 4IT1A 5FF2A 2VUYA 2XIJA 1DJQA 1NJJA 4RX0A 4B5VA 3R10A 3E2VA 4XG1A 4H01A 3SFKA 4HA0A 1DWHM 1OZMA 4EWND 1S5NA 3TYEA 2PC4A 2D23A 5D2VA 1O5RA 2C7FA 2NZLA 3E74A 3PG8A 3PZ9A 1TPH1 2WHJA 3GU9A 2GVYA 3S46A 5A69A 3ZVHB 4GJJA 4JYDA 3RJYA 2VCBA 1H1YA 1WOAA 3SQSA 3USBA 1QW8A 1LP6A 3OZPA 2ISFA 4HHLA 2PGEA 1VBJA 3CUFA 3OODA 4H9VA 1ZLPA 1TE6A 3KOZA 4RPPA 4HJWA 4FI4A 5G5IA 2P10A 3ITCA 1PWMA 3V1HA 1CGXA 3L7RA 4KEVA 4KRTA 1FKWA 4ATDA 3UYCA 1EDGA 1BAGA 2ZX8A 4C6JA 1QW9A 4GACA 1PTAA 4D2JA 1Z44A 4Q3MA 1RLCL 1XSIA 4AZ7A 2EKCA 1WO2A 2WANA 2GJLA 1E6RA 1KM0A 2CHNA 1LT7A 4AVNA 3C2FA 1JPMA 3EOSA 3U48A 3DC0A 1UD2A 4LAZA 4JIIX 2PDMA 4QM1A 2YYUA 3ES8A 3WF4A 1OCBA 2QV4A 1L6YA 3RFAA 1RUSA 2VURA 4LUTB 4YYCA 4LUSB 1UCWA 3BTNA 3EWXA 1WUFA 3L5LA 3M0HA 1W2VA 3WX7A 1EGMA 2CKRA 1GVEA 1UJPA 1TCMA 3K8LA 4TTUA 4HU3A 3GAKA 3M16A 1KWGA 5D2WA 1ME7A 3CQ0A 3SQLA 3IJQA 2XVLA 1I1XA 1CEOA 3Q67A 1JZ4A 5I3IA 1H49A 2E68A 4H4IA 4CUCA 4UCGA 4Q8WA 2WV8A 2C8NA 3DIPA 1PIFA 1C93A 4O13A 1Q6EA 2QCEA 3HGOA 5CAHA 1NF0A 3H8AA 4UTWC 1I0BA 1Q65A 3NPUA 4H83A 1R3YA 3V0UA 3DFPA 1XDJA 1V7AA 2WHMA 2YBUA 3BG3A 4LV4A 1UR3M 5HWMA 4AU0A 3MUY1 5I3KA 3M1ZA 1AJ0A 3SY1A 5CZKA 3VOFA 1ZJIA 2OB3A 4FIQA 4W85A 2JKEA 3R89A 1UUQA 3LGEA 1RCOB 3L4TA 3IEBA 3TYUA 2ACUA 3CLWA 1UROA 1MMFA 1EYWA 3GVGA 2WNWA 3MPGA 3RRAA 2ZTKA 1PPIA 3F4WA 3QOMA 2J74A 3TW7A 4GNKB 4EPKA 3WQDA 4CD6A 3ZWSA 3TMLA 3TNBA 4E38A 5A6LA 2V9DA 4YYFA 1GNXA 4PSRA 1SMAA 3UP8A 2DZXA 5C6MA 5LA1A 2DZVA 3QMTA 1XLCA 2PZ0A 1UWSA 1FDJA 4KMQA 3HPSA 1QJWA 1YW1A 4W93A 4BEQA 4M1BA 1SZRA 2V5BA 3TOPA 3TA9A 3W2LA 4JTSA 1FXPA 4BFAA 4Z2GA 3HJEA 3AROA 3AHZA 5CPQA 3BLDA 3GWQA 1UOZA 5AVHA 4B2DA 3T2OA 4ZSTA 4PL1A 2W67A 1WKDA 3N13A 2WPBA 4PSPA 2D20A 3FAWA 3KS5A 2WSRA 4K7YA 3DFYA 5HR7A 2ESCA 1QNSA 1QI4A 4HHHA 4HN8A 3W7GA 3SN1A 2Z28A 3VABA 3FHQA 1A0CA 3SURA 1YDNA 4EXAA 4UQDA 4V1XA 3MUZ1 2X0SA 1DTNA 4BR1A 3W70A 5FIPA 1GT8A 3CT7A 3NZPA 3PUDA 4JN6A 3TJXA 1IT7A 2RUSA 4K39A 2INFA 2BMBA 1XUUA 3WMSA 3NSMA 5HUPA 2PUZA 4R88A 5ECVA 2FLIA 2OPJA 3UR7A 1LQ0A 3VCRA 3AYSA 4KEUA 1TPFA 4DBEA 2DQXA 3URNA 1ISWA 3A21A 3EPNA 2FIQA 1I2RA 3MU7A 4GXMA 3AQUA 3WSUA 1KGWA 1ZAIA 3G1DA 4EACA 1JF6A 2B7QA 1IF2A 2FHBA 1Q6DA 2WB5A 3DFHA 1XYMA 1S2VA 2DZBA 1RK6A 4QEHA 4QDWA 3NXLA 1L8NA 1JDFA 2VZUA 3TN3A 3W74A 3P5ZA 7ENLA 3PR2A 3T0TA 5DY3A 2NWRA 4GHRA 4TOQA 3UCQA 4IPNB 3BSGA 3CYVA 1QI3A 4HCDA 1PXGA 3RCYA 3UJRA 5HINA 4DI9A 4S3AA 2QV5A 4CVUA 3L5MA 5F2LA 4OKDA 5HPOA 3G1AA 3APTA 3HQ1A 2Z1SA 4F66A 3OLDA 1DE6A 3K8KA 4AVOA 1KM3A 1Z89A 5B7YA 4YTUA 3TR2A 1KKRA 3N9KA 3P7YA 3N1AA 3HQPA 1LOQA 4B5UA 4V28A 1X6LA 1RPKA 3VKBA 1J5SA 4N0RA 2EGZA 5FCZA 3UZWA 5HPCA 4LH8A 2KX9A 4RNJA 2R82A 5A6KA 3VIMA 3BGAA 3SI9A 3G6MA 3SCOA 4PN2A 2XUCA 1WV2A 1EJWC 3AZSA 1Z7AA 3VA8A 2A1YA 3QFEA 2V68A 4H6EA 4C6DA 4GVHA 3VPLA 1RQBA 1VFUA 4IG2A 2VJXA 4HCHA 3AJXA 4Y6GA 5HQLA 4JTUA 1S3HA 2ZA3A 2C79A 1XBVA 1TFVA 3DCPA 2HJPA 4NZ4A 1J96A 3RR4A 2V0TA 3APGA 4PODA 3ZFHA 1F6PA 3U5UA 4FPSA 2J27A 3CS2A 4H8VA 2OELA 2VR4A 3UJ2A 1F76A 3CIVA 4LS0A 2E8YA 2GUUA 4AY1A 2ZZ7A 4GXWA 2REQB 1OFOA 4PTMA 3F5KA 3S5ZA 4LANA 4PUKA 5FJPA 4DYJA 8CGTA 1O60A 5LNSA 3ZSTA 1HJVA 5CQ1A 1OCJA 3WDQA 1XKYA 1RVKA 1HNYA 2HNHA 3B8WA 4LB3A 2G0WA 3RR1A 2PDCA 3GY1A 5IBXC 3CZEA 4DWSA 1FXQA 4FXSA 2GSHA 3LV6A 4OFCA 3A23A 4KS0A 4GYPA 1N7KA 3QZ6A 1G9HA 1CX9A 2BHYA 2IMRA 4AYGA 2ZKMX 4DUWA 3NM1A 4PMXA 1N82A 4PTWA 4OBRA 2VDIA 1LRQA 3OZMA 2ZWYA 3CZGA 4QHRA 1ZPTA 1XGZA 2OWWA 1J0YA 3HG3A 1SJCA 4B4HA 4MUZA 4H3DA 3SECA 3SCTA 5D02A 1K1DA 2DUAA 1UKSA 3ALGA 3N18A 3MUAA 2NUWA 4CGTA 2WZIA 1AD1A 1SQ7A 1JUKA 4HKPA 5D9MA 3S9YA 1AQ0A 3CHDA 5FA5A 3BLIA 2VX4A 3ES7A 4JL2A 9XIMA 1ZU8A 2WJEA 1TWWA 1KFBA 5H91A 5LNVA 4DWSB 4DX3A 2FVLA 4WR3A 3AXHA 1M7PA 1TREA 1CECA 4QISA 2JQXA 4MG4A 5IHRA 3L2IA 1XLEA 2UWFA 1FCVA 1W3IA 1E4NA 4Y90A 1DKWA 1FQ0A 2Z1VA 2ISDA 2BBFA 5G1TA 1ISZA 2J7HA 4DJDD 4XZNX 1OCQA 2XGZA 5DT7A 4E2BA 4LAMA 1LYXA 4H8NA 5I3JA 5ECUA 1EPXA 3A9BA 1DJHA 4TTGA 4UTUA 2JF6A 5GPRA 2R94A 2VEFA 1S2UA 2EBNA 1TPEA 4M80A 2XWEA 1H5YA 3LTSA 3AU6A 1JUEA 3S47A 3S6DA 4R9OA 5FJJA 3VKKA 3UZ5A 3M64A 2VQTA 4O1EA 2CXGA 3W7RA 2X1TA 4UFJA 6XIAA 4AZCB 4GY0A 5T26A 1VZWA 4RZ6A 3G22A 3STFA 2NSOA 5AHIA 3MQTA 1X1ZA 2WVVB 3AYRA 4US5D 2WPGA 1U33A 3F7JA 5J5DA 1MQRA 3HF3A 1DVJA 5A6TC 1WKYA 1OD8A 1PJ9A 4XD5A 1TJ1A 4GGHA 4PRWA 2Z25A 1Q6LA 2VFHA 1AUSL 1OX4A 5LHFA 1HJSA 3NG3A 1REQA 1V4YA 4H9MA 1M65A 1GHSA 2PTXA 3BLEA 3R4IA 1OY0A 3HZ3A 5TF0A 3TCSA 1T0OA 4J3XA 1JCTA 1E43A 2PF8A 3H54A 3CIWA 2E40A 4CNTA 1V7YA 2VNCA 4B3KA 2J8TA 5D05A 3TNOA 2GWNA 3UESA 1M7XA 3S2JA 1AQHA 2DEPA 2J8FA 3OTRA 2JKPA 1NM9A 3CV1A 1R3RA 1KWKA 1F3WA 2J7EA 1ZZMA 4E2OA 1ZP3A 3SUTA 3THQA 5CC5A 2WYSA 1AMKA 4IGHA 2JEQA 2YL8A 2VDGA 1TPC1 4XZBA 2R91A 1DBTA 4O15A 3ZVHA 4DBSA 2XFFA 5AB3A 1MZHA 1SGJA 2W27A 3D46A 4D6HA 3I4KA 1GZ1A 3S0CA 1TWIA 2V6AA 2EG6A 4IMEA 3R25A 3N12A 4D71A 5FI8A 2V8ZA 1DWAM 3UEQA 3LERA 1H61A 1VKFA 3UXAA 3UWUA 5C55A 2OLHA 2PLJA 3C3NA 1NDVA 1JG9A 1KM5A 5A2AA 2Y7GA 2NV9A 4S38A 3W7PA 3T2PA 1FDZA 3VINA 2Y8KA 1CGUA 1U2YA 1LUCB 3VU2A 4QBXA 2IQ0A 2ISWA 3HBLA 4PTDA 2C0HA 3G0UA 4F0KA 3G1FA 1P7TB 1DJXA 3IUHA 3M0KA 1ML1A 3H2CA 4GG9A 3WIJA 1DJYA 4AZ6A 3UBPC 4RR4A 4G6CA 4M7TA 4RPQA 3GNOA 3KOFA 5FJUA 3LK6A 2DJLA 4U3AA 3I7SA 3TXVA 3VO0A 5AYIA 3UPWA 3AI0A 1K03A 4KPLA 2NQ5A 4CN6A 4UBPC 1TJPA 3QGKC 3UWYA 3BL3A 4YLWA 4LEQA 4LCQA 4KWOA 3LHVA 3P93A 2WHKA 2NLYA 4MZ1A 1DHPA 4XK2A 2ZCGA 1KBLA 3IIVA 1JZ3A 3P60A 3STPA 4DELA 3GTNA 5BROA 1K6WA 2BHZA 3A5VA 4CD4A 5LXXA 4QAIA 2YR1A 3ZWTA 1JYVA 1B9ZA 3OVQA 3T2QA 3VNJA 4Y8EA 3WD4A 4F4RA 2PGWA 2INEA 4QS5A 4LYKA 1HO1A 3RILA 3XIMA 2J88A 3DG3A 1TO3A 4IIDA 1GKRA 5A94A 2BOFX 2RGLA 3BMWA 1KBJA 1PL9A 4TO8A 3GKAA 3M0ZA 1EO5A 4ROQA 3PB2A 1QMLA 5E93A 2HS6A 2Y85A 1XQLA 3AOFA 4OJYA 3FGCA 4IHCA 3FJ6A 4NZJA 3URAA 1MEWA 2P88A 2V3FA 4M5PA 3RX3A 3WQGA 5LKYA 5GNYA 5BOFA 1A5AA 4DUOA 1IIHA 3VGBA 4TQTA 4PCNA 1V0MA 3UNTA 2YYTA 5D04C 5DBUA 3L4VA 4GE8A 1UH3A 3H12A 2WMFA 4JNZA 1R2SA 1ZSXA 3DBPA 2PPGA 3DXIA 1J0HA 1XD1A 4OIFA 1KA9F 2CESA 3SQMA 1OT1A 3I7RA 3GDKA 1JRCA 4XBSA 4OHQA 4TMBA 2GQ9A 2VR5A 1QI0A 2R1MA 3VGFA 1DOSA 1V5XA 3MMUA 4AEOA 1HT6A 3RG6A 3JR2A 1RBLA 1VGAA 5FSDC 1E72M 1ZENA 3SCSA 1CB7B 2PWDA 4N02A 5I00A 5HQEA 1B4KA 1JDCA 1EJUC 1RQEA 4LF1A 3VKJA 2Y2WA 1CYGA 2C13A 3MY9A 3WDRA 2EKGA 4Q4OA 1QO5A 2FZNA 3NYDA 5I3HA 3GB6A 1CGYA 2YZRA 5A8MA 1MNSA 4OTKA 1VPYA 4QS6A 2BG5A 1PYMA 5HR6A 1O1ZA 3LZ3A 4CN4A 3CXOA 2Y8UA 2OSWA 4S3BA 3LN3A 4F48A 1TE1A 3CPGA 5T9BG 3W1QA 4WD0A 1CXKA 3VDHA 4GLEA 1JCXA 3MSDA 4QG6A 1J6PA 1PKYA 4MYXA 4NL1A 1GOXA 1H50A 5A6AA 3GHUA 1S39A 4PTXA 2EQDA 3QVQA 2HK0A 2V3GA 1K7XA 5CZJA 2XFYA 2OGYA 1PBGA 3BAWA 4XZWA 3ZOAA 1TUFA 2GJXA 2V2DA 1KCZA 4PTNA 1JPHA 1DQWA 4WRHA 4UOZA 4UXDA 1H1ZA 3GTXA 4I6VA 4WX2A 1UWUA 1ENUA 1W9PA 2CZFA 2D2HA 1QBAA 3KE0A 1UKOA 3O16A 5IXEA 1E15A 1F8IA 1Q45A 2C1GA 3BGJA 2ZX5A 1ISXA 2GQAA 2RDWA 4IIEA 1V3MA 3HV8A 2R1LA 4J3WA 1WKEA 2JIEA 4IFRA 4UQAA 4B5WA 3O6AA 1UPPA 2J24A 2O9RA 3TROA 3MZNA 3CK5A 1XIHA 3KVKA 2VCCA 1C90A 1TR1A 1JZ2A 3CZ8A 1E4IA 5JH2A 1J0JA 4MNKA 3U4FA 3TA6A 1A4MA 1YTDA 1JYXA 1MFUA 2PCQA 1TV2A 1LLWA 3LV5A 1JZ5A 4PUEA 3B9AA 3U2CA 2AKZA 3N15A 3WUFA 3LS9A 3UPMA 1Q3NA 4PB3A 2YFNA 1YPIA 3ZT7A 1V0LA 4Q8UA 5A2CA 1YBQA 4WXYA 1M53A 2CW6A 4W84A 1UP3A 4M1RA 2YXXA 3VNDA 3BV7A 2QYGA 2NUXA 1M7OA 1BVNP 2DIEA 6XIMA 3O15A 3GHTA 3ZJKA 4NNBA 3CAQA 2YOCA 2NUYA 3I3DA 3M0YA 4Y9NA 3TEVA 4MADA 1VYSX 4CLMA 3GR4A 1OIMA 3JW7A 5F2IA 1A5MC 3F2BA 4PFMA 3DYPA 3T09A 3ZM8A 3H4XA 4UOQA 4AEFA 2VENA 2ISVA 4RNHA 4MIMA 4MWAA 1RVGA 1NDYA 1U5JA 2XN2A 2PWFA 3M4HA 1H7XA 4OU1A 2PWHA 4WSKA 3CASA 2IQTA 4GABA 1XYBA 2JEPA 1GHRA 3LHWA 4A8RA 4W5ZA 2A3AA 5HMDA 1EYEA 3CMFA 4D6GA 1X6UA 3AS3A 5I3FA 3NOEA 2EO7A 3DFQA 4V2XA 3VGGA 2YXGA 2VR2A 3WNNA 1BXBA 5E9XA 2PRMA 4HBKA 4ZENA 2PURA 1XF0A 4JD4A 4S2CA 1D2KA 2O4QA 1FBAA 4IMAA 1GQIA 1TCDA 5D9PA 3VDAA 3W1MA 1E0UA 5MF5A 4P7RA 4XAGA 3W76A 2Q3RA 2BY2A 5JMUA 4ADSA 4NJHA 3FEQA 4AC7C 3NAVA 1Q2RA 3F4NA 4JTTA 4R34A 1YQ2A 3MCNA 3PJWA 4LC8A 4HU8A 1EXBA 3TC3A 1V6VA 2E7FA 4IQJA 5AC6A 2QF8A 2QXWA 4AISA 2PA6A 4EK7A 2G3NA 4PUJA 3E02A 1JVNA 1TV4A 4UFHA 1PO9A 1G4TA 3GXNA 2E4TA 1MDRA 3BMXA 2NW0A 5TD4A 1XYAA 1E51A 1OFEA 3S3GA 4H04A 3GIQA 4IGMA 4DWDA 4HPGA 1XDMA 2ZUUA 3QYSA 1G0CA 3UWZA 2QCFA 5DN1A 3PBMA 4UFLA 3L0GA 4Y9OA 1BYDA 4I3GA 5BMXA 3PF3A 1XUZA 4UTKA 4DY1A 3D0CA 1Q6CA 1UG6A 1U1UA 4J35A 3WK2A 1EJSC 2YA0A 3M07A 1FOBA 3UR8A 3EZ4A 5EGRA 2X42A 3B8IA 5EY5A 3E2SA 4TUFA 2J7CA 3NUKA 1XLFA 3BW3A 4XZMX 2J47A 4QE5A 3TMQA 1LOLA 2OT0A 2BGSA 3ONCA 4NXSA 1B90A 1KQYA 3LA4A 3BVJA 1NP0A 5XINA 4G5DA 4ZE4A 4A6GA 3OO2A 1TPWA 3W88A 1G4PA 2GQ3A 4MTVA 3QFWA 3NQ7A 3EYPA 4J27A 1PCKA 3KW3A 1V8EA 4YTSA 4Z1AA 2D0FA 4DBWA 1TRDA 3SIMA 1O68A 3SEPA 4KFPA 3AIEA 2D69A 3BE7A 4IX0A 1XH1A 3MCMA 3B8UA 4H6RA 2WLYA 4JNYA 2AGTA 4LEFA 3IANA 3XINA 4ORIA 2Q02A 3G77A 1BF6A 4XWUA 1FX6A 2XVGA 1GTHA 2DT0A 5CC3A 2CEQA 2FJUB 3Q94A 2VEPA 1KGUA 3PN8A 3VKAA 3TW9A 3C0JA 4HT3A 4HYVA 1HJXA 4O17A 1R3QA 1F2JA 5K9XA 6REQB 2HRWA 1JI1A 3NFUA 3L4ZA 4AYSA 2QF7A 3VGHA 2BY3A 4PUNA 1JD7A 2IXVA 3SCRA 4ZFCA 4EF8A 1GZGA 2E9BA 3QJAA 4YNGA 1MUMA 1LLZA 3GU1A 1WOBA 2V69A 5D09A 5FL1A 3C2VA 4CNSA 3O6YX 2WWDA 1JNEA 1UR4A 3F03K 4O10A 3HQNA 7XIMA 3ZIZA 1V3IA 4CD8A 3PZMA 3H7VA 5CJNA 4J1OA 1JCJA 4NAEA 4D72A 1GOMA 4QAWA 2Y0FA 2JFEX 5PTDA 4QCFA 3AZTA 3HN3A 3PNZA 3QPZA 4JBRA 3BJFA 4Q8TA 3NDYA 8TIMA 4WKHA 4LFYA 1JFHA 3WLSA 4EWJA 3N6QA 2VI0A 1A5LC 1OIFA 3U4AA 3QV8A 4HCLA 1DWIM 3QSRA 5T9CE 3L4YA 3V7PA 2XH2A 4GH1A 4DJDC 1E3ZA 3EA3A 4KKXA 4J3ZA 3WENA 1XKJA 5AN7A 3UYIA 4LC6A 2HROA 3PB0A 3QHMA 1H3GA 4KT2A 4HD5A 3M43A 4E4UA 4K2SA 1GKQA 4B5SA 5FJIA 1Q7ZA 2DT1A 1CZ1A 1F4HA 3QYQA 1AVAA 3NPWA 1B57A 1IWAA 1NQKA 2DY3A 2YCEA 2X1IA 4B5TA 4DEFA 5J5RA 7TAAA 1P0NA 4NJGA 3EWCA 3PTKA 3WQWA 3B9OA 3REQB 3GG1A 4Q4QA 2BVWA 4GI6A 2WVSA 4PH6A 4ZQRA 3WFZA 3OVRA 3ZJ6A 5TAOA 4HSHA 4ZL1A 4LUJA 1JAEA 3C0SA 4UMBA 3FYOA 2QPUA 3L9CA 1ZTVA 4MJZA 4DO6A 4LALA 3H6OA 2GOKA 3OQEA 1BLIA 3PZUA 3DESA 4R7JA 1C3FA 3N4EA 4KETA 1KR0A 4HIBA 2CWXA 5AHFA 3IGHX 2BX7A 2CKSA 2R24A 1NFGA 1ADOA 1F3TA 3PSWA 5BNKA 1A5OC 3VIIA 1YHTA 4JTAA 3H2OA 5FEWA 9CGTA 3P0WA 5CSYA 5H2ZA 4O4WA 2OOGA 2VOMA 1J9YA 5HK4A 3VOIA 1LBLA 4LXFA 5CG0A 2QPSA 2DZWA 1Y7VA 4DPQA 4PBFA 1IEXA 5I2UA 1XLDA 4RNFA 4V27A 2X2YA 1LWIA 1R5YA 2QDEA 2PWGA 3BANA 3S6TA 4JX6A 1HL9A 2QVNA 4G9PA 3KVLA 2PDHA 3ZLHA 2ACRA 4MUPA 1EKOA 2DP3A 1MXSA 3WQEA 4K68A 3WLHA 3WH8A 4IPPA 4NRRA 1J79A 1EIBA 1E1CA 3S1UA 1MW3A 1W32A 2HBXA 3MSRA 4FOJA 4QE4A 2I5IA 3I6TA 4KRUA 4O57A 4JQAA 3A4WA 3VE7A 4HQVA 3NZQA 3S9IA 3G1VA 3O0FA 3UA3A 2XIOA 4LU0A 4H2HA 1K9TA 2QULA 1XC6A 3KX6A 5JVLA 3FVDA 1GW1A 1BEUA 2DSVA 3PAJA 4DWSD 4O28A 3MKCA 3NXFA 2WWCA 3TYDA 4FAMA 2PU0A 4X2PA 1VC4A 6TIMA 4L4OA 2AQVA 1HXJA 2ZX7A 2CZDA 2OLAA 3OIXA 3WQ5A 2CZEA 5A8OA 1LT8A 2XSXA 5LNUA 4GZEA 5A3HA 4GZ7A 1QPRA 1JYWA 3ZR4A 4HMDA 1AZ1A 1LJYA 4FLOA 4I5RA 5C5YA 2PAJA 1I45A 1OSEA 1OC5A 5I7GA 4MJ4A 4E8GA 1S2AA 5E09A 3M5XA 2ZTJA 3PC0A 1XR2A 3ICJA 3EB4A 5HJLA 1YADA 1SFSA 3AS1A 2VOTA 1ZCCA 4PUMA 1H7OA 2I14A 3BAXA 1QHOA 3HOJA 3LENA 2PGRA 3BZJA 3KHDA 3HB9A 4GI8A 3SZ8A 2VEIA 3AYTA 5REQA 3ARUA 5ABFA 4C6QA 4AEEA 4JYFA 1TV8A 1Q6RA 3L0KA 4F8XA 1TWSA 2QUNA 1U83A 2BODX 1X38A 1GYMA 2E5CA 1YYAA 1QPKA 3ITYA 5FF0A 3T1GA 5G4WA 2PF0A 3GR7A 2EPLX 2A21A 3U8GA 5LIKX 3MI2A 1OF8A 3OVPA 3WO8A 1FP8A 3P61A 4ORMA 3BW2A 4OBSA 4LVBA 2OKOA 2FZMA 4L56A 1SSDA 4AG0A 1NVMA 1RJQA 4Y8FA 3UWQA 1Y5VA 1GOOA 4HP5A 1AW1A 3WQPA 4ILSA 1RK5A 3K46A 4FOKA 3GKFA 3GTIA 1KRCC 1EH9A 4JS3A 3Q58A 2CLHA 2HWGA 4R33A 3UD6A 4IIBA 1LZOA 4BQ2A 4H6KA 1IV8A 1PAMA 1XP3A 3FYYA 4C1NB 2WMIA 3PZVA 3INPA 4J3TA 3NSXA 2WNNA 2ZE0A 3KVJA 3DFSA 3U2ZA 1YDYA 2EG8A 3MUIA 5DO8A 2WC7A 3CWHA 1K6AA 4QITA 3AAMA 4YXGA 3PJXA 5HUOA 1KTNA 4K37A 2V63A 3S42A 5SWUA 4GYPC 2GVGA 1BSIA 2R6OA 4I7WA 2HVMA 3WFLA 3U6WA 3TN6A 2J9XA 2PB1A 4ZTYA 4MHBA 2EEXA 3GHRA 1R46A 4TVUA 2DZPA 4QP0A 1J6OA 4URIA 1XLJA 1FH7A 4K8GA 2E6FA 4KGLA 4HZ6A 2HPIA 4XISA 2CFFA 1NFPA 2QS8A 3W4RA 4UNIA 4KFNA 2AL2A 4PMJA 3UJEA 1V3KA 1KLYA 4NT0A 1OABA 2WHLA 4TMCA 5D37A 3TC6A 4GIRA 3EX4A 1WXYA 2Q01A 1OGGA 1SO6A 1EC8A 1RZMA 3VOGA 1P4CA 4R27A 4QG8A 1OC7A 5BWFA 3VFCA 3WD3A 2PP0A 1OGSA 4JY9A 2L5HA 1N8FA 1E4MM 5D30A 3WFAA 3H4GA 3QTGA 1AH0A 4MB3A 2NQJA 4XQ6A 2E9MA 5IDIA 3OU8A 4FNQA 1NWRA 4ZVJA 3IJ8A 2DDXA 2LLEA 3TAOA 4XAFA 4RE3A 1ADSA 4MYAA 3HU7A 4ERIA 3V35A 3FY1A 3FXGA 3SCVA 2Y70A 4D1JA 3S5YA 3QGVA 1Y5WA 4X60A 3F4CA 1FFQA 2WK2A 3KL3A 1WB0A 1PKLA 3V3WA 2ZUWA 2XN1A 4W88A 1XINA 1W5OA 3FA5A 3HG2A 2ZUVA 4WJ8A 2ZRWA 3S1XA 2VWSA 3VDBA 4MNLA 3H2FA 4CQBA 3JZEA 4NZ3A 5U7SA 1EGZA 1Q6QA 1UIPA 1KGXA 1D3GA 4IP4A 5CPSA 1Y5XA 2DSUA 3NQMA 2TSYA 1ESWA 2FFIA 2YL9A 3QV9A 4D6JA 3WELA 1GOKA 2VHLA 3OZYA 5DELA 3IJ7A 4B2DD 4EAMA 2IKGA 4LAKA 4NJKA 1EEXA 1UR0A 2BXZA 3VFLA 4XV0A 4UC5A 4NI3A 1OC6A 4D8AA 4NAEB 3G5EA 4ZE5A 3W2UA 3W81A 1CCWB 3QLLA 2QJMA 3CHVA 3BC9A 3G2GA 1ZB5A 3EDDA 2I16A 3UGVA 2DVTA 3ID7A 4FR1A 1KTBA 1UR1A 1J10A 2OZ8A 3D5HA 3N6HA 2HV5A 4LUTA 3ZLFA 1YRRA 3P2VA 2EPMX 3NQEA 1THFD 2EAWA 1HKMA 1VBRA 4XSLA 3CH0A 2RDXA 3BAYA 5D9OA 4JIRA 1MEIA 1KXTA 5AZ0A 3BK0A 1DWJM 3T0DA 1KCXA 1WDPA 4QROA 2ZIDA 1JCYA 2WCSA 4L9ZA 1IR2A 3CGTA 3EOOA 1ELSA 2QJNA 4FO4A 4GO9A 3TTOA 4LBRA 2VZSA 3CHCA 3UXKA 5BOOA 1SJAA 3USZA 3R12A 4ENLA 3WNKA 3A22A 3SJ3A 5CZSA 3RRXA 4L1XA 2CLLA 4O16A 3QN3A 1DIKA 3CWOX 3W1TA 4Q8PA 6A3HA 1OFBA 1R30A 1GVYA 4KBXA 4YVXA 1YNYA 1UMYA 2XSBA 2HXUA 2X09A 3P80A 2OU4A 2OXNA 2VGIA 5EB8A 3EMCA 2PE4A 2JGQA 4GH3A 4J28A 2VZTA 3BWWA 3V36A 1JXJA 4PCPA 3T44A 1PYFA 5EFDA 2QCDA 4HJFA 1T8XA 2XTKA 5AHEA 3M46A 4BS0A 2VYOA 3FDGA 3TR9A 2P76A 1VRXA 4Z2IA 2XJ7A 1K70A 2A5HA 3MV01 5KEZA 3GE7A 1VIZA 1IXNA 5EMMA 3R94A 1QT1A 4A8NA 2QDHA 3GDLA 3NQBA 2TYSA 3OBAA 4QJ3B 4A3RA 3TQKA 3DFNA 1GVRA 3LXAA 3L4WA 1IIGA 1SO4A 5C2CA 3WBYA 2EJ1A 3W1PA 2Y7FA 1ZJHA 3WQOA 1JF5A 1B5TA 1CXIA 4XAPA 1OEPA 3LTYA 5G4EA 4M6UA 3CUXA 4KH2A 4UZUA 1WDDA 3ELFA 4CU6A 5L6UA 1ITQA 1ZALA 2P8CA 2VO5A 1KFWA 2H8XA 1WBHA 3G1YA 3KHJA 4RZBA 3ZXWA 3CZLA 3AC0A 3KTSA 4K8HA 3SY8A 2EPOA 2REQA 1WXJA 4Q4SA 2ZWZA 3COTA 4RXFA 2GJNA 3U7BA 3IARA 1LM1A 2Q3OA 3TYZA 2R1KA 2G8ZA 2Y89A 5CPMA 5XIMA 4TIMA 4MFEA 1JXKA 4HA3A 3UJFA 1HL2A 1I6NA 2F2HA 2FTYA 2XU2A 4ZO6A 4FP1A 4CCCA 2ACQA 4RDYA 2BDQA 2QMKA 4ACZA 3H24A 3WLPA 1TIMA 4DWSC 1AA1B 2GPTA 3PZOA 4NX5A 4YWIA 1JDDA 4JTLA 2PEVA 1CLVA 1E6QM 1S5TA 4YHGA 4I9TA 3TQPA 4XVDA 1QXLA 3WY1A 1O66A 3B8TA 4HZ7A 3VDGA 2TODA 3HMCA 4QFUA 4R7OA 4JKKA 3W85A 1NWUA 3LBOA 4AWTA 1TTQA 2FDMA 3MBDA 5I79A 3ARTA 2PRLA 2IQDA 3KZPA 4C6EA 5I03A 1HF6A 1YE4A 1EP1A 3E9AA 2FZDA 2XINA 1NTHA 1L6WA 3Q45A 1DORA 3WBWA 3BLKA 1TPB1 1C7TA 4FOUA 2H9AA 3B9NA 1UA3A 3GDBA 2F7FA 1K8CA 4Q8NA 3KEHA 4O1AA 4O1FA 1KM1A 3Q37A 2Z0IA 1LL4A 2Z27A 1VYRA 4DXKA 5JH1A 3UG8A 3NQ2A 2BB0A 3VMPA 4AD2A 4PZVA 2QCCA 1IEQA 2JE8A 4MAZA 2VRKA 1VQTA 1KXVA 1A53A 3A4XA 1W9BM 4Y9PA 1PWLA 1UQZA 4PMQA 4GBUA 3R79A 2A4AA 3W6MA 4PA8A 4PUUA 2A3CA 4FK9A 4MKNA 4DXVA 2YDQA 1RP9A 1GTEA 1EP2A 1C29A 4HPHA 4AD0A 5I09A 4FNRA 1M1BA 1JIBA 1P43A 1JDAA 2DH2A 2GGJA 1X98A 3G1RA 1IGWA 3EXRA 4AAJA 2PP3A 1HP4A 1NDZA 1J2BA 1ZQ5A 1V0NA 3ZQ9A 4J3SA 1JCNA 4AWSA 3GG7A 4E4FA 5CSRA 4AZGA 3MWAA 1H0IA 3NEVA 3URBA 2J9YA 4RNIA 3WDHA 2ALDA 1IGSA 1F74A 2Z2UA 4JPGA 1QI5A 5LNWA 2YDSA 1FWHC 3WZ0E 2P1FA 3CHFA 3YPIA 1WAWA 5CSUA 4JFVA 3THUA 3BCJA 5TQLA 5FSEC 4GINA 4I9AA 4K3ZA 4QXIA 2OT1A 2WKLA 3PFMA 3BZGA 4IGNA 2BP1A 1JI2A 4QIUA 1VFFA 3JRKA 3NQ8A 1XLIA 1U1JA 4B16A 3HGRA 1TMHA 4ZOAA 4UWMA 4NF7A 3BCDA 4HPNA 3ANVA 3ALFA 3F4DA 5BWAA 2QHAA 1LBMA 2A6LA 1EA9C 3HJZA 1R87A 4MZYA 4ZXLA 5DRCA 3CB8A 1GOWA 1E71M 2GL5A 2X05A 1QATA 4Q6XA 3AXXA 3IJ6A 2W91A 5KSWA 4GCAA 2P50A 1SU5A 3B9EA 4QNWA 4F79A 3L4XA 3EWDA 1P6BA 1EJRC 4GCXA 2ZRZA 3M6YA 1R3VA 2D3NA 3VIJA 3S5NA 4B9YA 4JTDA 4HSNA 3H2AA 1W3HA 1Z6KA 2WSQA 1YBQB 1UH2A 1BRLB 3RLGA 1FWIC 2I9EA 2WZMA 4WOZA 4MOZA 4JX4A 1E6NA 1O5KA 1HO4A 3OP2A 1VBUA 2GDUA 2ZUSA 3EWYA 3AWNA 4AIUA 1WZKA 4PMOA 1W3LA 3QF0A 2B7OA 3OW1A 4OOZA 1WP6A 1H11A 3RUBL 3UW6A 4QX4A 3UXLA 4J4KA 1JEZA 2TPSA 1OYCA 2GSEA 2ZRYA 3IJIA 2EF9A 3N34A 1JPKA 5H6HA 1MO0A 4W5UA 3W9ZA 3MYOA 4AWUA 3NL6A 3ABOA 1K77A 5I0DA 3KL5A 3P81A 4DAIA 1OG0A 1A49A 4GO8A 2GJXB 1BRLA 3I10A 4XTDA 3GSMA 4Y7EA 4WF7A 4MWAB 3E1F1 4MWAE 4UTJA 4NUWA 5CPNA 3C3UA 1C92A 3Q65A 1Q5MA 1PTDA 3M5ZA 4OUIA 2X40A 1Y8BA 1XGDA 3R0UA 1AQFA 2HNEA 1KW1A 3B0PA 3VD4A 2YFOA 4H6QA 1VFHA 4BI6A 5E5CA 4AZHA 3TKFA 1K4GA 3OYXA 1Q4NX 4YIWA 1H7NA 4DM1A 3NSNA 1W3KA 3MKVA 2PI6A 1GQKA 1PV8A 2DGAA 2QGHA 3W72A 3ARRA 3CUJA 2H6RA 4NXKA 1DJNA 3STGA 2X41A 1Q85A 4IXHA 3DKJA 2YIHA 1H62A 1EHNA 4MNMA 2HBVA 3HFTA 4FZIA 4JGDA 1O1HA 4PMZA 4RDWA 5E9AA 4O8RA 1POJA 2WVTA 1NEYA 1UD8A 2W66A 4P7QA 2PWVA 5REQB 3SUVA 1M04A 2EXOA 1MDLA 4JIEA 2W3ZA 3AIWA 1YTEA 2I57A 4G8TA 3R58A 5MHBA 5EMKA 1K9FA 3PHAA 2ZDSA 4EKJA 4W4QA 4JTRA 5CPOA 4XSMA 4HB7A 1VJIA 3CV7A 3A9IA 1OYAA 3KFTA 5GJMA 3DHPA 4BA0A 2FTPA 4RL3A 2BZNA 3LXCA 2J77A 1SJBA 3UVAA 2XZ9A 1Z32X 4GX9A 1GOIA 4HSOA 4PB5A 4OGZA 3VI2A 4YTTA 3T7VA 2NSXA 5AYBA 5LHEA 3WMCA 1XW8A 2R9RA 2HZGA 2VFFA 2O9OA 3QKEA 3QPYA 2BHUA 4UFIA 3S1GA 4IFOA 3BICA 4JCMA 1A5SA 1BWKA 1ICSA 3H22A 3BG9A 4LRTA 5JU6A 2WKGA 1RY0A 3VMNA 3D3AA 1N8WA 1WQ5A 1JR1A 1JPDX 3UT0A 3CEPA 2PTDA 3GYCA