4N4QA

Crystal structure of n-acetylneuraminate lyase from mycoplasma synoviae, crystal form ii
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
293
Chain Sequence
HNFDKFKGLFPAMVTPFTKDGKLHKAGVKEVVNFLVEKQKVDGIYITGSTGEFLLLSFEDKKEVMKLVAEANAGRVTLIAQIGSLNIEETKELAKLAKELKYDAISAITPYYYNFSFNETHHYYEEISKAADIPMLIYYLPQLAGVSTDQFGKLLEIKNVIGSKYGATDLFAFERLMSKYPDKLFMFAWDEALAMGLTMGAKGFIGSTYNVNAKGANAIIKAWEANDKEAVMKLTHTYNDYVLDLISKGLMQSLKAIMRLHGVDAGYTRKPFWRYEDEEIKKHAEFITDKYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylneuraminate lyase
publication title GroEL/ES Chaperonin Modulates the Mechanism and Accelerates the Rate of TIM-Barrel Domain Folding.
pubmed doi rcsb
source organism Mycoplasma synoviae
molecule tags Lyase
total genus 106
structure length 293
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n4qA00
3NZRA 2FPTA 3A22A 3MI6A 5D37A 2Y88A 1J2WA 1T96A 4PC8A 4CCCA 3PB0A 1TJRA 1WDWA 2P0OA 1OABA 4CQ8A 1M6JA 4MPQA 1W5QA 3W76A 4UTLA 4UTTA 4FX6M 4I7UA 4WOZA 4Q32A 1FX6A 4AH7A 4AB4A 3W7MA 3UQNA 3F4WA 4Z1CA 3W7QA 1Q3NA 5K7JA 1FUYA 3R89A 2C3ZA 3P61A 4YMZA 4GWEA 3VFLA 4JTGA 3SZ8A 1GVQA 3MI2A 3QPYA 1FDJA 2QCHA 2DZVA 4EOUA 1FXQA 4PFMA 4JY8A 2NX1A 3WK2A 1KM5A 4MFDA 4O1DA 3W22A 4LRSA 5KTLA 2X1RA 3TV8A 1W3TA 2CLKA 3S1UA 2JKEA 2C16A 4O17A 3HG3A 3W86A 1M7PA 3GXNA 4UFIA 5CKSA 5F1UA 1PE1A 3OVPA 3W87A 1GTEA 1LLWA 3M47A 2B7PA 4M6PA 2H90A 3E49A 4Z1DA 4WOQA 4MZ1A 4R53A 2A7NA 4RR4A 4DBDA 1TPDA 1B4EA 1TPWA 4NX5A 2FJKA 2TPSA 2A7PA 2VKZG 4UTJA 3NEVA 1K3UA 4UUIA 3P7YA 3TK7A 4AMAA 1KBJA 3EX6A 4Y9AA 2GVGA 2YYUA 2ZRWA 3M0ZA 3T78A 1I2NA 3NGJA 1JCMP 5AHNA 3PUOA 2A7RA 1ZJIA 2BLEA 1EA0A 1LOQA 2BSLA 2ZCGA 1KM6A 4GUIA 3QJAA 4MLRA 2CW6A 1FDZA 3W2LA 2ZQ0A 5CPLA 5F4SA 3P84A 3A9IA 2GVJA 3L9CA 4UMAA 1OFBA 4OHQA 3WJXA 4FNTA 5U7SA 3IRDA 1I8JA 3MYOA 4IMEA 3G8EA 1KFBA 5LGZA 2JBMA 2Y61A 3KVJA 4BF9A 4RJEA 1D3GA 5AHIA 3M41A 2J88A 4IPJA 3LCWA 4G1KA 1ZALA 4IGHA 4XKYB 4JTFA 3TSDA 4UTHA 5EBUA 3PVFA 4RZ4A 1H50A 4FIQA 1ZAHA 2PURA 1D3HA 5FF2A 2EPHA 1SR9A 4O16A 1LLZA 1K02A 2QJHA 3GB6A 1KM2A 1O94A 5D09A 1ZCOA 3PAJA 1C29A 4FIRA 4UFLA 3UWWA 3GDRA 1FBAA 3DFNA 1CW2A 3W3OA 4JX4A 4N4QA 1EPXA 3FJ6A 5CZ0A 2DZUA 4ZQPA 3FKKA 3KX6A 4LVBA 3UPWA 1EUNA 4Y96A 2H3DA 1MSSA 1QOQA 1GEQA 1V7YA 5CPMA 3S1VA 3NQ8A 5DCBA 2Y63A 3NPUA 4XTIA 3ZWTA 3FA5A 4FX7A 4MZYA 4JIPA 1YTKA 5AHMA 3LCLA 4IMGA 4GNJA 2ZZ2A 3TW6A 5AHLA 5HINA 2OMAA 5I3FA 4UR8A 3G1HA 4JTIA 4IUOA 1EP3A 1DQXA 1MZHA 3SY5A 5K9DA 1TPVA 3FJLA 2B0MA 2V8ZA 2TSYA 4OT7A 1TMHA 3Q94A 2DORA 3W88A 3OBKA 3OIXA 5AYXA 3RLVA 4JDYA 4OV4A 3UYCA 3U2OA 3LHWA 2BWGA 1XBZA 2VENA 1ME9A 2A6NA 4UC5A 3STFA 3E02A 1GJPA 2ATMA 1EP1A 2RHGA 4UIOA 3TC6A 3N14A 5KZEA 3PS7A 3PG8A 1MO0A 3D0CA 4OV9A 3LI1A 4DEFA 4JIQA 3CM4A 1HG3A 1XXXA 5D2YA 3PB2A 2XFWA 3BLEA 1LM1A 1PHWA 3RF9A 2Y89A 2Y62A 3NQDA 3IIXA 5L9FA 3M16A 4WY0A 1FCQA 1M5WA 3TU9A 5HR7A 3SJ3A 5LNSA 2UV8G 4I7WA 1C8VA 4UFKA 4M5PA 4LTSA 1VHNA 4AHOA 4ZVJA 3FKRA 1FQ0A 2KZHA 3CWNA 3TE9A 3KOFA 1F2JA 3GDMA 5LGXA 1XBXA 1J4EA 1LTDA 4KFNA 3QEZA 4WY0F 3I68A 1XM3A 3MO7A 3LERA 5BOOA 4UMBA 4POCA 3EWXA 5CG7A 4NJGA 3UD6A 1OG0A 4FX8A 3C2RA 1BWKA 2FIQA 3H54A 4WX2A 4YL2A 4UXDA 3OG3A 4Q33A 1XBYA 1OK4A 3V75A 1SZEA 1AL8A 1G67A 1IIHA 3W6YA 4RCXA 1A5CA 4EF8A 2R94A 4IX0A 4LVGA 1ICQA 1QMLA 1JCXA 3P62A 4ZMGA 2B7NA 2Z6IA 1DKWA 5HJLA 3NDOA 1PV8A 3CQ0A 4IXHA 3RMJA 3GNDA 1EEPA 1SO6A 3UWZA 1V5XA 2C1HA 2XN2A 2YW3A 5EL1A 2RH9A 1VPXA 4JXCA 3B04A 4RX0A 3TXZA 5K9CA 3HB9A 4O13A 5HUPA 4R33A 1KM1A 2E77A 2NV2A 2VEIA 4E2DA 3AO0A 4C1KA 5J5DA 2E68A 1H5YA 3G1AA 4O54A 2YCEA 1X8FA 4NX0A 3NR0A 1IXQA 2TYSA 3FEMA 4TMCA 3BGGA 4Z0JA 3W7JA 4FNPA 1LP6A 1L2UA 3E0IA 4O12A 1F6KA 1AMKA 3P5YA 1ZAJA 4K37A 5LZLA 1FWTA 3G1VA 3LM7A 4JYDA 3NQAA 3TSMA 4Z1AA 5DN1A 4RXFA 5C5YA 3F1QA 2WNQA 1LBMA 2RDUA 1SW3A 2VFDA 4JX6A 1L6YA 1B4KA 4QNWA 4GUFA 1VRDA 4XBKA 1GG1A 3MP5A 1GPWA 3SGUA 2CLHA 4I9AA 4ORIA 1WBJA 3BVJA 1OX4B 3TR2A 4AWSA 4L4LA 4P61A 2PRHA 4O1AA 1W8SA 1NEYA 1H63A 3C4UA 3STCA 5AB3A 3OEXA 2A4AA 1G6CA 3DFSA 3TJXA 4JN6A 3P81A 5HR6A 3DGRA 4MKNA 3W2JA 3M9YA 3BW3A 4AF0A 2J9ZA 1TTQA 3QC3A 5LNUA 4JGDA 1R2TA 2V30A 1DJNA 4NJKA 4LUJA 3O07A 3MP4A 5U4NA 1G4EA 3F03K 1Y0EA 3SR7A 2QUTA 1TTJA 4YXGA 3TCEA 1OFAA 2E09A 1AW5A 3BW2A 3NXFA 4HNUA 4JTLA 5D05A 4IXXA 4LV4A 1WV2A 3O8AA 2VFIA 2Y7GA 2DJLA 1W3IA 1ICSA 3W7EA 3R12A 3FLUA 2ZZ6A 4M6QA 1RV8A 5K3VA 1B57A 3TROA 4CLMA 3T44A 1O4UA 4AXKA 2AGKA 3EXSA 2X2GA 1BKSA 5KMYA 2ZTJA 5SWUA 2QCDB 2NWRA 2ZA3A 4H4IA 4M6VA 3TSBA 5C6MA 5FF4A 3FYPA 2ZZ7A 4K8HA 3GR7A 4O52A 4K6AA 2CZEA 1SSGA 3BG9A 4RK8A 5KITA 4QQ3A 3TIMA 2WPBA 4NZFA 3QQ1A 3DFPA 1QOPA 1FY6A 1TJPA 2WSQA 4PTNA 1X1ZA 3GDLA 1X7FA 2JGQA 3IEBA 5K9XA 2JK2A 2OJPA 3HPZA 2CLMA 4ZQNA 3N19B 1VYPX 1A5SA 4O8RA 4FEZA 4EVZA 5CZSA 1SZFA 1H7WA 3L0KA 3WJWA 1J5TA 3VE7A 5D2VA 1P4CA 3RK8A 4CNOA 5F2IA 3W7KA 1QPRA 4TIMA 3QPZA 1TPUA 2PRMA 2ISWA 2ZDRA 1KBIA 3G22A 2W6RA 4DF2A 1H51A 4NUWA 5D32A 1ICPA 1SO5A 2E6FA 2HSAA 2HS6A 2VFHA 4JEQA 2HMCA 4CQAA 1GVSA 1VR6A 4JTUA 1HL2A 3WK3A 3W7HA 2EHHA 2NXHA 5DCEA 2Q3OA 3W1UA 3NAVA 3N9SA 5E1QA 3USBA 3HG4A 3MHFA 3DKLA 3QZEA 2QAFA 4X3ZA 3P5ZA 4XQ6A 2FB3A 1HO1A 3DZ1A 1DVJA 3V1PA 3CPRA 3NA8A 4O14A 3L5MA 1WX0A 3EX3A 2NX9A 1DORA 1FCBA 1FDYA 2ABAA 5HUOA 3O6YX 4OBTA 4O53A 1PS9A 1HO4A 1SW0A 4S2BA 1DOSA 4LVDA 3S1WA 3QW3A 2O7QA 3EWWA 2H3BA 5FF0A 4FXSA 1YTEA 5BW6A 5AYYA 3W1XA 3SFKA 3PBWA 1OYAA 1RQHA 3WJYA 3G0XA 2Y6ZA 2QCNA 2GVLA 3W9ZA 4A21A 4GJ1A 3W83A 4NU7A 3MBDA 2C15A 1OK6A 1QDSA 2V5BA 1EP2A 4MJMA 4AWUA 2D73A 2DZPA 1IGSA 1KTCA 2WSRA 4H6KA 4LUIA 1U5JA 4JDBA 4TMBA 1KFLA 4AEOA 4FXRA 1LROA 4EIVA 5G1TA 3T4CA 3PUDA 2V2HA 4OGZA 5EKYA 3BO9A 1F74A 3M5ZA 4LOCA 3I7QA 1VCGA 4DPQA 3GDKA 3TQVA 1YPFA 1DQWA 4LC6A 4ML9A 5DBUA 5AOUA 2CLOA 4NNCA 5G5IA 4YLWA 1W5OA 2G95A 3W2UA 1PCKA 5EMUA 1JCYA 2A5HA 1KFJA 4BFAA 4DQWA 1GVOA 3P74A 3FOKA 1LBLA 1S5VA 3SECA 3UXDA 3WFAA 2QCGA 2V2CA 1XC4A 5HWJA 2FQIA 3DI1A 3G1DA 4N4PA 3NYZA 2E5DA 1F6PA 3TH6A 4NQ1A 3A5VA 3EXTA 2V81A 4UFMA 3W7LA 3GDTA 3CWOX 4JTHA 2WKJA 1IXNA 4MY8A 2GOUA 3PR2A 2CLFA 1W54A 3TKFA 1Q6RA 2DZTA 1SW7A 3N9RA 1G7UA 5DXYA 1SFLA 4HHPA 2AQWA 3NPWA 1OYCA 3CT7A 4NJIA 1P0NA 4QISA 3P8IA 1MXSA 2ZRYA 1M7OA 1WOAA 1Q6OA 3W1QA 1O60A 2OT0A 1EIXA 1SU5A 2FDSA 1AW1A 3HIJA 1L6SA 3O06A 4MOZA 4BI7A 4LY8A 1LDCA 3WJSA 3LTYA 2YFOA 3A5FA 3EEGA 3CU2A 2AAMA 4UTUA 3L68A 3TQKA 1KLYA 2E5BA 1KM0A 5CGQA 3S5YA 3TXVA 1P5BA 3EWYA 3PC0A 2CU0A 3LX9A 4W9TA 1R47A 4JY9A 1F7BA 5K4ZA 3VI2A 2Q8LA 1W37A 5FEZA 1U83A 3UNDA 2Y70A 4WQ6A 3B05A 1JCLA 3INPA 4Z08A 2VEMA 4A29A 1SQ7A 3KXQA 2FB2A 3S6DA 3DHDA 3W85A 5C2XA 1ALDA 3TFXA 4Y90A 4AVFA 1UASA 1EWDA 2ZRXA 2GQAA 4UTWC 3NO5A 2PE4A 3OVQA 4UNLA 3T55A 3B0PA 1TYGA 3DFTA 4LW7A 4Z1BA 3W2NA 3ZS4A 3C56A 4Z0SA 3Q2DA 1L9WA 4HSOA 4OQVA 1W3NA 3THAA 3Q37A 4TU1A 3CHVA 4XKYA 2DZWA 3PWAA 1W56A 1NF0A 2A6LA 2CLEA 2FFCA 1OF8A 1TTPA 4LVAA 3VNDA 2Y7FA 2E1DA 4JTKA 4K36A 4BK9A 3T40A 3LDVA 1AK5A 3GYEA 4LU0A 2WJZA 1S3HA 3ELFA 5F1VA 1OX6A 3PBUA 4RXGA 3ZR4A 3ANYA 4FNRA 4FNSA 4YWIA 2V2DA 1KV8A 5KZMA 2VC6A 3B4UA 3CC1A 3SW6A 3M5XA 1JRBA 1MEWA 1VLWA 2VXNA 2OT1A 1RQBA 3W1NA 3ABRA 5BRBA 4PH6A 1YADA 3BARA 4DPPA 5AC7A 2NUXA 3ATZA 1L6WA 5AHFA 3YPIA 1FCUA 1KFCA 1T0OA 5CPOA 3NL2A 5D2TA 2A85A 3LCIA 5BMXA 4MVAA 3MUXA 1ME7A 1XI3A 5FESA 4GBUA 3W7CA 5HNRA 2CFFA 4AHQA 1R2SA 2RDWA 4O15A 1TSIA 3G1FA 2TMDA 5TQLA 3C8FA 3I65A 2QEZA 3UY8A 5KZDA 4GC4A 2NUWA 5F4WA 3IGUA 3ZFHA 5HMSA 4S2CA 1I2QA 5D30A 5CZTA 4ZL1A 4O1CA 1QCWA 3KFTA 2V9DA 3P82A 3EXRA 4HSNA 4IMFA 1ZHAA 3JRKA 4X2RA 1G4PA 2Q8ZA 1T8XA 1SZGA 2FPVA 3LCFA 3E96A 1H61A 4XTDA 1QO2A 2IQTA 3LTSA 3WK0A 2EAWA 3CLMA 3LV5A 3OA3A 4IOTA 1A50A 4O18A 2GJLA 3L67A 2B7OA 4UNKA 4DF1A 5LNRA 2GPTA 1SO3A 4C1LA 1W5MA 4JTEA 1XDMA 3W74A 3PSVA 2WV8A 1VCFA 3GVGA 3DKJA 1O95A 3A23A 5BNKA 4ALDA 1P1XA 4M7TA 3NQGA 1AL7A 3EWZA 3GIYA 3QF0A 4X22A 1Q6LA 3VE9A 2ZA2A 2VOMA 3O6CA 1VHCA 1QNVA 5BMWA 1EB3A 4GUGA 3B0UX 2DJXA 1UUOA 1BTMA 2C19A 3GXPA 3IVUA 4LV9A 4UFJA 3TW7A 1I45A 1JUEA 3LLDA 1QPNA 3EX1A 2EF9A 3TFCA 2PCQA 2BTMA 4AWTA 3L5AA 5T26A 3IVSA 1EX5A 4MYAA 2F7FA 2BZNA 1ADOA 3I7SA 4WUIA 1LYXA 2QUVA 1VYSX 4K39A 3IV3A 4KKXA 3GAYA 4N6FA 2VFEA 1OJXA 4QJ1A 4JNMA 1A5BA 2G5WA 2VEKA 1TPB1 2OX1A 2WQPA 4AHPA 4UTWA 2RFGA 2GUUA 1YXDA 3LCHA 4NT0A 3GZ3A 3N2XA 2R91A 1JR1A 3NZ1A 2CLLA 3NL3A 3C2EA 1VZWA 3LRKA 3A21A 4A22A 3LHUA 3G1XA 4N9EA 1WOBA 2ZZ3A 4UTKA 3LOTA 1H7PA 2H8ZA 1KTNA 1ZFJA 3P67A 3CEPA 3CTLA 1EWEA 4ZQMA 3LRLA 1WAUA 1R2RA 4HKPA 4N2YA 1H1YA 1TCDA 1W5PA 3S5NA 5LSMA 1FWSA 4ZQCA 3TA6A 3QH2A 1XFBA 3EKZA 1DL3A 3NL5A 4LS1A 4JX5A 1I2OA 3HQ1A 2ZRUA 1KFKA 5G2HA 3B0VC 1P0KA 3U8GA 1XDLA 2Z2UA 4U28A 4PODA 4TX9A 1TPFA 5G4EA 1EUAA 4NXSA 2NUYA 3RNDA 5IM51 4GE8A 3MJYA 3LBMA 1GVFA 5KINA 1UCWA 2CZFA 3LBCA 1OX4A 3AJXA 3GX9A 1N7KA 2VFGA 3L2IA 1GG0A 1K8YA 4QAIA 2E6AA 4ICNA 4JD4A 3S0CA 5G2IA 1BWLA 2J9XA 1N8FA 2R8WA 4ADUA 1O5XA 1VCVA 4FNUA 3QMSA 2JKPA 4XBSA 1UJPA 5L6UA 1FXPA 3KVKA 3W72A 4A2RA 2DP3A 3FS2A 1TQXA 3NQVA 2WOQA 1YLVA 3H55A 3SGZA 3HG2A 3FYOA 5LHEA 4H3DA 2NWSA 1OHLA 4M19A 1AW2A 1VLIA 2C14A 4UMCA 1KM4A 4E38A 4MJZA 1Q6QA 1O5KA 2BXVA 5D03A 3TAKA 3W7IA 2HS8A 5HQEA 4WD0A 2I9EA 1E51A 3W1AA 2H8XA 1JUKA 2YYTA 2YXGA 3DAQA 4FHAA 4PL2A 2QCDA 3MI3A 1G4SA 1Z48A 3W7NA 4U4MA 4DO5A 5HWNA 1W0MA 1WXJA 3MP3A 2QF7A 3M7WA 1DJQA 1ME8A 5CPNA 4PL1A 3TNOA 3BPWA 1SUXA 1F5ZA 3W70A 5MHBA 4HN4A 3S5OA 3C61A 1YXCA 1YYAA 1ZY9A 2YZRA 4PCFA 3W1TA 1LBFA 2ZTKA 5G1YA 1VGAA 1KM3A 4MIMA 6TIMA 5I3IA 3PF3A 4GFSA 1KA9F 4FB7A 3O63A 5DLCA 3N73A 5CSSA 4MZ8A 3N34A 1LCOA 4LVFA 3DHFA 4QM1A 4KFPA 1RZMA 3HOJA 3TC7A 3LXAA 3PULA 3UY7A 3W75A 1I2PA 1YPIA 4NZJA 4D2JA 1LZOA 2EKCA 4QSHA 3ABSA 2FLIA 4NJHA 2R14A 3W2MA 2F84A 2QDHA 2YR1A 5AC6A 4JTJA 3DFQA 1JQVA 3S5ZA 1DBTA 4MY1A 4LC8A 2YW4A 1NAL1 1JCNA 1K8XA 3IIOA 4GUJA 2GQ9A 4E2BA 5DY2A 3M5VA 4BWLA 3IGSA 3W07A 8TIMA 3EWBX 4XUGA 1R46A 1DV7A 3W7RA 1PVNA 2CWNA 4RZ5A 4JR5A 4GXMA 3L5LA 5G4WA 1WQ5A 4WJEA 5CZJA 1TRIA 4ORMA 2PC4A 2HTMA 3NL6A 1GYNA 3PUEA 4S1FA 2J9YA 3NVTA 4NXKA 2X1TA 5FEXA 3M5YA 1D9EA 1I2RA 3RU6A 5DBTA 1K7XA 1F73A 4DF0A 1HTIA 4FNQA 5F2MA 5E0KA 2FTPA 3SIZA 4IMDA 3QYQA 4HPJA 3NQ6A 1OFOA 1TREA 3L0GA 4N9CA 3DI0A 2H6RA 5I3JA 4N9BA 4LRTA 4UTMA 4ONVA 4M7SA 1LOSA 4K7YA 4UR7A 1OFEA 5A5WA 3L0NA 5LNWA 3KAOA 4UCGA 2QAPA 4NNAA 5IBXC 1CX9A 1K8ZA 2CZDA 3G1YA 4YCOA 5I3HA 1NSJA 1KTBA 1B9BA 1JQXA 4JYEA 3M43A 1A5AA 2DU2A 5HWMA 3FFSA 2YSWA 2QR6A 3B06A 3W1LA 1UB3A 4BI6A 2ZZ1A 4HPXA 1GQNA 2OCZA 3C52A 3NQ7A 1OFDA 5E93A 1K03A 3PG9A 4NNBA 3W1RA 2QCLA 2NV1A 4LNYA 2NXIA 3KVMA 5H2ZA 4I7VA 3PBVA 4JTTA 5EY5A 3QRHA 2B4GA 2WNNA 3KRUA 1H60A 4CNNA 3HMJG 3TMQA 1ML1A 1H7OA 3N2MA 3HGSA 1OF6A 2J6XA 2QCEA 4JS3A 2QUUA 2A2IA 3LV6A 3DFOA 3NNTA 4KWVA 3R2GA 1JRCA 1GT8A 3B8DA 1OFQA 4IX2A 1TPH1 4RV8A 3LI0A 3NM3A 3CEUA 2E5CA 5LHFA 5TBOA 1VS1A 2YDAA 2FPYA 3GR8A 3QMTA 5D04C 2JKAA 2GQ8A 1NFBA 1QWGA 4HT3A 4MYXA 3IIPA 3EWUA 4KFOA 5C55A 2DZXA 1XBVA 3MW7A 1BEUA 4HNVA 4YCPA 2LLEA 2X1UA 1CI1A 3MWAA 1OVDA 4ZZ9A 1I4NA 2Z6JA 5ABTA 3C2OA 1RQEA 3S1XA 3KVLA 1GYLA 1QFEA 3KRZA 1K7EA 4B5NA 1TTIA 1VYRA 3G3MA 5K4XA 3MBFA 1PL9A 3BLIA 3JS3A 4MLJA 4X9SA 3G8RA 3THQA 3LB0A 4MUZA 1TPEA 1YDOA 2PRLA 3IIZA 4O57A 3QQ0A 4JTSA 4MFEA 3BG3A 3NQCA 1LRTA 2X16A 1GTHA 5AN7A 1KV5A 5F2LA 3UWQA 3W7GA 3I6RA 3EX2A 3U6WA 5HULA 3G18A 4DXVA 1RR2A 5D2WA 1YDNA 3BV4A 2Y7EA 4NJJA 3R13A 2JGYA 2NXGA 3G0UA 4QIUA 3STGA 2WNZA 1PHQA 2EGZA 1HFBA 3R5EA 2C18A 2RKXA 3LHZA 1H7XA 5DXXA 3LRMA 2ATSA 3EB2A 3HJZA 3IGXA 3BLFA 2VFFA 4GUHA 1LORA 3LGEA 3G24A 3S9YA 2ZRVA 3ZWSA 5C54A 5G2WA 4RLIA 3Q58A 3HO8A 5FF7A 1IXPA 1VQTA 3HBLA 1TRDA 4A2SA 1GWJA 4R7JA 3UPBA 5IBXA 1F05A 2WSYA 3NG3A 3B03A 1TQJA 1DHPA 3UWUA 1ZENA 4CQ9A 5FEPA 4L4MA 2C6QA 4J9JA 1NF7A 1T99A 4WY0B 3PBYA 1K7FA 3UWVA 3QFEA 5D33A 1VH7A 4XWUA 5AHEA 3QM3A 3RLUA 1HUVA 3S42A 3HPSA 5K2ZA 4CCDA 5AFDA 1AG1O 4WZHA 2G97A 5AYZA 4UTIA 2VEPA 4XZ9A 3L66A 2O7SA 4BI5A 4IMCA 3GAKA 3O05A 7TIMA 3C3NA 2G96A 1TO3A 3M44A 3GK0A 1TPC1 3O6DA 2C0AA 5CSRA 1W31A 2QCMA 3ABOA 3NOEA 3DXIA 2CZ5A 5LNVA 2V0TA 2QCFA 1WBHA 4N6EA 2W0UA 2WO5A 4GRSA 1KFEA 3ABQA 5D2XA 1QAPA 3W7PA 3CB8A 3L21A 5I3KA 1JUBA 3WJZA 3BW4A 3MMTA 1MEIA 4Y6GA 4DO6A 5D02A 4N9DA 3QSTA 3DH7A 2V82A 3BG5A 4ZQRA 2V5LA 3UZJA 1QO5A 1S5TA 2XN0A 4Q4KA 3P8JA 4WXZA 3KHJA 2P1FA 3C2VA 2QKFA 1SPQA 2OZ0A 4EF9A 4IJBA 1F76A 5D38A 4EWND 1G7VA 2ABBA 4K8EA 3E9AA 2YFNA 3C0JA 2YX0A 3R8RA 3N3MA 4OWGA 5EA9A 3O15A 4O11A 5EYWA 1WA3A 3TMLA 1H7NA 4PEKA 3W1PA 1YDVA 2CLIA 3VKJA 3LHVA 4P2VA 3M6YA 3IVTA 3VCRA 1IF2A 4O4WA 5TIMA 4K38A 3W7OA 1SFJA 4BWLC 4N02A 3PY2A 4A3UA 3GXTA 3LHYA 1FCVA 2B7QA 5FF3A 3NQMA 3DU0A 2X30A 3TUUA 4BR1A 1G4TA 3DENA 2QJIA 1THFD 1FWNA 3T7VA 1XUUA 3NQFA 3I7RA 5GVJA 1TIMA 3HGOA 1KW1A 1QPOA 4O19A 2NLIA 1UUMA 3UXAA 4ADTA 1X1OA 3W84A 3S8HA 2RDTA 3JR2A 4O0KA 4O4VA 4PA8A 3EX4A 3UZ5A 2DZSA 1MEHA 1VJIA 3SSJA 1GVRA 3TQ0A 2E6DA 4O50A 2ZYFA 4DBEA 1JCJA 4AF0B 1XCFA 3MYPA 3G0SA 2ZFAA 4KWWA 1FWWA 1RVGA 3QW4B 4ADSA 1B3OA 1VC4A 3A24A 2A21A 2I14A 3NM1A 4DO4A 3SI9A 3HPXA 3TDFA 4UTTC 2ZZ4A 4QITA 4WXYA 3W2KA 2QJGA 3NPXA 2Z0IA 3W71A 1WYIA 5I3GA 1RPXA 3HGRA 1TV7A 1H7RA 3FIGA 3KRSA 1KLZA 1NVMA 3LHTA 4JYFA 1W1ZA 4E0CA 3UWYA 1TB3A 2Q3RA 4TR9A 3P60A 2A0NA 4NVTA 2BX7A 1TV8A 1OYBA 2ZBTA 3W23A 4OU1A 5KSWA 1A53A 4R34A 2QCCA 1G69A 1QPQA 2W79A 4TO8A 3EKLA 3LCGA 1FWRA 3QSRA 3GLCA 4JICA 4IPIA 1SSDA 3LCXA 1GOXA 3NPVA 3O1NA 1IXOA 3STEA 1R30A 1XL9A 5J5RA 4HNTA 2C13A 5H91A 1Q45A 4ZQOA 5LKYA 1LRNA 1UBSA 2GJNA 2QDGA 4OE7A 4O28A 1OFRA 1PIIA 3NQ2A 4MY9A 1H1ZA 2I1OA 3LLFA 4LS2A 4FF7A 4LT9A 3C6CA 2TRSA 2YGYA 1Z41A 3G3DA 1S5WA 4FO4A 4AAJA 1YXYA 3LXCA 2A1YA 3IIVA 1LRQA 1RD5A 5F2GA 4K7VA 1ZAIA 3TX9A 5DELA 1Z44A 2ZRZA 3BK0A 3L65A 1PCWA 3H53A 3LXBA 4RKAA 4O0ZA 1OX5A 2XN1A 3HGJA 1W5NA 5A8GA 2NZLA 3P80A 3LTPA 3CIWA 2E6YA 1ZNNA 3E12A 5DY3A 1GZGA 2Y7DA 1OFPA 3CIXA 3W73A 4IQLA 2Z1BA 3GKAA 3MHGA 1IIGA 1C9DA 2VELA 6ALDA 3OHIA 3M1ZA 3ATYA 3TJLA 3OVRA 3WK1A 1YTDA 1N55A 4LWWA 1JVNA 1QR7A 1SZNA 4O1BA 3GNNA 1H62A 2NX3A 2X1SA 3BGJA 1XUZA 3DBPA 4RZ6A 4Y8FA 4HIBA 4UFHA 3W1MA 2J24A 3GKFA 4IWWA 1ONRA 3RFAA 1X6UA 4CNPA 2P10A 3HF3A 5FI8A 2ALDA 1LOLA 3NQEA 1JJKA 3MHUA 1JULA 3K30A 2ZA1A 4DELA 3W7DA 4CCEA 3O16A 4QNEA 3PSWA 1XKYA 3QMRA 2ISSA 3G1SA 4LS0A 1Z42A 4HNNA 5DCDA 3F4NA 1TV5A 3C2FA 3HG5A 2Y85A 5EPDA 5FEWA 3TAOA 2YPIA 5F4XA 1SO4A 2ISVA 5AC8A 2ZZ5A 3PM6A 4O10A 2J27A
chains in the Genus database with same CATH superfamily
1ISWA 3GHTA 3MI6A 1T96A 1BQGA 1WDWA 1W8GA 3QC0A 4FZIA 2WMIA 4MPQA 1W5QA 3WN6A 3ZLGA 3WBAA 3LBOA 3IK2A 4XO6A 4WSJA 1V02A 1FX6A 2DT1A 2EJAA 3W7MA 1X6NA 3F4WA 4GY0A 1FUYA 1REQA 3CASA 3R89A 4RL3A 3W0KA 4IUGA 1GVQA 2WWCA 2ZX5A 3MI2A 3QPYA 3WG6A 4ZODA 4DWSC 1XLDA 3DUGA 1QI0A 2NX1A 2NQ5A 4PULA 3W22A 1W3TA 2CLKA 4R7WA 1SM9A 1XYZA 4AYSA 2ICSA 5CJ5A 3ME3A 1Z7AA 1ZBKA 1XF0A 3UG5A 3HG3A 1M7PA 4Z2JA 5I23A 3NIYA 3SRFA 2NQHA 1PE1A 2YIHA 5A94A 4J7RA 3M47A 3E49A 3VD4A 4KMQA 4MZ1A 4R53A 3FY1A 4UQBA 4D71A 1B4EA 1UR2A 4NX5A 5LIUX 2FJKA 2TPSA 2A7PA 4EX4A 2VKZG 1S46A 3B0XA 4JTAA 2QUMA 2BVWA 4FI4A 4YU1A 3O0KA 4MGGA 3URNA 4Y9AA 2GVGA 2YYUA 2BMBA 3NGJA 2Z29A 2HEJA 1ZJIA 1QJWA 4MB5A 3WYZA 1DJWA 2DSUA 1LLOA 2CW6A 3LQGA 5CPLA 1AQFA 1CBGA 3P84A 4GHRA 4KESA 2GLKA 3HN3A 6ENLA 3H7RA 3WJXA 5U7SA 3MYOA 2ZX7A 4AD1A 1S5NA 2JBMA 4FR1A 1UA7A 3PBMA 1C93A 3M41A 4IL2A 1TV3A 5HPOA 3ARYA 5C8BB 4L5ZA 3TSDA 4UTHA 2OOGA 4BKNA 1K70A 1V4YA 3GZAA 5FF2A 1TZZA 1V6WA 2FKPA 2QJHA 1KM2A 3U5UA 1BSLA 1AD1A 2J66A 3UWWA 3GDRA 3UETA 4YVVA 4N4QA 3BZGA 2OTDA 2DZUA 3UPWA 3TW9A 1EUNA 4LCSA 4Y96A 1QVBA 1PO9A 4ILSA 3ARQA 3NQ8A 1J12A 4C65A 3UPMA 1SGJA 5AHMA 3LCLA 2E8ZA 4C6DA 4PUWA 4BF5A 3G1HA 4IUOA 4NKCA 1EP3A 3WLPA 2NQJA 4AX6A 1MZHA 1VFMA 3NOYA 3ZOAA 1DWIM 1JCTA 4MKVA 3W88A 1BHGA 3U9IA 2VZTA 4JDYA 4S3BA 3MUY1 1XBZA 3E0FA 4UC5A 3STFA 1GJPA 3F5LA 3OP2A 1V77A 2PI6A 3PG8A 2CESA 1J5SA 4OV9A 3PTKA 3N4AA 1XXXA 5D2YA 2XFWA 4H9VA 1RXOB 2BB0A 2IPJA 3BLEA 4XZNX 4EACA 3N25A 3NQDA 2DH2A 3CT2A 3VGDA 3ZQ9A 2A3AA 5L9FA 3R0KA 4QDWA 3OQ8A 2WJFA 2YCLA 4UFKA 1R7AA 4M5PA 4KCUA 3O6AA 1F3TA 4Z2GA 3WQ6A 1QI3A 1FQ0A 2D0GA 3CWNA 4XSMA 3TE9A 1F2JA 4QQUA 3UW6A 3D3AA 1MDLA 3LERA 5BOOA 4B16A 1OG0A 4WX2A 1RJPA 2R24A 4H9MA 4WKAA 1DTNA 1XBYA 2ANUA 2QVHA 3V75A 1AL8A 4DWSD 3CYVA 3W6YA 4W8LA 5HAOA 3RX2A 3S2LA 4RCXA 4M3PA 4MWAC 3SJNA 2D2HA 1JCXA 1BRLA 3QPEA 4ZMGA 2Z6IA 1F3XA 5HJLA 3FYYA 1DP0A 3A47A 3RMJA 1SO6A 3A3HA 2QJMA 1V5XA 2XN2A 3BLDA 1H0GA 1GVIA 2YW3A 3PPHA 5C70A 2OO0A 5EL1A 1QW8A 3TONA 3KZSA 3WLRA 4S39A 2PTZA 4LPCA 2G3NA 3RIKA 1KM1A 1FOBA 4C6PA 1MMFA 4E2DA 4C1KA 5J5DA 2E68A 1V93A 2YCEA 4NX0A 3FEMA 1VFOA 4PE8A 1LWJA 3G1VA 4Z1AA 3TOPA 4RXFA 1XPYA 1LBMA 4NRRA 2PLJA 4QLLA 2VFDA 1L6YA 5H1WA 5JIWA 5JBDA 4US5A 3SGUA 3N4FA 1YRRA 2VWSA 3BVJA 1IV8A 3CMJA 1R3TA 1OX4B 3OQEA 3TR2A 2RUSA 3WBWA 3G6MA 4LJ3A 3VGGA 4C5YA 5AB3A 3H24A 3CHEA 4GINA 4C6OA 1A47A 3ZLHA 3BW3A 1TTQA 2VC7A 1AZ1A 1R2TA 5JBEA 2V30A 4HN8A 3LMZA 4M8UA 1W1PA 1BLIA 3MKVA 3RGTA 2OYLA 3C0LA 8RUCA 4HMEA 3W01A 1BAGA 3H2NA 3MKKA 4HNUA 3UT0A 3SBFA 3UNTA 2Y7GA 3A4XA 2DJLA 1UC5A 3R12A 4AU0A 1RV8A 3OGRA 3RLGA 4A8NA 4CLMA 4H2CA 4AD0A 4AXKA 3VZYA 3XISA 3CMFA 4HJFA 2QCDB 1UWAA 1BSIA 2VWTA 2ZA3A 3SAZA 3TSBA 4S3AA 3IJ9A 4AC1X 2ZZ7A 3A9BA 1E6SM 4K6AA 1SSGA 5AECA 3TIMA 5DMLA 4NZFA 3E2SA 3E2RA 4F0LA 1X7IA 4XD4A 2HE8A 2WSKA 2WSQA 2R1NA 1J93A 1VFFA 5K9XA 1DJYA 1E1EA 2OLHA 2BHYA 3D47A 3KS5A 1KO0A 4HQVA 5JXQA 1A5SA 3WNOA 3WQ5A 2X05A 3D6NA 4EVZA 1H7WA 1J5TA 3REQA 2Q09A 1P4CA 2VEFA 5HMDA 2OWXA 1TPUA 2XGZA 1OT2A 1PTDA 4M1RA 4DF2A 5CAHA 5GJNA 2E6FA 1XSIA 2RAGA 1TX2A 3JVAA 1ZL1A 4TUFA 2WZMA 4YS1A 3EPMA 4JTUA 1EJXC 3SIMA 3PPFA 5DCEA 2Q3OA 1DEDA 3WLJA 5E1QA 2D20A 2QAFA 4F0RA 1OCQA 2JALA 1DVJA 4O14A 1E72M 3EX3A 3VCNA 4QG9A 5HUOA 3O6YX 4O53A 4CEXC 1JXKA 4LVDA 1V3MA 2XIBA 1QW7A 3QW3A 4OECA 5JUVA 3PZUA 2AQVA 2H3BA 4CD8A 5FF0A 2DQWA 3W1XA 3NJ3A 1WZLA 5C2GA 1QK2A 3G0XA 1QBAA 5HATA 4A21A 2WJDA 3W83A 1J0YA 3FVDA 1QDSA 1FH8A 2E67A 2REQB 2GUYA 1U1JA 2G4FA 1PTGA 4TMBA 4JDBA 4YTUA 2WMGA 5TNVA 1KFLA 3VABA 1D3CA 5DRCA 4FXRA 1OBAA 1LROA 4Y9OA 3HQPA 3V0TA 3RU8X 1ZTVA 3I7QA 2PC8A 4PGLA 1XGDA 4LC6A 3NSXA 5GJPA 5DBUA 1E9IA 5AOUA 1PTAA 4DZAA 4YLWA 1LL7A 2CBVA 5EMUA 4FLOA 3BURA 3TTOA 4IFRA 3ZJ7A 4PMOA 3QGAC 3PHAA 3WFAA 1JG9A 2VP8A 4KWOA 2CHNA 2FHCA 3GHUA 3W28A 3NYZA 2O4QA 5M03A 3AIUA 3M0MA 4D6GA 4JQ4A 4FF5A 4W5ZA 2XIOA 1EJSC 3PJTA 2PAJA 1IXNA 2GOUA 1I6NA 3PR2A 1JDCA 3TKFA 3WQVA 2ACRA 3N9RA 2XSAA 3F2DA 4S3EA 3VKDA 1UYQA 3SCPA 3CZEA 2ZRYA 1RAKA 2O55A 1WOAA 1J0HA 3MUZ1 1TFVA 1Q6OA 1LF1A 4XZLX 1EIXA 1SU5A 5CJMA 4PMVA 4LY8A 2QGYA 1CB2A 2YFOA 3BSGA 1EL3A 3BLLA 4UTUA 2XVLA 4PMUA 2BHUA 5T8GA 4ZOAA 1WNOA 4HU8A 1J96A 1P5BA 3EWYA 4DBSA 2CU0A 1WZMA 4W9TA 1F7BA 1K9FA 4J5NA 2XFRA 1XLLA 3E2VA 4AIEA 1U83A 3UNDA 2Y70A 4WQ6A 3B05A 3INPA 4Z08A 3MZNA 4QEEA 1CGVA 1EQCA 3GBDA 2FMOA 3DHDA 3TFXA 2D0HA 4H41A 5A2BA 5I0DA 1UASA 2GQAA 1O6IA 1E3ZA 3OVQA 2IKHA 3ZS4A 4Z0SA 3Q2DA 5FJOA 2NW0A 3H23A 4CN4A 2QQ6A 1W3NA 4QP0A 2L5HA 2FJUB 3CHVA 4BF7A 1IEIA 3PWAA 1PB0A 5C9XA 2Y7FA 3R6IA 3LPGA 4PUKA 4BK9A 4LU0A 5BRQA 2WJZA 2VX5A 1S3HA 4NILA 4TVUA 3ELFA 3HQNA 3BGAA 4B15A 3ANYA 1M41A 4W7WA 1VRXA 3IJIA 4MNLA 4V33A 1KV8A 4LF1A 1KGUA 3TZNA 2PLMA 4H8NA 5LIKX 1VLWA 3HV8A 1FHLA 4MNMA 3V0SA 2YA1A 2VNCA 2VXNA 1RQBA 2GDUA 1R3QA 2GJPA 3BCJA 2Y5JA 4DPPA 5HJYA 1L0PA 2QHAA 1L6WA 2Y8KA 4JTCA 2UWFA 1FCUA 1KFCA 1T0OA 3VZZA 5CPOA 3OZMA 4BA0A 4CNTA 2I16A 5HNRA 2CFFA 4LF2A 4AHQA 2PDQA 3CUIA 2PDKA 3I65A 3UY8A 5KZDA 1GKPA 5F4WA 4QS6A 3ZFHA 7A3HA 3UZZA 2QVNA 3AAMA 5HMSA 2F6UA 1I2QA 4O1CA 2PDJA 1QI4A 1XYBA 3EXRA 4HSNA 1NDWA 2PF8A 2YDRA 4X2RA 1T8XA 3TJ4A 2FPVA 3LCFA 3TTYA 1QO2A 2IQTA 3WK0A 2EAWA 4L6HA 2EG7A 5LA2A 2FZ9A 1JFXA 4MB4A 4DF1A 4IF2A 4GG9A 4AZ5A 4C6QA 1O5RA 1W5MA 1VD6A 2QDDA 3W74A 1VCFA 3GVGA 1R0MA 1UKQA 1S2WA 4FLSA 1O95A 1Q13A 4PEEA 4RZBA 1AL7A 3EWZA 2BOGX 4X22A 2BASA 4XAFA 1YNQA 3W4RA 1XIBA 5DFAA 3B0UX 1HKVA 2HDJA 3TW7A 4AY7A 1I45A 1JUEA 2HVNA 2QMJA 2EF9A 3CV2A 4G6CA 1HJVA 2DSKA 3SUWA 3L5AA 5T26A 3IVSA 3I7SA 4TVCA 3KZPA 2QUVA 4K39A 1GVEA 2ZX6A 3IV3A 3EMCA 3GAYA 5FJIA 2YOCA 3GNPA 3UZWA 3DX5A 4QJ1A 2VEKA 4UTWA 2VDIA 1FWGC 1UPPA 3LCHA 2DUAA 3GZ3A 3GW3A 1JR1A 4LFYA 5HMEA 3LRKA 1E1CB 1MW0A 2J74A 3G1XA 3GFYA 4RNFA 2H8ZA 3CEPA 3LRLA 2FZDA 4HKPA 4N2YA 1H1YA 4UR9A 2ACUA 5C9UA 4RNHA 2BGSA 1ZUAX 2VYOA 3L4YA 4WSHA 1UD5A 4KF1A 2VRJA 3AALA 1IWPA 1ZPTA 3NL5A 2VR2A 1A3WA 4I5UA 4TX9A 4QLJA 3GTIA 4NXSA 2NUYA 3SRHA 4JL1A 3MJYA 1UW9A 1TWZA 3OPSA 1TE6A 1UCWA 3LBCA 4A35A 1OX4A 3AJXA 3NO1A 3TN3A 2WVTA 2VFGA 3L2IA 1M04A 1E5NA 2Z2BA 2A3BA 1SJBA 2YBVA 3V16A 3S83A 4GFIA 3ZT6A 4CVWA 1O5XA 4QHRA 1SMAA 3UERA 1D7KA 1IWBA 3GFZA 2XPKA 1A5UA 1JZ5A 2BNJA 3F4DA 3W72A 4A2RA 2WOQA 3F4CA 4US5D 4V1YA 3OBAA 1HL9A 4H3DA 4JTQA 1VLIA 2EG8A 4YTRA 4LH8A 2C14A 1KM4A 5LIYX 4TTGA 4MJZA 1Q6QA 3HM7A 3NZQA 3HURA 3W7IA 3WDHA 5CGTA 3WDPP 2YLAA 3H2AA 2HS8A 5HQEA 4WD0A 4ICCX 3C86A 3GXDA 3H6OA 4FHAA 1Q7MA 4P7RA 2QCDA 2NLYA 3OG2A 4LB3A 1W0MA 3QV7A 1POKA 2XISA 1TCMA 4PL1A 3MQTA 1H4PA 5MHBA 3MT1A 3AJ7A 3S5OA 1YXCA 2DY3A 4AIBA 5A6AA 2I5GA 3POCA 4PCFA 4URIA 1LBFA 2OYKA 5HNUA 4HJWA 3ECQA 4GFSA 4GQQA 3O63A 1RA5A 3ES8A 5CSSA 4S3DA 3N34A 1LCOA 4LEQA 4QM1A 1RZMA 3HOJA 3LEPA 3LXAA 3TC7A 5DEZA 2JF7A 3VOFA 1W3JA 3M0IA 1LZOA 1Z89A 1GOOA 2R14A 4NAFB 3U2ZA 3RYSA 2WJEA 3OU8A 3WUEA 4E8GA 4L4PA 3BC9A 4V15A 3UR2A 4E6MA 4QR6A 4MY1A 3B8TA 4AY8A 3IIOA 1E9YB 4G5DA 5ECVA 1ZSXA 1BYBA 2PDYA 2IQ0A 3M5VA 3W07A 8TIMA 4XAPA 4XUGA 2PFHA 1UPMB 3W7RA 1PVNA 4QCFA 3UR8A 2PP0A 1CLKA 4ORMA 3UEQA 1CXLA 2HTMA 4LUTB 5KZ6A 3CYJA 1V03A 3M5YA 2P53A 5DBTA 1F73A 4DF0A 2VUYA 4I6KA 5E0KA 2REQA 2H9AB 3SIZA 4P7QA 3O0FA 4N0RA 1QK0A 1KBKA 3NQ6A 1OFOA 1O12A 4LRTA 4ONVA 1LOSA 4K7YA 3HZ3A 3CQKA 1M7JA 1XRSA 2W67A 1OFEA 1HKKA 5LNWA 3KAOA 3KTSA 3UGVA 5IBXC 1YBQB 2WXDM 4ERGA 4YCOA 1VBUA 4O8AA 1KTBA 4NAEB 1JQXA 4JYEA 4PRRA 2Z1VA 1RJRA 4DB7A 4HOZA 2QR6A 3W1LA 1XX1A 4HHHA 3EYPA 5LYRA 1RSCA 4LAZA 2Z7GA 4HPXA 3OJGA 1AVAA 3PG9A 4NNBA 4Z42C 4HU4A 4TOQA 4Q8TA 4DLMA 4P8WA 5EY5A 4WR3A 4UCFA 1E0WA 4OUEA 3M0KA 4CNNA 1RALA 3EEZA 1ML1A 3VD9A 3N2MA 1OF6A 3WELA 2QPSA 3GH5A 3LV6A 3KBJA 4AZHA 1R86A 3VIIA 1Q4WA 1EGMA 3MUIA 3WLOA 2HZGA 4RV8A 4XVEA 5A69A 3GXIA 2ZIDA 1KXTA 5ABFB 4KETA 4U5KA 3SCTA 1O1HA 1VS1A 4ZA0A 1F8MA 3GR8A 2DIJA 3C3UA 2GQ8A 1NFBA 3KOWA 4MYXA 1SFTA 2XVPA 2ZWZA 4GKLA 4KFOA 2C79A 2W62A 1HJWA 4KQNA 3T0CA 4HNVA 5CLWA 1CGWA 1C8QA 4Q4MA 3EDEA 5M1TA 3WQ4A 1MNZA 1PZ3A 1GYLA 1NP2A 1W17A 4NYUA 4G9PA 1EYWA 1CNVA 5CG0A 3L12A 4B5NA 1B2YA 4C91A 1TTIA 3W38A 3MCNA 3BAWA 1HJUA 4FLRA 3UG3A 4P8XA 4L56A 2PU1A 4BCEA 3R7MA 3QQ0A 3NO3A 3L4UA 2X16A 1GTHA 1KV5A 5F2LA 2WZTA 4IQDA 1TV2A 3EX2A 3U6WA 3IACA 3G18A 2I57A 4DXVA 2Y7EA 3BLPX 3L4ZA 3F5JA 4NJJA 3I6EA 3A64A 3VINA 1XH1A 3ABZA 1FWBC 3G0UA 2ASHA 2WNZA 4PTWA 3ZJ8A 5DXXA 3CQJA 1JPDX 1BD0A 1T5AA 1QU4A 1FHUA 3G24A 2PBGA 1NWUA 3WCZA 1DJHA 3O9NA 3T6CA 3UCCA 5DQPA 1ADDA 4DVOA 1IXPA 1X8CA 3IJLA 4XD5A 3HBLA 4A2SA 3N2BA 3UPBA 2WSYA 3VDCA 2Z24A 3B03A 1XRVA 1CTNA 1BXBA 1NF7A 4LNCA 3QFEA 1UQYA 3NZGA 5D33A 3K5XA 4NZ4A 2TAAA 3HPSA 2VR5A 4HPGA 5K2ZA 4X0VA 2VO5A 5AFDA 2AOSA 2B81A 4KWUA 2BG5A 4JNYA 2G97A 1RBAA 3I4EA 2IW0A 2VEPA 4OOUA 1GPFA 4Q7NA 4IMCA 3GE7A 3QFWA 2OEKA 3WD0A 4HBKA 1VBHA 3O05A 4KEMA 3M0HA 3C3NA 1TO3A 3GK0A 2GDQA 1P0BA 2C0AA 4IGMA 3ICJA 1BXNA 2V5DA 2NV9A 4K3ZA 1HZYA 4D6FA 2FH8A 3QTGA 1ZZMA 4N6EA 4GRSA 5I79A 3ABQA 2PDNA 3L21A 1U5HA 3BW4A 5AVNA 1EIBA 2INZA 4Y6GA 3WUGA 4DO6A 3KWSA 3QSTA 3AIWA 4EXBA 1MXDA 1LWIA 3UZJA 3UGRA 4IPLA 1EC9A 4JTRA 4JN7A 3KHJA 3URBA 4ATWA 3CB3A 3BAKA 2P5NA 3G77A 5D38A 2VURA 4EWND 3WSUA 4CEUC 3E9AA 3C0JA 2YX0A 2E4TA 2BOEX 2FH6A 3E0WA 3O15A 1PIGA 4NY2A 4MWAE 1D8WA 4DHGA 1YDVA 3VKJA 1UHVA 1E1CA 4LXFA 1X97A 4HHMA 2Z25A 4GBDA 4O4WA 3W7OA 1Y5XA 1X98A 4J2PA 2PDCA 1BVNP 2YXXA 1DE6A 3NQMA 4IZGA 1NWRA 4PUNA 3DENA 1FWNA 4LCQA 1UZ4A 3HGOA 4AEEA 1N8WA 1NP0A 4O19A 3MMDA 4HYWA 3RPTA 3S8HA 3VIFA 4B5WA 4UOZA 3UZ5A 3WF3A 2O4MA 4S38A 2E6DA 4O50A 2ZYFA 1MZRA 1JCJA 4AX7A 1UZ1A 3G0SA 4I90A 3CL7A 3QXBA 1PKLA 1KBLA 1B3OA 1VC4A 4C6JA 2XGBA 4PB5A 4DNHA 4QITA 2OLAA 1W6TA 4DZIA 3II1A 2Z0IA 3IWPA 3W02A 1XYLA 3LSBA 4A3RA 1TV7A 2WVVB 4PN2A 5AZ1A 2QJJA 1TKKA 4KGLA 1XYAA 4TR9A 4RE4A 4NYYA 1XPGA 2A0NA 2XVNA 1AH3A 5HMFA 4O1FA 2X42A 4R34A 5EMJA 2VR4A 2QCCA 1G69A 4LUYA 3DC0A 3LCGA 3QSRA 5LA1A 3WBXA 2V3GA 3SSZA 4UZUA 3STEA 1R30A 5I3DA 2ZDSA 1XL9A 4RW5A 3SURA 4B90A 4HNTA 2C13A 5H91A 4AXNA 4D6IA 4ZQOA 3C0SA 5LKYA 1UBSA 1O5QA 3U48A 1E15A 4JIIX 4O28A 3BCDA 1OFRA 1G1YA 4JFUA 2E28A 3NQ2A 1H1ZA 1Q63A 4W93A 5C7HA 2YGYA 2WMFA 1Z41A 1CGYA 3SN4A 2A79A 1SZRA 4AAJA 5EMYA 5M17A 2W92A 3LXCA 3IIVA 1LRQA 3GU2A 3VOIA 1GVYA 3BICA 3B3DA 1WKDA 1BG9A 2XH2A 1MWOA 3FDGA 4RKAA 3AYTA 1OX5A 1W5NA 3UESA 1XLMA 3P80A 2VZVA 4CQCA 4I9MA 4J40A 1FWCC 3AXKA 4JCLA 4TX6A 5FAJA 3WDJA 1SJDA 2W66A 5JH2A 4GZ7A 3DYOA 2VL4A 1IT8A 3TJLA 5JIPA 3GTXA 4QSFA 4KGJA 4OBSA 4NAFA 1KQYA 1H62A 4GY1A 3CIVA 2AQOA 4Q8VA 4HIBA 3GKFA 5BOEA 1ONRA 4CNPA 5FI8A 1LOLA 3CL8A 3NQEA 4HOXA 3UZYA 4ATDA 3B9DA 1IR1A 1XKYA 2OPJA 3QMRA 4D8AA 3WNNA 3F4NA 3KBNA 4OJYA 1ONXA 3SADA 3C2FA 3HG5A 2Y85A 4XIMA 2E40A 5EPDA 4LUSB 3NEHA 3I3BA 1SO4A 2ISVA 4RPQA 2E7FA 5AC8A 4O10A 4LUTA 3HU7A 1W1VA 1J2WA 4PC8A 3W6LA 1TJRA 3EOOA 4UB9A 2P0OA 1OABA 1M6JA 3N6QA 4U3CA 4U10A 3BL3A 4UTLA 2H9AA 2OQLA 3LGDA 3SQLA 4AH7A 1US2A 3W7QA 4L6OA 3P61A 3GNXA 4JTGA 3W29A 3RUBL 2F6KA 2BY1A 2DZVA 6A3HA 4PFMA 1KFWA 1KM5A 4O1DA 4LRSA 5KTLA 3EPOA 1XIGA 3GXFA 4J4KA 1YBQA 1NFPA 4D9PA 4AWEA 2JKEA 1EDGA 4NAEA 2C16A 1ZBWA 1RA0A 2JFEX 3OZYA 3UXLA 3W86A 3OVPA 3FXYA 2MUCA 4B3KA 1JZ2A 1GTEA 6REQB 4M6PA 2H90A 3ZR6A 4WOQA 1G94A 4S23A 4QROA 4XB3A 1HX0A 1CXHA 1EYEA 2F8QA 2P76A 4H9ZA 3NEVA 1K3UA 4UUIA 3VNJA 4IH3A 3WH9A 1VEOA 3TK7A 5E09A 2BY2A 4AMAA 1GGOA 1WDPA 3EX6A 2ZRWA 1I2NA 3DBNA 4EP8C 3PUOA 5ENLA 4QJ4B 2WVUA 2X1IA 9CGTA 4GUIA 3QJAA 3GC5A 4BEQA 4C6IA 5JH1A 2ZQ0A 4GMEA 3RPDA 5ABFA 5AC5A 1XG4A 4B2DD 4L9XA 3A9IA 1DTUA 2QJNA 3E3HA 1AH0A 4UMAA 4OHQA 4NI8A 3FJ4A 1I8JA 3WUFA 5LGZA 2Y61A 4BJHA 4TV6A 4RJEA 1JYVA 1BF6A 1D3GA 5AHIA 2OO6A 2P0IA 4IPJA 3JUGA 4H9YA 1OG6A 1AFSA 4K1GA 4RZ4A 1ZAHA 2PURA 4HK6A 4OKDA 1SR9A 4S3FA 1O94A 3DESA 1ZCOA 3V0UA 3PAJA 4ZO8A 2G3FA 3MC5A 3BJFA 4HK7A 3W3OA 3AWNA 2OQHA 3WQDA 1EPXA 3FJ6A 4ZQPA 3FKKA 3KX6A 4LVBA 3OYXA 1WUFA 1MSSA 1RP9A 2INFA 1JDDA 1LL6A 4QDMA 1LJYA 3ZWTA 3PJXA 4MZYA 4JIPA 1JFHA 1YTKA 1E4IA 2F2KA 3CMGA 4IMGA 2BGNE 4AZ7A 5HINA 5A6BD 5FCZA 2OMAA 2WHMA 5I3FA 2AGTA 4PBGA 3FGCB 3DECA 1WDQA 3SY5A 3VOGA 1NELA 4DI9A 2V8ZA 4OT7A 1PWLA 3Q94A 5A8NA 4KWSA 5AYXA 3FAXA 4OV4A 4B92A 3U2OA 3LHWA 1Y5WA 1ME9A 2A6NA 1EP1A 2RHGA 1TWSA 1QNQA 1HJSA 2VX6A 4IISA 4G7EB 4DEFA 2R82A 4JIQA 2HXTA 1HG3A 1US3A 3M64A 2V69A 1UD8A 4HZ7A 2Y89A 1W1TA 2Y62A 3IIXA 3GFXA 4GACA 1M5WA 3SJ3A 5LNSA 5BWAA 3XIMA 1C8VA 1GEHA 3UA4A 4LTSA 4IG2B 1Z9AA 3ITGA 4ZVJA 3FKRA 3WDIA 1G9HA 1JNEA 1XFCA 1XBXA 4KFNA 4WY0F 2Y24A 1ECEA 3G2GA 1UP2A 2VGIA 3EWXA 3IUHA 4GI6A 5CG7A 2B31A 1KXVA 4Q8QA 1UZDA 1DXIA 4FX8A 4WK9A 3UD6A 1KXHA 3H54A 3SN1A 3PZMA 1F4AA 1H09A 2A3EA 1OK4A 2E25A 1G67A 3GO2A 2PDXA 1V3IA 3ABXA 4H9TA 3L4XA 4WHBA 4EF8A 9XIAA 3TVAA 4LVGA 4IHCA 3CZ8A 2Q02A 4I8YA 2NVDA 4C1NB 5GNZA 1W9XA 1DKWA 4I5XA 3WQ8A 3KBWA 3NDOA 1PV8A 2ISDA 5J04A 1EH9A 1EEPA 1PXGA 1ZBVA 2PDFA 1W3KA 4QFUA 2QMKA 3T1GA 4JKLA 2W4XA 2RH9A 5F7UA 4BQ3A 1VPXA 3WLHA 4Q4SA 2QXWA 3B04A 3R0DA 1WKEA 5K9CA 2NV2A 2E77A 4QE4A 2G41A 3AFBA 1A5LC 1WO2A 3AO0A 1GZ1A 1H5YA 1X8FA 3NR0A 2TYSA 4TMCA 4GO8A 1U33A 4B3LA 1LP6A 1L2UA 1XLCA 3E0IA 4E2OA 3BDKA 3GYCA 3QV6A 3P5YA 1I60A 4K37A 5LZLA 5C5YA 2WNQA 1VBGA 3GY1A 3F4VA 3ZJ6A 1SW3A 3VM7A 4QNWA 4XBKA 1GG1A 5C9RA 1GPWA 3UVIA 5EBAA 5HBFA 2JF6A 4B5TA 5AC4A 4ORIA 4GCXA 1EO7A 1WBJA 3BOXA 2Y5EA 5ABEA 4H2HA 4L4LA 4C6KA 1HKMA 1H63A 3C4UA 2A4AA 1G6CA 3E0VA 3ZJKA 3GUGA 3P81A 5I03A 5BU9A 1MQQA 5HR6A 1FFQA 2X0HA 3W2JA 2PTXA 1ITUA 2J9ZA 4NZ5A 3QC3A 5LNUA 4JGDA 3GNRA 3KTXA 3SCVA 2XFYA 4LUJA 3MP4A 3F03K 1JYXA 4PUEA 3GTFA 3ZO9A 2CKRA 3AMGA 3T2QA 4R9XA 4AIOA 2QUTA 1F8IA 4YXGA 2OYMA 3XINA 4A6GA 3HMCA 2E09A 3BW2A 2WVVA 3B9AA 3NXFA 5D05A 1ICSA 2ZZ6A 4H8UA 2PDLA 1MW3A 3TROA 2GK1B 4EPEC 3T44A 1X39A 2X2GA 1JF5A 2XIIA 3GHRA 4GKTA 4H4IA 3TN6A 5BZAA 3OGSA 1IE7C 4AD2A 4FR6A 1PZ0A 4GO9A 3DN5A 2CZEA 3BG9A 3DFYA 4B5XA 4AZ6A 5CPQA 3DFPA 4QEHA 3KOXA 4F9JA 1TJPA 4HB7A 1FWFC 4CGTA 2XHYA 3GDLA 3GVRA 4HNCA 2JGQA 3IAQA 2JK2A 2OJPA 1A0DA 4ZQNA 1EDQA 3N19B 1VYPX 2JIEA 3T08A 4O8RA 1UROA 3FK4A 3RRXA 4YTTA 5FJTA 5LIXX 2HE5A 3WJWA 1VFHA 3VE7A 1TVNA 3EDKA 4CNOA 3WMCA 1QPRA 2Q01A 2PRMA 2ZDRA 2CLPA 4RE0A 4UTFA 3NSMA 1RCOB 2HS6A 2HMCA 5EMMA 1C7SA 1W3HA 1XD0A 4PUMA 1A49A 4C6FA 3HG4A 1DIOA 3MHFA 3B8IA 4XQ6A 3P5ZA 3SB0A 1FWIC 1HO1A 1EOKA 3RITA 2XGIA 2W3ZA 4UWMA 4F48A 2WB5A 1I1WA 3WF2A 1M7XA 3WQGA 2GSJA 1EJRC 2ABAA 1C9WA 1HO4A 1US0A 9XIMA 1WDRA 2O7QA 2CXGA 4AVNA 1WUEA 3SFKA 3PBWA 1K4GA 1OYAA 3PZNA 3WNLA 3EWCA 3QOMA 4PB4A 1XINA 3IGHX 4B5UA 2QCNA 3QHMA 2E9MA 3KBMA 4H9XA 2WZEA 3WDRA 3GW0A 3BSHA 2J62A 1E6PA 3THUA 3MBDA 2C15A 3TNBA 3DIPA 4LUSA 2ZADA 2V5BA 1RHCA 4MJMA 4AWUA 3B4YA 4IIHA 2I17A 3MU7A 4EIVA 2MANA 4OGZA 1GONA 5A6JA 1W91A 1XIMA 3AMDA 3OLGA 4JBRA 4X9YA 1VCGA 3GDKA 2QIWA 6CGTA 1DQWA 1UR1A 4NNCA 2AKMA 2ZICA 1UP0A 1E1FA 3MDUA 5D9NA 4BFAA 4DQWA 3P74A 1LBLA 1S5VA 1S2UA 3AUOA 4JZ5A 3UXDA 4AEFA 4MMWA 2VCBA 3U57A 2QCGA 3WNPA 5HWJA 1PX8A 2FQIA 3AISA 1J8VA 1NWSA 4N4PA 1BYDA 2E5DA 3AC0A 4NQ1A 1Q8JA 4Q8OA 3A5VA 4UFMA 1XICA 3W7LA 1QBBA 2P8BA 1HW6A 2PLCA 2WCSA 5A2CA 2POTA 2DZTA 3GVQA 5DXYA 6REQA 1SFLA 1IEWA 3VDGA 1M68A 3OLIA 3UG8A 1OYCA 4NJIA 1W9DM 2W61A 3WIJA 3L23A 4G7FA 2WM1A 1AW1A 4MOZA 3PNUA 2EG6A 5HA7A 5TD4A 2Y1HA 1JDEA 3A5FA 2AAMA 1B3YA 3VX0A 1UUQA 4PMZA 1KM0A 3S5YA 3TXVA 4HMCA 3MO4A 4P7NA 1R5YA 4JY9A 1QW9A 3B8WA 5K4ZA 2GZXA 1JIBA 1J0ZA 1W37A 1JDAA 1YEYA 2D23A 2VEMA 1KWGA 3CPUA 4J3XA 4GIRA 3S6DA 5AKQA 4NIRA 1QWKA 3B9NA 4YYFA 4G2DA 2VI0A 8CGTA 2X2YA 2PE4A 4UNLA 3T55A 1Q6GA 4DJFA 4GNVA 1RLCL 1TYGA 4U2ZA 4GQGA 4Z1BA 2X09A 1BQCA 1L9WA 3ARUA 3FJNA 3NSNA 1FHVA 4OQVA 4O1EA 4D6DA 3S6TA 4TU1A 1EXBA 5BXTA 4DO7A 2A6LA 1Z69A 5G4HC 3TQPA 2FFCA 1GQJA 1GUVA 4GIEA 4GYJA 4W84A 1POJA 4K36A 3LDVA 3GYEA 3HPAA 4HD5A 4JN8A 4H7CA 4LBRA 2YL6A 3SUSA 5CBJA 1Y7VA 4P8UA 1BYAA 1XDJA 4FNRA 4REQB 4QE1A 3UJSA 4H6RA 3CC1A 1JRBA 1MEWA 3ITCA 1B30A 3OIHA 2PDMA 2OQYA 3QHNA 3QY6A 3W1NA 1YIXA 2D3NA 2XM2A 4PH6A 1YADA 1JAEA 3BARA 1S2VA 4K2SA 5AHFA 1ISYA 4GCAA 3YPIA 3FGCA 4J3WA 2C0HA 2A85A 4GVFA 3LCIA 4WKHA 2Y2WA 3QBUA 1XI3A 3CH9A 2FVMA 1R87A 5XIAA 3MWCA 3OGVA 2RDWA 4O15A 1TJ0A 3G1FA 1SR0A 4MTVA 3MTWA 5PTDA 4DJEC 2NUWA 3IUIA 3EPNA 2V5CA 5CGMA 5D30A 4G7EA 4ZL1A 1QCWA 3KFTA 2V9DA 2ALRA 4IMFA 1ZHAA 1W2VA 3JRKA 2QUNA 3LSCA 2Q8ZA 2AAAA 3VIJA 3IJ8A 4XTDA 3PZOA 4HYRA 3GIQA 5D9PA 1A50A 4O18A 4UNKA 5LNRA 3TTSA 4IG2A 1GW9A 2PODA 4V28A 4YPJA 1XDMA 1S2CA 3A4JA 4FS9A 4CCZA 3PSVA 1RH9A 4ACYA 2DT2A 3HTWA 4F40A 3UF9A 5BNKA 3S3GA 1P1XA 1BF2A 3NQGA 2F6XA 3GIYA 4MHBA 2QPXA 2VOMA 1CZ1A 1EB3A 4GUGA 1BTMA 2C19A 4UFJA 4LV9A 1B31A 3LLDA 3DHUA 4TV5A 4N42A 3KDOA 4ML4A 3LQLA 3EX1A 2PCQA 3KOZA 3V1HA 1XLBA 1MQPA 2CBUA 2F7FA 4C1NA 3M46A 1LYXA 4YVXA 4KKXA 4ZFCA 3L2MA 3N12A 1A5BA 2G5WA 4AHPA 3P0WA 3AHZA 3DHPA 4W4QA 2GUUA 1ZB5A 5CPSA 4JQ3A 4UQCA 1Q65A 1S3TC 2NVAA 1ZJHA 3K8KA 3EOSA 3SUUA 3C2EA 4BS0A 3A21A 4UQDA 4A22A 4ZOBA 3OBEA 2FZMA 4N9EA 1NFGA 5GQBA 1KR1A 1H7PA 1KTNA 3P67A 3CTLA 4JEJA 1EWEA 3VNKA 4ZQMA 1P0DA 1TELA 4MJ2A 3RDKA 1FHDA 3ZT5A 3AIQA 2OODA 3ZZ1A 4ZQCA 3TA6A 1XFBA 3QR1A 4CD6A 1PUDA 4JX5A 1I2OA 1MNSA 2F2HA 2R1PA 1QOXA 3HQ1A 2GGGA 1KFKA 2OKTA 1XDLA 4H6QA 2BY3A 4L80A 5CSYA 5G4EA 4CD4A 4I5RA 3RNDA 4ICMA 3THCA 4ZXLA 3LBMA 3SM0A 1CGTA 2G3MA 3QY7A 2GGJA 3LZ5A 2GFTA 4QBXA 3V35A 2OWCA 1MI3A 2YL8A 2E6AA 4DJDA 3FDKA 3PZGA 2Q8XA 5G2IA 2WYSA 1BWLA 1CDGA 2J9XA 5EMLA 3A3WA 1WP6A 2BGQA 3FEQA 4FNUA 1D8CA 2J13A 2P8CA 1UJPA 1HP5A 1UZHA 2XZ9A 3LM3A 1EF2A 3FS2A 3VKKA 3NQVA 1YLVA 1QNOA 1LL4A 3SGZA 1UD3A 1AA1B 1OHLA 1AW2A 1XLGA 3VUSA 2VHLA 3NVDA 2D2GA 1TR1A 1O5KA 1H41A 2BXVA 5CPTA 2FZNA 1PKMA 3TAKA 5T91A 2E9LA 4EXQA 2D0FA 2GK1A 1B3WA 3WH7A 3W1AA 4E4FA 1ZS2A 2YYTA 3QTPA 3BJTA 3MI3A 4PL2A 1G4SA 3W7NA 2WLYA 4U4MA 4DO5A 2Y8VA 5HWNA 3VOCA 4LYQA 2WWDA 3M7WA 3GXMA 1EZWA 5CPNA 1EJVC 1V0LA 3TNOA 2DVTA 3W70A 2CYGA 3MCMA 4HN4A 3C61A 1Q6EA 1YYAA 2OGYA 1EBHA 2YZRA 4H6EA 3U3HA 1Y65A 3S2NA 1EX1A 4DJED 3K4WA 6TIMA 3UVAA 5I3IA 3PF3A 4FB7A 1WKFA 4LVFA 3DHFA 3GUWA 3UY7A 4PMYA 2AL1A 1YX1A 3W75A 2WMJA 3N2TA 2CERA 4D2JA 2EKCA 4EANA 4DJFC 3BQ5A 2F84A 2YR1A 2C91A 3PZVA 3WY1A 4B91A 3TCSA 4AD4A 3I6TA 1T41A 2XH4A 3GC2A 4E2BA 1TZ9A 2PP1A 4S3CA 5DY2A 2G37A 1R46A 1DV7A 2PPGA 4RZ5A 1OY0A 3T0TA 1XIJA 3N18A 3PTMA 1IWAA 3TOYA 1WQ5A 3ZXWA 5C71A 1XRTA 2VUNA 1EF3A 2DDXA 4C6MA 3NL6A 4NHVA 4HCLA 3NVTA 4NXKA 1JPHA 2WW5A 1WCGA 3K1GA 3ARVA 1K7XA 3ES7A 1YMYA 3ZM8A 5DT5A 4QG8A 4Y9NA 1BPLB 1G0CA 4IMDA 7ODCA 2EPKX 3QYQA 4UBPC 3DCPA 4HPJA 1PDZA 1K77A 2YDSA 4N9CA 4IL0A 1Z8AA 4HU3A 4IGSA 5I3JA 4UTMA 4M7SA 1R38A 1JGMA 3WX7A 1GQIA 3SY1A 4KS0A 3VA8A 3NWRA 4PMDA 4OIFA 3WEZA 4NNAA 1K8ZA 3KW3A 5C0QA 3I4KA 2J7GA 1NSJA 3VUPA 2R9RA 2CZVA 1A5AA 2DZBA 2G4JA 2YSWA 3VMNA 3ID7A 1UB3A 4BI6A 3WLNA 2OCZA 3C52A 1OFDA 5E93A 4EKJA 2QCLA 4ZTYA 3A13A 5E0CA 3CWHA 3A12A 3SO7A 4M56A 3PBVA 1XV8A 2PA6A 3EB4A 2DVXA 1B5TA 3GVVA 2V68A 2J6XA 1MFVA 2IXVA 3COTA 1ZRQA 3DFOA 1JF6A 5IFPA 4F79A 1XGEA 1OFQA 3PUGA 2CITA 1E6XM 1CYGA 5T9BG 2VDHA 4RUBA 2E5CA 5TBOA 2FPYA 4YNGA 2JKAA 3N29A 4XO7A 2DZXA 4PCNA 1I0BA 4K8GA 1BEUA 1ZBCA 4D8ZA 4YCPA 2LLEA 5BRPA 2X1UA 1CI1A 2YKKA 1OSEA 1I4NA 3MDWA 3H8AA 5CCZA 4PYSA 1QFEA 4Q6JA 3D46A 4R3UA 1K7EA 3G3MA 1VYRA 1PL9A 3JS3A 4X9SA 1VB9A 3G8RA 2RJHA 4GXPA 4MUZA 1DWGM 3AYRA 1TPEA 1YDOA 1X96A 4KEVA 4O57A 1PEZA 3IARA 4FALA 3SCRA 1E4NA 2PDIA 4IPNB 4JCMA 1XQLA 1OB0A 1Z6KA 3HFTA 5D2WA 1YDNA 5LIWX 1U22A 1QNRA 2VGGA 4REQA 4ZSTA 4LGXA 4DJDC 2C18A 3WFZA 2VX7A 1L6GA 1H7XA 1CXIA 3GSMA 4Q7BA 1P6CA 3BANA 3GU9A 3BLFA 2VFFA 3ARPA 4ZR8A 2YBTA 3ZWSA 2UY2A 1CXFA 4RLIA 5CBIA 4DWSB 7TAAA 5FF7A 4HGXA 4F0SA 1GWJA 1F05A 2EKGA 1TQJA 2G8ZA 5MKGB 1SFSA 3GC4A 3H21A 1TWIA 4L4MA 2HK1A 1Q7QA 1K7FA 1AJZA 2OX4A 1VH7A 1B0IA 5AHEA 4QG6A 1GHSA 1LG1A 4CCDA 1AG1O 3LPFA 1F6YA 5AYZA 2W63A 3WMSA 4MB3A 7TIMA 1TPC1 1DJZA 4P7LA 2GUBA 3O6DA 3UXIA 5CSRA 4Z2IA 1W31A 1O1ZA 3TZFA 3NOEA 3DXIA 2X7VA 4E2VA 2V0TA 2QCFA 3U2CA 1OM0A 1Q66A 2WO5A 1NOWA 1P0EA 1QAPA 3EZ4A 2NVCA 1JUBA 1OWQA 5BYWA 2VRKA 1XLJA 1MEIA 4N9DA 5CSUA 4PCPA 4IP5A 5GNXA 3B97A 3DH7A 2VGFA 3MVIA 1OCJA 2V5LA 1QO5A 5JU6A 3AYSA 1AH4A 4JIHA 2XN0A 3P8JA 3IV8A 1ISVA 2P1FA 4GQ0A 4IJBA 1F76A 3VD3A 3GDBA 1GJUA 1G7VA 2ABBA 1BKHA 2YFNA 1JZ6A 3BZJA 4RDZA 3LENA 2HPMA 1NDYA 3IS4A 3WLMA 1F3EA 3N3MA 3P14A 2OXNA 1DE5A 5EYWA 3KL3A 1EEXA 4GH3A 1H7NA 3CAWA 4PEKA 4L65A 3LPPA 3GBEA 2CLIA 1UH3A 2QPUA 5HK4A 3ERPA 3AHYA 5M2FX 3NYDA 1FCVA 3PN8A 2B7QA 3WH5A 3RX4A 1V51A 3KP0A 1PDYA 3DU0A 3PTDA 3C5QA 1DJGA 3VIKA 2OFJA 4DAFA 3AI0A 2QJIA 3T7VA 4IP4A 3I7RA 3M0YA 3CUXA 2NLIA 1UUMA 4HCHA 3UXAA 3B8VA 4PTVA 4ADTA 2RDTA 1S2AA 4O0KA 3QV8A 2E9BA 5DF0A 5GNYA 4WDTA 2DZSA 4PR4A 2WHLA 3AXHA 1XCFA 3ZLFA 2UZ9A 4D6JA 1ISZA 3OZPA 4INFA 4ADSA 2A21A 3VVGA 4DO4A 3SI9A 1UIPA 3TDFA 4QX4A 2ZZ4A 1L8PA 3K2GA 1PIFA 4WVXA 3W71A 1WYIA 4QE5A 1ITQA 2FGZA 3HGRA 2I5QA 1TUFA 2C71A 3BMVA 1KLZA 3LHTA 2ZE0A 3TYEA 4JYFA 5C2CA 3CUFA 3TWBA 4KBXA 3HQOA 4FOUA 3W23A 5XIMA 1UMLA 5IXEA 1A53A 4MDPA 1NJJA 3GG0A 1E55A 3WQFA 5GPRA 2V3EA 1UKTA 2CIPA 1JNDA 4GPNA 4IPIA 3NPVA 3DERA 3AQUA 1QHPA 1P43A 1TVLA 1LRNA 5EFDA 3L4VA 2YL5A 1A5NC 2GJNA 2E0PA 2QDGA 1KGWA 1XWYA 4AQLA 1W9UA 2PDHA 1F3WA 4ZO9A 3G3DA 1S5WA 4XAGA 4F0KA 3LMYA 2HBVA 5FJUA 3N04A 4GJJA 4ZENA 3S46A 2OWWA 4WJ8A 4TXEA 2YZ5A 1ZJBA 3VILA 8XIMA 1S2TA 2OSWA 1Q8AA 3VDHA 1MUMA 1OIMA 1W9BM 2A3CA 2J7DA 2E6YA 1ZNNA 3APYA 3E12A 5DY3A 4LBUA 2Y7DA 4RE2A 3CIXA 3KP1A 3W73A 2CPUA 2SFPA 3OW1A 3MHGA 4B4FA 4TVDA 4KH2A 1C9DA 4AIUA 4GZJA 3IJQA 3M1ZA 3OVRA 1YTDA 1JVNA 1QR7A 1UR3M 3RJXA 1U30A 2X1SA 3DBPA 4Y8FA 3W1MA 2J24A 3HF3A 1JULA 2VDGA 5A8QA 3PSWA 4LS0A 4QS5A 4D72A 2EPLX 4IIDA 4K68A 1A4MA 4MWAD 3W53A 3TAOA 3EA1A 5F4XA 1HKJA 2ZZ5A 1E9ZB 3PM6A 2J27A 5FJRA 3NZRA 2FPTA 1EJWC 1D7FA 5GJMA 2Y88A 4YTSA 4H1ZA 1XLFA 4ZGYA 4CQ8A 1RJQA 4BQ5A 1EPVA 3A4WA 4E4UA 3W76A 1UD2A 3V18A 4JFWA 4UTTA 3VGHA 1SVDA 2V67A 3TC3A 4WOZA 3OVGA 1K1DA 4AB4A 3UQNA 4Z1CA 1Q3NA 2P50A 5HNTA 4MJ4A 1HKWA 4H04A 1KQZA 3SZ8A 3DC8A 3KOYA 1FDJA 4H8VA 3RM8A 2DT0A 1KB3A 3SEPA 1FXQA 3V5FA 4XKMA 4JY8A 3ZT7A 4MFDA 4Q4RA 3TV8A 2O9RA 6XIAA 3KHDA 2ZX9A 3FXGA 3P2VA 4GNKB 4Z17A 3UR7A 4WGHA 3FCPA 4B5SA 3GXNA 5F1UA 1XISA 2B7PA 1ELSA 1JAKA 4Z1DA 3BV7A 1RCQA 2EJ1A 4DBDA 2PD9A 1TPDA 4PBFA 1HJXA 2R6OA 1MXGA 3AHXA 3SCOA 1W1A1 3R1ZA 1IT7A 1UD4A 4ZOEA 2IPGA 1JPKA 5EFFA 3LYEA 1KBJA 4K1WA 3GM8A 3HA1A 1JCMP 5A6KA 3TJIA 3CQHA 2A7RA 5HJXA 4O0QA 2BLEA 4EAYA 2GJRA 3SQSA 1LOQA 1KM6A 4MLRA 3W2LA 1FDZA 1V6XA 5CAKA 3Q4DA 3PFRA 5F4SA 4LAUA 1EHAA 2GVJA 4LBSA 2EPNA 1R7OA 3L9CA 3TA9A 1OCNA 3IRDA 4DIAA 1XH0A 1KFBA 4AFYA 3KVJA 3QR3A 1VFLA 4BF9A 3W24A 4AD3A 3LCWA 4G1KA 4IGHA 3L4TA 4XKYB 4JTFA 3PVFA 1RVKA 2Z27A 1VF8A 2EPHA 4O16A 1J11A 3GB6A 3MSYA 5CH9A 3GD6A 3UCDA 1C29A 2YB1A 4ZB2A 3TN4A 3DFNA 1CW2A 1Q7ZA 4JX4A 4R9OA 4V27A 1XH2A 1VFTA 4ROPA 1A5KC 4JFSA 4RDWA 5D8WA 4F2UA 1V7YA 5CPMA 3S1VA 1S39A 2IXUA 4FSAA 5A6LA 3AUJA 3I10A 2Y63A 2J8FA 1F9CA 3NPUA 4XTIA 1L6FA 1FWHC 4DUWA 2ZZ2A 4Y8EA 3TW6A 4JTIA 3MJMA 4ERIA 1B54A 3A3XA 3BCFA 5AY7A 3O2LA 4ZTXA 1XQKA 2ZUVA 3FJLA 2B0MA 1TMHA 1X38A 4M82A 3OIXA 1VKFA 3UYCA 1J01A 2BWGA 3AROA 5KEZA 1MVYA 4DWSA 3TN5A 3E02A 4IQJA 4UIOA 4AY1A 3CGTA 3PS7A 4JIRA 2X7WA 3LI1A 2YCKX 4QLKA 1IEXA 2HXUA 2BVYA 3CM4A 5A95A 3BLKA 5MKGA 1LM1A 2BOFX 3RF9A 1SJCA 2Q71A 3E2QA 3VD7A 2V5JA 2BDQA 1FCQA 2PGWA 1T7LA 5HR7A 1VEPA 2VTFA 1V0MA 2UV8G 3MKCA 3GR4A 4AHOA 1G01A 3KOFA 5LGXA 4GZEA 1J4EA 1LTDA 4NP7A 3MO7A 2VCAA 3VNLA 4POCA 3N13A 3I3DA 3ARTA 4NJGA 1ZP4A 3LGGA 5FIPA 1BWKA 1XHGA 4YL2A 4UXDA 3OG3A 3CHFA 4Q33A 3TTEA 1R85A 2QYGA 4IX0A 2ZUMA 4X60A 2O9OA 2XJ7A 3WD4A 2XTKA 3P62A 4GOAA 2B7NA 1UG6A 5DT7A 3NUKA 1JZ4A 1VBJA 4MF4A 3CQ0A 4IXHA 4HA0A 3GNDA 1UC4A 5T9CE 2C1HA 4DN1A 1J6OA 2J77A 3CUZA 2XZ7A 4RPPA 4JHMA 4DYEA 4ROQA 4ACZB 4RX0A 2ESCA 2Y5SA 3HB9A 4R33A 2VEIA 2F61A 2J7CA 5J8LA 4HNOA 1DQUA 2HVMA 3G1AA 1PSCA 4O54A 2UBPC 1JZ7A 3D5HA 4Z0JA 2HJPA 3W7JA 4FNPA 1TV4A 1JDFA 2ZWYA 3B0YA 4O12A 4Q4OA 1ZAJA 2XVGA 3RPMA 1FWTA 3DGBA 4JYDA 3NQAA 3TSMA 5DN1A 3MY9A 1J0IA 5I77A 3D3FA 1E6ZA 3QLLA 4HMDA 5A6TC 7REQB 1K6WA 4N7QA 2CLHA 4I9AA 2Z7KA 4M24A 3IJDA 2PBOA 1SYTA 4M29A 1XIIA 4AWSA 3VNIA 4O1AA 1VPQA 2XIMA 1KCLA 1NEYA 2DFAA 3L2LA 3STCA 2VZSA 3OEXA 3IJ7A 3TJXA 1FFRA 1P6BA 4L1GA 3M9YA 3S5SA 1GKRA 2D22A 2E1WA 3M0JA 4E4PA 1XYFA 1DJNA 1EHNA 4NJKA 3O07A 1TX0A 1EO5A 1GQLA 4XUYA 3SR7A 2CHOA 3AICA 1AW5A 4QTGA 2FFIA 1V3JA 3N2CA 4JTLA 3GHSA 4FLQA 4IXXA 4LV4A 3BMWA 1WV2A 4OZOA 2F9RA 1TWDA 5I06A 3W7EA 3S1GA 1H49A 2V38A 3APTA 4OBRA 4ASTA 4E5TA 3VIOA 1O4UA 1UA3A 4L7ZA 2IUZA 4GISA 2FZBA 2ZTJA 5SWUA 4PUUA 1HGWA 4J27A 4HTBA 1EC8A 3T0DA 1Q2SA 3FYPA 1ZJAA 4K8HA 4DY1A 4PRTA 3H70A 3OOQA 3T8LA 1U1HA 1XYCA 1FY6A 4FAMA 3BE7A 3QR0A 4WJXA 4KCTA 2CLMA 4HK5A 4FEZA 2Q6ZA 5A8PA 3L0KA 2DSWA 3PJWA 1QHZA 1I1XA 3NFUA 3R43A 5D2VA 4EPBC 5F2IA 3W7KA 2ISWA 2W6RA 1RY8A 3QN3A 5DX7A 1H51A 4NUWA 5D32A 3VIMA 1BTCA 3ARWA 1YPXA 2VFHA 4JEQA 4CQAA 4Q4PA 3PTQA 1NOFA 1HL2A 3CTTA 1J18A 1V3HA 2YXOA 3WK3A 4EPKA 2EHHA 2NXHA 3W1UA 3V3WA 1LG2A 3MSDA 1XRFA 3NAVA 3N9SA 4DWDA 2ONEA 2Y0FA 1RCXB 3DKLA 3QZEA 4X3ZA 2FB3A 3V1PA 3CPRA 3ITLA 2R1MA 1UKPA 2NX9A 1FCBA 1FDYA 4DXKA 4OBTA 1PS9A 1SW0A 4S2BA 2J75A 2FHFA 1UMYA 2PDUA 3BWWA 3WLTA 4FXSA 1YTEA 5BW6A 3RCMA 5CLTA 1RQHA 4JL2A 5FA5A 3WJYA 4XIAA 2GVLA 3E0LA 2PDBA 3W9ZA 1OGSA 4NU7A 1OK6A 1TJ2A 3FSTA 4EPDC 1FH9A 2D73A 2CETA 1M53A 2DZPA 4W85A 2WSRA 3EDFA 3GVWA 4LUIA 2DUXA 1S5MA 3BAJA 5CZKA 4HPHA 3PNZA 3QYSA 4AEOA 2MNRA 3K13A 5G1TA 3T4CA 2DW6A 3PUDA 5HNNA 2V2HA 3GG1A 4LOCA 1ONEA 3T2OA 3VAVA 3U0HA 1BVWA 3IUDA 4DPQA 2D2OA 2CLOA 5JMUA 1W5OA 1E43A 3MV11 2PWVA 1PCKA 3W2UA 1JCYA 4XZMX 1I9CB 3FOKA 1MUWA 3SECA 1TR9A 1XJBA 1B3ZA 2ZOXA 1AD4A 2V2CA 2PUZA 1XC4A 2GGEA 3H26A 2J7HA 3G1DA 3BAXA 2OGJA 1V6YA 1WE5A 1F6PA 3TH6A 1BYCA 3DDMA 1A4LA 3UJ2A 5HXMA 3EXTA 2V81A 2GYIA 3GDTA 4L61A 3S4TA 3CWOX 3M0VA 3NURA 3W27A 4NZCA 4MY8A 1HIZA 2CLFA 1W54A 5B80A 1PYFA 2YL9A 1XLIA 3LPOA 5D9OA 3VIHA 2AQWA 2WC3A 3NPWA 3CT7A 1TWWA 3P8IA 1MXSA 1YKWA 4D6HA 1M7OA 2X0YA 4W86A 1FP8A 3H2CA 1L6SA 3KLKA 3WJSA 5KETA 2ZE3A 1OZQA 1Y8BA 3L68A 5CQ1A 1EBGA 3C0QA 3CQIA 2PGEA 1KLYA 2E5BA 2WANA 3AHVA 4FOJA 4JHZA 4PMRA 3PC0A 1PWMA 1CGUA 4JKKA 3VI2A 2Q8LA 2BS9A 3EDDA 1JCLA 1W3LA 1QASA 1SQ7A 3KXQA 5C2XA 1ALDA 4Y90A 2EEXA 4TX8A 1EWDA 3KEHA 2ZRXA 4UTWC 4R7OA 3LLXA 1HVQA 1GHRA 1K9TA 1E6RA 1J0JA 5I00A 3B0PA 3S2CA 3NXLA 4LW7A 3C56A 1QT1A 3VGFA 4HSOA 4DBWA 2DT3A 4XKYA 3MB9A 1NF0A 4MAVA 3U4FA 4L1WA 1OF8A 1TTPA 2E1DA 4JTKA 3T42A 1AK5A 3LY0A 5F1VA 4F0HA 2QZRA 4RXGA 4UZSA 4Z2KA 3G5EA 1GYMA 5FL1A 4FNSA 1JXJA 2Z4GA 3N3TA 1TMQA 1KC7A 1J2BA 3M5XA 2GJXB 4MNKA 1VJSA 2X0SA 3CZLA 4D8LA 1GCYA 2OT1A 2IKIA 1C3FA 1V6UA 3ABRA 3WUBA 5AC7A 1NTHA 4H19A 3PANA 1DPMA 4XD3A 5BMXA 1WZAA 4MVAA 3MUXA 2NQLA 4GBUA 1LT7A 3TR9A 3KRBA 3PBGA 4PMJA 2TMDA 1P6WA 2NT1A 3RO8A 2I7GA 4IIGA 4S2CA </