4N4SA

A double mutant rat erk2 in complex with a pyrazolo[3,4-d]pyrimidine inhibitor
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
349
structure length
342
Chain Sequence
GPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVADLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKILDFGLARVADPDTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation-Selective ATP-Competitive Inhibitors Control Regulatory Interactions and Noncatalytic Functions of Mitogen-Activated Protein Kinases.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 103
structure length 342
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4n4sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4n4sA01
1Z5MA 2GHGA 4L67A 4GKIA 3F2AA 2XZSA 4ARKA 3ROYA 1XKKA 5HNIX 4IDTA 2PVRA 4ITIA 1REKA 3CQWA 5J7BA 5EKOA 4ZLYA 4N4SA 1R78A 4J1RA 1OPJA 2E9PA 3LFSA 3LLAA 5ITAA 3E93A 3IS5A 4RVKA 4JOAA 4EHVA 2CNVA 1XBAA 3QYWA 3GU6A 4BBEA 4NKAA 4A4XA 5IA0A 4MTAA 1M14A 3QL8A 3HRBA 3RALA 4D55A 5L6PA 5FD2A 3ULZA 5HTBA 3R7UA 3RVGA 4AZWA 4OBPA 5AP3A 2J5FA 3KCKA 3PIYA 3Q04A 1ZY4A 4PDPA 1G8AA 1OL6A 1Q8YA 5JGDA 3R83A 2LGCA 4HNIA 4TT7A 4H36A 4ZXTA 3DTCA 2ITPA 3MSSA 3EIDA 3VUDA 4F70A 1KWPA 3OWKA 3L8PA 3R21A 4E7WA 4DF3A 5HE2A 3QCYA 4JBQA 4DEAA 4EK5A 4XLIA 4EYMA 2XNEA 4HVGA 3BEGA 2R3HA 4KD1A 1IAJA 4N57A 2WTWA 4H3PA 5EOLA 3R8ZA 4RVTA 4RJ6A 1BMKA 2OSCA 4U0IA 2QQ7A 3R02A 5LVPA 2OIQA 5EM6A 5JGBA 3NUAA 4CTCA 2BRGA 4EUUA 3LMGA 5M4FA 4FKGA 3I7CA 3RNYA 3RHXA 3TNPC 3U6IA 3TV7A 3ZFYA 2RFSA 4DH8A 4IJ9A 2E9UA 5LWNA 4K2RA 4FEUA 3KN5A 4IBMA 4AG8A 2J9MA 4KABA 4BIEA 4C4JA 3FUPA 4WBBB 5CEKA 3DV3A 3HKOA 4F7LA 4BL1A 1XBBA 1FPUA 3C0GA 4J7BA 3SLSA 2GS2A 4A9YA 2BDJA 4BYIA 2RG5A 3JS2A 3QU0A 5HCZA 3C4ZA 2YIYA 1J3HA 1WAKA 3WYYA 3OWJA 4BBFA 1CKIA 3CGOA 1JKKA 3CPBA 3IW7A 4JRVA 5BVDA 4DBXA 4EOQA 4FR4A 4UWCA 3QD3A 2UUEA 4QPAA 3KVWA 3N51A 5HVKA 4GVAA 2VD5A 1W0XC 4AA5A 4LOPA 4C58A 3CJFA 5KKRC 3E63A 2IZRA 4DEHA 1MQ4A 2ITVA 4NZWB 1H1QA 3U87A 3KCFA 4ZSEA 3WF6A 4BGHA 5KKRB 4TWOA 3RPSA 1HCLA 5AA9A 2RIOA 3CKXA 4IM2A 2R2PA 1B38A 1EH4A 2C6DA 3ZZEA 2W5HA 2R4BA 4BKYA 4A9RA 5IQFA 5ANGA 4NIFA 2XJ0A 3NX8A 1KUTA 3IECA 4K1BA 4RGJA 1ZZ2A 2C0OA 4LMUA 2Z60A 3H3CA 2VTJA 4S34A 2V55A 4X2FA 3NGAA 3QYZA 4QT1A 4WHZA 4BWPA 5HE3A 2OFUA 2VTOA 4B8LA 5HG5A 5EFQA 4J71A 4PF4A 1XR1A 2GS6A 3E64A 4KRDA 1T45A 3AG9A 3BBWA 4O91A 4PPAA 5DRBA 4APPA 4X2KA 5AIKA 3ALNA 3KXGA 5HGIA 3HP5A 4XG6A 4IVAA 1PMUA 1YDTE 3I6WA 5JT2A 3BPRA 2XIYA 4ANLA 3KF4A 5CXZA 2BRMA 4FSUA 5I9YA 3C4FA 3RJCA 2VNYA 1UU9A 2AC3A 5H2UA 2J4ZA 5JN2A 5CEPA 4RWKA 1ZYDA 3ET7A 1UV5A 4ZIMA 1H26A 3FZPA 2LAVA 4HVDA 1O9UA 3O8UA 3O96A 4F99A 1X8BA 3ZO3A 4RQKA 5HTCA 4QTAA 1LR4A 2J51A 3E7OA 3D94A 4EOJA 4TWNA 1FGIA 2GPHA 1HCKA 3FZRA 5DR2A 3PP0A 5T3QA 4B99A 4C62A 3R1NA 5E8TA 1Q24A 3ZEPA 5LQFA 3PLSA 4M69A 4AN2A 3UO4A 2R5TA 2WB8A 5JEBA 3QXPA 2GMXA 4BWXA 5DVRA 3BEAA 4HYHA 4RPVA 4X0MA 4JAIA 4O7WA 4EOPA 4YR8A 3DFCB 4F08A 4UZHA 1K9AA 4QMQA 4Y73A 5JKGA 4FKVA 3Q4TA 4DEDA 4GH2A 2YIRA 3NUYA 2R3GA 5C8MA 4BCKA 4IM0A 4R3PA 2YIQA 3GCVA 2XIKA 4M84A 4C33A 2C6EA 3ZO4A 4WNPA 5LOHA 3I7BA 3ACJA 4NW6A 4UEUA 4BCQA 4IVCA 2YCQA 2IW8A 4C34A 4F64A 3D14A 1YHSA 2BIKB 4KS8A 3V04A 4AFJA 4EI4A 4DG0E 5LCKA 2YM8A 4DGLC 1FOTA 3PRFA 3R2BA 3TL8A 4UYAA 2R3OA 4AT4A 3NUNA 3TZ8A 4F6SA 5IA5A 4MNEB 4PL4A 4FTMA 1GIHA 5AUVA 3ZRKA 2YM7A 2PMNX 4BHZA 3PXZA 4PDSA 4CGAA 4BHNA 3BGZA 4W8DA 4RWLA 2JIVA 3DFAA 4ASDA 5IPJA 4OBOA 5TF9A 3C7QA 4FV2A 4YTFA 4D9TA 2EWAA 3BE2A 4EBVA 4GFOA 4U7ZA 4MD7E 3ZUVA 4C4HA 5HG9A 5HORA 5AP7A 5J1WA 3FYKX 4WBOA 3P7CA 5AAGA 4FG9A 2G2HA 5I9VA 4FA2A 4IWQA 4YJRA 2ESMA 2R0UA 3AMAA 3FI3A 4YZ9A 5AP2A 5CASA 1OPLA 3WZJA 3MN3A 3ZC6A 4X3FC 4I41A 4M69B 4XRLA 4BN1A 3UGCA 5GHVA 3AC2A 4NUSA 3FKLA 4GYIA 5J1VA 4M13A 1Z57A 2UZNA 4IH8A 4DGMA 2JDOA 1WZYA 3C13A 4G6NA 3DU8A 3B8RA 3GXLA 3KN6A 3TV4A 4EJ7A 2XJ2A 4S30A 5FRIA 4BWKA 2RSVA 3NPCA 3S95A 3U9NA 4O0RA 4FODA 3WE8A 1B39A 5HD4A 4FKQA 4LI5A 2KULA 4UV0A 5CU0A 3PPZA 3PLAE 3CKWA 3BQRA 4FT0A 1WBVA 3UYTA 1DI9A 2JDRA 2VAGA 1XO2B 3KK9A 3GC8A 5KNJA 4JX7A 5IUIA 3T3UA 2Z2WA 3VBWA 3PJCA 4U6RA 2XK9A 2XUUA 5HBJA 4ZEGA 2C6OA 4R77A 4F0GA 4NFMA 4E4NA 2WNTA 3DK6A 3R22A 4QTDA 3WYXA 4AW0A 2CDZA 4FZ7A 4ZTMA 5E8WA 1IRKA 2WIHA 3KB7A 3AQVA 4KKEA 2CKEA 3UP2A 4R78A 3TTIA 4FIFA 1OGUA 3PG3A 4DFYA 3RCJA 5C9CA 3PXYA 2FO0A 5J87A 3FPQA 5LMKA 4WIHA 2HZ0A 2JDVA 3H9FA 5G1XA 4NFNA 2OIBA 1LUFA 2VRXA 3SG8A 3AXWA 4HGSA 4BDGA 2C5VA 4JNWA 3B2TA 3MYGA 3MTLA 3A7HA 4U97A 3DDQA 2JBPA 5BYYA 3DXQA 3QTWA 4DYMA 2YLEA 1PXIA 4BGGA 1Y6AA 4WOVA 4CLIA 3QUDA 2WMBA 1UVRA 4JXFA 3R8UA 3Q2MA 3G9LX 1Q3WA 4LOQA 4BIBA 5DYJA 1Y6BA 3BI6A 3FY0A 4JR3A 5M07A 1A06A 3HUCA 4D1XA 5CEMA 5EW9A 2PVLA 3QLFA 5FXQA 4C3FA 4YLLA 5DLSA 3VS1A 3L8VA 3IDPA 4FZAB 1KV2A 4ZTRA 4GT4A 1J7LA 2IZUA 4FBXA 4JBOA 3QD4A 3U51A 5DMZA 3GEQA 4DITA 2VWBA 3MPAA 3W2QA 3PPJA 1H24A 4OAUC 1WVYA 2OJ9A 2F7XE 4G5PA 3Q9WA 4H39A 5KMOA 4E4LA 3P5KA 1JSUA 2VTIA 3AMBA 4QP3A 1FBNA 3JR1A 5L2TA 4C4IA 3DLSA 2YIWA 3DKCA 4GEOA 3I5ZA 2QKRA 4F9BA 3BLHA 5IQBA 2YWPA 4NTTA 3TKHA 4ALUA 3AD4A 3V3VA 4AGCA 3WZUA 3EQDA 2GNHA 3F5GA 4XH6A 3TNWA 4ZZOA 4RIWB 3TI1A 4D1ZA 4FT5A 4XLVA 5E8XA 3FMDA 4G2FA 3DQXA 4FZ6A 3REPA 3FZOA 4FGRA 4BDIA 1UU8A 4M97A 5DOSA 4OUCA 1Q8WA 4XG3A 1J7IA 3EKKA 5ANIA 3P23A 3COMA 3TZ9A 3FQSA 1YI6A 3W2SA 2I0YA 3W55A 4IAZA 5LCJA 5BYZA 4ZMEA 2W1EA 4IADA 3DA6A 4X2JA 2C3LA 5ANDA 3TZ7A 3FQEA 3GC7A 3PXQA 2VX1A 2J0MB 4U5JA 3VF8A 1R3CA 4HZRA 4AZVA 4CZTA 4YHJA 3HDMA 4JX3A 4AF3A 2ZMDA 2W1FA 4YO6A 5IDNA 1WVXA 4F09A 5HD7A 3LXKA 3AD5A 3ZLSA 2C4GA 3KGAA 3DXPA 4L68A 3LFBA 5GZAA 4CFWA 4WG4A 2IW6A 3GCUA 2GFSA 4HGEA 1UNLA 1VR2A 3FBVA 3IW6A 4UMQA 4NKSA 2R3NA 5HQ0A 4I0TA 4CV8A 5HKMA 4J8NA 2Z8CA 4BR3A 1BL6A 5L8JA 3NW5A 3ZFMA 3L8SA 3UQCA 2PZ5A 5HO6A 1OKZA 3TDWA 3S3IA 4FKTA 4E93A 4LL0A 4DAWA 1Q61A 3QLGA 1H4LA 1M2RA 1OM1A 2Z7LA 4FNYA 3QF9A 5IH5A 5AUTA 2GTMA 2UZTA 2Y4IC 2Y6MA 4FV3A 2C5NA 3QQLA 4J95A 3U4WA 2I7QA 2QOBA 3UC3A 3KULB 2QONA 5DI1A 3CD8A 2XKCA 2ZJWA 3QD0A 4I21A 2A4LA 3VQHA 1YWVA 5JZNA 1JAMA 1CMKE 1UNHA 3NIEA 4W9WA 4CT1A 3GU7A 5M51A 5A4LA 3DKOA 4IFGA 3TZMA 3MW1A 5H3QA 2Q83A 3VUMA 2QR8A 3SW4A 3A7GA 3IQ7A 4YHFA 4TXCA 2WIPA 4YTCA 4R5YA 2XF0A 2PULA 3HA6A 1CM8A 4QMTA 3IW8A 3HA8A 4AGWA 5IEYA 2JC6A 3GCSA 5I9UA 3VBYA 4USEA 5AP5A 3KRWA 4QP8A 4HVHA 4D2WA 1GZOA 2G15A 5HCYA 1YOLA 3NUPA 4TN6A 2NP8A 3AOXA 4KIKA 4MXCA 4MVFA 3R7VA 4JQEA 2YM4A 5C4LA 4HVIA 2XYUA 2B1PA 3TKIA 1YVJA 4FV0A 2NNWB 5GZ8A 2VTAA 1DAYA 1RJBA 3R9NA 1ZWSA 4HYUA 4M15A 3G15A 3CS9A 4J97A 5HG7A 1Q97A 2IG7A 3QFVA 3QCQA 2J5EA 4M14A 4KUJA 3MIAA 4FV4A 3OUKA 4BY9E 3MBLA 3VHKA 4DE4A 4NEUA 4IX3A 5M55A 5J9ZA 2PZRA 3WF9A 2QO2A 4QMNA 4JBVA 3Q32A 1W84A 4JDHA 3VUTA 1NT2A 1PXLA 3NAXA 3VRYA 4AU8A 4I5HA 2Y4PA 2XB7A 2YM3A 3N4TA 3IW4A 3CY3A 4JIAA 3G90X 2R3LA 4LL5A 3I0QA 3PA4A 3UPXA 2PWLA 5M4UA 1J7UA 3CTQA 4O7ZA 5DN3A 1M7NA 2ZVAA 4WG3A 5B2MA 1I09A 2ZV9A 4XP0A 2W06A 4ORKA 4RT7A 4OR5A 5I9WA 3FSFA 2ZM3A 3K5VA 4FF8A 5AR4A 3RAWA 4EC9A 3DXNA 1UU3A 4IM3A 5IMEA 4XV1A 4W4VA 1F0QA 4L46A 4YPDA 3EQBA 3KQ7A 3DKGA 3A4OX 1BL7A 5KBQA 3ORIA 4GFGA 3SV0A 4FT9A 3VNTA 3QD2B 4RWIA 3VS4A 3S1HA 4YJNA 4XOYA 4J99A 4AN9A 1RW8A 2NO3A 1VYWA 2OG8A 3DPKA 5IQHA 2GQSA 2QOLA 2OWBA 2ZV7A 5FEQA 3R7OA 3LMHA 2F7ZE 1PXPA 5CX9A 4EONA 1QPEA 2OZAA 1APME 1KOAA 3CPCA 3P0MA 5CAUA 5EW8A 4RMZA 5AV2A 4HOKA 4HW7A 4ZTNA 3A7IA 2XIRA 3ORKA 3BHHA 3PVWA 3QWKA 2BAKA 3ACKA 3HMOA 4QQCA 1XH9A 5A4EA 5KO1A 2C1BA 3M42A 3QZFA 2UZOA 4EZ3A 2WMQA 4AWIA 3COIA 5AV4A 3KFAA 4F1TA 4F4PA 5IA2A 5L2WA 3UOJA 3F6XA 3W2CA 5CXHA 4DGOA 1OIRA 5IQCA 1J1CA 3GQLA 1Q8UA 4IDVA 3EN4A 4PPCA 2FSMX 2W7XA 3P7BA 4CZUA 4CV9A 3OWLA 3VS3A 2ZYBA 4XOZA 3Q9YA 3PG1A 5K0KA 4EWHA 2E9OA 2UW0A 4GW8A 4RIXA 4IWPA 4CRSA 3OT3A 3ZSGA 3C4WA 4A9TA 2XMYA 3UTOA 2I0HA 2XM8A 4P4CA 3D2IA 5M06A 4V05A 3K2LA 2C30A 5B0XA 4C3RA 4N70A 4NL0A 2HOGA 4BKZA 3D5UA 3RPYA 2F2CB 2EVAA 2O3PA 4E20A 4CMUA 2PK9A 4KIPA 3EQPA 3MJ2A 3MPMA 3HMIA 4EH7A 4IVDA 2HZ4A 5D12A 1V0OA 3THBA 4CVAA 2C3JA 3SRVA 2IVTA 2Q0BA 5GINE 5LVLA 5J7HA 3DB8A 5DR6A 3RWQA 2CJMA 4F9YA 4O38A 2GNFA 3GC0A 2W17A 4YU2A 5DH3A 3OTUA 4LUEA 3ANQA 1PKGA 1ZYSA 2W9FB 5TOZA 1ZY5A 1H1SA 3RPVA 5HTIA 1BUHA 1JWHA 3PDTA 4YC8A 3TIZA 3TKUA 2OKRA 3EN5A 4HCVA 2CCHA 3BU6A 3FDNA 5JFVA 2CHLA 1ZYLA 5IEXA 2HK5A 4A4LA 4G3EA 2PYWA 4YZCA 5LVNA 5HOAA 2P3GX 4WD5A 3D4QA 4ZS0A 4DEIA 2W9ZB 1SYKA 4DT9A 5AX9A 1BYGA 1GJOA 3QBNA 2W1GA 4YURA 4ZLZA 3DJ6A 2VTQA 2BR1A 4IEBA 3KK8A 3OWPA 4OTHA 3HNGA 4Z16A 3QKLA 4BBMA 1Z9XA 4D5KA 3F66A 4Y5HA 3UG2A 2DYLA 4EHZA 5CQWA 2NRYA 4EKLA 3D2KA 5J79A 1H28A 3LVPA 1J1BA 4IJPA 4EQCA 2WKMA 3C0IA 3R6XA 4L7FA 4RIXB 2FVDA 4EEVA 3QAME 2XVDA 5LARA 3D7TB 3OHTA 4FMQA 3GNIB 4OTIA 4BCIA 5HI2A 3ANRA 3HV6A 4LQMA 5AIRA 4BDDA 1IA9A 3FHRA 4O7SA 5KE0A 3ZS5A 2CGVA 1LP4A 2BVAA 3LCTA 1YHWA 3A4PA 4XV3A 2VUWA 3Q4ZA 4PTEA 2YJRA 4Y95A 4EZ5A 4YNEA 4Q9ZA 1JKLA 2BHEA 3EL8A 3NEWA 4EOMA 2QO9A 2XNGA 2VO0A 2B55A 2BDFA 2VTSA 3OEFX 4W4XA 3RM6A 3Q5IA 3SRVB 3PXFA 2WU7A 4DA5A 1PYXA 5CF5A 3ENMA 3BHVA 3PFQA 4YBJA 3TJDA 2ITYA 3TNQB 2O8YA 4D0WA 2VWVA 2VZ6A 4QPMA 2A19B 4I94A 3SA0A 3DK3A 5AAFA 3C50A 5TO8A 3OD6X 2X9FA 2YM5A 3EN6A 4G6OA 3SQQA 1WBOA 4AW2A 2P4IA 3DZOA 2BCJA 2O2UA 3F3UA 3ORZA 4DHFA 2EU9A 2BAQA 2Q0NA 3KRJA 4NU1A 4RWJA 5AADA 1WFCA 3JVSA 4C4GA 5KMIA 3MFRA 2AUHA 2ITXA 2R3FA 3GOKA 3HDNA 3PXRA 3R63A 4G17A 1ZAOA 2O63A 4GJ3A 4JS8A 3W2PA 1ZMWA 4WG5A 3V8SA 4R6VA 2CGXA 3ZC5A 1UNGA 2ETMA 1YXVA 5CSHA 2UW5A 3HECA 3H4JA 4P7EA 4FYOA 4DCEA 2FA2A 3LFFA 5BVOA 4BCJA 4FKIA 2YACA 4XG4A 4HYSA 5I9XA 5M08A 1R0EA 3W32A 4H3BA 4RFZA 5HLPA 4E26A 4JDKA 2QOFA 2VTHA 2EXCX 5EH0A 2Y8OA 4M68A 3SC1A 3LKMA 4FV9A 2C3KA 2OH0E 3GU8A 2FSLX 3BYOA 1T46A 5H8GA 4EH6A 2PVMA 2IZSA 3DAEA 3KL8A 5CANA 1YW2A 2BTSA 2JKKA 1G8SA 5IQDA 3ZRMA 4RC2A 3GVUA 1GIIA 3WBLA 3GOPA 5EQPA 1IEPA 3SOCA 3AMYA 4L00A 5JH6A 4DFXE 2PUIA 2XA4A 2W5AA 3OMVA 5CTPA 4FKLA 4AT5A 5DGZA 3UPZA 2OI4X 4JRNA 5K3YA 2VX0A 3KF7A 3G2FA 3ZDIA 5AP4A 5AR3A 4F63A 4C36A 3FSKA 2Z7QA 2QG5A 3CTJA 3GU4A 4N0SA 2HY81 3EQCA 3Q6WA 3A7FA 4FV7A 4KKHA 2WO6A 3A60A 4UWYA 4H1JA 2QC6A 4BTMA 1ERKA 3PVUA 4QYFA 2C6TA 3H0YA 4IZ5A 1M17A 4AACA 2W1ZA 2YAAA 3EB0A 3I6UA 5A3XA 5HVYA 5CSPA 3M2WA 4IC8A 1YXXA 2BRHA 2NPQA 2RFEA 3P7AA 4CG9A 1Y8YA 3NNVA 4UBAA 2RFDA 3PVGA 4TL0A 3FMEA 2B52A 4PDOA 4WA9A 3LJ1A 2V22A 2VTRA 4CFNA 2WQBA 3R7IA 2PMIA 3OUNB 2B54A 3QX4A 4TY1A 2JD5A 3ORNA 3ZM9A 4EOOA 2QKWB 3I81A 4DN5A 4KIQA 5IKWA 5CENA 3VWAA 2A27A 2YEXA 3E5AA 5L8KA 5HX8A 4HVSA 4R5SA 3ZXZA 1JKTA 3PTGA 3S4QA 4E73A 2QLUA 5KZIA 4O1OA 2AYPA 4OTDA 3SD0A 4AA0A 4TW9A 4UN0C 3PY3A 2RGPA 3ORPA 4ITJA 1A48A 1H00A 2J0IA 3UOHA 3UMWA 3SG9A 4FVPA 4D5HA 1BI7A 2BTRA 1BLXA 2G1TA 4I92A 3G0EA 3K3IA 3H0ZA 2XH5A 3OW4A 4DTBA 2JEDA 4JVGA 3CP9A 2R3MA 3O17A 3PSBA 1A9UA 3JY9A 3NUSA 4Z3VA 2J0JA 4G34A 2E9NA 3RMFA 3ZTXA 3SHEA 5IA4A 1YWNA 1BX6A 5AP1A 5E8SA 3QTQA 4X6QC 5JQ8A 1JKSA 4KWPA 1YHVA 5DNRA 4RX9A 1H1PA 2QOCA 4C2WA 5IDPA 3VVHA 4RIYB 5LWMA 3LE6A 4YJUA 2VN9A 2I1MA 5M53A 3Q2JA 3ENHA 4QP4A 4RJ8A 2QNJA 3U4UA 1NY3A 3FI2A 4NWMA 4O7TA 2PUPA 2JKOA 1Y57A 3VUKA 3RBWA 4FKWA 1U59A 4L9IA 3FLQA 4FSRA 5DG5A 1FGKA 4V0GA 1GIJA 5TE0A 3SXFA 3VS2A 4HGLA 3R04A 5EQEA 3O8TA 5BUEA 3DZQA 4U3ZA 4C57A 3CIKA 2Y4IB 2CMWA 4O7LA 3T9TA 4AE9A 3ZUUA 5KBRA 2HZNA 1KSWA 3QQHA 5IQGA 3D5XA 4M0YA 4IX5A 3OXIA 4XG2A 2PVHA 3UG1A 3MGYA 1ZYJA 4ZSJA 3RHKA 2UZWE 4PP9A 3Q9XA 3EL7A 4PP7A 4YSJA 4KBCA 2OJGA 4CQEA 3LQ5A 2B9JA 3VBVA 4CFMA 2REIA 4CSVA 4RIOA 3C5IA 2X6DA 5K5XA 2W4OA 4KB8A 1VEBA 3KXZA 4TNDA 5CSVA 1E9HA 1U54A 3R7YA 3TJCA 5F1ZA 4CFUA 4DLJA 4CKJA 1K3AA 1W98A 4ALVA 2QI8A 4ZSGA 3UO6A 4A9SA 4PQNA 4RZVA 2C0TA 2YCSA 3L9NA 2YM6A 4FUYA 5EI6A 4F0IA 1M2PA 2V7AA 3R30A 3BX5A 4XBRA 4KINA 5E4HA 4A07A 4FK6A 4GS6A 4BIDA 3EOCA 4QMWA 3NCGA 3ATTA 4ZK5A 4AZEA 1L8TA 2ZM4A 2X7GA 3IKAA 1OVEA 2H8HA 4A06A 3F3WA 2W05A 2QURA 4ZZMA 3GI3A 2YAKA 3R8PA 4QMLA 5BVEA 2B9HA 2PVFA 1NW1A 1ATPE 4RJ5A 4CMOA 1ZOEA 1H0WA 5E8YA 2VTPA 3HUBA 3FZSA 3TCPA 3DS6A 3ZHPC 2YDIA 2RF9A 4I6QA 5HESA 1E1VA 4L42A 2G01A 4IANA 4UMUA 3FLSA 2C6LA 2W5BA 3MH2A 4C4FA 3A99A 3QQGA 2PVYA 4FKOA 5EK7A 4FEQA 1KV1A 5C03A 3BBTB 4XV9A 4FSMA 5CF6A 2GNLA 3DGKA 3ZCLA 1V0PA 3PIZA 4IW0A 3KA0A 2FH9A 4TYGA 3EZVA 2YDJA 1P4OA 1S9JA 1SMHA 2PL0A 2FGIA 2BPMA 4I4EA 4MAOA 3UYSA 3FI4A 3LQ8A 4IX4A 4L3JA 4BCGA 4CKIA 4DH3A 3G6GA 4EOKA 5JSMA 1KE5A 2X2KA 2V62A 3OCSA 3IK3A 1F5QA 3LXLA 3HGKA 2BROA 3C4XA 4XS2A 4WNOA 4EWQA 3BE9A 3NVKI 3ORTA 4PUZA 4I6BA 5HNGA 2OXDA 5DR9A 4QP1A 2OZAB 4DEBA 2XS0A 5ICPA 1JSTA 2H9VA 3WF5A 3QRTA 4AP7A 4GK3A 3OFMA 3R1SA 4D2TA 5BVWA 3UJGA 4C2VA 5BYLA 4MEDA 1R0PA 2VWIA 5E7RA 3VO3A 2PVKA 1PKDA 5J95A 1PHKA 2VU3A 4ALWA 1E1XA 4BZNA 2XNMA 3FPMA 4OTRA 1YDSE 3LIJA 2UW8A 2F57A 3MY5A 5EM8A 3UC4A 4AS0A 5BVNA 2GFCA 2JKMA 4WKQA 3WZDA 2X4FA 4L8MA 4TZRA 4MKCA 3GBZA 3TNHA 5IU2A 3UNZA 4YLKA 4AZFA 5HVJA 5LVMA 2UVXA 1WVWA 4MCVA 3MWUA 5CAOA 5HZNA 4WT6A 2QCSA 4FGBA 3RI1A 3MY1A 2WOTA 3VQUA 2YABA 3BV3A 5LVOA 3PP1A 2CGUA 2VX3A 1OL7A 3QWJA 4RVLA 4RRVA 3WIGA 3UNKA 4NM7A 2HXQA 3KC3A 3DB6A 1RDQE 4K77A 4RZWA 4NW5A 1R1WA 3UVQA 1BKXA 4MYGA 3D5VA 3UIBA 1J91A 4L3PA 3C51A 5BUIA 1IASA 3AGMA 5F95A 4BCOA 3TUBA 3SOAA 3FLNC 4DBNA 3AC1A 5AR7A 5HE0A 2IWIA 3FKNA 3UQGA 4E6CA 1GZKA 4I6FA 1OMWA 3K3JA 4I3ZA 4TWPA 2C5XA 3P4KA 2F9GA 4BYJA 4JG8A 2WEVA 3PE2A 4MQ2A 3OY3A 5EDPA 2JITA 4D4SA 3TUCA 1OBDA 2JKQA 2X7FA 4RX7A 2BIYA 3O8PA 3EN7A 3OZ6A 4D4YA 2OO8X 3DAKA 5GNKA 2UZBA 2PU8A 2PUUA 4C4EA 3AT3A 4F7NA 4O7VA 4DEGA 4CFXA 4M7IA 1SZMA 3D83A 3U54A 4ZY4A 3A2CA 4KAOA 1ZXEA 3NUXA 2ZMCA 4U44A 5J9YA 2XBAA 4UB7A 1OL2A 5E91A 4BTKA 4ZTSA 1UU7A 4G9RA 1NVSA 1JOWB 2WTCA 4ENXA 3EH9A 3ORLA 4HJOA 4O21A 4OBQA 5KMMA 4B4LA 2R3IA 3IOPA 5B2KA 4YC3A 2OK1A 1ZMVA 4NJDA 4Y5QA 2CKQA 4IXPA 2XK4A 4F7SA 3JYAA 2ITNA 3FYJX 3NS9A 5EYKA 4R7HA 3LQ3A 5DBXA 4C7TA 2QHNA 3L8XA 4CD0A 4QNYA 4BCFA 4NM5A 4GIHA 3TIYA 4ANMA 2XM9A 2WAJA 2IO6A 3NNUA 4RA5A 3EQRA 3IDCA 4EZ7A 3PZEA 5AP6A 3EWHA 4I1ZA 1Q62A 4FX3A 2UZEA 4EBWA 3JVRA 3QGWA 2UV2A 4U9AA 2C0IA 1DM2A 1TQPA 3HLLA 4M3QA 4GVJA 3SDJA 5E9EA 3PWDA 3CQUA 1H01A 2OH4A 3CC6A 3COHA 3EN9A 4PNKA 4CEGA 3ZBXA 2OGVA 2EUFB 2XKDA 4KKGA 2X2LA 5CI6A 3WI6A 3R9DA 3QRKA 3POZA 4CNHA 4F9CA 3V5WA 4UYNA 5FUTA 2GS7A 5KMJA 3VAPA 5HCXA 4AOTA 3F3TA 4R8QA 2WTKC 4ERWA 1ND4A 2R7IA 5E8ZA 2QR7A 3ORXA 3TV6A 3C9WA 4K11A 5EHOA 2XCHA 1PJKA 5TR6A 3U6JA 4U3YA 3I1AA 3R2YA 4ANBA 5AR8A 4XJ0A 4FEXA 2R3RA 3RWPA 3VF9A 4FSNA 3OOGA 4U80A 4FSZA 4BTJA 2VWWA 5JRQA 3UO5A 5IQIA 1JNKA 3Q3BA 1O6YA 4EOIA 3BQCA 4O0VA 4LGGA 2XP2A 1H1RA 4FOCA 4F0FA 4ACDA 2OIDA 4I23A 4FSYA 3PXKA 4MQ1A 4DG2E 5HU3A 5AA8A 5DIAA 1YOMA 2W1DA 3IDBA 4R3CA 4XG9A 1PXOA 1Q5KA 3ALOA 3ULIA 4I4FA 4C38A 1KOBA 2XNBA 3D5WA 3GU5A 4E8AA 2GNJA 5EI2A 4TYIA 2EB2A 4JJRA 3WE4A 3RK9A 5A54A 3S0OA 5DWRA 5CNNA 4AW1A 3QCXA 3NYNA 5HO7A 4MXZA 2WXVA 3KMMA 4MD8E 2JAMA 2ONLA 3CCNA 3O50A 3E8DA 2WTDA 4W4WA 4YLJA 1YXTA 3MVJA 5F20A 2YCRA 4BDEA 3OC1A 3MFUA 3Q4CA 2EXEA 5EG3A 3DKFA 3KXMA 4FV6A 4FKJA 4KA3A 3Q96A 3EFLA 4IZYA 1H0VA 4OW8A 3F5XA 4Y85A 2R7BA 3H9OA 4R3RA 3VJOA 1AGWA 2F49A 3IO7A 4FC0A 5CVHA 5AWMA 3G9NA 3LCDA 1H1WA 4EUTA 2HENA 3G6HA 5IQAA 5EHLA 3S00A 2HW6A 1QPJA 3TNIA 4FZFB 5AV0A 3VC4A 1ZMUA 4YC6A 3HMNA 4XP3A 5K0XA 2UZUE 3KRRA 5FM3A 3FXXA 5CU6A 5DT3A 4CXAA 3VS6A 5LMBA 4FE2A 3HV7A 4MWHA 1RE8A 4PX6A 3LCKA 4AOIA 4TYHB 2CN8A 4F1MA 2G2IA 5CSWA 3F69A 4L3LA 3PYYA 1WCCA 5HE1A 3NR9A 5ANJA 5EM5A 2UW7A 3HAVA 2FUMA 3PJ2A 2QODA 4RSSA 4I20A 4EOSA 3A8XA 4MH7A 3SVVA 3VULA 4FTLA 1SM2A 3NW7A 3UODA 1QCFA 4ZTHA 2WQOA 2W1IA 4BCPA 3QQUA 5JGAA 3BHTA 3EFKA 4IWOA 3VS0A 4FTUA 3G51A 2X39A 4QQTA 5CF8A 4MBJA 4YMJA 5M4CA 2VTTA 4JG6A 4O7YA 1LEZA 4O0YA 3ATSA 3UZPA 3GFEA 3LFEA 3ZLWA 4JI9A 4G1WA 4X3FB 3TUDA 4I5PA 3AGLA 1QPDA 2O5KA 1PXJA 3FC2A 4PTCA 3H30A 3ITZA 5L2QA 4LGHA 3D0EA 4O0WA 2DS1A 1DS5A 3EFJA 5CAPA 4R7BA 3VN9A 4DFBA 3OXTA 1FMOE 4O84A 5CT7A 3D9VA 1NVRA 3ZZWA 4X3JA 3D7ZA 4DH1A 5F9EA 4DCAA 4O86A 4F6WA 3FMKA 3HEGA 3ZSIA 3QRUA 5IF1A 4YJPA 4YBKA 5AUUA 4U45A 4HGTA 4S32A 3ERKA 4C59A 3W8LA 3PIXA 3DJ7A 3LPBA 4K6ZA 4EQUA 5EYDA 3TG1A 5K4JA 4JIKA 5BPYA 3ZLXA 3LJ0A 4E1ZA 2OXXA 3FY2A 4FT7A 2Z7RA 4HCUA 2ZM1A 5J9LA 1MP8A 2BZIB 2YLFA 4OT5A 1U5RA 3F61A 2WMRA 4K18A 2ZDTA 4OTWA 4QTBA 5CNOA 3UBDA 4AGDA 4HZSA 2ERZE 5EOBA 4IZ7A 2WELA 4FG7A 4I5MA 5IUGA 2IPXA 3QZIA 4RFYA 3TEIA 3OVVA 3QTXA 2UVZA 4KS7A 2ITZA 2HWOA 3JXWA 1FVTA 3EQGA 3QQJA 4Q5HA 2C6IA 2OLCA 2PZPA 3PJ8A 4NK9A 4AW5A 5BX0A 2PMLX 2V7OA 3MY0A 5HBHA 3E87A 4Y46A 3SXSA 3FHIA 3OXZA 4L7SA 3NZ0A 4YZNA 4H3QA 5D7AA 4DH5A 4O6EA 5CI7A 3VUGA 4EH3A 2R3KA 3H9RA 4UZDA 2ZV2A 5AUYA 3QKKA 4MNEA 5E92A 5EHYA 1PY5A 5E8UA 4MWIA 4L45A 5KHWA 2XK3A 3NWWA 3N4VA 4FIEA 3BU5A 3FZ1A 3SXRA 5C26A 3TXOA 4XP2A 4D4RA 3QQFA 4CT2A 1MRYA 4JT3A 2BZKB 3UVRA 4HPTE 4L44A 4RVMA 1Q4LA 4O96A 3BWJA 3TACA 5A46A 2PE2A 2YERA 4TKSA 4QPSA 4YJQA 4C61A 2QD9A 4IAIA 2YA9A 5C01A 5IUHA 3DQWA 3O51A 4M8TA 4X2GA 5HHWA 5HLWA 1U54B 2WEIA 3DK7A 4QYHA 2P2IA 1ZOGA 1OL5A 5J8IA 5CEQA 2R3PA 4Q5EA 1IR3A 2I6LA 2HIWA 2GU8A 2XBJA 1YQJA 4M66A 3LXNA 2XNNA 3I4BA 2ZDUA 3CJGA 4U40A 5I9ZA 4Q9SA 5DEYA 2WQEA 1U5QA 2VGOA 3BIZA 4FKPA 4R1VA 4U41A 3RPOA 5LXMA 5FBNC 3LFAA 3C5UA 4GIIA 5I5ZA 3ZM4A 5A4CA 5EKNA 5IZFA 3EFWA 5EYCA 3ETAA 4FSTA 4G9CA 5FDXA 4Z7HA 1YXUA 3VJNA 4W9XA 3LHJA 3OEZA 1MRUA 1CKPA 5D41A 1GOLA 2A0CX 3WF7A 4XNEA 3PVBA 4B6LA 2VO3A 3P79A 4PNIA 3K54A 2IN6A 3V5QA 4HPUE 4BDBA 4YJSA 5CVFA 3GB2A 4OGRA 3R01A 1OKWA 5L6OA 2HCKA 3AD6A 3FE3A 4QMUA 1R39A 2WMUA 4NIFB 2WPAA 4L01A 3BGQA 5IA3A 4QMMA 2EXMA 1YXSA 3LJ2A 5DFPA 1WBNA 2ZV8A 3MH1A 4EHEA 3QHWA 3LCOA 1PMEA 2GHLA 4O6LA 2YFXA 2XYNA 1Q8ZA 4O7RA 1OIQA 3LM5A 2XIZA 3BELA 2WU6A 4M0ZA 5JZJA 4YTHA 2PE1A 2V5QA 4QYEA 2WTVA 5GJGA 4EK3A 5IG1A 4WNKA 4TTHB 3PY1A 4LMNA 2X8DA 4XG7A 3UOLA 4ANNA 2UZDA 4TNBA 4BZOA 2G2FA 3E8NA 4F6UA 1SNXA 2XRWA 4EK4A 2C47A 4K8AA 4QQ5A 1XH5A 4GU6A 4ANQA 2Y0AA 3BHYA 5GZ9A 5FXSA 3AT4A 4IQ6A 4ZJIA 5LJJA 5CU4A 4QP9A 1FQ1B 4RJ4A 4MNFA 5HLNA 4MX9A 2BMCA 3R8LA 3RAKA 3RK7A 2ZAZA 3Q5ZA 2FSTX 2XIXA 3DY7A 3UNJA 5D1JA 2PUNA 1IG1A 2I40A 3QRJA 2EB3A 2X1NA 1CKJA 3FLYA 5HG8A 4IZAA 4N6YA 2XNOA 2BRNA 3FL5A 4ID7A 4M12A 5EDRA 5CY3A 2X8IA 4KIOA 4RA4A 5K4IA 4GJ2A 3MV5A 1H08A 1V1KA 3DBFA 2XKEA 1ZYCA 4CMTA 4CCBA 1MRVA 2Y9QA 2WHBA 3FAAA 3NNXA 4YSMA 4PV0A 5KHXA 3HV5A 4O2ZA 5AAEA 5DPVA 2J50A 2IZTA 4B9DA 4E5BA 1ZZLA 1PYEA 5I4NA 2UW9A 3CY2A 3RZFA 4USFA 4MK0A 3E62A 1XJDA 4LUDA 3V6SA 4AUAA 4QMZA 3EYGA 2JLDA 3RK5A 3DT1A 4NCTC 3W10A 4RLLA 1PXKA 1Y91A 3C4EA 3VIDA 3MJ1A 3Q53A 2JDSA 2BKKA 5AR2A 3GCQA 2HY0A 5AV1A 1GY3A 3CTHA 4AX8A 1CDKA 1RQQA 3P08A 4FIIA 4EKKA 4MXAA 1FMKA 4RC4A 3E3PA 4CRLA 4CYJA 5ETFA 4Y72A 5AFVA 3TM0A 4BI1A 4LOOA 4O1PA 4RIWA 4CG8A 5GIPE 4MBLA 3PE1A 3VRZA 3G5DA 1UA2A 2VTNA 2BRBA 3AC4A 2B0QA 4P2KA 2B7AA 4D2PA 4GG5A 2B4SB 4MHAA 5E1EA 2WMWA 5FP6A 4H58A 2JBOA 4AGUA 2C1AA 1ZRZA 3HAMA 5CLPA 1PXNA 1W7HA 3W2RA 4IAYA 4FSQA 3KRXA 4IX6A 3VS7A 2C69A 4I0SA 3ZYAA 5KX8A 3IOKA 4OT6A 4UY9A 2X4ZA 1W83A 2O64A 2IVSA 3DOGA 3OF0A 2C5OA 5ACKA 3R9OA 1S9IA 3MS9A 3RPRA 3NMUF 3VBTA 4X21A 4QMOA 2GQGA 4E3CA 3P78A 5HICA 2CKPA 4X3FA 4PDYA 5FG8A 3OTVA 5AUXA 3LFQA 3LOKA 4IB3A 3BYUA 4AA4A 3PJ3A 1H25A 5F4NA 4D0XA 4NM3A 5CAQA 1BI8A 3OBGA 4BCNA 5BMMA 2E2BA 3ZO1A 1OB3A 4O82A 5FLFA 4IB5A 3MFSA 3I0OA 4QO9A 1URWA 4GCJA 5HNBA 1QPCA 5C8NA 5ETIA 3FWQA 3QRIA 1H8FA 3WZEA 4AT3A 3QXOA 4QMSA 4EK8A 3D15A 4Z7GA 2WQNA 1G5SA 5AP0A 3DCVA 5JRSA 4KSPA 3W18A 3NYXA 4LV8A 3ZBFA 2OXYA 4DH7A 3EYHA 4LM5A 4NYEA 2RG6A 2YCFA 5CALA 4ZJVA 4P5ZA 5AUWA 4CFVA 2WTKB 3DBDA 3NRMA 3A61A 4DINA 4APCA 4BFMA 3HRCA 4X7QA 4C35A 5FXRA 3RGFA 1OBGA 2CN5A 1ZOHA 2BFYA 3ORMA 3PPKA 2ETKA 4E5AX 4DG3E 3LZBA 4IE9A 3HZTA 4JG7A 2WGJA 1KE8A 1URCA 4FTRA 5CS6A 5L2IA 2CPKE 3VHEA 4BICA 4C37A 5L3AA 5CSXA 4BVUA 2QHMA 3KRLA 2H96A 3FMLA 4C02A 5CAVA 3QTUA 4ZLOA 5KMLA 4FVRA 4IIRA 3Q6UA 1Q99A 4LV5A 3D7TA 5KZ0A 3FJQE 2J90A 3POOA 4O0SA 2BZJA 3ZSHA 4WUAA 3DAJA 4KIKB 3MTFA 4G3DA 4FVQA 2WMAA 3V8WA 4IWDA 2UW4A 3U55A 3ZLYA 3MI9A 1QMZA 2W1HA 1PRYA 1P5EA 4WSQA 3FXWA 3FMNA 4DFZE 2W1CA 5HBEA 5T68A 2VNWA 1VZOA 3MFTA 1SNUA 3BV2A 4IVBA 4QRCA 3ZUTA 3SGCA 5CT0A 1JLUE 3LLTA 3L9LA 3QTZA 4NH1A 2QOIA 3QUPA 4QMYA 3T9IA 4AQCA 2B9IA 4PY1A 5T6KA 3U8WA 4XG8A 3NUUA 1JSVA 3OCGA 3RZBA 5CQUA 3WZKA 5CF4A 4HNFA 3OROA 5HEZA 5IEVA 4BI0A 4EH5A 3KREA 4GFMA 3QX2A 3FMHA 4RJ3A 3JY0A 4U8ZA 1XH6A 4ZTQA 4AOJA 4BDCA 1IA8A 1JPAA 2QO7A 4E6DA 5JK3A 2J7TA 4BCMA 5L2SA 4C3PA 4J8MA 4KSQA 2W0JA 3HVCA 4FL2A 3DBQA 4UWBA 5BVKA 4YZBA 2CLQA 4F1OA 3TT0A 5IH6A 4RJ7A 3OT8A 2ITTA 4MXXA 2A1AB 2GSFA 3F9NA 2PY3A 4FICA 2F4JA 2P55A 2ACXA 1NVQA 5A4QA 2DQ7X 4RX8A 4QOXA 4AE6A 3NDMA 5K9IA 2YITA 3UZTA 2R9SA 4IC7A 4ZS4A 5TT7A 2B53A 4ZSLA 3OP5A 3PJ1A 2X0GA 4CTBA 3CBLA 4FNXA 5EDQA 5FM2A 4P90A 3O2MA 4MF1A 3UE4A 4EH8A 4V04A 3AC5A 3QKMA 1JQHA 3RINA 4BZDA 2HWPA 4S2ZA 1WMKA 3MA3A 5DT4A 4E4XA 1YOJA 2DUVA 2BFXA 2IJMA 3QGYA 5IQEA 4O27B 3OY1A 4UMTA 5HO8A 4O0TA 4CLJA 2WZJA 3KEXA 2CLXA 1WBWA 4ASXA 1SVHA 2W96B 4RBLA 4GV1A 3FC1X 4C0TA 5ETAA 2OJIA 4ONAA 4LYNA 4FG8A 4BDHA 2X8EA 2BZHB 4EORA 2JAVA 5D7VA 3BHUA 3QZGA 2CNUA 2QOKA 4FI1A 4ANSA 4LRKA 4BKJA 1OIYA 4BGQA 4D4VA 3QQKA 4IMYA 4RFMA 5D10A 3OG7A 2XK7A 1XWSA 2VTLA 3CE3A 4GK4A 1O6KA 3GCPA 3LW0A 1Q41A 3TN8A 4JBPA 4KBKA 4FK3A 4ZMFA 4DGNA 3NW6A 1MUOA 4MBIA 4BDKA 2R3JA 2H34A 2QU6A 3EJ1A 3E8EA 3PRIA 2OF2A 3V5JA 4W8EA 3HV3A 4XCUA 2CCIA 4G6LA 4JQ8A 3F3VA 3EKNA 4WSYA 4JDIA 5FWKK 3RCDA 5IISA 5ANKA 3O7LB 4YJVA 1Q3DA 5A4TA 2YWVA 4MXOA 2OJJA 3ROCA 1M2QA 3EQHA 4OTPA 5ANEA 4ANOA 3Q60A 5CU3A 4DT8A 3LAUA 4NT4A 4EH2A 1YI4A 2JIUA 1XH4A 4G3CA 4DFUA 1U4DA 2Y7JA 2Z7SA 3BYVA 4UX9A 4X2NA 2ETRA 2PE0A 2UZVA 1STCE 2VWZA 1OI9A 5DHJA 1UWJA 2VO6A 4IAFA 3CSVA 3NNWA 4FIJA 5AMNA 1O6LA 1L3RE 1VJYA 3DLZA 3KMUA 4O0UA 5B2LA 1FVVA 3RM7A 5FEEA 3CEKA 4R7IA 3V8TA 4HYIA 3GQIA 5F94A 3FL4A 4PPBA 2R64A 2GNIA 3EQFA 4PRJA 3W1FA 4DC2A 1DAWA 4Y83A 4BI2A 4RX5A 4J52A 4BDJA 3OBJA 3R00A 4ZAUA 3HV4A 4NJ3A 2VTMA 2QU5A 3DJ5A 1OKVA 2ERKA 4O83A 4QMVA 5H8BA 4AXAA 4UMRA 5A6OA 4GT3A 2J2IB 2PZIA 1UKIA 2R0IA 3O0GA 4OTFA 4FUXA 4LRMA 4DEEA 3R9HA 3RTPA 3W16A 1PW2A 2QVSE 3VS5A 2XK8A 3M1SA 5JQ5A 2QG7A 1I44A 5M4IA 4E6AA 3L9MA 4GG7A 4TYHA 4ZSAA 4FEVA 4W4YA 5TKDA 2YIXA 4FKUA 3PZHA 3UZRA 3KY2A 4G5JA 4TYEA 4FNWA 1ZLTA 3KMWA 5AM7A 4Z55A 2XEYA 5KMNA 2XKFA 4II5A 5FDPA 4RIYA 1TVOA 3F7ZA 4GYGA 1YRPA 4QTEA 2G9XA 4ACHA 2VGPA 4EH9A 3FQHA 2WTIA 4NTSA 3UIXA 3AT2A 1OUYA 3UVPA 2VO7A 2JDTA 3RNIA 2FYSA 3Q4UA 5ETCA 5FTOA 4IAKA 3UOKA 1OL1A 4D1SA 3KXHA 1UKHA 2C6MA 3FMJA 4G16A 5CEIA 4EK6A 5BQ0A 1GZNA 2P33A 4JLCA 4KNBA 2KTYA 4FV1A 3F7WA 4V0GB 3AC3A 2XK6A 3AC8A 3HMPA 3MVHA 1PMVA 3EQIA 2W4KA 3V01A 4L43A 4L6QA 4WNMA 4QP2A 3QC4A 4FTQA 4PMPA 3ODZX 3QHRA 4ASEA 1M52A 3NYOA 3VBQA 3QC9A 3NCZA 3FMMA 2UW6A 3A62A 2RL5A 4ZY6A 3ODYX 3PSDA 3LCSA 4IAAA 4PL3A 2PVNA 4FSWA 4A9UA 5FTGA 3UP7A 3V5PA 2OJFE 3QCSA 4GMYA 1XQZA 2FB8A 5C8KA 4EYJA 1KE9A 3T3VA 3F2RA 3BLQA 4D2VA 3F82A 3CQEA 4RG0A 3H10A 4NSTA 5L6WL 4FTAA 5EM7A 3EHAA 3FEGA 1W82A 2F7EE 3PSCA 4UALA 4IB0A 4MF0A 1M7QA 3K5UA 4YTIA 4CKRA 3ZONA 5D9HA 1P14A 3NAYA 3WARA 3KKVA 5IMXA 2CNQA 4TRLA 2X81A 2I0VA 2SRCA 3A7JA 4JL9A 4NM0A 3WILA 3WOWA 4AAAA 4DFLA 5BNJA 5C4KA 2QOHA 2BKZA 4J96A 4NCTA 3NIZA 4FZDB 4LRJA 4PMTA 4USDA 4GRBA 2UVYA 3C0HA 3OCBA 5JFXA 2OBJA 2OZOA 1PXMA 1OKYA 4QMPA 3W8QA 5ACBC 2HW7A 2R3QA 1ZARA 5CVGA 2XJ1A 2XNPA 4I22A 3G0FA 3O71A 3F5UA 2V0DA 4TWCA 3ZEWA 3KULA 4JAJA 5GIOE 4B8MA 3R1QA 4YO4A 1GZ8A 4GUEA 3DDPA 3NLBA 5JFWA 4RQVA 3M11A 4DFNA 3MA6A 3CD3A 3F3ZA 4KBAA 3I5NA 4OTGA 3LMIA 1H07A 2QLQA 2PZYA 3E7VA 3TTJA 2OW3A 3QZHA 3C4CA 3V5TA 2WMVA 4CZYB 5HIEA 3ZMMA 1UWHA 3ZU7A 1TKIA 4PMMA 1U46A 2HELA 4E5WA 3VUHA 3HL7A 3V6RA 3WF8A 2JFLA 4LGDA 3W33A 2WQMA 4U43A 4U42A 4YGAA 5E8VA 5AV3A 1PF8A 2GTNA 3KU2A 3P86A 3COKA 4FKSA 1KE6A 2AC5A 3IONA 4H1MA 4YP8A 5HIDA 4EH4A 2OF4A 3CR0A 4GUBA 5H8EA 3BLRA 4YZDA 3NSZA 3SKCA 3ZXTA 1YWRA 5C27A 4MXYA 4LG4A 2QOQA 4FYNA 5BMSA 5JMSA 4CQGA 2BILB 5E1SA 4ACMA 5CU2A 2OU7A 4YHTA 5HU9A 5FEDA 3L9PA 2ZB0A 5FP5A 3BGPA 5DT0A 4QYGA 1DI8A 4BF2A 5HX6A 3FI8A 3FXZA 4S31A 5IH4A 3EZRA 4F9WA 1XH8A 4YZMA 5CZHA 4YNOA 3NVMB 3FLZA 5I3RA 2IVUA 2WMTA 3IGOA 4KRCA 4AN3A 5M44A 5CWZA 4DTAA 1XHAA 4CCUA 2W4JA 4FOBA 3OCTA 5AX3A 4EL9A 3MH0A 4GSBA 4AZTA 4PWNA 4FL3A 2Y6OA 3PUPA 2ITQA 1REJA 2IVVA 4AFEA 4BTFA 5K5NA 2XEZA 3S2PA 3N4UA 1OUKA 3LXPA 2WMXA 3P9JA 4I93A 1YI3A 4PTGA 2CGWA 4FIHA 4OAVB 4WO5A 2RFNA 4QD6A 3QA0A 3DTWA 4K0YA 1WBSA 1HOWA 5GJDA 2PTKA 5KMKA 4FL1A 3ZRLA 3IG7A 3TDVA 5CZIA 2HZIA 5EQYA 1P2AA 4UXLA 4C8BA 4E4MA 4GU9A 3LM0A 4WRGA 2ITUA 4XRJA 3NYVA 3ZOSA 5L8LA 4EQMA 2A2AA 4F65A 1CSNA 1P4FA 4D28A 3HX4A 1PMNA 3VW8A 2C6KA 2ZOQA 4PMSA 4R1YA 5CYIA 2JGZA 4ZTLA 2WMSA 3ZO2A 4PL5A 4EC8A 3MDYA 3DBEA 2X9EA 3RAHA 3IPHA 1YKRA 4FTTA 3I60A 1JBPE 2XCKA 3BU3A 2C3IB 4X6RA 5FTQA 2WOUA 3QTIA 2UW3A 5I0BA 4FV5A 5M57A 3BRBA 2JIIA 2B9FA 3KXXA 3R7GA 3R28A 5J5TA 5C1QB 4I0RA 3FZTA 4S33A 2BALA 2O65A 2IW9A 3VUIA 4CFFA 5BVFA 3MIYA 5J5SA 3MVLA 4P5QA 1Y8GA 3MB7A 4O2PA 4YJOA 2NRUA 2WD1A 2ZB1A 3F88A 5DA3A 4B7TA 4F9AA 3LFNA 4LFIA 5JFSA 2X7OA 4K9YA 4ZP5A 4FEWA 5IA1A 4ENYA 2VWYA 1OIUA 5L4QA 3GC9A 4J98A 2PSQA 3HRFA 4QP7A 4YJTA 3FV8A 3R8MA 2VV9A 3KVXA 4XV2A 4E6QA 2YZLA 4I6HA 3V51A 3C1XA 3MVMA 3E8CA 4XUFA 3MH3A 2W99B 3CXWA 3Q9ZA 4GT5A 3W2OA 4O0XA 3RP9A 2GQRA 2YHVA 3JPVA 1W8CA 3E92A 1XH7A 3OS3A 3P1AA 3B2WA 3HMMA 3PWYA 4YPSA 5I3OA 3T8OA 3GP0A 2YISA 4ASZA 4FTCA 2WFYA 3FKOA 3PY0A 4O22A 5D11A 4BB4A 4BC6A 1V0BA 2BDWA 1K2PA 3SW7A 1FINA 2P0CA 4ITHA 4GK2A 4D2SA 4WUNA 3TWJA 4F7JA 4YUQA 3DNDA 5AUZA 3O7LD 4JQ7A 4M67A 4EOLA 4QP6A 4ACGA 5B7VA 2PVJA 3U9CA 1OECA 1MQBA 2H6DA 3BCEA 3VW6A 4FTNA 4G31A 2X2MA 2YJSA 1WBTA 4XHKB 5EYMA 4H05A 2OFVA 4XEYA 4ZOGA 2BUJA 5ANOA 1F3MC 3WIKA 5BUJA 3JUHA 4ZY5A 1OPKA 2XRUA 3A8WA 3F2NA 4ZJJA 3O23A 4OLIA 2PPQA 1SVGA 3B8QA 3ID6C 3II5A 4QNAA 4DGGA 5M09A 4G3GA 2E9VA 5GJFA 3G33A 2OICA 1WBPA 4FNZA 3ZH8A 3BKBA 4FKRA 1AQ1A 5FBOA 2CKOA 4BDFA 4D58A 4FIGA 2QOOA 2RKUA 1KE7A 2C68A 3MB6A 4U79A 2X6EA 5DE2A 1SVEA 2GCDA 3LFCA 4I5CA 3R8VA 3ZFXA 4AZSA 1H27A 4BRXA 4DTKA 2GHMA 4ZZNA 5AEPA 4TPTA 3OW3A 2CSNA 4HCTA 1B6CB 1AD5A 1CTPE 1YDRE 3IW5A 4V01A 5DEWA 4K33A 3FLWA 4CYIA 4UMPA 3MPTA 4QTCA 2GDOA 4XX9A 5A9UA 2J0KA 1XBCA 5CEOA 4FTOA 2C5YA 1LEWA 4FT3A 4D9UA 5AJQA 4XMOA 2F2UA 1TQIA 5LMKC 4QMXA 4RC3A 3KXNA 3BYSA 4ACCA 2VWUA 4IHPA 5A14A 4FV8A 4IB1A 1OITA 3VBXA 4Z9LA 4QYYA 3ZDUA 2WTJA 3LFDA 4EJNA 1NA7A 2UZLA 4GL9A 3I79A 3SAYA 3Q52A 4L52A 3V5LA 3RKBA 5AR5A 2PHKA 4IFCA 3QALE 3PA5A 3GFWA 2ITWA 4L53A 3UDBA 2P2HA 1VYZA 4Y8DA 3U6HA 4MD9E 1IAHA 5FGKA 3R1YA 3RAIA 3SX9A 4QQJA 5HIBA 2YN8A 4IACA 3EMGA 4RLKA 5LMAA 5M56A 4O7NA 2HXLA 3N9XA 3QUEA 3QA8A 4DLIA 2J0LA 3CLYA 4A7CA 3GENA 1NXKA 3UMXA 2Z02A 1OZ1A 2ITOA 3DBCA 2BHHA 5H9BA 4JR7A 2FSOX 3HP2A 3QTSA 4FTIA 5E90A 5KUPA 4U81A 5DRDA 3GGFA 3L1SA 3ELJA 4Q2AA 4ERKA 2DWBA 2VWXA 3CGFA 4J53A 4TYJA 4EHGA 3E88A 1GAGA 3BZ3A 5KCVA 3R7EA 1TQMA 3HYHA 3IGGA 4JDJA 4XBUA 2YDKA 4XYFA 2ONLC 3R0TA 2YZAA 3PA3A 3BWFA 3R9RA 2J6MA 4UXQA 5AM6A 4WRSA 4I24A 1QL6A 3DNEA 1FVRA 2PMOX 3GUBA 2O0UA 2GNGA 4N6ZA 4B0GA 2BAJA 2HYYA 4OTQA 3OOMA 3BYMA 3R71A 5G6VA 4O81A 1G3NA 2JFMA 3UIUA 3MESA 3UIMA 3F5PA 3E3BX 1JVPP 3UQFA 3GT8A 4A4OA 3R73A 4D2RA 1Q8TA 4FTJA 4GKHA 2HAKA 1GNGA 5EW3A 4BDAA 1LPUA 3QTRA 5A6NA 4BCHA 5EI8A 2I0EA 5FQDC 4G3FA 4FTKA
chains in the Genus database with same CATH superfamily
1Z5MA 2GHGA 4L67A 4GKIA 3F2AA 2XZSA 4ARKA 1G8JA 3ROYA 1XKKA 5HNIX 4IDTA 2IF8A 2PVRA 4ITIA 1REKA 3CQWA 5J7BA 5EKOA 4ZLYA 4N4SA 1R78A 4J1RA 1OPJA 2E9PA 3LFSA 3LLAA 5ITAA 3E93A 3IS5A 4RVKA 4JOAA 4EHVA 2CNVA 1XBAA 3QYWA 3GU6A 4BBEA 4NKAA 4A4XA 5IA0A 4MTAA 1M14A 3QL8A 3HRBA 3RALA 4D55A 5L6PA 5FD2A 3ULZA 5HTBA 3R7UA 3RVGA 4AZWA 4OBPA 5AP3A 2J5FA 3KCKA 3PIYA 3Q04A 1ZY4A 4PDPA 1G8AA 1OL6A 1Q8YA 1VLRA 5JGDA 3R83A 2LGCA 4HNIA 4TT7A 4H36A 4ZXTA 3DTCA 2ITPA 3MSSA 3EIDA 3VUDA 4F70A 1KWPA 3OWKA 3L8PA 3R21A 4E7WA 4DF3A 5HE2A 3QCYA 4JBQA 4DEAA 4EK5A 4XLIA 4EYMA 2XNEA 4HVGA 3BEGA 2R3HA 4KD1A 1IAJA 4N57A 2WTWA 4H3PA 5EOLA 3R8ZA 4RVTA 4RJ6A 1BMKA 2OSCA 4U0IA 2QQ7A 3R02A 5LVPA 2OIQA 5EM6A 5JGBA 3NUAA 4CTCA 2BRGA 1W2CA 4EUUA 3LMGA 5M4FA 4FKGA 3I7CA 3RNYA 3RHXA 3TNPC 3U6IA 3TV7A 3ZFYA 2RFSA 4DH8A 4IJ9A 2E9UA 5LWNA 2ZFYA 4K2RA 4FEUA 3KN5A 4IBMA 4AG8A 2J9MA 4KABA 4BIEA 4C4JA 3FUPA 4WBBB 5CEKA 3DV3A 3HKOA 4F7LA 4BL1A 1XBBA 1FPUA 3C0GA 4J7BA 3SLSA 2GS2A 4A9YA 2BDJA 4BYIA 2RG5A 3JS2A 3QU0A 5HCZA 3C4ZA 2YIYA 1J3HA 1WAKA 3WYYA 3OWJA 4BBFA 1CKIA 3CGOA 1JKKA 3CPBA 3IW7A 4JRVA 5BVDA 4DBXA 4EOQA 4FR4A 4UWCA 3QD3A 2UUEA 4QPAA 3KVWA 3N51A 5HVKA 4GVAA 2VD5A 1W0XC 4AA5A 4LOPA 4C58A 3CJFA 5KKRC 3E63A 2IZRA 4DEHA 1MQ4A 2ITVA 4NZWB 1H1QA 3U87A 3KCFA 4ZSEA 3WF6A 4BGHA 5KKRB 4TWOA 3RPSA 1HCLA 5AA9A 2RIOA 3CKXA 4IM2A 2R2PA 1B38A 1EH4A 2C6DA 3ZZEA 2W5HA 5KCVA 2R4BA 4BKYA 4A9RA 2XAMA 5ANGA 4NIFA 2XJ0A 5IQFA 3NX8A 1KUTA 3IECA 4K1BA 4RGJA 1ZZ2A 2C0OA 4LMUA 2Z60A 3H3CA 2VTJA 4S34A 2V55A 4X2FA 3NGAA 3QYZA 4QT1A 4WHZA 4BWPA 5HE3A 2OFUA 2VTOA 4B8LA 5HG5A 5EFQA 4J71A 4PF4A 1XR1A 2NYAA 2GS6A 3E64A 4KRDA 1T45A 1ST4A 3AG9A 3BBWA 4O91A 4PPAA 5DRBA 4APPA 4X2KA 5AIKA 3ALNA 3KXGA 5HGIA 3HP5A 4XG6A 4IVAA 1PMUA 1YDTE 3I6WA 5JT2A 3BPRA 2XIYA 4ANLA 3KF4A 5CXZA 2BRMA 4FSUA 5I9YA 3C4FA 3RJCA 2VNYA 1UU9A 2AC3A 5H2UA 2J4ZA 5JN2A 5CEPA 4RWKA 1ZYDA 3ET7A 1UV5A 4ZIMA 1H26A 3FZPA 2LAVA 4HVDA 1O9UA 3O8UA 3O96A 4F99A 1X8BA 3ZO3A 4RQKA 5HTCA 4QTAA 1LR4A 2J51A 3E7OA 3D94A 4EOJA 4TWNA 1FGIA 2GPHA 1HCKA 3FZRA 5DR2A 3PP0A 5T3QA 4B99A 4C62A 3R1NA 5E8TA 1Q24A 3ZEPA 5LQFA 3PLSA 4M69A 4AN2A 3UO4A 2R5TA 2WB8A 5JEBA 3QXPA 2GMXA 4BWXA 5DVRA 3BEAA 4HYHA 4RPVA 4X0MA 4JAIA 4O7WA 4EOPA 4YR8A 3DFCB 4F08A 4UZHA 1K9AA 4QMQA 4Y73A 5JKGA 4FKVA 3Q4TA 4DEDA 4GH2A 2YIRA 3NUYA 2R3GA 5C8MA 4BCKA 4IM0A 4R3PA 2YIQA 3GCVA 2XIKA 4M84A 4C33A 2C6EA 3ZO4A 4WNPA 5LOHA 3I7BA 3ACJA 4NW6A 4UEUA 4BCQA 4IVCA 2YCQA 2IW8A 4C34A 4F64A 3D14A 1YHSA 2BIKB 4KS8A 3V04A 4AFJA 4EI4A 4DG0E 5LCKA 2YM8A 4DGLC 1FOTA 3PRFA 3R2BA 3TL8A 4UYAA 2R3OA 4AT4A 3NUNA 3TZ8A 4F6SA 5IA5A 4MNEB 4PL4A 4FTMA 1GIHA 5AUVA 3ZRKA 2YM7A 2PMNX 4BHZA 3PXZA 4PDSA 4CGAA 4BHNA 3BGZA 4W8DA 4RWLA 2JIVA 3DFAA 4ASDA 5IPJA 4OBOA 5TF9A 3C7QA 4FV2A 4YTFA 4D9TA 2EWAA 3BE2A 4O4EA 4EBVA 4GFOA 4U7ZA 4MD7E 3ZUVA 4C4HA 5HG9A 5HORA 5AP7A 5J1WA 3FYKX 4O4DA 4WBOA 3P7CA 5AAGA 4FG9A 2G2HA 5I9VA 4FA2A 4IWQA 4YJRA 2ESMA 2R0UA 3AMAA 3FI3A 4YZ9A 5AP2A 5CASA 1OPLA 3WZJA 3MN3A 3ZC6A 4X3FC 4I41A 4M69B 4XRLA 4BN1A 3UGCA 5GHVA 3AC2A 4NUSA 3FKLA 4GYIA 5J1VA 4M13A 1Z57A 2UZNA 4IH8A 4DGMA 2JDOA 1WZYA 3C13A 4G6NA 3DU8A 3B8RA 3GXLA 3KN6A 3TV4A 4EJ7A 2XJ2A 4S30A 5FRIA 4BWKA 2RSVA 3NPCA 3S95A 3U9NA 4O0RA 4FODA 3WE8A 1B39A 5HD4A 4FKQA 1W2FA 4LI5A 2KULA 4UV0A 5CU0A 3PPZA 3PLAE 3CKWA 3BQRA 4FT0A 1WBVA 3UYTA 1DI9A 2JDRA 2VAGA 1XO2B 3KK9A 3GC8A 5KNJA 4JX7A 5IUIA 3T3UA 2Z2WA 3VBWA 3PJCA 4U6RA 2XK9A 2XUUA 5HBJA 4ZEGA 2C6OA 4R77A 4F0GA 4NFMA 4E4NA 2WNTA 3DK6A 3R22A 4QTDA 3WYXA 4AW0A 2CDZA 4FZ7A 4ZTMA 5E8WA 1IRKA 2WIHA 3KB7A 3AQVA 4KKEA 2CKEA 3UP2A 4R78A 3TTIA 4FIFA 4JMQA 1OGUA 3NFFB 3PG3A 4DFYA 3RCJA 5C9CA 3PXYA 2FO0A 5J87A 3FPQA 5LMKA 4WIHA 2HZ0A 2JDVA 3H9FA 5G1XA 4NFNA 2OIBA 1LUFA 2VRXA 3SG8A 3AXWA 4HGSA 4BDGA 2C5VA 4JNWA 3B2TA 3MYGA 3MTLA 3A7HA 4U97A 3DDQA 2JBPA 5BYYA 3DXQA 4QDVA 3QTWA 4DYMA 2YLEA 1PXIA 4BGGA 1Y6AA 4WOVA 4CLIA 3QUDA 2WMBA 1UVRA 4JXFA 3R8UA 3Q2MA 3G9LX 1Q3WA 4LOQA 4BIBA 5DYJA 1Y6BA 3BI6A 3FY0A 4JR3A 5M07A 1A06A 3HUCA 4D1XA 5CEMA 5EW9A 2PVLA 3QLFA 5FXQA 4C3FA 4YLLA 5DLSA 3VS1A 3L8VA 3IDPA 4FZAB 1KV2A 4ZTRA 4GT4A 1J7LA 2IZUA 4FBXA 4JBOA 3QD4A 3U51A 5DMZA 3GEQA 4DITA 2VWBA 3MPAA 3W2QA 3PPJA 1H24A 4OAUC 1WVYA 2OJ9A 2F7XE 4G5PA 3Q9WA 4H39A 5KMOA 4E4LA 3P5KA 1JSUA 2VTIA 3AMBA 4QP3A 1FBNA 3JR1A 5L2TA 4C4IA 3DLSA 2YIWA 3DKCA 4GEOA 3I5ZA 2QKRA 4F9BA 3BLHA 5IQBA 2YWPA 4NTTA 3TKHA 4ALUA 3AD4A 3V3VA 4AGCA 3WZUA 3EQDA 2GNHA 3F5GA 4XH6A 3TNWA 4ZZOA 4RIWB 3TI1A 4D1ZA 4FT5A 4XLVA 5E8XA 3FMDA 4G2FA 3DQXA 4FZ6A 3REPA 3FZOA 4FGRA 4AAYA 4BDIA 1UU8A 4M97A 5DOSA 4OUCA 1Q8WA 4XG3A 1J7IA 3EKKA 5ANIA 3P23A 3COMA 3TZ9A 3FQSA 1YI6A 3W2SA 2I0YA 3W55A 4IAZA 5LCJA 4AXDA 5BYZA 4ZMEA 2W1EA 4IADA 3DA6A 4X2JA 2C3LA 5ANDA 3TZ7A 3FQEA 3GC7A 3PXQA 2VX1A 2J0MB 4U5JA 3VF8A 1R3CA 4HZRA 4AZVA 4CZTA 4DDIA 4YHJA 3HDMA 4JX3A 4AF3A 2ZMDA 2W1FA 4YO6A 5IDNA 1ST0A 1WVXA 4QDEA 4F09A 5HD7A 3LXKA 3AD5A 3ZLSA 2C4GA 3KGAA 3DXPA 2AQXA 4L68A 3LFBA 5GZAA 4CFWA 4WG4A 2IW6A 3GCUA 2GFSA 4HGEA 1UNLA 1VR2A 3FBVA 3IW6A 4UMQA 4NKSA 2R3NA 5HQ0A 4I0TA 4CV8A 5HKMA 4J8NA 2Z8CA 4BR3A 1BL6A 5L8JA 3NW5A 3ZFMA 3L8SA 3UQCA 2PZ5A 5HO6A 1OKZA 3TDWA 3S3IA 4FKTA 4E93A 4LL0A 4DAWA 1Q61A 3QLGA 1H4LA 1M2RA 1OM1A 2Z7LA 4FNYA 3QF9A 5IH5A 5AUTA 2GTMA 2UZTA 2Y4IC 2Y6MA 4FV3A 2C5NA 3QQLA 4J95A 3U4WA 2I7QA 2QOBA 3UC3A 3KULB 2QONA 5DI1A 3CD8A 2XKCA 2ZJWA 3QD0A 4I21A 2A4LA 3VQHA 1YWVA 5JZNA 1JAMA 1CMKE 1UNHA 3NIEA 4W9WA 4CT1A 3GU7A 5M51A 5A4LA 3DKOA 4IFGA 3TZMA 3BL7A 3NFGB 3MW1A 5H3QA 2Q83A 3VUMA 2QR8A 3SW4A 3A7GA 3IQ7A 4YHFA 4TXCA 2WIPA 4YTCA 4R5YA 2XF0A 2PULA 3HA6A 1CM8A 4QMTA 3IW8A 3HA8A 4AGWA 5IEYA 2JC6A 3GCSA 5I9UA 3VBYA 4USEA 5AP5A 3KRWA 4QP8A 4HVHA 4D2WA 1GZOA 2G15A 5HCYA 1YOLA 3NUPA 4TN6A 2NP8A 3AOXA 4KIKA 4MXCA 4MVFA 3R7VA 4JQEA 2YM4A 5C4LA 4HVIA 2XYUA 2B1PA 3TKIA 1YVJA 4FV0A 2NNWB 5GZ8A 2VTAA 1DAYA 1RJBA 3R9NA 1ZWSA 4HYUA 4M15A 3G15A 3CS9A 4J97A 5HG7A 1Q97A 2IG7A 3QFVA 3QCQA 2J5EA 4M14A 4KUJA 3MIAA 4FV4A 3OUKA 4BY9E 3MBLA 3VHKA 4DE4A 4NEUA 4IX3A 5M55A 5J9ZA 2PZRA 3WF9A 2QO2A 4QMNA 4JBVA 3Q32A 1W84A 4JDHA 3VUTA 1NT2A 1PXLA 3NAXA 3VRYA 4AU8A 4I5HA 2Y4PA 2XB7A 2YM3A 3N4TA 3IW4A 3CY3A 4JIAA 3G90X 2R3LA 4LL5A 3I0QA 3PA4A 3UPXA 2PWLA 5M4UA 1J7UA 3CTQA 4O7ZA 5DN3A 1M7NA 2ZVAA 4WG3A 5B2MA 1I09A 2ZV9A 4XP0A 2W06A 4ORKA 4RT7A 4OR5A 5I9WA 3FSFA 2ZM3A 3K5VA 4FF8A 5AR4A 3RAWA 4EC9A 3DXNA 1UU3A 4IM3A 5IMEA 4XV1A 4W4VA 1F0QA 4L46A 4YPDA 3EQBA 3KQ7A 3DKGA 3A4OX 1BL7A 5KBQA 3ORIA 4GFGA 3SV0A 4FT9A 3VNTA 3QD2B 4RWIA 3VS4A 3S1HA 4YJNA 4XOYA 4J99A 4AN9A 1RW8A 2NO3A 1VYWA 2OG8A 3DPKA 5IQHA 2GQSA 2QOLA 2OWBA 2ZV7A 5FEQA 3R7OA 3LMHA 2F7ZE 1PXPA 5CX9A 4EONA 1QPEA 2OZAA 1APME 1KOAA 3CPCA 3P0MA 5CAUA 5EW8A 4RMZA 5AV2A 4HOKA 4HW7A 4ZTNA 3A7IA 2XIRA 3ORKA 3BHHA 3PVWA 3QWKA 2BAKA 3ACKA 3HMOA 4QQCA 1XH9A 5A4EA 5KO1A 2C1BA 3M42A 3QZFA 2UZOA 4EZ3A 2WMQA 4AWIA 3COIA 5AV4A 3KFAA 4F1TA 4F4PA 5IA2A 5L2WA 3UOJA 3F6XA 3W2CA 5CXHA 4DGOA 1OIRA 5IQCA 1J1CA 3GQLA 1Q8UA 4DDGA 4IDVA 3EN4A 4PPCA 2FSMX 2W7XA 3P7BA 4CZUA 4CV9A 3OWLA 3VS3A 2ZYBA 4XOZA 3Q9YA 3PG1A 5K0KA 4EWHA 2E9OA 2UW0A 4GW8A 4RIXA 4IWPA 4CRSA 3OT3A 3ZSGA 3C4WA 4A9TA 2XMYA 3UTOA 1TZDA 2I0HA 2XM8A 4P4CA 3D2IA 5M06A 4V05A 3K2LA 2C30A 5B0XA 4C3RA 4N70A 4NL0A 2HOGA 4BKZA 3D5UA 3RPYA 2F2CB 2EVAA 2O3PA 4E20A 4CMUA 2PK9A 4KIPA 3EQPA 3MJ2A 3MPMA 3HMIA 4EH7A 4IVDA 2HZ4A 5D12A 1V0OA 3THBA 4CVAA 2C3JA 3SRVA 2IVTA 2Q0BA 5GINE 5LVLA 5J7HA 3DB8A 5DR6A 3RWQA 2CJMA 4F9YA 4O38A 2GNFA 3GC0A 2W17A 4YU2A 5DH3A 3OTUA 4LUEA 3ANQA 1PKGA 1ZYSA 2W9FB 5TOZA 1ZY5A 1H1SA 3RPVA 5HTIA 1BUHA 1JWHA 3PDTA 4YC8A 3TIZA 3TKUA 2OKRA 3EN5A 4HCVA 2CCHA 3BU6A 3FDNA 5JFVA 5BV3A 2CHLA 1ZYLA 5IEXA 2HK5A 4A4LA 4G3EA 2PYWA 4YZCA 5LVNA 5HOAA 2P3GX 4WD5A 3D4QA 4ZS0A 4DEIA 2W9ZB 1SYKA 4DT9A 5AX9A 1BYGA 1GJOA 3QBNA 2W1GA 4YURA 4ZLZA 3DJ6A 2VTQA 2BR1A 4IEBA 3KK8A 3OWPA 4OTHA 3HNGA 4Z16A 3QKLA 4BBMA 3BLAA 1Z9XA 4D5KA 3F66A 4Y5HA 3UG2A 2DYLA 4EHZA 5CQWA 2NRYA 4EKLA 3D2KA 5J79A 1H28A 3LVPA 1J1BA 4IJPA 4EQCA 2WKMA 3C0IA 3R6XA 4L7FA 4RIXB 2FVDA 4EEVA 3QAME 2XVDA 5LARA 3D7TB 3OHTA 4FMQA 3GNIB 4OTIA 4BCIA 5HI2A 3ANRA 3HV6A 4LQMA 5AIRA 4BDDA 1IA9A 3FHRA 4O7SA 5KE0A 3ZS5A 2CGVA 1LP4A 2BVAA 3LCTA 1YHWA 3A4PA 4XV3A 2VUWA 3Q4ZA 4PTEA 2YJRA 4Y95A 4EZ5A 4YNEA 4Q9ZA 1JKLA 2BHEA 1G8KA 3EL8A 3NEWA 4EOMA 2QO9A 2XNGA 2VO0A 2B55A 2BDFA 2VTSA 3OEFX 4W4XA 3RM6A 3Q5IA 3SRVB 3PXFA 2WU7A 4DA5A 1PYXA 5CF5A 3ENMA 3BHVA 3PFQA 4YBJA 3TJDA 2ITYA 3TNQB 2O8YA 4D0WA 2VWVA 2VZ6A 4QPMA 2A19B 4I94A 3SA0A 3DK3A 5AAFA 3C50A 5TO8A 3OD6X 2X9FA 2YM5A 3EN6A 4G6OA 3SQQA 1WBOA 4AW2A 2P4IA 3DZOA 2BCJA 2O2UA 3F3UA 3ORZA 4DHFA 2EU9A 2BAQA 2Q0NA 3KRJA 4NU1A 4RWJA 5AADA 1WFCA 3JVSA 4C4GA 5KMIA 3MFRA 2AUHA 2ITXA 2R3FA 3GOKA 3HDNA 3PXRA 3R63A 4G17A 1ZAOA 2O63A 4GJ3A 4JS8A 3W2PA 1ZMWA 4WG5A 3V8SA 4R6VA 2CGXA 3ZC5A 1UNGA 2ETMA 1YXVA 5CSHA 2UW5A 3HECA 3H4JA 4P7EA 4FYOA 4DCEA 2FA2A 4FJVA 3LFFA 5BVOA 4BCJA 4FKIA 2YACA 4XG4A 4HYSA 5I9XA 5M08A 1R0EA 3W32A 4H3BA 4AXCA 4RFZA 5HLPA 4E26A 4JDKA 2QOFA 2VTHA 2EXCX 5EH0A 2Y8OA 4M68A 3SC1A 3LKMA 4FV9A 2C3KA 2OH0E 3GU8A 2FSLX 3BYOA 1T46A 5H8GA 4EH6A 2PVMA 2IZSA 3DAEA 3KL8A 5CANA 1YW2A 2BTSA 2JKKA 1G8SA 5IQDA 3ZRMA 4RC2A 3GVUA 1GIIA 3WBLA 3GOPA 5EQPA 1IEPA 3SOCA 3AMYA 4L00A 5JH6A 4DFXE 2PUIA 2XA4A 2W5AA 3OMVA 5CTPA 4FKLA 4AT5A 5DGZA 3UPZA 2OI4X 4JRNA 5K3YA 2VX0A 3KF7A 3G2FA 3ZDIA 5AP4A 5AR3A 4F63A 4C36A 3FSKA 2Z7QA 2QG5A 3CTJA 3GU4A 4N0SA 2HY81 3EQCA 3Q6WA 3A7FA 4FV7A 4KKHA 2WO6A 3A60A 4UWYA 4H1JA 2QC6A 4BTMA 1ERKA 3PVUA 4QYFA 3UDSA 2C6TA 3H0YA 4IZ5A 1M17A 4AACA 2W1ZA 2YAAA 3EB0A 3I6UA 5A3XA 5HVYA 5CSPA 3M2WA 4IC8A 1YXXA 2BRHA 2NPQA 2RFEA 3P7AA 4CG9A 1Y8YA 3NNVA 4UBAA 2RFDA 2XARA 3PVGA 4TL0A 3FMEA 2B52A 4PDOA 4WA9A 3LJ1A 2V22A 2VTRA 4CFNA 2WQBA 3R7IA 2PMIA 3OUNB 2B54A 3QX4A 4TY1A 2JD5A 3ORNA 3ZM9A 4EOOA 2QKWB 3I81A 4DN5A 4KIQA 5IKWA 5CENA 3VWAA 2A27A 2YEXA 3E5AA 5L8KA 5HX8A 4HVSA 4R5SA 3ZXZA 1JKTA 3PTGA 3S4QA 4E73A 2QLUA 5KZIA 4O1OA 2AYPA 4OTDA 3SD0A 4AA0A 4TW9A 4UN0C 3PY3A 2RGPA 3ORPA 4ITJA 1A48A 1H00A 2J0IA 3UOHA 3UMWA 3SG9A 4FVPA 4D5HA 1BI7A 2BTRA 1BLXA 2G1TA 4I92A 3G0EA 3K3IA 3H0ZA 2XH5A 3OW4A 4DTBA 2JEDA 4JVGA 3CP9A 2R3MA 3O17A 3PSBA 1A9UA 3JY9A 3NUSA 4Z3VA 3W0MA 2J0JA 4G34A 4AXEA 2E9NA 3RMFA 3ZTXA 3SHEA 5IA4A 1YWNA 1BX6A 5AP1A 5E8SA 3QTQA 4X6QC 5JQ8A 1JKSA 4KWPA 1YHVA 5DNRA 4RX9A 1H1PA 2QOCA 4C2WA 5IDPA 3VVHA 4RIYB 5LWMA 3LE6A 4YJUA 2VN9A 2I1MA 5M53A 3Q2JA 3ENHA 4QP4A 4RJ8A 2QNJA 3U4UA 1NY3A 3FI2A 4NWMA 4O7TA 2PUPA 2JKOA 1Y57A 3VUKA 3RBWA 4FKWA 1U59A 4L9IA 3FLQA 4FSRA 5DG5A 1FGKA 4V0GA 1GIJA 5TE0A 3SXFA 3VS2A 4HGLA 3R04A 5EQEA 3O8TA 5BUEA 3DZQA 4U3ZA 4C57A 3CIKA 2Y4IB 2CMWA 4O7LA 3T9TA 4AE9A 3ZUUA 5KBRA 2HZNA 1KSWA 3QQHA 5IQGA 4O4CA 3D5XA 4M0YA 4QEBA 4IX5A 3OXIA 4XG2A 2PVHA 3UG1A 3MGYA 1ZYJA 4ZSJA 3RHKA 2UZWE 4PP9A 3Q9XA 3EL7A 4PP7A 4YSJA 4KBCA 2OJGA 4CQEA 3LQ5A 2B9JA 3VBVA 4CFMA 2REIA 4CSVA 4RIOA 3C5IA 2X6DA 5K5XA 2W4OA 4KB8A 1VEBA 3KXZA 4TNDA 5CSVA 1E9HA 1U54A 3R7YA 3TJCA 5F1ZA 4CFUA 4DLJA 4CKJA 1K3AA 1W98A 4ALVA 2QI8A 4ZSGA 3UO6A 4A9SA 4PQNA 4RZVA 2C0TA 2YCSA 3L9NA 2YM6A 4FUYA 5EI6A 4F0IA 1M2PA 2V7AA 3R30A 3BX5A 4XBRA 4KINA 5E4HA 4A07A 4FK6A 4GS6A 4BIDA 3EOCA 4QMWA 3NCGA 3ATTA 4ZK5A 4AZEA 1L8TA 2ZM4A 2X7GA 3IKAA 1OVEA 2H8HA 4A06A 3F3WA 2W05A 2QURA 4ZZMA 3GI3A 2YAKA 3R8PA 4QMLA 5BVEA 2B9HA 2PVFA 1NW1A 1ATPE 4RJ5A 4CMOA 1ZOEA 1H0WA 5E8YA 2VTPA 3HUBA 3FZSA 3TCPA 4I6LA 3DS6A 3ZHPC 2YDIA 2RF9A 4I6QA 5HESA 1E1VA 4L42A 2G01A 4IANA 4UMUA 3FLSA 2C6LA 2W5BA 3MH2A 4C4FA 3A99A 3QQGA 2PVYA 4FKOA 5EK7A 4FEQA 1KV1A 5C03A 3BBTB 4XV9A 4FSMA 5CF6A 2GNLA 3DGKA 3ZCLA 1V0PA 3PIZA 4IW0A 3KA0A 2FH9A 4TYGA 3EZVA 2YDJA 1P4OA 1S9JA 1SMHA 2PL0A 2FGIA 2BPMA 4I4EA 4MAOA 3UYSA 3FI4A 3LQ8A 4IX4A 4L3JA 4BCGA 4CKIA 4DH3A 3G6GA 4EOKA 5JSMA 1KE5A 2X2KA 2V62A 3OCSA 3IK3A 1F5QA 3LXLA 3HGKA 2BROA 3C4XA 4XS2A 4WNOA 4EWQA 3BE9A 3NVKI 3ORTA 4PUZA 4I6BA 5HNGA 2OXDA 5DR9A 4QP1A 2OZAB 4DEBA 2XS0A 5ICPA 1JSTA 2H9VA 3WF5A 3QRTA 4AP7A 4GK3A 3OFMA 3R1SA 4D2TA 5BVWA 3UJGA 4C2VA 5BYLA 4MEDA 1R0PA 2VWIA 5E7RA 3VO3A 2PVKA 1PKDA 5J95A 1PHKA 2VU3A 4ALWA 1E1XA 4BZNA 2XNMA 3FPMA 4OTRA 1YDSE 3LIJA 2UW8A 2F57A 3MY5A 5EM8A 3UC4A 4AS0A 5BVNA 2GFCA 2JKMA 4WKQA 3WZDA 2X4FA 4L8MA 4TZRA 4MKCA 3GBZA 3TNHA 5IU2A 3UNZA 4YLKA 4AZFA 3PUFC 3UDZA 5HVJA 5LVMA 2UVXA 1WVWA 4MCVA 3MWUA 5CAOA 5HZNA 4WT6A 2QCSA 4FGBA 3RI1A 3MY1A 2WOTA 3VQUA 3TYKA 2YABA 3BV3A 5LVOA 3PP1A 2CGUA 2VX3A 1OL7A 3QWJA 4RVLA 4RRVA 3WIGA 3UNKA 4NM7A 2HXQA 3KC3A 3DB6A 1RDQE 4K77A 4RZWA 4NW5A 1R1WA 3UVQA 1BKXA 4MYGA 3D5VA 3UIBA 1J91A 4L3PA 3C51A 4BJJA 5BUIA 1IASA 3AGMA 5F95A 4BCOA 3TUBA 3SOAA 3FLNC 4DBNA 3AC1A 5AR7A 5HE0A 2IWIA 3FKNA 3UQGA 4E6CA 1GZKA 4I6FA 1OMWA 3K3JA 4I3ZA 4TWPA 2C5XA 3P4KA 2F9GA 4BYJA 4JG8A 2WEVA 3PE2A 4MQ2A 3OY3A 5EDPA 2JITA 4D4SA 3TUCA 1OBDA 2JKQA 2X7FA 4RX7A 2BIYA 3O8PA 3EN7A 3OZ6A 4D4YA 2OO8X 3DAKA 5GNKA 2UZBA 2PU8A 2PUUA 4C4EA 3AT3A 4F7NA 4O7VA 4DEGA 4CFXA 4M7IA 1SZMA 3D83A 3U54A 4ZY4A 3A2CA 4KAOA 1ZXEA 3NUXA 2ZMCA 4U44A 5J9YA 2XBAA 4UB7A 1OL2A 5E91A 4BTKA 4ZTSA 1UU7A 4G9RA 3KIOC 1NVSA 1JOWB 2WTCA 4ENXA 3EH9A 3ORLA 4HJOA 4O21A 4OBQA 5KMMA 4B4LA 2R3IA 3IOPA 5B2KA 4YC3A 2OK1A 1ZMVA 4LV7A 4NJDA 4Y5QA 2CKQA 4IXPA 2XK4A 4AQKA 4F7SA 3JYAA 2ITNA 3FYJX 3NS9A 5EYKA 4R7HA 3LQ3A 5DBXA 4C7TA 2QHNA 3L8XA 4CD0A 4QNYA 4BCFA 4NM5A 4GIHA 3TIYA 4ANMA 2XM9A 2WAJA 2IO6A 3NNUA 4RA5A 3EQRA 3IDCA 4EZ7A 3PZEA 5AP6A 3EWHA 4I1ZA 1Q62A 4FX3A 2UZEA 4EBWA 3JVRA 3QGWA 2UV2A 4U9AA 2C0IA 1DM2A 1TQPA 3HLLA 4M3QA 4GVJA 3SDJA 5E9EA 3PWDA 3CQUA 1H01A 2OH4A 3CC6A 3COHA 3EN9A 4PNKA 4CEGA 3ZBXA 2OGVA 2EUFB 2XKDA 4KKGA 2X2LA 5CI6A 3WI6A 3R9DA 3QRKA 3POZA 4CNHA 4F9CA 3V5WA 4UYNA 5FUTA 2GS7A