4N4YB

Structure of recombinant cytochrome ba3 oxidase mutant g232v from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant G232V from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4yB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4n4yB02
2R4SA 4KO5A 3D4SA 2H3XC 1B3IA 3C9LA 5AX0A 1R2NA 4W1TA 5AWZA 1N70A 5IY5B 3CG8A 3T6VA 4BV0A 5JJNA 2YXVA 3WG7B 3HASA 5I6LA 3SQRA 2GC7C 5E9NA 1GY1A 1F50A 4BVNA 4Q8BA 3WKPA 1L9PA 1SF3A 1L9QA 4A4MA 1WS7A 1F4ZA 1UAZA 4K5YA 2PP7A 3QJVB 1DZEA 5H2NA 2PCFA 2XXFA 2BWDA 3PLYA 8PAZA 1KG9A 1KG8A 4AKPA 5A8EA 3PDSA 4LDEA 3T9WA 3HAOA 3UTYA 5DYSA 1MDAA 3FU7B 3NP3A 1JOIA 2GBAA 1S8JA 4YSOA 3PAZA 1P8HA 3FU9A 2XUWA 4E9TA 2ZWNA 1R1CA 1HZXA 3ZPRA 1EZLA 2HX8A 4DJHA 1L9OA 2IDQA 1SDDA 3PXLA 1JXFA 4NB7A 1MGYA 1X9RA 4FPDA 2YCWA 2WO3B 2AFNA 3FT0A 4XTOA 2VW4A 4UF7C 1QNIA 4E9QA 1X0SA 5DHHA 1AZBA 2RH1A 3ZX1A 2Z73A 1PNDA 3NY8A 2Y04A 1URIA 3NSFA 5B6YA 3H4FA 2PEDA 2YDVA 1L9TA 2QPEB 1A3ZA 3L45A 3RFMA 1JZFA 4IARA 2A3TA 3OD3A 1PAZA 2I20A 1JERA 2PP8A 3FQYA 3FSWA 3ABWA 5BR5A 4YSCA 1S51A 5BR2A 2Y1AA 1E0PA 1OCOB 4CSZA 1E65A 4NC3A 2VW6A 2J55A 4GYCA 4GP4B 1SJMA 5AZDA 1XJIA 3CVBA 1GS8A 3QBGA 4X1HA 1GSKA 4RH4A 1M0KA 3OE6A 1XB6A 3OM3B 2M3GA 4XTNA 4CSPA 2YCXA 1BXVA 3AYNA 1UCQA 3CODA 2IDUA 1GUEA 4KOBA 2HRGA 1PLCA 2Q9OA 4JKNA 4P5RA 5A44A 3X2QB 2BRDA 2YCZA 1HAWA 1AAJA 1SHXA 3OMIB 3X1FA 3ZPQA 1A65A 5LDUA 2FNWA 1TU2A 2HRHA 4X4KA 4A2HA 1J9SA 3WNJA 2DV6A 3ABMB 3NJMA 3DDLA 3AG2B 5AZUA 1RKRA 2OCCB 2HZHA 4YVUA 4BUOA 4BDVB 2PPDA 1BRRA 3ZEVA 5H2JA 3AG1B 4HALA 1X0K1 3CDZA 4DP8X 1L0MA 3GYRA 4PXKA 3T71A 1QKPA 3FSZA 2X87A 3VGAA 1S8LA 1I53A 2AZAA 2JKWA 2UX6A 5I5JA 2CUAA 1TN5A 3QDCA 1PLBA 5D4JA 2ZXWB 5FC9A 4KO7A 1KDIA 2XWZA 4UAHA 5I6MA 4KLYA 1WS8A 4HHWA 2J57A 5G54A 1AANA 2Z55A 1RZPA 2BHFA 1F88A 2IDTA 2W8CA 2XX1A 4YSPA 5B1JA 1JVLA 3QJTB 1V55B 2BP8B 2JXMA 3HANA 3EHBB 2VSMB 3FQ2A 4PAZA 2UXVA 1R84A 2AZUA 2VW7A 4N4WA 3RYMA 4E9SA 5B6XA 3NJNA 5B1BB 1AIZA 1M56B 4GXFA 3VW7A 1PZBA 2BP0A 4KOCA 1CYWA 1A4CA 4DPBX 3N55A 3NJGA 1W8EA 1M9WA 2PPCA 1U19A 2FT6A 3FU8A 2DWSA 3IBOA 1QHQA 2I35A 3NSYA 5D4IA 3WNIA 1KCWA 3DQBA 1JZEA 1CURA 3SN6R 4DPAX 4DP0X 4KNUA 4E9XA 2IWEA 2OV0A 1PMYA 1FBKA 2FQFA 2ZZLA 1GYCA 2YAEA 4JR8A 1AT9A 1CWQA 1OE3A 1TKWA 3ABKB 3COCA 5I6NA 1M57B 3UG9A 2JAFA 3NYKA 3OMNB 4BEZA 3TASA 5ETZA 1ZIBA 2WJKA 5I5MA 3KJ6A 3FYEB 3T6XA 3RZEA 1P8UA 2QPDB 4G7RB 5LWEA 1ASOA 2LNLA 3EMLA 1AZRA 1AZNA 1NIFA 2IWFA 2ZFEA 1IBZA 2P80A 1AOZA 3AM6A 1ET8A 4YSQA 5PCYA 4F7KA 1IKOP 3VHZA 4UHRA 2GC4C 2VM4A 3ZIYA 1RZQA 1JXDA 2QT6A 3EF4A 3PPSA 1ILSA 1ET7A 1IXFA 1AQ8A 2VT4A 1IUZA 2PCYA 3NT0A 1JZGA 5AKRA 3PWHA 4K9JA 1NICA 1PY0A 4GPOA 3CAPA 3UZAA 1KBVA 1RCYA 1SNRA 4KNSA 3WI9A 3S3BB 3WIAA 1PXRA 2I21A 1AS6A 1NWPA 4MQSA 2XX0A 5TGZA 2H47C 2KS9A 4HYJA 1ZDQA 4EJ4A 1PZCA 2GIMA 3T6WA 2W88A 1ILUA 4UG2A 3UONA 2Y02A 1S53A 1AS7A 1OCCB 1V10A 1W6WA 3UTXA 1GS6X 1JGJA 5H2PA 1TN0A 1KCBA 2XYBA 3X1EA 1MZYA 2B08A 5I28A 2YCYA 2YDOA 2ZIYA 4AMJA 2CCWA 1J9RA 5ANHA 4AKOA 5G2DA 2QDVA 4GY4A 2OJ1A 1BEXA 2IDFA 1XMEB 4XT3A 2FT7A 3FSVA 5TK4A 3X1BA 2BO0A 3T6ZA 3IN2A 3OE8A 4YSUA 1BQ5A 1L9SA 4G7SB 3DKHA 4E9RA 1HFUA 4AZUA 4BWTA 4DP9X 4HYXA 3VVKA 3ODUA 3AG3B 4XT1A 1C3WA 4A2GA 5TK2A 3NSCA 1E30A 3QJSB 3S8FB 1A4BA 3G5WA 1NTDA 2JFCA 1AS8A 4F2FA 1JV6A 5B6ZA 2PPEA 5B1JC 1Q5JA 4BXSV 4YSAA 2DYSB 3SBPA 4GP5B 2UXFA 5G2AA 4HAKA 3T45A 3X3BA 4DP7X 2FQGA 2R7EB 3ASOB 1AR1B 1KBWA 2YARA 1OE1A 3PAUA 5G36A 4M4RB 5C1MA 4OV0A 3FPXA 5I6OA 3OMAB 1GU8A 1JXGA 3ERXA 2IH9A 3ASNB 4YSSA 5A45A 1BRXA 5H2IA 3AZUA 2UXGA 1OCZB 1GZMA 1PCSA 2VN3A 3UTWA 5G28A 1BXUA 3S3CB 1MZZA 1AZCA 3FPYA 2G87A 3CVCA 3FQ1A 3N2JA 3NY9A 2YAHA 3NJKA 1IBYA 4BDVA 3TA4D 2BW4A 2L6XA 4MQTA 4YSTA 5JJJA 3JTBA 1S54A 2GB2A 2VSKB 3V2WA 2YAPA 1QM8A 2GHZA 3DIVA 4QLWA 4KO9A 3IN0A 4HCFA 2BW5A 1WA2X 2AANA 3H4HA 2YAQA 3PCYA 4ZK8A 3NJLA 1AG0A 5JJEA 2XXGA 5B7EA 9PCYA 4DP5X 4UANA 5B34A 5DHGA 1NPJA 2AVFA 1ADWA 1JFPA 1PZAA 3FS9A 2TSAA 1HAUA 2TSBA 4G70B 1SF5A 2I7SA 2XV3A 1NPNA 2BP8A 1J5CA 3AYMA 3EH5B 2BWIA 1KGYE 3UZCA 1VGOA 2Y01A 6PCYA 3QBIA 3EH4B 2AT9A 3OQRA 1NDTA 2EIMB 2YAFA 5B1AB 4AX3A 4MBSA 4YSDA 1QKOA 3VI0A 2FJSA 3IEAA 2IWKA 3BVDB 4FAAB 2DY2A 5F7AA 1P8IA 1XIOA 1O0AA 1QHJA 5H2KA 1QLEB 4AKQA 2WO2B 4BWBA 1OV8A 4BXVA 1WA1X 2EIKB 5EN0A 4XXJA 1JVOA 2J4YA 5ITCA 1AACA 2DWTA 3TBCA 4E9YA 4DP1X 5I5IA 1ASQA 4JHVA 1BYPA 1NIDA 1SFHA 2FQDA 4E9VA 1IW6A 4TXVB 5I26A 3ZBMA 4BEYA 1L9RA 1M0LA 3C75A 3QAKA 2JAGA 4IB4A 2YQBA 1TEFA 3DTUB 4JQ6A 2RACA 3OE0A 4DKLA 5B1KA 2PPAA 1LN6A 4GP8B 4BWWA 3VG9A 1KV7A 3PQRA 4A66A 2I7OA 1ASPA 1VJMA 4HWLA 1S52A 4ENZA 3CZUB 1Q5IA 2PLTA 3MX0B 2IAAC 3C9MA 6PAZA 3NSBA 3NS0A 4XTLA 3ABLB 1NIBA 4DAJA 3NJFA 3HB3B 3UAAA 3HAQA 5I6KA 2BZCA 2Y03A 3KW8A 4FBZA 3QPKA 4WAVA 1H68A 1JV7A 5H2MA 1BQKA 4BK5C 4IAQA 1OF0A 1PY6A 2WJLA 4QRYA 2Q5BA 3V2YA 3OE9A 4Q89A 1JZHA 1GY2A 3FU7A 4A2FA 4X32A 2ZOOA 2XLLA 3QAPA 3UGEA 3X3CA 3SBRA 4EF3A 1W6LA 4G72B 4QKTA 5F7BA 3JT2A 4L6RA 1MG3C 3IE9A 5FJGA 2IDSA 2FQEA 5B3SB 4DP4X 4WW3A 4EIYA 1DZ0A 2EINB 1X0I1 2HLEB 3AY2A 4NERA 4G71B 4MFHA 4YVNA 2FT8A 2UXTA 4WKXA 3UTVA 1L9HA 4NAJA 4HHGA 2FWLB 2X72A 1AG6A 1V54B 3V9EA 3S8GB 3BQVA 4A67A 4L0PB 2J5WA 4HZ1A 3WQJA 2VMJA 4DP6X 4Y9HA 1C8RA 4GRVA 1SDDB 4JHUA 2KSYA 4KO6A 1C8SA 1BAWA 2KSBA 2FTAA 3S3DB 5PAZA 2QDWA 5D4HA 5B0WA 5J7AA 1NZRA 3OAXA 3PXOA 2ZONA 3V9CA 5AFAA 3EH3B 5H2LA 4JKVA 2E86A 3NSDA 3FYIB 1NWOA 1J9QA 1T5KA 7PCYA 4HCGA 1NIAA 2N0MA 2XV0A 3WKQA 2KSAA 4HCIA 3KW7A 4J4QA 5EHFA 2NTWA 3NJHA 5KKHA 4X31A 1AP9A 1CYXA 3NYAA 2HXAA 2MTAA 2YAOA 4FA7B 1E5ZA 1ET5A 1FFTB 2CALA 5H2HA 2R7EA 3MBWB 2EIJB 2PPFA 3AG4B 1NINA 1WAEA 1IC0A 2HX7A 1WA0X 1E5YA 3QJQB 1PNCA 2CBPA 7PAZA 2I1XA 3PBLA 3QJRB 1XB8A 4M3HA 4P5SA 3TBBA 2HPYA 5AHZA 1SHWA 2YAMA 3FSAA 3ABGA 4LDLA 4AI7A 1TEGA 1UATA 1E67A 3UABA 2MRYA 1NIEA 3QBKA 1EHKB 1KDJA 4F2EA 1F56A 2YXWA 3UACA 5B2NA 2NRDA 1ZV2A 1BXAA 4MD1A 2Y69B 1PLAA 5A7EA 2BZ7A 1BRDA 3D12B 4G7QB 1H2SA 2UX7A 3UAEA 4LDOA 2X88A 3NJJA 4WTQA 2VM3A 3P0GA 1JZJA 4A68A 4L35A 1JZIA 5H2OA 2DYRB 1FWXA 2WSDA 3X1GA 1XB3A 4TL3A 1M0MA 1ZIAA 1CUOA 3QQXA 1BYOA 3MBVA 4MD2A 2P80D 5G2CA 3NP4A 5I6PA 2GSMB 1BM1A 4GBRA 1GR7A 4GYBA 4KNFA 4PXFA 1OE2A 2EILB 1MG2C 3CDZB 1FBBA 1DYZA 2GI0A 4YSRA 1KYAA 3X1NA 1ETJA 1KMEA 3REYA 2IH8A 5B35A 4E9WA 2NTUA 2Y00A 4QI1A 1A8ZA 1J9TA 1X9UA 2HX9A 3UADA 5B6VA 2F93A 3QJUB 2J56A 4W9ZA 1PF3A 4KNTA 1ZDSA 3PAVA 5AHYA 1BQRA 4A2DA 1ZPUA 3A7KA 2EI4A 3CVDA 1E12A 2XVBA 5B7FA 3SBQA 2B3IA 5ITEA 1YLBB 3TU6A 1A4AA 4EA3A 4HIPA 1GW0A 4DPCX 3NJIA 3AW5A 5G53A 1VLXA 3ZDWA 4N6HA 2BP0B 2LLNA 4PCYA 1FA4A 4BWUA 2CAKA 2CJ3A 3U25A 4YL4A 5B6WA 4A2EA 1SFDA 3HAPA 1CC3A 3GDCA 2F95A 4AMIA 4YSEA 2R4RA 5F8UA 1OCRB 1AZUA 2PP9A 4N4YB 3GXUB 3HEIB 5B7MA 5AX1A 1PXSA 3H56A 2H5UA 4N8UA 1KGBA 4DP2X 2XU9A 3HARA 1OOWA 1N68A 2I85A 2XV2A 3QBLA 1IW9A 4QIDA 1ID2A 1J5DA 1GS7A
chains in the Genus database with same CATH superfamily
4K3JL 1MJ8L 3UC2A 5IY5B 1EMTH 5FYKU 4S1SH 1O5DT 1CIUA 2OTPA 3PWUA 1SM3H 4PG9B 4R97B 1IEAA 2G3NA 3ZDYE 4BFIA 2VUYA 4M7JH 3GHBH 4Q6YA 2YA2A 4UBDD 4Y19A 4XBEH 3SQRA 4U1HB 2VLKA 5K9KB 4F5CA 1L9PA 4KXZI 1UCBL 2NQ3A 3HS8A 2OPCA 3V5DB 5IJDC 4G8GE 4X8GA 1FLRH 3LIUA 1R0AL 2X0WA 1KG8A 3SGDI 4ZW3A 4Z7AA 4EI5D 2OS7A 4DK3A 3FU7B 3VW3L 1F86A 2VTFA 3TTYA 1N3NA 1QEWA 1RZJH 3QUZC 3U36A 2ZWNA 1E6OL 4PJAB 4NHUA 1EZLA 1I1AD 5EIIA 5B1CA 1JPSH 3L4TA 2J6EH 4FQCL 1Z9SB 3FUMA 3LV3B 2UZIH 4M93B 1P7QB 4LRNH 3ZQ9A 1VACB 1F3DH 1T4KB 1WFTA 1MJ7L 3FOMB 2NY6B 4JGJA 2FD6L 2VLME 1NLBH 3ZQWA 5B6YA 5F7HA 3BAKA 5DDHB 3MGOA 3DROB 3Q2VA 1BVLA 3ZKNC 2WLLB 4Q9RH 3CC1A 5I8KL 4HC1A 3TYFB 3NCEB 4IU3A 2R2BB 5IMMB 2NZ1A 2CK2A 1A7QH 3MBWA 4NFCA 1S5IH 5T5FA 1GOFA 3UX9B 3JUYA 3EBIA 4FRWA 5FOJA 3L48A 3TEUA 3TONA 3U9UB 2J8UF 3BQUB 5H37A 1QTPA 5KS9E 2BIIA 4H40A 4PRHD 3LIZA 3RZCB 4CSPA 3JV4A 3EZ8A 1WT5A 5CLTA 3DSFL 1BMZA 4LCYA 5IP4A 3HNVH 3L1EA 2YCZA 1U91B 4N2GA 4URTB 1SYSA 3TM6A 3V4PL 3HJ0A 5GZOA 5K1VA 3W2DL 2JH2A 3BWAB 3N44F 1J0JA 3EGXB 3EO9L 5DEFA 1E6JL 3AG1B 3SBWA 1RI8A 4G6JL 1JZ5A 3FSZA 4U6HA 3VGAA 2YWZA 1RJCA 4PWFA 1Q90A 3ZU8A 3T2NH 4BUHA 5EO1A 4PWHA 3IB4A 4YDVA 1Y7VA 2IADA 3DNKA 2BFVL 2X05A 3F65A 3L6FA 1P53A 2BHFA 2K8MA 3FFDB 3QJTB 1DJWA 3T4YB 4LARL 2CKBL 3D69B 1ZS2A 2ITDA 4FXKB 4OZ4A 4FTVA 1NCNA 4JO3H 5DD5L 4AUUA 4BSVA 4FFVC 1DQKA 1RMFH 3ETSA 4ZXBC 4RNRA 2VDKB 1SXCA 4N0UB 3GB7A 1FYTE 4M9PA 4NWUH 3FU8A 5C0JA 4FKEA 3SDXB 1DVUA 4X0KB 3MCLH 4DPAX 3VU1A 4JLRB 4UM8B 2IWEA 2OV0A 1PMYA 2QZQA 4AZ8B 4WTZG 2RMNA 1JHTA 3W9EA 1TKWA 4UTCA 3HI6L 4ELKA 1OAYL 4WU5B 5J1AA 4DTGL 4CNIA 2JAFA 4YK4B 1VGKB 1NAMA 3KJ6A 1BAFL 3ZQXA 3OPZL 1YUHA 5IMOB 1UHVA 3BDYL 3QEQE 4AH2A 5C0IB 4ELMA 3BKMH 1KCVL 3H7LA 1ASOA 4M6NL 3TVMB 3FTYA 2DLTA 3PHOA 4KROB 4L3FA 5SWQB 3AM6A 4ENED 4R7NB 1GGCH 5IQLA 1ADQL 1E8ZA 4P0DA 1QLRB 3FRPA 4JCWA 5E95B 4D9RD 2PW2B 1B4TA 4OI9A 3D3VE 3GMQB 5KVDL 3NT0A 1FFRA 2XNAB 3BW9B 4WK0B 5AKRA 1PY0A 3UZAA 4LOUD 2OR8A 4NEHB 4PGBA 1GZHA 1JGDB 2GTZA 1RIVH 4PJ7B 4KQ4L 4XMPL 3T3MF 1UT2A 3FO9B 4IBSA 3FT2A 1CU4L 1XD0A 3ENEA 3T6WA 4KK6D 3GLEA 5F7EL 1WAPA 3KLKA 3AFLA 3DHJA 4U6YA 2A6DA 3V0VA 3VFSA 5DRNA 5I28A 2J6EA 2YCYA 5LAPA 1PKQE 1XIWD 3MV9D 3LSOA 2ARJQ 5FW6A 1U3JA 2K78A 2OJ1A 2VDML 3GMLB 4DERA 4Q56A 2K4AA 3SDDC 1MHHA 1O6SA 2YPLB 1DBJH 3LRHA 3WV0A 1OTTC 2ILLA 3ESOA 1F3DJ 2AXFB 3AG3B 3W0WE 2BK8A 3ARFA 2OMVA 4JPSA 5AW5B 4X6EB 4TQIA 4DCQB 1E30A 2F1EA 3ZHFA 1LEKA 3GBMH 4GUOA 4WI0A 4X8JB 3RWFB 5CGMA 4CN1A 4Z3HA 2JFCA 3E8VA 4K5PA 1AS8A 4F9PC 4PN6A 1JGVL 2PPEA 3BPNC 3NPSB 5EOCL 3X3FH 2BSTB 2E3VA 2VH5H 3OC5A 2OTUA 2RA1A 3R7QA 4MDRA 2XQ0A 2K9UA 2PYED 1TTBA 5G36A 3TFKD 1TSRA 1HHGA 2X9WA 1GSMA 1OAKL 2XC8A 4JG5A 5L88H 2H3KA 3QEHB 4CKVX 1ND0B 2UXGA 4ZBJA 1JZ6A 1RK0A 4HXBH 4X5PA 4PJBF 1G84A 4QO1A 4XNQB 3FPYA 4PRAB 2XWXA 4ODUB 4IRJD 1ZT7A 4PJIE 4FI8A 3OX8B 3WFZA 3MRJA 1OO2A 4U1JB 1FIGH 3DK2A 4GKSB 2WANA 4Q6IC 3PQYA 5TDNB 1PZ3A 2G75B 3OLIA 3ROLA 4HCFA 3IKCB 1JD9A 4FLOA 4PRBB 3DGDA 3FU6A 5E6ID 5B34A 3MRDB 2WP3T 1A4KB 2F6AA 5CCGE 4ZRGA 2GITB 3QUXD 2J4WL 4S1RH 5CSGA 1I1YB 4X9FA 1B9KA 1RJYA 2I7SA 3LKOB 1N10A 4ONGH 5BV7H 1K4CB 2O6CA 1I8AA 1NGPL 2K4WA 4LE8A 4S0SD 1MWOA 4QHUA 5TE7H 1N6QL 4FULA 1E2VA 2OXHA 2XIDA 5B1AB 4H1LG 1RIHL 5DFVC 5HYSA 4PWKA 1P8IA 1TZHA 1E5AA 2VL4A 4PW9A 1VCAA 3HC3L 1QHJA 3H9HA 5GSRA 3TV3L 3P4NA 1OV8A 2XWTB 3C5XA 2KT6A 3LRSA 4HC1L 1CK0L 2QADD 2AQ1A 1A6UH 2TRHA 3SE8L 2PF6A 4TXVB 1B9ZA 1IQDA 1UACL 4LOFA 1UA6L 4Y2OB 3OKKB 5T5FL 1O9VA 5DQDL 1NKRA 5E4EC 3L9YA 4D2NA 1NSNL 3O2DH 2NW2B 2A77L 4ZAKD 1CGWA 3PL6D 4HWLA 2P5WE 3N0PB 3MX0B 3LIZL 3H2QA 4AEIH 4DAJA 5DO2C 1H6FA 5EIQA 1WCBA 5GS0C 4OZGF 4TQPA 1DSFH 4LAJH 5D72L 1D7FA 4L3CA 4YR6B 3V2YA 4XC1H 3SJVE 1F1DA 1Q9WA 1C7TA 1G7LB 2RFXB 4F8QA 1AHWA 1WPCA 5MENA 2YRLA 3QAPA 4R90L 1UVQA 3FBKA 3HRPA 4XGZA 2XBZA 3EIFA 4QYAA 5IVXF 5K39B 2IPKB 2L7EA 2NY3D 3AM8C 1WC7B 2JQZA 4I1RA 4OT1L 2DLEA 4FZEH 2Y7QA 2EINB 4LAQH 4KKAC 2HFFB 3FT9A 4AEFA 4Z7OB 4R4FH 3VFGH 4HKJA 4HEMA 4FNUA 4JO2H 4XX1G 2J88L 3BT0A 1PCXA 3BQVA 5E6SB 4Z76A 4TSBH 4DHLA 2WINA 1M05A 5LNEA 3KPTA 2PABA 2NX5D 3N9GL 2IALA 4FQHB 3ZRCC 4MAYC 2E7LC 3S3DB 1ZA6B 2FATH 4C54A 3MRBB 3QI9A 1FG9C 3VWJC 5I71B 4K5OA 3L9RA 5EZLA 4M8RA 3MRRB 2LAGB 5C07D 3GSXB 1KFAL 3UPCA 1EGJH 4OCNC 5JOPE 2JJSA 2NNXA 4HCIA 3GBDA 2GFBB 3T5WA 2DL2A 1A6WH 4L8DB 2GI7A 1HXKA 4QPEA 3X13A 1MCIA 4GXVH 5HHVL 3RUGE 1OSEA 4FA7B 1U0QA 1IM3D 2R8SH 2CALA 1QBLL 2VT0A 4Y5YB 1LILA 7PAZA 4XXCC 1NAML 5C2BL 1S9WB 3MGTB 1HXYA 3PBLA 3QJRB 1H5BB 1TTAA 3EYVB 3KJ6L 1RLBA 4O00A 5LN4A 3RTQD 5EO9B 1GRWA 3AY4A 3B9VA 3D0LA 3PWPE 3WUWB 2MRYA 1U8CA 1ZT4A 4NC0B 1RZKL 4RIRA 5T8IA 1M2VA 1TJHH 1II4E 4S1SL 3T0EB 4DQOH 3WDIA 1NL0H 1K5WA 1RVFH 1NFDF 4M7JL 3GHBL 3QQNA 3ATAA 4OZHE 4XBEL 3AREC 4ELDA 1I9JH 3IPFA 1N12A 3VFUA 4JDZA 1MHEA 2YK1H 2VZSA 2YSSB 1TQSA 3MLRH 2GSMB 1FNSH 4GBRA 4OUOA 1A3RH 3FTUA 1E5CA 5F97E 4FFZH 4MB3A 4NQDB 3FW6A 2DB8A 1RZJL 1WAAE 4YHIA 1ECZA 4X5WB 2YEVB 3E9TA 3UADA 3WL9A 2Z4QA 4W9GC 2J6EL 3ML9A 3LXBA 4O9HH 2ZE0A 3L3KA 2UZIL 2YD6A 4DEPB 1A1NA 2DICA 3BLBA 5BPPA 5JZ7D 1QO3A 4AYMC 1HI6B 3U2IA 4B9YA 3CN3A 5AUMB 4O02H 1BM3H 4WGKA 4LLWA 4AQZA 4K73A 4G3YH 3QRBA 1T20B 1F2QA 1UZ6F 1S9VA 4LL4A 4Q9RL 4LSRH 4L3ED 3WEMA 1EBPA 3U25A 1EJ6A 2BJML 5B6WA 2NR6C 3UAJA 1YC8A 4HT1H 1SFDA 4LIQE 3P4MB 1A7QL 2WBJC 3WFDL 2FWUA 1S5IL 4N9OB 1MCQA 3MYJB 1OVZA 1IC4H 4IKJA 2ZOKB 2CU9A 3O3BA 4YHNA 1RUKH 5GGVY 1AXSB 2X4SB 3O2DA 1Z7JA 1DBMH 3CFIC 4NKDA 3GXTA 5IB5A 3N50A 4EI6A 4I0KA 4N2MA 1QSEA 2VMFA 1Q0XL 4DZBA 5F9DC 3CG8A 2OR9H 3QZNA 3KM2A 5KYWB 5SV4A 1KLUA 1S7WA 3IGAB 3HNVL 1QZ1A 3CBRA 1MH5B 4K5YA 1A1MB 2NUPA 2Q10A 3D0AA 5CWSA 4BUGA 8PAZA 1CQKA 5EU4A 3CVHA 3PDSA 1LP9B 4X6CF 5DS1A 1MDAA 5DYSA 1JG9A 4FQIH 1C7SA 5AOLA 2C1PB 4RZCA 4S1QL 1DQQA 1R1CA 5J0BA 1HZXA 2HX8A 2QLYA 3B2VL 3CFEA 1X5JA 3QO1A 3T2NL 4NB7A 4HUVB 2BP5M 4KJPC 3C6LA 4XTOA 2IMMA 2VW4A 4JM2F 4KWUA 1FV1B 3SDCB 2X6VA 1PY9A 5CJXC 5CEXB 1NGYB 4NYLA 1CB4A 4NZUH 2LAAA 1R33A 1I82A 3WJLC 4JO3L 2MHAB 4YHPB 4WUUA 3A6OA 4JZNB 1RMFL 4IBVA 2A6KB 3O0LA 3F58H 3L13A 4LEBA 1EGJA 4NWUL 1PY4A 3B9KB 3S96A 2YOAA 2W95A 3MCLL 1QI4A 1X4ZA 3FOLA 4CVZB 1DUZB 2APWA 4GYCA 3HN5A 5GGUB 1HH6B 5HYJE 3A67H 1JFHA 5JW4Q 4X6DE 1PX4A 3L4VA 3OE6A 5DJDB 5DURB 2YCXA 5D7KD 1VADA 1W0WA 1E8WA 3VQ2C 3DX9B 2FE0A 2F53A 4AT6A 3TESA 4CU7A 1SHXA 1FVCB 3X1FA 4KPHH 4QHLB 3RVTC 1FZMA 3WNJA 3RVXD 3MRNB 5J12C 4XBGB 3QORD 3VXSE 4YVUA 3O45B 3TH2T 4D3CL 3HPJA 2ZUYA 4HALA 3IGLA 4MHHG 1G4RA 4DP8X 3GYRA 1AR2A 1S8LA 1TYRA 4EJ1C 5D1XA 2HUHA 3P4OB 1HHIB 1RIVL 2J2ZB 3T1FB 2CM5A 2V9UA 3FZUD 4FFZA 2GBUA 2XWZA 3FTZA 2L7JA 2OXGB 4WTXA 2EVIA 3EGDA 2J57A 4GKZA 3L4CA 4XWOC 1I3GH 4N2DA 5IB4A 5B39B 4IOIB 5I16A 1DQTA 3QDGD 5E4IA 4BE5A 4JUSA 2WAHA 3N85L 2QELA 2J6WA 4MZIA 5C0BB 4Y2NA 5BS0B 1MRCL 1FFPA 3BIAX 4ZPTA 4LHUB 4O02A 4HK0A 3N55A 5GRUH 1HZLA 4OLWL 3N42B 4R6UA 4IHBA 2A4CA 3QUYC 4XPGH 3K6SA 3IVKA 3AVEA 1XGUB 3DO4A 1QSVA 4W6YB 2ENSA 2AQPA 3VSVA 5AAMA 3GBML 1M3IA 3GMMB 1AD9B 3ARFD 3VXNB 2VLRB 4MCZA 4CGUB 1BZEA 3TASA 5ETZA 3U83A 4HVBA 2DBJA 4PJXA 4TOYH 4OV5A 4QRPB 3GKWH 3TCLA 2V9TA 3X3FL 2VH5L 5CD5C 4XMVA 3HHRB 3BMWA 1MHCB 1ZVNA 5LWEA 4N0YH 2OCJA 2ZFEA 2BOCA 2D7QA 2CPCA 3KYOB 1JGLH 1DE4B 5L88L 1WBYA 5EF2A 1MI5E 1NJ9B 1S8DA 3OKMB 4F7KA 3QQ4A 3VD2A 5KJ4A 1QWHA 4XBPA 1KXVA 4HXBL 5IT2H 4I3RH 4OZFH 5DJAA 1IXFA 4HUMB 3L2MA 3VXMB 4NKQB 4LGRB 4LU5H 1RU9H 4OF0A 3MRKA 4EE2A 3RWCB 1LMIA 4P5TC 5AD0B 1E3XA 1FIGL 3T3PB 2NT0A 4J3SA 1HKFA 1AZVA 4QTIH 1NOLA 4NBXB 4PRPA 3NK3A 4YOKA 4OU3A 1D6EB 3DDGA 1JK8A 4UG2A 1OPOA 1WSST 5F1IA 1RUAH 3IFOA 1VAHA 3ARSA 3WUWG 4ONGL 5BV7L 5LBSA 4X99A 2HH0L 3ZZ1A 2IAMC 2MNUA 1BQHA 4MHHI 4XPTH 3NFPB 4M8QA 4KAQH 3VXUD 4C56A 4HAFA 2UYLA 4U7KA 3RFRA 1D9KB 3QDJB 3CHQA 1C16B 1C3WA 3HMWH 5BUAA 4A2GA 4JVWA 5E9DB 1MLBA 2PTUA 1U4EA 2E9BA 3GUFA 4OFVA 4A39A 4K3HA 5ESAA 4IEFB 4N9GA 5BRZA 3M45A 3O8XD 2FO4B 1KYOJ 5ESVA 3RG1C 1AFVH 3O2DL 3QEUB 5BCAA 4JCMA 4JPIB 3FQRA 3SOTA 5ITFB 4B9CA 2OX5B 2IH9A 1XGRB 1R3LA 4NPYA 1F11B 5BJTB 2FUQA 2EDNA 3B2PA 1QAWA 3EW3B 4AEIL 4FC3E 4O2CB 1JTOA 4I2XA 3Q8BA 4XCNB 1Z3RA 2O5ZH 1AZCA 1MRDH 4KU1A 4P23A 1YMMA 3WNPA 1DSFL 4M7ZB 5IJVA 3HB3D 2C26A 1NH6A 4H8WC 1WFNA 4XC1L 4J8RA 4UQDA 3O0RL 4GRWH 3ALXA 2QSCH 5IEHA 1S5HA 3DTDA 3HE6A 4KKZA 2CG9X 3PWVA 1RZ7H 5EU5A 5B7EA 3NCYS 3CVHL 2Y7OA 1CFSA 3CVIH 1DJYA 3WDHA 1C5CH 5MEND 5LB1A 3DURA 3H42H 2AVFA 4FZEL 1PX3A 4LAQL 2TSBA 4RFEA 4WW1B 4KFZC 1P2CB 3VFGL 3LKRB 1UJ3C 3MUY1 4IGBB 3BIBX 4Z8FH 3FCSA 5DTFB 1N26A 1WZAA 3NACH 3VSTA 3RY4A 4TSBL 5LG6A 4TLKA 3IEAA 4H5SA 4F37K 2FATL 4FABH 2AQ3A 5HGDA 1PG7X 1J05B 4CVUA 4NQEB 5IOKA 5MEQB 3QWRA 4KKBC 4OLVL 5CSZB 2WO2B 3NEXA 3A22A 1RZ8B 2QR0B 3BPNB 4ACTA 2R0WH 2YHGA 4IW4C 1AACA 4FJZA 4LPTA 1EGJL 4EN3C 1L5GB 4J3OH 4N2AA 2JIXB 2R4RH 2XN9E 5I1IH 4TVPE 5DVMA 2XWCA 4PS4H 4DKDC 1SDAB 4P46B 3HE7A 3VDCA 5JO5A 1YECL 2RACA 1CYGA 4GXVL 4CADB 1TQCC 1LTXA 3VG9A 1S7TA 2R8SL 3GINA 3C5ZA 1U3ZA 4KI5D 2ZUXA 3NA4A 3UJTH 4NRYA 2LFGA 3ABLB 4R83A 1IZJA 2FVNA 4DN3H 3PP3K 4MJ5A 3WY1A 4G1EA 4OJDH 3KW8A 1M3JA 4FBZA 3QPKA 1S78D 4WAVA 1JV7A 1EUUA 1KC5H 3P2TA 4N2EA 3TJEL 2L04A 1NMCC 1HKLH 1CD8A 1TJHL 1JS4A 1WBXA 4GJTB 4LVNC 1KTJA 4OZFA 2YEZA 5HHNA 1YN7B 4OLUH 4DQOL 2ICWA 5BO0D 1CE1H 3WO4C 1RVFL 4L4VE 4HJ1A 3OXSB 4OIIH 3CSGA 2B0SL 2X1PA 3VGBA 1I9JL 2CIIB 2WNKA 4BZ2H 3UPRA 4L0YA 4C47A 3IJYB 1HOCA 4H0LC 2LOEA 2YK1L 1IBBA 2UXTA 1FNSL 4Y19E 1A3RL 2VLKE 15C8H 4HHGA 4UDTB 1KTLA 4LCWD 4AYFA 4FFZL 4GIAA 4F5CE 3OWRA 4ZDHA 5FYJH 3WQJA 1T04A 3F3HA 5ISZB 3U1PA 1DLHB 4AGQA 3MBEB 4O9HL 4WW2F 5B0WA 5DYOB 5T3XE 2F5BH 2VDQB 1FC2D 5D4QA 1T21B 5ETUB 3AWFA 3BN9D 2V5MA 4O02L 4Z7UA 1BM3L 5E4EB 1D3CA 3EOYG 4G3YL 5EEYA 2E7HA 2DWYA 1JPEA 1YSOA 1T4WA 2KSAA 1SYVB 5LXGH 3VSQA 2H1LM 3F7PC 4W70A 1RSFA 4LSRL 1CT8A 2XWBB 4HGMA 3S5LB 3ARDC 3BP7A 1YNLH 2EC9T 5DHYB 1KN4H 4HT1L 3L5XH 3AG4B 1WAEA 1IC0A 3TZVA 3KCPA 3UAJD 1IC4L 2JK5B 1LJMA 1RUKL 3H53A 2OJZL 4WNQB 5E6YA 1UATA 1DBML 1FL5B 1O7SA 4GRMA 5B39G 5KS9F 4YHLL 3C08H 3JWDC 3LXCA 2GYSA 5H35B 3QJFB 2J3SA 5E4AA 1FDLH 3Q9PA 5DHVH 2YJQA 4OZIB 1YN6B 2OR9L 2VGLM 4LHUG 5HI5C 5DRWA 2V7HA 3T0XA 5HDOA 4GBXA 4NO3A 4QAMB 1BGXH 2PWGA 5F7DA 2WSDA 4YXLH 4ZMLA 3VFOB 1LGVA 5I1EL 2WVTA 4HUWB 2F54B 2W07A 5KYNA 3NESA 1UA3A 4PRIA 2E46A 4YC2B 3PF2A 2Z9TA 4K55A 4IOFD 1CXHA 1I8IA 3EO1B 4PXFA 1DO6A 1YQVH 2EDYA 2OULB 4MAYB 4PJGA 4YLCA 4FQIL 4M8VA 4W4OC 3SIKA 5TTRA 2HP4A 5C6TH 1IAIL 3ZHLA 1G9NC 3DHUA 3FN3A 1L6ZA 3ARVA 2QKIB 2F93A 1T2XA 2FEDD 4XVSH 2VSDA 4BKTC 2ZPKH 4NUMA 4WHYH 2R2EB 2XETA 5LBSL 1ZDSA 4YS4A 2XI9A 3G6DL 2Z31C 1AMYA 2R1XA 2ED6A 4NAQA 3D09A 1P7QD 5KVGH 3KYKH 4P3DA 4JY6A 2VZ1A 3KDMA 3QQ9D 3MU3A 2X4RB 2BP0B 1F97A 4JJOA 3H85A 1N19A 3BDXA 2FO1A 2NY6D 3DOSB 3F58L 4WUUD 1S7SB 3OHMB 4FTVE 1FHNA 3GMOB 4WI8A 1A7RH 2MWCA 2R4RA 5F8UA 1FFOA 2W0FA 2WLYA 1XGQB 2WM0A 2PP9A 5I2IA 5IMKA 3MNWA 1QOKA 4MQ7B 4M6ML 4Y1TA 2C9RA 4HA1A 4XC3L 3A67L 3EJTA 3T77A 4M9OA 3IMVA 3DTXA 4Z7VB 3APNA 3LCYA 5DLLA 3CLFL 1IILE 4MVBC 1OB1A 3BQUD 3AREB 1XCQA 4GOSA 2F19L 3CHPA 1IO4C 3WKMH 4MCMA 3KPSE 3QYCA 1MKFA 3RGBA 3UDWC 3SGKC 3RZCD 1CF8L 1LK3H 1BZ9B 1DDHB 2CRIA 3N40F 1QW8A 4Q8BA 1I8MA 1DANU 2QFRA 4GIPD 5LGHL 4AMWA 1OM9A 3CH1B 4EOWL 7CGTA 5GJSH 2ARWA 4OVVA 3E3QE 5FYKE 3I9GH 1FFNB 5HI4C 3MRFA 1LO3H 4QRUA 4X6FA 3MV7A 4CC4A 1DBBL 4E9TA 1NBYB 4PRNB 5CAYB 4FADA 1DEEA 2F8VA 5T1JA 3PNRB 5E8OB 2NY4C 2YKLH 1YUKB 3I6GA 2Q7NA 3ZDZF 2H45A 4D0DB 2I25N 2YMXH 1I3GL 1AI1L 2Y5EA 3MRIA 2EZ0D 2XG5B 3N91A 3L3OC 4QF1A 2AABH 2F8IA 2QPEB 4Y5VB 2DD8H 2A6IB 3GMPA 3RFMA 4IARA 2BSSA 3TXAA 3FB6B 5DEZA 5GRUL 4E68A 4NNXB 5BR2A 1H3WM 2YD7A 5AALA 3OR6B 4XPGL 2V5RA 1A8JH 4CC1A 1ACZA 4APXA 2VQ1A 4N8PA 4F2MB 2ZYIA 1JWUB 3BI9X 1YAZA 3QBGA 2L7QA 1RJLB 4J27A 4NJ9L 3WN5B 4X8XA 1UD2A 3NGBC 2XG4A 4MTMA 2ADJA 1BZ7B 3KJ4B 3W39A 2QQKH 1FIEA 4FQXC 3QIWA 5IHUH 1U3YA 3OMIB 1AAJA 4N0YL 4DVBB 1EWHA 4U1SB 3MN8A 5JPNB 2YQ2A 3A6BH 3N3EA 2H4EA 4JZOB 1JGLL 5DHVA 2VMDA 3C5SA 2QPSA 2XACC 3HZKA 5EF1A 4AVJA 4JVUA 3N0AA 3CIAA 3TVMD 2UWEB 2BY3A 5IT2L 4OFYA 4PJ6A 2ZICA 3BJLA 4OCLC 1MWAB 3KPNB 4LU5L 3UTZB 1RU9L 1XGPA 2BNUA 3NIDF 4BBWA 1A6TB 2CXGA 3T71A 2C8NA 4DQAA 5BO1H 3CQPA 2VAAA 1NGZA 4G5ZH 1UD6A 4HGWA 4MX7B 1B88A 4OCRH 5D71H 3LDBB 4PRPD 3PQYE 3WHE1 2IDTA 2JCCE 4S2SB 3E3QC 3EHBB 2O5YH 9PCYA 1Z6JT 2H0FA 3S97C 2FWSA 2J8OA 3K8MA 3GXFA 1ZVYA 3PIQA 1K9TA 1M6OA 3QAZC 2IIJA 1OW0C 2W60B 4WFGD 4XPTL 4KAQL 2AQ2A 5FLUA 1KXTA 4PJCB 4DPBX 1GZQA 1R5IB 4BCXA 3JUZA 5J6GB 3H0TB 1IEHA 3UZVA 3ZJAA 1Z2KA 5EU7C 4YHYC 1UH3A 4C56D 3VD0A 4TNVF 3K5RA 4HUCA 5HJBA 4KTDL 4YHMH 4CBZA 3K71B 3EXLA 2E7CA 4JN2A 2C4FT 5LBGA 2OP4H 5JDSB 1ZHLB 3AU1B 1CFMA 1KNOA 1LE5A 3GXIA 5L2KA 3MNZB 5IB1A 3QUHA 4N0RA 3TCTA 1OPGH 5T5NG 1DQLH 1NBQA 1F4AA 2QHRH 4HPYL 2HYMA 1QQDA 3KPPB 3QWOB 2OYLA 4P3CH 1Q38A 1AFVL 3GTNA 5BRZD 5BVPH 3CFCH 5J12B 3VWKB 3CD4A 5K59E 1XAKA 3ILPA 2EH7H 4PBDA 4YSQA 5ESQB 2EYSB 4UHRA 1T83C 2JKTM 2VM4A 1OGPA 3BD4A 2O5ZL 3VD7A 1MRDL 3OV6A 5DSCA 5I1KH 4M7KL 1UD8A 2HJKA 1TJXA 5JPMA 1F58H 5L2JA 1NDGB 2CA3A 1CZ8H 4FI7A 4FXGA 5EBWB 1EAOA 2D0FA 1YMMD 3ULVH 3CAPA 5B7MA 3S5LG 2QSCL 1JP5A 1BF8A 4WEBH 1RZ7L 2WUCH 3CVIL 3UMNA 5LKNA 1C5CL 3H42L 3HE6D 3UTXA 1ZLDA 2N1TE 3OJ2C 3TJPA 3MLPA 4J4PA 3DX6A 3CZGA 4DKFL 2YDOA 5D1ZI 4H88H 1OZTG 2VNCA 5SWSB 5F1NA 5FYLL 3BVXA 4KXAA 3ZTJG 2FT7A 3QUYB 3X1BA 2QGBA 3NACL 5DMIH 4QD2E 4YSUA 5DZPA 2J8UB 4FTDA 4Y2DC 1TF4A 3O6KH 1AIFA 1FHGA 1ITBB 4GSXA 4IS6A 1PIGA 2WWOA 4NZDA 4FABL 2OSXA 4HEME 2YD1A 4RMRA 3DETD 4Z5RA 3G7TA 1MJJB 4M00A 5DVKA 1MCDA 4CMMB 1MVYA 3REVB 2R0WL 4FYQA 3RI5K 2A83A 2GUOA 5K1NA 4U1NA 1KELH 2ZNWA 4X5RA 3L7EA 2DEWX 2R4RL 4R26H 5I1IL 2X0VA 4HAGA 4KZ0A 4NC2B 1JYWA 2Z64C 4Z7WA 5G2AA 5FIEA 3RUGF 4DH2A 4Y2LA 3N44B 3VXRA 4QWWD 3S88H 4PJFA 2DM2A 5TH2B 3UJTL 3MLXH 1A5FH 3TEZA 4DN3L 4ZFFA 2JJWA 4B9FA 1WQVT 1G1CA 4UOW1 4XWGL 1KC5L 1J0YA 2EC8A 2L6XA 1YZZA 2N01B 1HKLL 2GB2A 5TDOA 2YAPA 3K74B 1RH8A 5FGRA 3ZR5A 4KXZH 4OLUL 2F74B 5BRPA 1CE1L 3T6QC 2G0KA 4JFDB 1XT5A 3JV0A 4JQVA 4OIIL 4U1GB 5JW5B 3ARBA 3SGDH 4H0HB 3MOBH 5DZAA 5HJ3A 3EJZC 2DWEA 4WVRA 4NQCB 4WFFD 5JOFA 5KSBA 1CFBA 4IJ3B 5FHAH 4DF9A 3JWNE 3L5WB 2WGXA 15C8L 5IHBA 1ZGLM 1F42A 1OP4A 5FYJL 3HR5B 3PWJB 1WAAF 2X4TA 1FL6B 3WN6A 3KD4A 3PHQB 4PHXA 1UD5A 1QFWM 4RBPK 3BP5B 2JTDA 2YXMA 1CLVA 1S9YA 2RH0A 3D4CA 4LLVB 1GGIL 1E3FA 2ZXEB 2DQJH 3QVAA 2F5BL 3KVPA 3V7MA 5DUBA 4BWBA 1YEDB 1XR9A 2GJ6A 4PB0H 3RWJA 5AYTA 1JZ3A 4DP1X 1UB5B 5FO9B 4UM9A 5IMLA 2AS5M 4W9LC 1R19A 3I75B 1ZVSB 1NIDA 5CJ8A 3S7GA 5E8NA 3ZMEA 1L9RA 2WUBH 3KBEA 3IMUA 2HSIA 5LXGL 1U93A 3DTUB 4V33A 1E50A 2D8KA 3FTXA 1YNLL 3MV11 4NO0B 1NANI 3F7VA 3GNML 2CR3A 3TO2A 3HAEG 3IYLW 2I32A 3PGFH 5KVMC 2JKSA 1OGTA 3MV8A 5H2BA 1WD8A 2GJPA 2P47B 3HBPA 3B9DA 4HKXB 2ZF9A 4ZSOB 1OGAA 5EUOF 3AB0C 2BSRA 4MXQC 1OEZW 2BCKB 3C08L 4TNEA 3NIGB 2ZP0T 1R3JB 1BP3B 1UWXK 3QNYA 3S3PA 4DEWA 3BGFC 4C83B 5KW9H 3CSFA 1QUNB 1V5JA 1XDTT 4QRQA 3U1SL 1FDLL 1KBKA 2K3TA 3O4OC 3UGEA 3ES6A 1FYHB 1IGJA 3TNMA 5LXVA 1ORSB 3QZLA 4ETQB 1XZ0A 2CHXA 1BGXL 4POUB 2H9GA 2H32H 4YNYA 3WE6B 3T0ED 1UJ3B 1WUNT 4UAOC 4UNUA 5E51A 4EBQH 4GBXD 3DV4A 5FM8A 1OCWH 4JJ5B 3MR9A 3W3BA 3DMMC 2KS0A 4GEJA 2J5LB 4R0LC 1H3TA 4KHXH 4QRRE 5DC0A 4J5VA 4E5XB 1K2DA 3QZMA 5B4MD 4IU2B 3T09A 4FQPA 4HWUA 2VDPB 4L1LA 4JHUA 2KSYA 4EUPB 1DCEA 4OAWA 4P05A 1OHZA 1BF5A 1NCCH 4FKHA 1LWRA 4B0MM 2CDGB 3GC3A 5AFAA 3JWNC 1BLIA 2N7SA 2JLPA 3FYIB 3AUVA 1HSBA 1NWOA 2AJZB 1Z32X 3KWVA 4XPHH 2FJGA 1ZTXH 5CIPH 1TQCB 2ZWYA 4WWKA 2ZKWA 3PJSA 5EHFA 1IM9A 5KKHA 1JPFB 4J1UA 1NMBH 3F12B 4PJBB 1E27B 3QNZA 4I8DA 4AE1A 1F02I 2W92A 3ARRA 2VR7A 1NINA 4JZJB 4YN3A 3SE6A 4DGYH 1XSOA 2DM3A 3QUKA 3TBTB 1GTFA 2Z0UA 5AVTB 2MCG1 1TEGA 1EHNA 5KYYA 1G7IB 1NIEA 4K15A 2XXMB 3ZE2F 3DX7A 1F6LL 4QCIA 4RRPG 3U7YH 1OLLA 3KPMB 4QXGH 1RZGA 1H8LA 2OMZB 3UO1L 3NJJA 2X88A 5FKAB 2E56A 2R27A 4PLKD 3M1BB 5T1KA 3BP6A 5I8CB 1KJ2L 1LK3L 3C60A 4AVHA 4U1MA 4WDIB 4J2XA 2DI9A 1NGWA 2F53E 2AI0L 5AKVA 3ZLQC 4JNXA 1NFKA 4NFBA 3EJYD 4CDHA 2GUYA 3NCFB 1OE2A 3I9GL 1S7QA 2GI0A 3HFFA 2MKLC 2VC2H 1LO3L 1OAXH 1ESOA 1JZ7A 4XTRD 1QP1A 5EUKA 5C08E 3E7JA 4QTHB 4Z7NF 5E6ZA 4ODHH 1A8ZA 1X9UA 1MIEH 1I4FB 1MCPH 2YKLL 3MV7D 3VI3A 1GVIA 3VFRA 3W9DA 4GUPB 1DFBH 3N1GC 5D1XE 1WIPA 1ZAGA 2G4EA 2YMXL 3NFSH 4BH7A 4LKXB 2A1WH 2B3IA 2DLHA 2WQAA 2IXQB 2YFNA 3BFOA 3G6JE 1GA2A 2AABL 4N0CC 5D7JC 3SDCD 2X4PB 2L8AA 1TQVA 3QXDA 4NQVA 5GRVK 4IBUA 2DD8L 3DX4A 3PHSA 4F80A 4AM0A 2CNYA 2CJ3A 4M6AA 5F0MB 1PZ5B 2HUEA 3A3YB 2HTKD 3B9EA 4OZGB 5JYMA 1FL3B 5DRZB 5CM1A 4YHOH 1J7VR 5F3HB 4LF3A 2K45A 3HEIB 2HLAB 1S9XA 1T1XA 2H5UA 1QYGL 3B9KD 3PP3H 5HVFB 4HXAH 5IVXB 1K8DB 2XN0A 1EV2E 1BLNA 3BH8B 4B7LA 5I0DA 5IJKA 4MDIB 1G6RB 1B3IA 4U3XA 5CKGA 2EECA 4W1TA 4I7ZC 3BH9B 5E8DH 4M7LH 1W72B 2QQKL 4LBAA 2V3DA 3CXHJ 4E2OA 1CGUA 1M71B 2XA8H 4ZFOB 5IHUL 5DURD 3RL2B 3ALPA 3C09B 1AQDB 1TLMA 4WV1C 1H9VA 3A6BL 3JWOH 1SXAA 4PJXE 3QIWD 2EUVA 4A4MA 4Z3IA 2PO6A 2WZPD 3BZ4B 4K3GA 2WOYA 4OJCA 5DEJA 4OQTH 3PFUA 2H32A 1X9LA 1HILB 2X9YA 1JOIA 4YE0A 2XVLA 4XN2A 4YDLC 5AOKA 1G7QB 5KVFH 1U8QB 1YPZB 2XUWA 3CQFA 5BO1L 4JFHE 3KZ8A 4P06A 5GS1C 3ZPRA 2W81C 3FQUB 4G5ZL 1CFVH 3BPCA 5JW3H 5EPMA 2QQNH 2ZKMX 4NUJA 1UURA 2WO3B 4UF7C 4OCRL 1KB9J 3BZDA 5K33A 1D7BA 4RMTA 3ECBA 4ZX5A 3U2JA 2Z73A 4H8QA 3K81A 3NY8A 3TIDB 3VI4A 4XAWH 3B6SB 2FIKA 1SJHB 5E2UH 25C8H 3H4FA 4N3TA 4D0CB 3AT8A 4EDXA 3AXHA 5KUMA 1L6XA 3OKDB 1FGVH 2A3TA 4FYTA 3GRBA 4GLRI 4AYID 5IQ9B 4ANUA 3C5JA 2GK0B 2CGZA 3KDPB 5C0BD 1I7TA 4ZS6C 1JWSB 3VRJB 3TPUB 4PGEB 2QGDA 2NNAA 1Z9LA 3B37A 4JY4B 2XZCL 2OL3H 4YLBA 1SJMA 2DYPA 2OP4L 2ZAGA 4PWGA 4UV7H 2WVUA 1JN6B 2CLVB 4M1CD 2YC1B 1OPGL 2GEEA 1DQLL 3J27A 4LLMA 5F6HJ 2VLRD 1ZGLB 3EFFA 2VISB 5BVPL 3CFCL 1G9ML 5E2VH 2X44D 2BY0A 1TR7A 4QRPD 5FO7A 4YX2H 4A2HA 1J9SA 5GZNC 3CC5B 5AZUA 4J23A 5LNDA 2DAVA 5D1QB 1IZKA 2PPDA 5I1KL 2NY4B 5MHSE 1SOQA 1X0K1 1F58L 4ZO8A 3C8KA 5BVJB 4EKXA 3HZYA 1DFXA 1ZHBA 2X87A 4V2BA 4I2XE 1E9OA 2V4LA 3PP4H 4FHKA 4FX5A 1HHKB 4MS8C 4FNQA 4WEBL 3MTRA 4GQ9L 2WUCL 4OUUB 3MC0A 3P3RA 3L3OB 5HGBA 4KHTH 2Y24A 2XX1A 4M1GH 1CICB 1U8PB 3LN9A 1IJ9A 3CZNA 3DXAA 4BK4A 3NQIA 1A0QH 4H88L 4NOBA 3V6FA 3T65B 4ANXA 1OARL 3RWIB 2YZ8A 1X5MA 3TFBA 3TBYA 4FYSA 1ZKAA 1W9XA 2Q76A 1HVXA 3PWNA 3QUMB 4C4KO 5E23A 3F6IA 5HGGS 3K0YA 3O6KL 2BVEA 3X12A 1CXLA 3BLKA 3QNXA 4H26B 3LNDA 4AV0A 4CMHB 3MRCB 3NGBB 1D9KD 4TUJA 4H1LH 3I50H 1SHSA 1KUMA 5IQ7L 5CP7B 1BG9A 1WISA 4OCWH 1KELL 1BD2A 2Y23A 1AGDB 4ILDA 3KWUA 3V6OE 4XVUD 4E5XG 3OF6A 4PJDA 3QO0A 1CGSL 1ZT1B 4K7PX 2D31A 1HDMB 1UH2A 4N6RB 4WJG3 3ZZQA 1A6ZA 1CE6A 4ONHB 3GSQB 3S88L 5GISH 2HCZX 6TAAA 5PCYA 3UBFA 1IKOP 3MLXL 4MMXB 1A5FL 4WTZA 3IJEA 4ZOAA 5T1MB 1ET7A 3ULUH 2DJMA 4NN7C 4B0MB 4WFHE 4H44C 3HG4A 5INDB 4KJWD 1UGNA 3CFNA 4H0GA 4N1CA 4DPRA 4JM2B 2OMYB 1RK7A 1T0MB 5IK3A 4DAGH 4EMZA 1NICA 2FIRT 2VABB 4AV5A 3QIBB 4OQTA 1AS6A 5T1DH 1HEJC 5EZIL 3VQ1C 4HYJA 3WTTA 1SY6H 2EDBA 1WGVA 1W6WA 3EH2A 4NO2A 1S7XA 5K9OB 2XYBA 3QAZB 4TL4A 4WEEA 4XN5A 1E2WA 2B14A 4PMEA 4HEPG 1RP9A 3VMOA 1BOGA 4HG4K 4BSWA 3RWDB 1I8LA 1EDQA 5GSVB 2COQA 4UOZA 2BO0A 4KX9A 1AO7B 4U1LA 3IN2A 1HWWA 4UQ2B 4XO9A 3T0WA 5IWLA 3BUIA 3MVSA 1BREA 3SDAC 2FHBA 2VR9A 2ESVB 2A73B 4IGBD 4UINH 4YDJB 2EVFA 4HYXA 1A1OB 4A7SA 4DW2H 5MERB 2DQJL 2FK9A 1P9MA 5CILL 1V27A 4K2UL 4YBQC 4GSDH 4PB0L 4UT9H 1ODAA 3SE3C 5KSAC 2JJTA 4NQED 3ZE1E 1JIBA 1CJYA 4PTUB 4MNQB 5B6ZA 2B1OA 3Q01A 2WUBL 4FNTA 3ECWA 1E5BA 2OL3A 4UM9D 1UOLA 3BESR 3LX9A 1KBGH 2UXFA 4RESB 1B0RB 4Z7UE 3OGOE 2VKXA 3GZKA 4QOKA 4MRBA 2JIXD 3MJ7A 3KE0A 5KN5B 3KNBB 1BX2A 4P46D 3KLHC 2VRAA 2WLZA 3F8UB 5CEZD 2APFA 4NX0A 2ZG2A 3CPLB 2VN3A 3MRHA 1DLFH 3CFKB 4P2QA 2CDEB 5LG1A 3CVCA 1XCWA 4N0FB 1SLUA 1M6UA 3V6OC 5TE6H 5JLZB 2BW4A 4YSTA 5KW9L 4LNRA 1I1RA 4JFFE 5FGCE 3RFZA 1TSHA 2Y3AA 2VSKB 4IRSD 2RQEA 4ZS7H 2X0UA 3F7YA 4I89A 4QLWA 4HKBA 4HJ0C 1T1ZA 2FX8L 3V6BR 3OKEB 4FA6A 2P24B 4MJHA 1AG0A 5DVOA 3P0VH 4BA8A 1A6VH 1N59B 4EBQL 1ZGLP 1W80A 3Q48A 1ADWA 3TEWA 1OCWL 1IGIH 2DQIH 3QFJD 1Z9NA 5DZOA 4Y2DB 1J5CA 3O6LL 3ULVD 1OP3K 4N3UA 1G7MB 2IMNA 4KHXL 5FS5A 4JG0H 3RVWD 4GO9A 5D6CB 1P4IH 3QS3A 4GRWE 2NUTB 1TYEB 3BKCH 2NNCA 3IXTA 4OF6A 2Z8VC 5E70A 4CRPA 4F15C 3LRGA 1J8RA 2FSDA 2IWKA 2Z92B 2Y1YA 3BVDB 4FAAB 3LKNA 1TMQA 3BZEB 3MODL 1NCCL 1QLEB 3GI8L 5TF1H 4P5MB 5E00B 4HZLA 5ISZD 5BUGA 2VN5A 2GAZA 3MBED 4PH8A 3TO4A 3UGUA 3TBCA 4YEEA 5FYLE 4QY8B 3V0IA 4XPHL 1BEYH 2FQDA 2KZKA 1E4WH 3ZUCA 3DYOA 4PRHE 2H1PH 3HS0A 3MRLB 4EN2A 5IB3A 5E5MB 2VN7A 3BPLC 4H1LA 1NMBL 4G9FA 4DKLA 4WWKD 4I48B 2LT9A 4NQQA 5AL0A 1M7DA 4GP8B 5LAXA 2B59B 3KBPA 4OFQA 4PIRF 3NZ8B 1TNMA 3UTTA 1EQWA 4X83A 2WWKT 4R96B 4U1HA 1H8SA 3VJ6A 3ZL1A 4P2RB 5T3ZH 1GMEA 4KI1A 2WO4A 3MV01 4KKRA 5D5MA 4P57B 4NQXB 1UGKA 3U4EA 4F7TB 4HSCX 3FU7A 2W0PA 2ZOTA 3U7YL 4QXGL 1G7PB 3GRGA 4AQAA 2FUTA 1A9VA 2XLLA 4L8CB 1LXMA 1WDAA 3CSPA 4X9IA 1TFPA 3QCTH 2OMTA 2IANE 4LXFA 4UBDC 1F6FB 2N1KA 5AKSA 4HJJH 3UZQB 5IHLB 4L18A 3ISYA 4HJUA 4XVOA 1F4XH 4DP4X 4F3FB 2HVKB 4TUOA 3EJSA 3IJHA 4E42A 1YMHA 5F7YC 1HIMH 1SY6A 3FOMA 3UTVA 1OIOA 5DK0B 5E2TH 2Y7SA 2VDOH 2F54D 4EI5C 5AW8B 2VC2L 1OAXL 3S8GB 2WC7A 2YKKA 5JMRA 1QLFA 4ODHL 1SDDB 3OKYA 3HMXH 1MIEL 1I1AC 3SN6N 2R2BA 4Z3TA 3QDME 4YBLB 3OAXA 5JHDA 1DFBL 3RAJH 5I66B 3NFSL 2E86A 2X28A 3NSDA 3U9UA 2XICA 4WZ9A 3PDOB 5IFJB 3T2LA 2G3MA 4PCKA 3H9SB 2A1WL 1EEQA 5C0GA 5A1AA 1WP6A 3WKQA 1MCEA 5D7LB 4Z77A 4UT9A 2R9HD 3NYAA 3D25B 2X4OA 5DA4A 3UTSE 3ZKXC 1JUFA 2O30A 4BQ8A 5F3BB 1HHHA 3KCWA 4MJ6A 4CAGA 2WXRA 3AB0B 4XI5D 4WU7B 3QJQB 2CBPA 1WFMA 1VZIA 3VXTA 1KT2B 4HU8A 1RURH 1WBZB 3DUHA 2SEBB 3JSSA 2O61B 1TTRA 2VR4A 1T89C 3ALWA 4NP4H 2ZP9A 3PGDB 3RQ3A 4P4RB 1P7KA 5G55A 2AW2A 1VJSA 3GS4A 4D9RE 2FZ3A 2OZ4H 1AYOA 4UIMA 2HJFA 1T0OA 4MD1A 3D8MA 3BKYH 4M7LL 2HKHH 5E8DL 3MRGA 4UAOB 5SWZB 2F58H 3L95A 4X8CA 1ZE3H 3P0GA 2XA8L 3LY6A 1NBVH 4GSUA 4M3KB 2BVQA 5I15L 5IHZB 1MREL 2DQHH 3JWOL 5CBEA 3LRKA 3D4YA 2P49B 1M0MA 2WVVB 4AJWA 1SUHA 3IKKA 1BYOA 4Y4KA 2LLLA 4YDMA 3LN5A 3CFTA 3WHXA 1WVZA 4JANB 4OQTL 3TH4T 3D69A 4RWYH 2OQJB 3KLLA 5GGRB 1ZLUK 4DK6A 2A9NL 2BVYA 5KVFL 3SHSA 1R24B 2N56A 2CO7B 3GSNB 3WXWH 1OSZB 4B7IA 5HGAB 5JW3L 1XF2B 1BQLH 1HH9B 2KDYA 5I30H 3MJ9H 5I6XC 2ARJB 1UUSA 4UM8A 4KDVA 4Y16A 4AZ8A 4WKZA 2VLLA 4WRLA 5B7FA 4XAWL 3IXAB 5DO8A 4HD9A 4WU5A 5I1DB 1ZS8A 3UBHA 3TU6A 25C8L 1X4YA 4KXCA 3ZW3A 2P5EA 1QSFD 1C5BL 4HBQA 4U33A 3ZDXB 3QZWB 4N6HA 4RAUB 5ICYA 2CWRA 4BA0A 1FGVL 4HIJA 3P3UA 1TNNA 1P4BH 3RGVB 1TG8A 4P99A 1IGCH 4A2EA 3LZRA 1BV8A 3OAUH 3I84A 2F95A 1UG9A 3OKOB 2R1YB 4NJAH 4ISVA 4N4YB 3UC0H 4L1HA 3ECVA 2OL3L 5IVZB 1LWJA 4PSPA 2XU9A 3MXWH 4UV7L 2VQTA 4IKNA 4XP5H 3OZLA 3LH2H 3SDYH 4OI8A 1OXYA 3GIZH 1J5DA 1T66D 3CCHB 4XO5A 2DYPD 1UWXH 3C9LA 3TN0A 3IF1B 3B1UA 2EDJA 3BW9A 4FMVA 5GRXG 4EZJA 3VD9A 1UWYA 1DVZA 2IGFH 1T1YB 1JGDA 1H8NA 2NY5L 4XVTH 4Y7MA 5E2VL 3JV5A 1J0ZA 1XXFC 3D39B 3N5AA 4P2OA 3LHPH 4YX2L 1F4ZA 3ZE0F 4OLYH 4ENEC 3QJVB 1W15A 4G80A 1RUQH 3D4ZA 1YG9A 3P11H 5DR5H 3AWEA 1D6VH 3GJEB 4W9KC 4YSOA 2QSVA 3EGSB 5L9DH 5JW4M 2E74C 3UP1A 4LOUC 1PDKB 1TTCA 4LLUA 5D7EA 5DJ2B 2YPLA 4DKAA 2ZQKA 1CDGA 2HKFL 5C3IA 1MGYA 2CR6A 2UZPA 2A99A 2AFNA 3FT0A 2K6WA 3O9WA 5ERWA 5C97A 3HHSA 2WKLA 4KHTL 2AXFA 5IJKC 5DMJB 1SEBA 1E28A 4KK6C 2XQYG 4M1GL 3HMXA 4NUGH 1T03H 1PNDA 5B38B 2BVPA 3JVGA 3AXLA 3B2MA 5IKCB 3SY0B 1A0QL 3DLQR 1XIWC 1B0GA 2ZX9A 4ZUUB 2WNXA 5AVXB 1FNEA 3GXDA 1LEIB 3QFDB 3F5WB 4B3EA 1G7HB 3EHBD 1F6AA 1JZFA 4GNKB 3PY9A 3IPEA 1U8OA 4R2GD 5LLIC 2QBWA 3ZGIA 1I9EA 3ABWA 3NTCH 2VDLH 3ULAB 3QAQA 1PZSA 4APQA 2WYIA 4DZ8A 1CGYA 1D5MB 1K85A 3QEHA 1A9BA 3K6OA 1IV8A 3TC9A 1QZNA 2YGVA 5E7FA 1AZZC 1PFOA 4NM8H 2C7FA 3I50L 1U3HB 4MAZA 4UOW0 2FR4B 1J8KA 1XB6A 4OCWL 1G87A 4XTNA 3AQXA 4NZRL 5BUPA 2DLGA 4G7VH 4R4BA 1EO8H 3DPBB 3V9FA 4AGMA 1AQMA 3GHPA 4OV6F 5TDNA 1BD2D 3LNFA 1JI2A 3TFKC 1C1EH 3MLUH 1A65A 2OZ4A 2EDEA 3EO0B 4TRPH 4YWGL 5GISL 3MRDA 5DJCA 4FCAA 4BFKA 1CD1A 1FNAA 3OB8A 3LKPB 1Y18A 4LVOC 4AIXA 4ZMVA 3P0YH 3VWKD 2LVEA 3ULUL 1I1YA 1SGKA 2HFEB 4IRJC 4BDVB 2WLIA 4GW5A 4PJFE 4B6ZA 4G6FD 2MCAA 4YXHH 4OBSA 5JHAA 5JHBA 1URLA 5IEKB 5J6SA 3TWYA 2D73A 3U4BH 4JRYD 3LPWA 3OVUB 4GG8B 2I9LB 4NQSB 1SY6L 2NX5E 4AXWA 2W0KA 2X7LB 1HNYA 5E6IC 1IQWH 2R1WB 4HHWA 1U8NA 3ARGA 5G54A 1HESA 3D05A 4HZAA 4NDMB 3CZLA 5CUSH 1L7TH 3H2PA 3ETBF 3IRPX 3QUXC 5DQJB 5F6IB 4KFMA 1JZDC 3FQ2A 1BFOB 3OZ9H 4E9SA 5B6XA 3MJ9A 4L29B 1UT1A 1H3VA 4QGTA 4NBYB 2R59A 2OMUB 2DMBA 2WXJA 5IR1A 1EHLH 2B9AA 3G3LA 4UINL 3SCMB 3MDJA 3QUYD 3PFQA 1KG0B 3NH7H 2NOYA 1SHMA 1UKTA 1WK0A 2EQDA 4HQQH 3TBSB 4DW2L 1UWGL 5CLYA 4LSTH 2Y4SA 4UQEA 5FKPA 3QEQB 1FZJB 1CWQA 4GSDL 4E36A 4UT9L 1ZMYA 3QIUB 4QHNA 2QADC 2YJLA 3KHOA 1M57B 5E9AA 1M1XA 2AK4B 5F0LB 2OMXA 4YQXH 3FYEB 4FNSA 1UXSA 1YYCA 1KBGL 2Z34A 1WWAX 1IGTA 3KXFA 3K3QA 1AZRA 1EDYA 4ZAKC 4K23H 4N25A 3PL6C 4P4KA 1WC7A 4HX1A 2BVUA 3UXFA 4LFHD 1HHJA 2BMKA 2XKNB 1DLFL 4JRXB 3MACH 3IDGB 3CHSA 3DO3A 5GRYA 1MLCA 3BFQG 3MV8E 3ET9F 4HH9A 4KV5F 1WFJA 4JFOB 5TE6L 5GRWA 4P2QD 3ZDZB 4AVKA 4H4NA 4ZS7L 1SJEB 1KBVA 1OGAE 3GDBA 3KPRD 4EJ4A 1PZCA 5C0CA 2NY3C 3P0VL 4GMSH 3IS0X 1AS7A 2G5BB 2JNZA 5FECB 5H2PA 2KQNA 3H55A 3M6DA 4LLQB 4AC4A 2GJZB 4JFDD 2VDKL 1IGIL 2DQIL 4NO5B 3G04A 1INQB 1TQBC 4Y0GA 3AU0A 3RIFF 2DQMA 3STLA 1WUZA 2F9BT 4JG0L 3EF7A 4NQCD 1HEZB 1P4IL 2ED8A 1TVBA 2WXMA 3BKCL 5DZJA 5AYUH 1AP2A 3WEXB 7FABH 1IC1A 3DKHA 4RQQA 1SMDA 2X53A 3SE9H 4KRPB 4Y5YA 4E41A 1AJ7L 4XT1A 2AKRB 5TF1L 1G0DA 1NFIA 2V2WB 5DXWA 3EYVA 4WY7H 3ESUF 4MSWB 3X11B 4BGDA 1HSAB 3WUWA 4XNZC 1BEYL 4WK2B 4LPWA 5F7UA 1E4WL 5ECJE 5B1JC 5F3FA 1CMOA 4JFUA 4LPUA 3WY4A 2XBDA 2H1PL 1UEYA 4QRTA 1MHPH 3X3BA 2R7EB 1YJDL 2VLJB 1ZXQA 3DRQB 3JWNG 4XCEB 1T7WA 4BGLA 4HSQA 2ROXA 1U8JB 3RX9A 4ODXA 2XKSA 4PJ5A 4YUEH 3NIDB 3UO8B 2JVUA 2ORBL 3RY6A 4B9PA 2CBTA 5CJOH 5KUKA 4GAYA 3UTTD 3RTQC 3FQ1A 3MNDA 4AQ8C 1CBVH 3HZMA 1W8NA 3CLWA 1SPDA 2W65A 2QZ5A 3Q2NA 1WE5A 5FHBH 1ZLWK 2BW5A 4R3SB 2EIZB 2YAQA 4PBWD 2VZ3A 3EFOB 3QPQD 5C0ND 3K6IA 3AGVA 2NYZA 1W8OA 1J1PL 1A4JB 1F4XL 1HI6A 2CLZB 3HG3A 4MD5A 4G6AD 4C57C 1IKNC 1HIML 1I9IH 3VGDA 5E2TL 1EJFA 4OF3A 2VDOL 1XWVA 4PJ9A 1HCFX 2CJUL 4Y1AB 3DX1A 1U8IB 1Y6MR 4AX3A 4YSDA 3GM0A 3HMXL 1R5WA 5E8PB 4ZMAT 4L8SC 5KSAB 1A2YB 3D2UA 2PXYA 4ZPVB 3JTTB 4K7PH 2D0HA 2NNFA 3DI2B 3H7BB 2Z65C 1GIGH 2KZ1B 4G8FB 5D7HA 1J8HA 3U48A 2P8MB 4IIQC 3RAJL 3MYJA 1DN2A 3W81A 3O3DA 2BERA 2GPZA 3G6JF 2D3NA 1EAPA 5I9QB 4BKLA 3FB7B 4BEYA 5E1IA 4JFYA 2MPVA 4WHTB 2D9CA 2ZXGA 3D4GA 5EWIH 1V7NH 4KJQD 1WEJH 4JG1H 4JM0A 3IGAA 6PAZA 3SJVB 1Q5IA 5JHMA 1X5LA 1K3IA 2R4SH 4HJSA 3NS0A 5F9OL 1J10A 2EE0A 3NJFA 3SEPA 1RURL 3UAAA 2BZCA 1HTYA 4H2CA 3WCYA 1S3RA 4NP4L 3GMNB 3SSGA 1I85A 3KYAA 4JO1H 4XNXL 1JFQH 4KVCH 4Q89A 4ZQTA 2OZ4L 1JZHA 2FJHA 3FQNB 5JZ7C 1SRDA 3O6FA 3P2DA 3BKYL 3FCTB 2HKHL 2O6DA 4NAMA 5MP6H 4YL9A 1VGEL 2F58L 2W94A 1KLGB 5D2NB 1CVRA 4IOSA 4QKTA 5H94A 3N40P 5JA9A 1WT5C 4K8RL 2YGQA 5HYQB 4PJXF 2YA1A 4UCFA 1QFPA 3W11D 2CGRH 4TS6A 4XP1H 1KY6A 4F33A 5CN2A 5IB2B 1DZ0A 4KZDH 4NERA 1TCRB 1MFEH 4K5NA 5CEXA 5ITBH 3AGWA 3MRMB 3DSNB 4RWYL 4R4ND 4WI3A 1UUNA 4N2IA 4YHPA 4JZNA 3VU2A 2J5WA 3VD5A 3GPSA 5ENWA 2CDFB 3CXFA 3BXNA 2Z35B 3WXWL 1H0DA 3EDFA 4I0PB 2IH1A 4NI6A 3RB5A 2BCMA 3VH8G 3ELAT 4PJEA 5J7AA 3ML8A 5I30L 5TD4A 4D9QD 2VERN 1KCRL 2ZONA 4L9LC 1DUZA 5I23A 3VFPB 3RUGB 1QTYT 4M61B 1JNHB 4NN6B 4Z0XA 3BPLB 3UFIA 4ES8A 3CX5J 4LLYA 1B6UA 4KQ3L 3CFDA 4L4TA 5HTSA 3ARTA 4CW1B 3DGGB 2ITFA 5IW6B 3NJHA 2VZTA 3FUEA 5CU9A 1FN4B 2XZZA 3VI4E 3ZYJA 1P4BL 3PWPB 1E5ZA 2Y5TA 1ROCA 1IGCL 3PJNA 3LMJH 2DF3A 2K7PA 3BUTA 3QQ3B 4HP5A 4MNGA 1NUDA 3OAUL 2F8XC 3HG1A 1T0NB 1WA0X 2OM5A 4NJAL 3WS3B 1EFXA 3A0OA 5IF0B 3UEQA 1Q94A 3FDWA 1NC2B 1MFVA 3MXWL 3QUZA 4PJHA 3TA3B 5H4ZA 1Q8MA 1YA5A 3EG9A 3LH2L 3SDYL 1ES0B 1KDJA 1YEWA 4LSPL 2LU3A 1KIRB 5AVZB 5J57B 3NZUA 1SVZA 4G7QB 2Z7UA 3HKZA 2ZX5A 3P3YA 1OGSA 2V8MA 3SQOH 1HHIA 2AXJA 4A68A 5T3ZD 4HIIB 4DGIL 4XVTL 3T1FA 3NN8A 4UQIM 2A74B 5C0AA 3EH1A 4G8EB 4OLYL 1JV5A 1RUQL 1CL7L 3RVXC 3B1TA 3I9IA 4MD2A 4DFIA 3P11L 3QORC 5B39A 4P2OD 4IOIA 1I1AB 4HIHB 1ZA3B 2HT4D 5DR5L 2WNGA 4U2ZA 1N8ZB 1D6VL 3QG6A 1MFNA 5I0ZA 4AITA 5L9DL 1IL1B 2AV1B 4FF9A 2EEBA 4QI1A 2HX9A 3MO1A 4LHUA 3GLZA 5EBMA 4F8PA 5LGJB 2QMKA 2FGWL 2OW7A 3FZUC 5AVSB 2XYCA 3LQZA 4XNMB 3GSOB 5HHOA 4JFEA 1QRND 2IQAB 5INCA 5J9PA 3SPGA 4UZSA 3N41F 4NUGL 4PP2A 5I73B 1T03L 4PP1D 3DX8B 2J72A 4OFDA 4JL1A 2WCSA 1AD9A 35C8H 5SV3A 3V55A 5E03A 1AXTH 3Q3GB 2OCFD 4B96A 1UYWH 5I0YA 2X4UA 3PV6A 4BWUA 5I74C 4N8CH 1ZANL 1KY7A 3UERA 4M5TA 5EUOB 4MJ4A 4RFNB 3B2DC 2E8ZA 3NTCL 2VDLL 4G6ML 4JVPA 2FX7H 1G0XA 4WGWB 3OKMA 2ADGB 1H15A 1X5AA 1KPUB 5AEAA 4NM8L 3ARFC 3CSYA 3MBXH 3WELA 2WV3A 3VXMA 2EIBA 2AMGA 4KZCA 2B8OT 4MYPA 2R4SA 3CHOA 5CBAB 2XSKA 2LR4A 2JI2A 1R2NA 4G7VL 5AWZA 4XHJD 3T2OA 4A63A 5AD0A 2D2OA 1SOXA 4AIZB 1IGYA 3LZLA 5BXFB 1HYSD 5J1TC 4TULL 2AC0A 2HJLB 4YH6A 1C1EL 3MLUL 4I85A 4TRPL 2BOBA 4ALAH 2DKUA 4DIXA 1XSKA 2W9EH 3RWHB 3P9LB 4ZXBA 1H6TA 5AB9A 3FH5A 1WFOA 2I07A 4GRLB 4NENB 1I7UB 2ZCKH 1VKXB 3FUNA 4BK8A 4YXHL 5D1QD 4IBWA 2WQRA 3DBXB 3IFPA 4UDUB 1L9OA 4PV9A 3U4BL 3V0GA 4LSSH 4NFDA 2TAAA 2Q8AH 4I4WA 1OM3H 1RV6X 1SQMA 1HINH 1XGYH 3QDJA 1IQWL 5DHHA 3MHZA 3HC2A 2RH1A 5CUSL 3ZX1A 4O4YH 3GRWH 4HG4J 3M1CA 5E9DA 3ZHDA 1MCFA 4RWHA 1KIQA 3ARGD 3DVNB 3NSFA 5DJ8A 2Q6WB 1OD7A 5GS0H 2F68X 1CICD 4P49A 1HOEA 5ABZA 4IEFA 4D8PB 3OR7B 3QHZH 2DH2A 4U6VL 2D7MA 5E1AB 3V0HA 1CDJA 3FSWA 3FXIC 1EHLL 5F89A 4AM0Q 3L8QA 3QT2A 1S51A 1GC1C 2AK1H 3ZE2B 5JIQA 2BC4B 5EORH 1A66A 3NH7L 3RL1B 4HQQL 1QFOA 1JNLL 2BNRB 2OX5A 2HN7B 1R3KB 3L3IA 4KI5E 1FH5H 4LSTL 1S7UB 4GP4B 2ICCA 2H2SD 4O2CA 1XJIA 5EU6B 3VM5A 1NANH 2YIHA 3OKNA 2ZKYA 3T4AB 1P1VA 1BIIA 3TJHD 1KGUA 3BYTA 2RR3A 2G0LA 3IDMA 3O8XC 4NRXB 1J12A 2R83A 4Z7UF 4ZO6A 3KPQA 1MCOL 1L6PA 2GSGA 1MFCH 3DVFA 4NN5C 2NLJA 3LRLA 2EUWA 4RLDA 4HF5H 3RB7A 3GSWA 4K23L 3DIFA 2NY0B 4X4KA 1TU2A 3E6FB 4Z7NB 1OF2B 3BT2H 3SDDA 4EXKA 4K7FA 3MACL 2WQSA 1UKSA 4QOKE 5I18L 4NNYB 3PV7A 3ZEVA 1AKJA 2AJUH 2CD0A 2K0RA 1DQIA 3HB3C 1HCZA 3IDNB 4PXKA 1QKPA 4L1SA 4LCWE 5GGSA 2VR8A 4JGMA 1AKPA 1EZVX 3QDCA 4G1MB 4L0ZA 2ZXWB 3K72B 4JM2D 2FYYB 4MNHA 1XF4B 2AJSH 1T7VA 2IGTA 4YPGA 5IIEB 4GMSL 1XIWB 1IAII 2BSDA 3MV9B 5ES4B 3QIBD 3HLAB 4O58H 4XXDA 4YAQA 3V2AR 4F9PA 1AANA 2OFQA 1YNKH 4RGNE 5MEPB 2UUDK 5EEXA 5C0CD 1Y0LB 1FYTA 5HHMD 4HK3N 2UXVA 1OWWA 5CFHA 1UXMA 1KFGA 1M56B 1QR1B 2K8QA 2R69H 3VXQB 4GRWF 3ROOB 4KOCA 3QH3B 5T33H 1U19A 3SKJH 4PJGF 1KCWA 2MNJB 3G5YB 1FZKB 1Z5LA 1OP5H 3SE9L 1AO7D 3ME0A 4KNUA 2K3HA 3IDXH 4UIKH 3UYPB 3L3GA 1MAKA 1GYCA 3T8XA 4WY7L 3G9VA 1T3FA 3GSVA 2G4GA 1G1OA 4Q6IA 5EZOH 2EUXA 5ID1B 1Q9OA 1UOKA 3WLBA 3INOA 3IU3A 2PYEB 3PABA 2X70A 4JQIH 4ZW7A 1L7IH 4ZUVB 1I1FB 1JYNA 1CQYA 1MHPL 1VIWA 1VF5C 1AC6A 4MNQD 3WAJA 1RFDL 3EMLA 1AE6L 4KI5C 1MCWM 2KPNA 3D3VA 4YUEL 3QRLA 2CIIA 3OL2A 1PYWB 5A7BA 1K5NB 1YEHH 2ADFH 3G6AB 3TBVA 1RZQA 5CJOL 2KZWA 4MJIB 4J3OF 4PJ5D 1R3HA 1S78C 4F93B 3E8UH 1THCA 4CVXA 1DUYB 1CBVL 3HAEH 3FUFA 3APFA 3V4PB 4KH2A 1T7ZA 5FF6A 5JIIA 1MFAH 4K9JA 4C4UA 4AW7A 4I87A 3C87A 3IJSB 3OC8A 1RIUH 3H6JA 3WIAA 2I21A 1FPTH 1YYMH 3AQDA 3QUXB 1NCDH 1PKQA 1QNZH 3CSBA 4OI7A 2ZSWB 1JV2B 3NEEA 2Y02A 3HUJB 3OHXC 5DYOA 1TN0A 4XR8C 4KRNA 3ATFA 4PJAE 4MMZB 3RDTD 5D96C 3WJJC 1EK3A 5C9JA 3SKMA 1I9IL 4R7VA 4AG4H 4Q9CA 4NZTH 3U46A 5HVHC 2GTWB 3OE8A 3GRWA 3HC4H 4HIXH 3U82B 2YN3A 3S5LA 3UTPD 5D6DA 2KL6A 4YZFE 3BAXA 3MMEB 4AZUA 4DP9X 1VFBB 3P3SA 2NY2D 3ULSA 2IFGA 3Q1SH 1GIGL 2G2PA 4LK4A 1VFOA 1YDPB 3PXHA 5ADOL 3BN9C 2IOIA 1E40A 1TZOA 2VR3A 4WNQA 2YFOA 4M29A 2H3NA 1HZKA 5FCSH 5FUCE 3L1OH 3QFGA 4XMXA 1K4DA 1ACXA 3D18A 2E76C 1FZOA 3PL6B 4G43B 1ECYA 3IDUA 1L0XA 4X7TB 5EWIL 1LO0L 3AQYA 5AAPA 4OZIA 1YN6A 1V7NL 3GIVA 3IGKA 1OQXA 1WEJL 5LGYA 5ICZB 4JG1L 4PJIA 4WJ5A 2X4NB 4XX1E 5KVGL 5A45A 2R4SL 3VFOA 3UAJC 5A40E 4NKOA 3P30L 4AQOA 4IBQA 2E5EA 3VFWB 1IBYA 3EO1A 4KVCL 4Y9GA 1P5UC 4MAYA 4WO4B 4L1DA 4GG6A 5MP6L 2JKIS 3K4DA 3VWJA 3EJPA 3U4AA 5DEGA 3AQZA 3DO7A 1XEDA 3C9NA 1G5GA 4XPAL 1TQBB 4YHZH 2R2EA 1J5IA 1AYRA 1RL1A 1NPJA 2NY7H 3I3DA 4R97C 4XP1L 2KYIA 2EABA 3UBXB 2XPGB 2BPBA 4KZDL 4ODSL 3GPEA 1JWMB 5ITBL 1KGWA 4IOFC 3EH5B 3GGWA 1UWEL 5TGBA 1DZBA 1VGOA 3DYMA 5B3JE 5ANMB 4AJYV 5JORB 5E6UB 2Y07H 4FJ6A 3QHTC 4ABUA 2M2DA 4XXCA 1QKOA 3BEVB 3IU4H 2LVCA 3QE5A 2FEDC 2W91A 3CHXA 5C07B 2R69A 4LIQH 1HS6A 2NNRA 2CNZA 1VEPA 5BMFH 3I6KB 4MQ7A 1WZ1H 2HWZH 1EEYB 3MNMA 4FXLA 5FWRA 2VN6A 4GLRH 3SDXE 3STBA 4M93C 4ZNEE 5IHHA 2JKLA 1QI3A 3MUJA 2H26A 2P5WA 3QQ9C 3C75A 3FNKA 4PU2A 4DVRH 3AREA 3H9SD 4WF7A 4JQ6A 1IB5A 2NY6C 4BM7A 5GS2H 2DBLH 3LMJL 3RTQB 3VFNA 4G82A 3Q2CA 1W0VB 1MF2H 2X6MA 4OCYH 3WO3B 4JQIA 1PBYA 3J2PA 5GRZA 2KLSA 5GXBB 1BZ9A 4JPQA 2QMJA 2HLFD 5AVVB 1BQUA 3D0VA 3CQQA 5FUCC 4LKCB 4R8WH 3RE0A 4YXKH 1ONQA 3BQUC 1WITA 1EEUA 3UYOD 1IEAB 4BFIB 5K9JH 2X6UA 3SQOL 3HAEA 3JT2A 3RZCC 3L3HA 4ONFH 5SWZD 2X1WL 2B4CC 3D30A 4PREA 5DZNA 4WW3A 1KPVA 4ZODA 5EFIA 4G71B 3QA3B 4YVNA 1E4KC 5EIVA 4PJ7E 3JV6A 2NR6A 3EJQA 4IK7A 1QEWB 1KCSH 4TV3A 3U36B 2WBJA 5EZPA 2DH3A 4NHUB 1SLXA 5EIIB 4WFGE 3O6MH 4JBSA 1OT1A 1PS3A 3P02A 2Q1EA 4HFWB 2EE2A 4MCYA 3RPKA 1BZ8A 5J5EA 2YPLE 3ORJA 5F71A 2EZ0C 4H20H 4JFED 1T5KA 4F8NA 35C8L 1AD0B 3MJGX 4LPYA 3WD5H 3MGOB 1BVLB 5BNXD 2CJSA 5I1LA 1UYWL 4UV4H 2FL5A 2PWDA 4IU3B 1KPRA 4FXKC 2V3FA 3MBWB 2PPFA 3FFCD 1OHQA 5F72S 3ZYIA 2EUZA 4KH9A 5CZKA 2E7MA 2FX7L 3NPZB 2KQMA 4JZOA 2F1BA 3RGVD 3KLDA 5DMKB 1N18A 2XTSA 5K5YA 3ABGA 1BVOA 3RNKA 2DZEA 5DHXB 2WD0A 1MWAA 2BP3A 4FNLH 2KKQA 4OZHA 5E2JA 3UTZA 1MJ8H 5LNGA 1C12A 2YQ3A 2GCYA 4ACPA 3IWUA 3APMA 3NJVA 2DMKA 4IMKC 1FCGA 4AW4A 2ICEC 5IZ7A 4ZTEA 5CJXA 4HMCA 1SYSB 1FWXA 2DYRB 2GABA 2WWNA 3L54A 4G8GD 3WJLA 4Z7WF 1LE9A 2P5PA 1CUOA 1JNJA 1HZHL 3OAYK 4FEIA 3TVMC