4N4YB

Structure of recombinant cytochrome ba3 oxidase mutant g232v from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant G232V from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4yB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4n4yB02
4GP5B 5DHHA 4E9QA 4BK5C 2PPAA 2ZOOA 2UXFA 5B7EA 1NICA 1SFDA 2OV0A 5G2CA 5AZDA 2E86A 4GBRA 4GP4B 4BEYA 1S54A 1KCWA 4WW3A 1P8UA 3QBKA 4XXJA 2Q5BA 2X88A 4YSTA 5A8EA 2R7EB 3PPSA 1L9SA 5G54A 5H2JA 1E30A 1XB8A 1IBYA 3EHBB 1MG2C 3QBLA 2EILB 3FPXA 2FJSA 1E0PA 3JT2A 2F93A 5EN0A 3FQYA 2J56A 3FS9A 7PAZA 1OOWA 4KO9A 3AYNA 1ET7A 3ABLB 1JXDA 3QAKA 1R1CA 2YAPA 2PLTA 2HX8A 3KW8A 2YCYA 1PY6A 5D4IA 3AW5A 4E9XA 2VSMB 1R84A 1CYXA 4PXFA 5JJJA 1JZEA 2DWSA 1QHJA 3NYKA 1JXFA 2BP8B 2EINB 2F95A 1S8LA 4QRYA 1PZBA 1AG6A 3FU8A 4CSZA 4NC3A 3FSAA 1PXSA 1CWQA 4G7RB 1IBZA 1L9QA 1F88A 1QHQA 3TBBA 3ZPQA 1J5DA 2CCWA 2LLNA 4KNTA 1P8IA 3QJTB 3IN2A 1L9HA 3HAQA 4G7SB 4TL3A 4IARA 1F4ZA 1GS7A 1MG3C 2I7SA 1BRRA 9PCYA 3NJMA 1NINA 3CVBA 2G87A 1PY0A 1GU8A 1XB3A 2IWKA 4YSQA 1PLBA 3T6XA 2AVFA 1V55B 1ASQA 2A3TA 4DKLA 4IB4A 4X1HA 2YXWA 4PCYA 2IAAC 3OAXA 2CUAA 2I7OA 4L6RA 3AM6A 4WAVA 3ASOB 3C9MA 2FQEA 2FT8A 3SBPA 3QAPA 1NPJA 2XLLA 4JHUA 1SHXA 3CODA 2YCXA 1QM8A 4XTOA 5PCYA 8PAZA 1UATA 1JZFA 4BV0A 4TXVB 5H2MA 2HPYA 3OMAB 1NWOA 3WKPA 3KW7A 2KSYA 3FSVA 4HCIA 1VLXA 3AG2B 4YSRA 1OE3A 2B08A 5G2AA 5B6XA 4UAHA 3TBCA 3NJGA 4DP5X 2HX9A 2AZUA 3QBIA 1GR7A 1MZZA 2GI0A 4L35A 1QLEB 3V2WA 2KS9A 5BR5A 2R4RA 2Y02A 1NZRA 1DYZA 2Y69B 4LDEA 1GW0A 3T6ZA 2VN3A 4YSEA 4YVUA 3HAPA 2ZWNA 4K5YA 3ZDWA 3FQ1A 1NIEA 1AS8A 1ILSA 1I53A 3AG3B 3PLYA 3SBRA 1CC3A 2QPEB 3UTXA 1V54B 1AOZA 2PP9A 1AT9A 2OCCB 3NJKA 3IEAA 2P80A 1AACA 1F56A 4YL4A 3UAAA 2GB2A 2UX6A 5F7BA 3WNIA 4UANA 2IDQA 1A4CA 2WO3B 1TKWA 1H68A 1URIA 4WKXA 1PMYA 4E9VA 5AHZA 1ILUA 3EH5B 3X1GA 2BRDA 2X72A 1SNRA 1TEFA 1WS7A 2IDFA 3OE6A 5DYSA 1FBKA 1X9RA 2FNWA 5B6VA 2YAMA 5B1JC 1JVOA 5B1JA 4BWBA 1X9UA 3NJIA 3SN6R 2HX7A 4KNUA 4A68A 1BQKA 4QIDA 3CDZA 4KO7A 3NSBA 1JV7A 4FAAB 3X3BA 5AKRA 4YSDA 3HASA 1AZUA 5B2NA 3BQVA 2IDUA 1OE2A 2ZFEA 3TU6A 5DHGA 4GRVA 1XIOA 1PF3A 1MDAA 1KMEA 4MD1A 1AANA 5I6NA 3CZUB 1CYWA 2J55A 5AWZA 5I6MA 1JV6A 4HCGA 2DYRB 2JAFA 3CAPA 1SF3A 3SQRA 5H2NA 1WS8A 4DPBX 1ET5A 2QDWA 3IBOA 4F7KA 5B7MA 2VW4A 3FU7A 2OJ1A 3UTWA 1GS6X 3T6VA 3T45A 1L9OA 1GUEA 5ITCA 3NSDA 4EF3A 2FWLB 3RYMA 3WNJA 1J5CA 1WA2X 3NJHA 5H2KA 2XV2A 2N0MA 3PCYA 4K9JA 3IN0A 5G2DA 3ZEVA 3RZEA 4W9ZA 1E5ZA 1LN6A 2VM3A 1KBWA 4JKNA 2ZZLA 4G7QB 4KOCA 1AZNA 3TASA 3ZX1A 3HAOA 4BEZA 1NTDA 1SJMA 2XV0A 1N70A 3QPKA 3N55A 2BP0A 1J9TA 5ITEA 3OQRA 2FT6A 3UG9A 1XJIA 1NIDA 1JGJA 1A8ZA 2XXGA 4HZ1A 1GZMA 3WKQA 1HFUA 5H2PA 4DP1X 4BXVA 3QJUB 5H2HA 3OM3B 3PXLA 3GYRA 3QJRB 5H2OA 3AZUA 3FU9A 2YARA 2GHZA 3NP3A 5TK2A 2M3GA 2FTAA 1BYPA 1JOIA 3GDCA 4FPDA 2Y00A 4AMJA 1L9RA 1NDTA 3NJJA 5B0WA 5AX0A 1OCZB 4KNSA 4BDVA 1Q5JA 4Q8BA 2BWIA 5I5MA 3DKHA 4RH4A 1KG8A 1J9SA 3VW7A 3MBVA 4HWLA 6PCYA 1PCSA 1AS7A 3REYA 5D4HA 1BEXA 4AZUA 2I21A 5B6WA 3QJQB 1IXFA 4LDOA 4MD2A 2TSAA 2PPDA 3C75A 1A4BA 4FBZA 2VMJA 3HB3B 1PLAA 3UACA 4CSPA 5IY5B 1AP9A 3S3CB 1E12A 3BVDB 4YSPA 1IUZA 3P0GA 3S8GB 4AMIA 3ABMB 2IWFA 2L6XA 2IDTA 2NTUA 4X32A 3RFMA 5B35A 5BR2A 2MRYA 4JHVA 3C9LA 5FC9A 1JERA 1F50A 2WJKA 2YAHA 2AT9A 5I6OA 3FYEB 1BXUA 1CURA 4M4RB 2IDSA 3FYIB 3OMIB 1KBVA 4N4WA 2J4YA 3PAUA 3NJNA 1BRXA 3GXUB 3T71A 1VGOA 4NB7A 5PAZA 1ID2A 2YAFA 4GPOA 1EHKB 2YXVA 5AZUA 5B1BB 3ZPRA 2XXFA 2XX0A 1W6LA 4YSSA 2QT6A 1NIAA 3NT0A 4HYJA 4AKPA 1TN5A 2DYSB 3MX0B 3CDZB 4HHWA 4UG2A 1GS8A 2VT4A 2HXAA 4KO5A 2CALA 1JZIA 1BAWA 2Y01A 4G72B 1OE1A 1DZEA 3NYAA 1AZBA 3V9CA 1M0LA 4L0PB 4A67A 2EIJB 4MFHA 2P80D 1OF0A 4E9WA 2VW6A 3QBGA 4E9TA 1PAZA 3PXOA 2W88A 1JZHA 2HRHA 4HYXA 4BVNA 3VVKA 1AR1B 1AZRA 4A2DA 1HAUA 4DP7X 3T9WA 3G5WA 1KDJA 2PCYA 3MBWB 3S3BB 3V9EA 4MQTA 4QKTA 1WA0X 5B6ZA 3AYMA 1E67A 5I28A 1IW6A 3FU7B 2BHFA 2DWTA 2BWDA 3EH4B 3UTYA 3UZCA 4A2HA 2J5WA 1KCBA 3WI9A 3EH3B 3ERXA 3H4HA 2R4SA 3HANA 2W8CA 1M9WA 1ZIBA 1NIBA 3COCA 3ABWA 5D4JA 5JJNA 3OMNB 2YCZA 2RACA 3NSYA 2QDVA 2JXMA 1OCCB 2JAGA 5B1KA 4FA7B 5TGZA 1SDDA 1T5KA 2BO0A 2BP0B 4A4MA 5AFAA 4KOBA 1ASOA 2WO2B 5JJEA 3CVCA 3X1FA 2NRDA 2AANA 2GIMA 4DPAX 4XTNA 2FQDA 2H5UA 3WG7B 2UX7A 4EIYA 1JFPA 4JQ6A 2PPFA 1WA1X 4UF7C 4DP4X 1JZGA 3UABA 4GY4A 4EJ4A 4NERA 5AHYA 1P8HA 2H3XC 1BXAA 2H47C 6PAZA 3JTBA 1PNCA 3UADA 2UXTA 4BDVB 4DP2X 4YSCA 3WQJA 2TSBA 1IKOP 3CVDA 2I35A 5I26A 2XVBA 3D4SA 3NJFA 2HRGA 3X3CA 2XYBA 4WTQA 4AX3A 7PCYA 1W6WA 1BQRA 2IWEA 3AG4B 2BW5A 1RCYA 1DZ0A 1RZPA 4E9YA 3QQXA 2Y1AA 5G28A 2CAKA 1L0MA 1S52A 4W1TA 3VI0A 1A3ZA 5G53A 2KSAA 2EIMB 1MGYA 4HHGA 3FSZA 3H4FA 2ZXWB 3FT0A 2Z73A 2XX1A 2GC4C 2Q9OA 3KJ6A 1A4AA 3DDLA 3TA4D 5B3SB 5AX1A 4HAKA 5KKHA 2UXGA 1UCQA 1NWPA 2Z55A 3IE9A 4YSAA 3NS0A 1KDIA 3PAVA 3N2JA 2YDVA 1YLBB 4BWTA 4GYBA 1E65A 2UXVA 1VJMA 3UTVA 3H56A 1ZIAA 1PXRA 4HIPA 4DP8X 4BWWA 1BXVA 2YAOA 3ASNB 3SBQA 4AI7A 4AKQA 4XT3A 3QJSB 1B3IA 2PP7A 5H2LA 3HARA 1AIZA 1FWXA 4NAJA 3WIAA 4A66A 4JKVA 1M0MA 2Y03A 5ANHA 3QJVB 3EMLA 4YSUA 4DPCX 5A44A 1TEGA 3AG1B 4P5SA 4F2FA 2Y04A 3VHZA 3PDSA 2I85A 4JR8A 4A2EA 5A7EA 5H2IA 3UGEA 5I5IA 5I6KA 2I1XA 5I5JA 2BZ7A 3OE8A 1BQ5A 1KYAA 2J57A 5ETZA 1PNDA 2YQBA 2FQGA 2JFCA 3HEIB 3X1NA 1TN0A 4E9RA 1TU2A 4EA3A 3EF4A 5E9NA 5I6LA 4ZK8A 3NY8A 2YAEA 4BXSV 1BM1A 1H2SA 1XMEB 4XT1A 3NY9A 4IAQA 3NSFA 2DY2A 3OD3A 1N68A 2EIKB 2XU9A 1GSKA 5B6YA 5FJGA 1S8JA 5LWEA 1KGYE 1QKPA 1OV8A 3PBLA 1X0I1 1SF5A 1S53A 3NJLA 2R7EA 2VW7A 1ZPUA 4HALA 2YCWA 1HAWA 2AFNA 2WJLA 3U25A 1RKRA 3D12B 3A7KA 2I20A 4GXFA 5I6PA 3S3DB 3UAEA 4E9SA 3ZBMA 1GY1A 4GP8B 1V10A 2PP8A 2YAQA 3DQBA 1JZJA 1C8RA 4F2EA 1OCOB 1ZV2A 4KO6A 4YVNA 4PXKA 1E5YA 1W8EA 1J9QA 2ZONA 4P5RA 1JXGA 3T6WA 1IW9A 4MQSA 1M0KA 1J9RA 1NIFA 4KLYA 1SHWA 1BYOA 1GYCA 1SDDB 4BUOA 2FQFA 4MBSA 4N8UA 3PQRA 5EHFA 2BW4A 2XWZA 2DV6A 1X0SA 2BP8A 2IH9A 4A2FA 1KV7A 2WSDA 4QI1A 3UONA 4DP6X 4HCFA 3OE9A 1Q5IA 3QDCA 1RZQA 3VGAA 1AZCA 1NPNA 2B3IA 2HZHA 2X87A 2YDOA 2KSBA 2GC7C 1AS6A 2PEDA 1ZDQA 2EI4A 1PZCA 3OE0A 4J4QA 3L45A 3X1EA 5G36A 2BZCA 3ABKB 5J7AA 1S51A 2MTAA 4DP0X 4DP9X 4OV0A 1A65A 1MZYA 1PZAA 2PCFA 3UZAA 1CUOA 1M56B 1M57B 2ZIYA 1AAJA 4A2GA 1FA4A 2IH8A 2LNLA 1KG9A 4Y9HA 2XUWA 1U19A 4DJHA 2NTWA 3FSWA 5B7FA 5TK4A 1GY2A 1FBBA 2XV3A 5LDUA 1AG0A 3PAZA 4KNFA 4LDLA 2GBAA 1HZXA 2CBPA 1ETJA 1SFHA 2JKWA 2PPCA 3NP4A 4M3HA 2FT7A 3ABGA 4N6HA 5A45A 3NSCA 1C8SA 5F8UA 3VG9A 1WAEA 2QPDB 4GYCA 4N4YB 5C1MA 1EZLA 4X4KA 4Q89A 2GSMB 3CG8A 3X1BA 2AZAA 2RH1A 3PWHA 1O0AA 1L9PA 1ET8A 1ZDSA 3FPYA 3X2QB 4XTLA 1ADWA 1AQ8A 1BRDA 1UAZA 3S8FB 4AKOA 1QKOA 1ASPA 4G70B 1JVLA 4QLWA 3AY2A 3ODUA 1KGBA 1R2NA 1OCRB 3DIVA 1L9TA 2CJ3A 4PAZA 3ZIYA 5B34A 4UHRA 1IC0A 5B1AB 2PPEA 4BWUA 1XB6A 1X0K1 2VSKB 1QNIA 2VM4A 4X31A 3FQ2A 3V2YA 1C3WA 2HLEB 5F7AA 3DTUB 4DAJA 4ENZA 1FFTB 4YSOA 1PLCA 4G71B
chains in the Genus database with same CATH superfamily
2NX5A 4Y4KA 12E8H 4NHUA 2QVKA 5FO7B 4FLOA 3J2PA 4DGYH 3WTWA 3L6FA 3ZPDA 1TJIH 1RZ8A 5CWSB 2X12A 3IB4A 5DJ8A 2HRPL 3VI3E 1XF5B 2YD3A 2OPCA 4GBXB 1INEH 3QVAA 4NUMA 5EO9A 4F93B 1B2WH 2N0KA 2Q76B 2XTSA 4C56B 2MMXA 4XMLL 3ZKSD 3BDYL 2VLMD 1E30A 3FTGA 4GXUN 4XE5B 3O8XA 3I74A 3ZGIA 3IAQA 4X6BA 2CHXA 1PSKH 3RFRA 4E68A 2J56A 3LRSA 4UQ2A 1I9IL 5EIIB 3QHFH 5FYLE 3SKOB 3GI9H 4WU5A 1JXDA 4ELKA 1F6LL 3MOAH 5BZWB 4AM0Q 2R29H 3DV6A 2L4OA 1U4EA 4TQPA 5E5UB 4TVSa 4OAWB 4HSQA 2CDEB 3QJZA 1YNLH 4TTGA 4NZUL 3WJJC 4WHTB 1PJWA 3CFKB 4OCYH 2ERJB 1CE6A 1CT8B 1PZBA 4G82A 1I7UB 2E9BA 2WBJD 4DGIH 5C6PB 1CWQA 1PD0A 1RK1B 5FW6A 3QEUB 3ZPQA 5DLLA 1HHHA 3VU2A 3L54A 2XWXA 3A67H 4G42B 3KWWA 1YEWA 3U0PB 1BOGB 4ABWA 2UYLA 2ZG1A 1E4XI 1OTUD 3NIDF 4ZMYA 4JDZA 2HVBA 2HT4C 1PLBA 2OI9C 1E6JL 4JRYE 1AJ7H 2H26B 1S78D 2BSRA 2KZKA 3RY4A 1HH6A 3B43A 3DHMA 4JO4L 4R2GD 4LP5A 4GIOA 5BQDA 4BZ2H 4KUZL 4PCYA 1TQCC 2ZCKL 3WS3B 4XHJD 4YE4L 4ZTPH 3BWSA 1DL7H 1N26A 3SBPA 1HHKA 2Q20A 1Q1JL 5E6YA 3CH1A 1HXMA 3BYYA 4OCWH 4JFVA 2KPNA 4YLBA 4JO3H 2X6VA 4W9DC 3W38A 1LNUB 4WFFD 2B08A 2IOIA 2ZICA 3KM2A 1CFNB 3MLVH 3QPXL 1IBHA 3EUUA 3S96A 5BR5A 2JNZA 5KSUB 1NGZB 4GO8A 4QRQA 3G9VA 5G55A 4YS4A 3WU1A 4IDLA 5C08A 5FHBH 1T3FA 1CC3A 4HUCA 1LEKB 4WW2A 4DGWC 2A6JA 3MUGB 3EG9A 5LJYH 2GIYA 1WHPA 2Z91B 1F56A 4JFEB 2ZE0A 2WJ7A 1TKWA 4E9VA 4OM1H 2C3XA 2F1AA 1YEFL 4PR5A 3EH5B 4CGUB 4NENB 3T3PF 3R4RA 3TJHC 2NY2B 1Z0MA 4LFHD 4WSJA 5EBWB 3WUWA 5MHSD 1LO0L 3MYJB 4HULB 4QIDA 2R1YB 1NAKL 2J25A 3OKEA 5IOKA 3CHQA 2VDOL 3L1EA 4JG5A 2CHWA 3V4PH 1DUZB 3FF8A 1YECH 1C16A 1Q9KA 5FDYA 3RNKA 3ZTEA 3OR6B 1CYWA 1O9VA 4GLRI 2K6YA 1WZLA 4ZTOL 4KNQA 1L3NA 5JPMB 1NCCL 1IM3A 1BFVH 1BGXH 4XPHL 1SF3A 1UD5A 2BVPB 3UTSE 3UO1H 1QI4A 1NUNB 3BP5B 1R3HA 2R8SL 5E2WH 4G59C 4GAJL 4XMKL 2FWLB 2IALA 1WA2X 4GW1A 1TXKA 2ZKXA 2XXCB 5HVGB 1DJIA 1CLOH 2QLYA 4LKXB 4RFEB 1HTYA 2DL2A 2WWMC 2QZQA 2WWKO 3LXCA 3MV7E 4ZFFB 3GMNA 1AFVH 1N6VA 2G2NA 4OM0L 3SE4C 5FKPB 2OL3A 3MGTA 5L2KA 1XJIA 2OTPA 3GSUB 3L08A 1NL0H 4I1RA 3MUZ1 4MCNA 3HW7A 2WTRA 4I5BA 5H2HA 3GUTB 3OKLA 1AKJB 2JB5L 4QAWA 1TF4A 3T1FA 1MCWM 5C6WH 3F5WA 3OKOA 3X11B 4EEEA 4K4KA 4KX9A 1RK0A 3BWAB 5E9DD 3AXIA 4PS7A 2KQMA 5C0BA 4HPYL 4ZXBD 3LXUX 4FQHB 3V0FA 5L8KB 5D1XC 4MXWH 1ORQA 1I9EA 2DLFH 5AKVA 2YPLB 4XN5A 4J3BA 3KVDD 3ZK0A 4H8UA 2JQZA 3HZKA 4HF5L 1PCSA 4DIXA 1ML0A 4WLCA 3EXLA 3QJQB 1NCAH 2ED6A 4JPVL 2NUPB 3VACA 5DVPA 5IJVB 3X3GL 4ZMQA 2VLLA 3TC9A 3AT8A 1F5WA 1ZLVH 5AVVB 2LW3A 4PVLA 4P9HC 4Z7UF 1GVIA 4XT1C 1OP5H 4ZUUB 3SGJC 1HSAB 3VH8G 2WN2A 4LCYA 5EEXA 2K1MA 5F96L 2L6XA 2L8AA 5B35A 4G5ZH 3ECBA 4M7KL 3QB7C 4WAFA 3FO2B 5GGUA 5F9JA 4FNSA 4PI0A 1OXYA 4ZMZA 4NB7A 3K1KC 5DZLA 1QSEB 1KOAA 5PAZA 1DO6A 4PJ8A 4DGUA 1XGQB 1UZ8A 1KFAL 5CP7B 5JLZA 1YMMD 5F6IB 5HPMA 3ET9F 3L3DA 2PXYB 1OK0A 1CGVA 1EDHA 3BUIA 5JHDE 2Y01A 4XXCC 1U33A 4HV8A 3UTTE 1BVZA 3CU1A 3MLWL 3RIKA 4C54A 2VLJD 5HHVL 3ARZA 4LAJH 2D73A 2EIJB 3WEBA 2DLIA 4UT6L 2OCJA 2A9AA 4K2UH 4J4PD 1ACZA 4YDVA 1HILA 2ILLA 1HAUA 1NCDL 2V9RA 5JDJA 5EU6B 2G30A 3DGGB 2Y5EA 3KE0A 3O45B 5GGVH 4ZW3A 5MERA 4CMMA 3M1OA 2BHFA 5BXFA 5KVFL 5CJQL 3T8MA 3HVDA 2CO7B 2J5WA 1FO0H 2YIHA 1HEHC 3MKKA 5BRZE 3VD4A 1LWHA 2C34A 2MQ3A 2XBZA 3OHMB 4LCWB 3ZMRA 3QJFA 3GXNA 3TT3H 4H0GA 1Q90A 4DTGH 4RGND 1RULH 1BBDH 2WWKT 3BUYB 1L9NA 1EAQA 2WO2B 4BCXA 4LASH 2VXTH 1AGDB 4TPRL 3RVTC 5HYSB 2VL5B 5D71H 2ZCLH 1KGCE 4OJFL 1RURL 3P3SA 5CBAB 3BXNA 3TLRA 2JJTA 5IW6B 4O51A 2A9NH 4UF7C 4WTZA 1MVUB 3UERA 3KCPA 3UABA 5F9WC 3U82B 3B9KA 4MLIA 5KSAA 1QR1A 2IMNA 4FZ8L 1L6PA 4LPXA 1CDCA 5EU4B 1PNCA 3NFNA 4CILA 1MHCA 3WL9A 3ISWA 4N2BA 4ABVA 1GKEA 3ULSB 4W4OA 1Y0LB 3ZDYF 1G7PA 1IGCH 3DROA 3OAZK 1S7VA 3QUKB 4F7TB 5C0FB 5EOQL 5G28A 1KCLA 4FA6A 1DN2A 5JNYA 1ZAGA 1SOSA 2J1WA 5TH2B 1DJXA 3T04D 2HTLD 4FGMA 1WGVA 2XG4B 1Y7VA 2C26A 1TITA 3GKZA 3K2IA 1NKOA 5TTRA 5KYXA 1BD2E 1EZSA 3MACL 4M8RA 4Y5YA 5LGJA 4UIKL 3KMDA 1YLBB 3RVVC 3IFOB 4JB9H 4CSTA 4FA8A 4PRIA 4BWWA 2RD0A 3BSZH 3T65B 3BSHA 3NA9H 3QEHA 4WUUA 1RUPL 3QIUA 5DWUH 1M0MA 5IMKA 1RIVL 1MCWW 2CJUL 3OZ9H 4EZLA 3ASWA 1KGWA 2DM3A 5C2UB 4OUOA 3BDXA 1OWRM 1TEGA 1XF3B 5HI5C 1IAIL 1UA3A 3E2HC 3VXUA 4M1GL 3P9LB 3UBHA 3BC9A 4NO5B 1OAXH 4QHLA 3S96B 3IJ8A 1TN0A 2IDCA 2J6EA 5I18H 3EF4A 1IE4A 2X3AA 1AY1H 2WKGA 4ZK8A 2J12B 3CVIH 4XCEB 2EIKB 2EZ0D 5CEZH 1HOEA 5B6YA 1MREL 3OKMA 1JUFB 3IMUA 4S0TD 4HUKB 4M93C 3REVB 4G5AA 1NLBH 3KYAA 2VDRB 3MRKA 4Z7QE 1S5IH 5IQ9A 1I3GH 4LQ1A 5DHMC 3LPGA 1CXFA 1TJHL 4JW3A 5DQJB 1X3DA 1SUHA 5SX4I 43CAB 3G6JB 1CGXA 3EOBA 2Q7AA 5DRXA 3MXVH 3CAFA 3SOTA 4PG2A 1F3DJ 3F01A 3I3BA 3BQUA 4LU5H 4MBSA 4B96A 3MPCA 4LCVA 4JM2A 3I50L 1MFMA 4XCFL 2WVUA 3AMKA 3OC8A 1ITCA 5IFJB 3NGBC 1NSNL 3K0WA 1DBBH 1DVFD 3QUZD 2WLJA 2YDOA 3SE8H 5JW5B 4BQCA 3EKCA 2B2XL 1AS6A 3QEGL 5CN2A 1PYWA 2QKIA 2WAQA 3TL5A 4Z7NF 3SDCB 5EMYA 1JAEA 4OV0A 4L3EE 2OYKA 1M56B 2A9MH 2Z7WA 3L95B 1A7QH 4GT7A 1LDPL 4LLMB 4AM0A 3ZO9A 2AV7B 4WVRA 5E2UL 5HYQA 1NFIB 1QPPA 3PDOA 3QBTB 4DAGL 2Q8AL 1WZ1H 1RUMH 1BZQK 5E94A 2YSSA 4MQ7A 3LMJL 2WXOA 3KZ8A 4ICWA 4PS4L 4Q97A 4N6HA 1WBZA 4FXGA 3ROLB 1MFAL 3ZDZE 2VXSH 4GYCA 5C09A 1COBA 2HVKB 4OD1L 1F90H 4U0RB 2R15A 5AVWB 4L4VA 3LN9A 2H6PB 1AH1A 3DJRA 3ARVA 1JNNL 1JRHI 1MJ8L 1FG9C 1RZKL 1XDTT 2KT6A 2VJ8A 1KELL 4KWUA 1ORQB 3VFMB 1TENA 1RH8A 2NSMA 4XNYL 1MWAA 3ZTCC 2VLKA 1IAOB 2E47A 3FCSB 4DEUA 6CGTA 3JWNC 3CHOA 4WW2F 3NH7L 3IJHA 1KWKA 3K4DA 4LHJB 4IKIA 3FFDB 3EOYG 2EDOA 1O9WA 1A6ZA 2CKNA 4IBVA 2C5DC 4KROB 2BNRD 5HHMD 3O3EB 1MCQA 4YHKL 3CHSA 4XAWL 5AZDA 5JORA 2CPUA 3WV0A 5CJXA 4OFKA 4WWNA 2HRLA 1WWAX 3UG3A 1AHWC 2E4TA 2ZUWA 2ZUTA 3FUJA 3OX8B 1KIRA 4WW3A 1P8UA 3QBKA 2F7RA 3M8OL 4OR1A 4TUUA 4DK3A 3C5ZA 4Y2OA 4IRJD 3IPBA 3NTCL 1P4UA 3KPRA 4P2OC 2H2PC 1YO4A 1MKFA 4HJ1A 3IDXL 3ZXAC 3ZY7A 2X4NA 3GHEL 3KYMB 1H9DA 1ZLWK 4A7UA 3DXAA 4XN7A 5TF1L 1K8IA 1ZT1A 1QHJA 3QIWA 4AGLA 4DF9A 1YC8A 3L5HA 3LKPB 3CXHJ 2AJ3B 5IB4B 3LZRA 1QD0A 4L3AA 3WMSA 4OFVA 5F9AC 4ZMVA 2JCCE 5DGRA 2R0KH 3R7QA 3VXPB 4PJEB 4TRPH 1TLMA 3INOA 2OMZB 3HAQA 3VI4A 1G9EA 3ZQ9A 4ORGA 3QCVL 1CDJA 1NGXA 3Q3GA 4ERSH 3Q05A 1KN2H 4ZFOB 3QUXB 4N9GA 3PJLA 4HKZB 4R3SA 3X14B 4YSQA 4PG9A 1DE4A 4YDMA 3OMZA 3AB0C 5DEFB 4OSUL 4NBXB 3WO3B 4GAGH 5A6LA 3KXFD 4G8GB 4NM4L 4OVVA 1OGAE 1UEMA 2MPAH 5F7MC 2V5SA 5FUCC 3JV6B 3QCUL 4L8BA 4A2LA 2OMYB 3F58H 4TSBH 5A3ID 2ZWYA 2VDQB 1H9VA 5GZNA 4L5FH 4R83A 4RX4A 4DZ8B 5JQIB 1TOXA 1K8DB 4OCNC 5H2MA 1V7ML 4UILL 2JQAA 1TTGA 2CGYA 3MFGB 4HUWA 1FH5H 4JDTL 1TQUA 3H9SA 1VLXA 4S1DD 3T2NL 4P3CH 2IAMA 4GAYA 4DFHA 4IU3A 1ND0A 2HCZX 1EA9C 1TQTA 3FUMA 1HI6B 5GSRA 4Y16B 2BFVH 1CR9H 3VW3H 4A7QA 1C1EH 5AOIA 1GC1L 4AV5A 1MCPH 1A3RL 1MCBA 3L9EA 1O7SA 3OJDB 1DBML 4F8LA 3V8OA 5I8CB 3QDJA 2JCWA 1SM3L 3C60A 1A6VH 1FVEA 1NGPL 3UZEA 4HU8A 3WE1A 1BLNA 3RVUC 3BH9A 3VVWA 1MJUH 2IQAB 3GHBL 3O3AB 5IWLA 2E4FA 5DHXB 2QGCA 2X4OA 4JG9A 2XPGB 4PGCA 1BZDA 2EH8H 1TEFA 1WITA 1QSFE 5EU3B 4C4BA 2XWDA 2D9CA 4MA7L 3OPZL 3D85D 4L37A 1QBLL 4X9HA 1ITBB 1OAYH 4A68A 2ICES 5CS7A 3MX0A 3V0DA 1DQML 1U8HA 1ZLDA 3HC2A 3LRMA 3HASA 1KLUA 4YLQT 1RMFL 1I8MA 1GJIA 2XV6B 1OE2A 1YEGL 2XJLA 3TU6A 5ES4B 2GG1A 1INQB 4YPGB 1EJOL 3PWVA 2OQJB 3V5DB 1MDAA 5EA0H 1OQOA 3IVKB 2FBJL 4QI3A 5AWZA 1UJ3C 3Q1SH 4JRWA 3EJRA 1HDMB 3TZVD 1E0OB 2FATH 2WPGA 4NQUA 3KS0H 3KWTA 2Y36L 5D70L 5B7MA 2OJ1A 3TZVA 1NGQL 2NW2A 3N9GL 3NSDA 1SXSA 1L9MA 3DI2B 4OLZL 3DVIA 2JIXB 2VO8A 3PABA 1XBDA 4H1LA 1ULVA 2IH1B 4XNXH 3TO4A 4LLVB 1WZKA 3P54A 4W9ZA 1LN6A 5DRZB 1J0JA 4OBRA 4W9CC 1H6TA 4KOCA 4X5XB 2K3HA 3THML 6FABL 2XV0A 1GAFH 4EOWH 4BZ2A 1U2CA 2PYEE 3KAAA 3L5XL 3HI5L 3QS3A 3NDYE 4DP1X 1T1YB 5KS9A 2DEXX 3DMMB 4RESB 5CD5C 2FHCA 2ZXEB 3C08L 3QJRB 3AZUA 2W0FA 4PJ5E 1BJ1H 1VEOA 1IFHL 3Q01A 15C8L 1T0NA 3EJZD 3FAXA 3OHXA 4X7SH 5F88A 1XR9B 3GGWA 4NQDE 2NYZA 5DQ9B 3MLYH 1IGTA 3MREB 3P40A 2WB1A 4NYLB 3QFJE 1SLVA 2QQNL 1SJEA 1VEMA 1JPSH 4MMXB 3LH2H 5IHUL 3L3OC 3A22A 3FBQA 1S7QB 5DUBB 3VO0A 1CN4A 4MD2A 3Q6GH 2QVTA 4LOVA 5DA0B 3U36B 1KPUB 4F8PA 3HB3B 5E24E 5CGYC 5AZ2L 3UACA 3TNMA 4PWJA 1BAGA 3VYOA 2JWYA 3F7YB 3OG4B 3SBWA 3RAJH 4HISA 4WSGA 2HFEB 3ETBF 3LQAH 2IDTA 2MRYA 4HWEL 5E2VH 2XQYG 5BR2A 4XP4H 4CDGC 4E42A 1DEEA 32C2A 4NZRL 4S1QL 4QWWD 3FYEB 3O3BA 2KH2B 1EJ6A 2J43A 3A6OA 4GRWF 3U6RA 1E9PA 4TNVK 2ZYHA 5DC0A 1RP8A 1BCIA 3ORJA 4HCRL 5MENA 3GZPA 3LIZH 1MHHA 3NCYP 3VFRA 2AEPL 4G6ML 1Q1PA 4P9MH 5IQMA 1BXXA 3HMXL 4WIQA 4XPGL 3NT0A 3V4PA 5F1NA 3CSYB 5FO8B 4Q9BA 3CDZB 1LGVA 4AYID 5ADPH 4AL8H 3VFTA 5FOBB 3BZ4B 2L7QA 2VUKA 2W0LA 4LT7A 4JHWH 3F7VB 3AY4A 4G1EA 2F08A 4FOMA 4FNQA 4V1DE 4AYDC 3WNLA 5JOPE 4Y4HD 2WVSA 3G08B 2GAZB 4PJBE 1WJ3A 3QUYA 3TWYA 2OJEB 3I2CH 1OSZA 2OSWA 1I4FA 1AZRA 4A2DA 3RWFA 2PCYA 2E56A 1QLFB 3QIBD 4W9EC 2PN5A 2IPKB 3OB8A 4OIAA 5JORB 1ZY9A 3U0TB 1CLYL 4U7SA 4D7PA 3ZLQC 3VNZA 3GTNA 4MA3B 3DUSB 4E0RB 4UBDD 2R2EB 2MCMA 1CE1L 3AXLA 4NQCB 5DVMA 2YOCA 3B5HA 4ZAKA 1ZLVK 2SODB 3FB8A 3EGXB 3EBHA 3UPRB 2B77A 1D5XB 1KYDA 4FA7B 3MUJA 3Q2NA 1T5KA 1U8QB 3ZRSA 1W15A 4C4KO 3WD5L 4X6CE 4OF6A 3X1FA 1VFOA 3S0PA 2WUBL 3KHOA 2QSVA 2IC2A 4WV1B 4G9FE 5FR3A 1CIDA 4ZMNA 2M8XA 4GY4A 4EJ4A 1RY7B 5AOZA 4P23D 1QEXA 3OLDA 3QI9B 1VFUA 4AQEB 5KSBE 1BF8A 4MHHG 1N7MH 1MWOA 5HJ3B 3O6KL 4M4PA 5LXGH 2VSDA 1IKOP 3EDJA 4PJXF 1ZCRA 4G6JH 2YK1H 1FIEA 3X3CA 4GB9A 4ZMOA 1ZLUK 5BO1L 1JDAA 4OFDA 2XYCA 3QDMD 3GSRB 1FAIL 2J2ZB 5D7IA 2RMNA 1KG0A 3OL2A 4W1TA 4TYUA 4HZLA 5GSVB 2YD1A 4MXVF 2ZJSL 3UMNA 3WDJA 1L4IA 3S34L 2FUQA 3LY6A 5L9DH 2P26A 3KEDA 5ISZB 3V6OE 4H40A 1CI5A 1FZMB 4PD4J 4TVPH 1HL5A 1M71A 3ASNB 1ZSDB 4MS8D 1H19A 4XT3A 2G9HA 4P59H 1PY4A 3BIBX 1B0GA 4RFNB 2F53B 5JXED 2LLGA 1LO5A 4PRHD 1AGFB 3VD5A 1KT2B 2Q3XA 1UXMA 3RBSA 2X89A 5DRNA 4D0CB 2AQNA 2ICWB 5A44A 5L4FA 4CAGA 1S7XA 1CF8H 5IMOB 4YC2C 1AVAA 5EPMA 4PEEA 4Y4FB 2H32B 2ICEC 4R6UA 3E6HA 4ZW6A 3KH3A 4NBZB 2YD0A 5JDSA 1UB6B 3WUWG 3B3IA 1GGBL 5E9NA 4GUPA 5E4AA 3IDYC 4JPIA 3LKSB 4BXSV 1U91A 3KLKA 4IOIA 2ZPKH 5GS1B 3ZDXF 3RJDA 3RVXD 4LFHG 3WXWH 1FO0A 4YDIH 5IB1A 3L4XA 3RWCA 2J72A 4CNIA 4HALA 4K7PL 4AEHL 2DW5A 3MODL 4LVNB 5EWIL 2ZUSA 1X5KA 2AXWA 1JHKL 3ZE0F 4J27A 4OB5L 1BZEA 3BVXA 3UTOA 3MGAA 4L4TA 2F19H 4OV6F 4ECNA 2EXWC 4K3JL 4FZEH 5SWQB 4AJWA 4M8VA 3W39A 5D7LA 3MV11 5FUOH 4L9DA 5EZLA 1S6NA 3WO4B 4MQSA 3VXRB 1NIFA 3D33A 4K94L 3PL6D 4XNUH 2Z4QA 5C0NC 5CGTA 4C47A 3ELQA 4HS8H 2D8KA 2AEQH 2VDKH 4FQ1H 2YN5A 4TNFA 4C4KT 2EUWA 2WSDA 1WC7B 5A7BA 4PGBA 2XKSA 4Y7OC 1T83C 4H8WL 4WKZA 3HZYB 4IRSD 4MCYB 5ESQB 5B39G 3D6GA 4IKKA 3OJMB 3N43B 2YZ8A 3WHE0 2XTJB 3IBEA 4YXHH 5ESVB 1VRSA 4M48L 3HN5A 4DN4H 4UIMA 3GEWB 2IF7A 3D51A 3X1EA 4HEME 4CMHB 1NEPA 1I7ZB 5E4EC 5SWZE 1MZYA 5GRUH 4WTXA 1IO4C 3ULUC 3IGLA 3BIKB 2WXRA 1QHOA 4Y9HA 1SZNA 5I66A 1J0ZA 3HS0C 3QSKB 2F1BA 2NTWA 4JAMA 2VDPH 4A6YA 5CN3A 2DTSA 3CBKB 2XG5A 5E70A 3KJ4B 3BD5A 4W81A 2HMID 2IQ9H 4NNXB 4PRAB 5F8UA 1SHMA 2QPDB 4PJ9D 3ZE1F 4NKDB 1DLFL 3AREA 3NA4A 4JJHA 3QDGE 1FJ1A 1KEGH 1HC1A 1G7LB 3WEXB 2ZKMX 4ZS6D 2DM7A 3RZCB 2XKNB 4AJ0A 4O00A 2G3MA 1P7QB 4OJEH 2VYRE 1OCRB 5ANMB 1GHFH 4FNRA 4AMKL 4YX2H 3VQ1C 4N5EC 3FO0L 4JFHE 4EXPX 3R4DA 3RU8H 3V7AG 3P4OB 2YLKA 2O5YH 4YUEH 4MNHB 4AUJA 1T03H 2NY0C 3LH9A 4JMNA 4N0FB 4ZS7L 2MWCA 2ZP0T 1VA9A 3WLWD 4KY2A 3PAYA 2H0EA 1J1PL 3V4UH 1F00I 1SFDA 2DWDB 3QO1A 4MASA 3RX9A 5TQ2L 3C9NB 3ZZ1A 1HWHB 3O3BB 2OMBA 3QXDA 3BGAA 4M8QB 2H9GB 4E9LA 4XXJA 1FYTA 5FF6A 3HG1A 3U7YL 1FFNB 1AIFB 1CL7H 3IKCA 4JO2L 3SZKC 4N2FA 5GJTL 3WHXA 4KI1A 1VFAB 2XIDA 2BSTA 2QQLH 4KO9A 2AI0H 5T1MB 2BY0A 3ABLB 3GBEA 2CO3A 1SEBB 2R0LH 3SDYH 3F7LA 3EO9H 1SBSL 1KCRL 2PLTA 2G4EA 3KW8A 5C2BH 3MLXH 3DGDA 2AXHA 1ZGLM 3P0VH 4DT2A 1BEYH 4NQSB 3VXMB 3VFWB 4PREA 2H0JA 2BVOB 2AQQA 3CZLA 2PR4H 3MJ9H 4G8FA 3P4MA 4GBXD 5CSZA 2R1XA 5EH1A 4C56D 1AG6A 4CSZA 5C0CA 2HWZL 5CU5A 1PQZA 1MHPH 1YN6A 4FHKA 5GISH 4OGYL 2CCWA 1HN1A 1KIUB 2GT9B 4N0CC 4ODXA 4B27A 3GIVB 4KPHH 1IKNC 4TL3A 4YIQA 2GJ6A 1PTZA 2VRAA 3CFEB 3HNVH 3U9PH 3ZE2E 3MBXH 4KMTL 3D3VD 2J73A 4OLXL 3FUIA 5IB3B 4PJAE 3IJYA 4FABL 5HVHB 1U8CB 1MCKA 3KBFA 4L0ZA 2P44B 3KPQB 3O9WC 1P7BA 3B2DC 3OAXA 3KJ6H 3AM6A 4I0PB 4QF1A 3PHOA 1L7IL 4IKJA 4NN7C 5DUMH 3L3GB 1SYVA 5E5MA 4RNRB 2W94A 5T3XE 4MKTA 1B2YA 4HWBL 4BK8A 3K8MA 1F18A 3FSVA 4TLKA 5KSVB 4JFYB 4UAHA 1SVBA 4DP5X 1HSBB 3D0VB 4ZSOB 3PDDA 1NBZB 3HE7C 1X6NA 4AQ8C 3DRTB 4HQQL 3WTYA 5B22A 2O5XL 3NIFB 5LHDA 1E6OL 4PV9B 3GSOA 3S4SA 5D7IB 4ZX4A 2C3WA 1G87A 1KG0B 1TZIB 2NY6B 2ZXBA 3MLRH 5T5NF 2MHAA 3R7RA 5KVMC 3KLHD 4WNQA 1YPZA 3LPWA 3ETBJ 3QHZH 3MRCA 4J6RL 1Z9MA 5EULV 5I82A 2R69H 2CBTA 1PKQB 3RDTA 4JZJA 4QCIA 5IQLA 4WUKL 4UANA 1IQWL 2GTWA 3OWEA 1RLBA 5IVOA 4EDXA 4I9WE 3RWIA 1OCWH 3IRPX 3A3YB 2B0SL 4HHAB 4U6YA 1BM3H 4OFQA 5E8OA 3BRDA 3B4NA 5IGXL 2G9HB 4TSAH 1AD0B 4HX1A 1YJDL 1JHLL 2LHAA 5GRZA 3RGBA 1LK2A 4P2QA 4JFFB 3NSBA 3DLQR 2XRAL 1XV8A 2CUMA 4I3RL 5DRNB 1K5NB 1QABA 1JZ4A 3BQVA 5AAWA 3HG4A 3V6ZA 1HHGB 3NZHH 1D9KB 5KVEL 2APBA 1FLRH 3QRLA 4JFED 5HHOE 3M1BA 5J89A 4P46B 1JSYA 1F86A 2DYRB 2VWEE 2LT9A 3BAEH 1MQKH 4NRYB 1A0QH 2IJ0C 4DPBX 2NY2D 2XZQL 3AM8C 4F7KA 3DSNA 3KGSA 5EOTB 5T1LA 1CDUA 4FFWD 1M6OA 5I8EA 1UH2A 3AS3A 3K5RA 4H0IA 3U30B 5MHSE 1QTPA 3P9WB 2Y7LA 4H26B 4Z76B 2VL4A 4ODHL 3TASA 2VR8A 4LRIA 5DHDA 4QY8B 5ECGA 2CWRA 4XWOD 5LWYL 1JGIA 1HQRB 4OTXH 2NW3A 3UG9A 3CFCH 3KM1A 3WIHA 4S2SA 4MZIA 3NOIA 5T5FH 3GBNL 4AGQA 5MP6H 2EO1A 3TYGH 2LVCA 4PJHB 4U31A 2WSKA 1LL1A 3AUWB 3VWKA 4PJGE 2CHNA 3QJXA 3WN5A 1ETZB 4XC3L 4ZTEA 4FQ2L 3PG2A 5DR5L 4D3CL 2KLRA 1BYPA 1CICB 2BCKA 4MJIA 2WLKA 1NDTA 4N0UB 1NDMA 5T1LB 1XO8A 4LK4A 2QHRH 2X3CA 4XVTH 4C83A 1F4XH 4NQTA 1R5VA 1KG8A 2JJVA 4PLOB 1W0YT 4Z0XA 1VFMA 1BG9A 2FJFA 3BH8B 3CSFA 4U3HA 5CHNA 5FGBC 2V8LA 5EUOB 2X4RA 1QRNE 2WXFA 1X7QB 4OD2B 1LQBC 5IY5B 4LDEB 4ZUSB 1AKJD 1AP9A 3KDMA 3FT4B 4X9YA 5SX5K 1FVCB 4F57L 1N5AA 2JKRM 3SPIA 3W2DL 2ITDB 3IKKA 4HJUA 4BZ1H 1LK3H 4EZJA 1TJGH 3GQFA 3RFMA 4KKNA 2VDNH 3TIDB 4P4RB 1NGYB 3DBXB 5FUZL 4GG6A 2Z31C 1GOFA 2AJXH 1KBPA 2AQPA 2YPLD 1UGNA 5D2NC 1N0XL 2MPVA 4PJFA 2YGOA 3JV4B 3UIZA 3ARBA 4KTEH 2CO1A 5B1BB 2VXQA 4CVZA 5A2KH 1NIAA 2E8YA 4KQ4H 3BD3A 3C5SB 2DYSB 2LTQB 1URZA 3KNBA 5CIPH 2ENSA 5ERWB 3RFZA 1T4KB 2GSGB 1ZEAL 2BNQE 2XIIA 4HJGA 4OZHE 4F7CB 1I1CA 3BO8B 2K8MA 2GYSA 2WLYA 3B6SB 4R7DB 4OLUH 3C8KA 1U58A 3LHPH 4Y9BA 4I1PA 1UB5A 2H1PH 1XFPA 3ML9A 5F1OB 3V7AE 3KLSA 1AQKL 4FC3E 2BC4B 4B9KC 4HYXA 1HHIA 2FJGA 1QSED 2QSCL 4HU2A 4BYHA 3G5WA 3RUGE 3DURB 4TULH 5JQ6L 2UY7A 2XWJB 4KI5D 4ZFQA 3UTYA 3BCDA 5LCVH 3VI3B 4M5TA 1KCBA 2PXYD 4I4WA 3QZPA 1JGUH 4QXWA 1Q9LA 1AYOA 3WFZA 1NBQA 1FHGA 4YDKH 2AQ3A 2AERT 4RMBA 3W0WE 2Y23A 1T04B 3FULA 3QQ9D 2JAGA 2WZAA 4PJIA 1KPRB 1PL3A 2DH2A 1DBJL 4KOBA 2FO8A 4X8JA 1F0LA 4W6YB 4XTNA 2Z8SA 3B5TA 4TL4A 1MRCL 2XN9A 1A7OL 5EU6D 4IBYA 1WA1X 1NAMB 3IDNB 2GITA 3QJHA 1TNNA 4XPTL 2FYYB 3DC0A 1BXAA 1YUKB 1N4XH 4PUBH 4JQIH 2AXFB 1G9NL 4JN2B 4PW9A 2OJZL 4U6VH 3B56A 4ZQTA 1CTOA 4LCWD 4XGZA 3MJ7B 2X4SB 1H3PH 1LHZA 2IWEA 3GRWL 3LRLA 3GEFA 3MXWH 3QQXA 4DKTA 1F42A 3RWHA 4JFWA 4H0LC 1UZGA 5HGHB 4U1IA 4XVSH 3OR7B 1W9XA 2R4RH 1XL6A 3H4FA 4HHGA 3QFDA 2WCSA 2ADFL 1NMAH 4JRYB 2NXYB 1WO2A 2NXZB 1NGWB 1WD8A 4Y4KC 2PNDA 3HAEG 1Q9WB 4JKPL 3HPLA 3BZEA 4KVPA 3RHWK 2WINB 4Z1PA 5MEPA 4PGDA 3PAVA 4DO6A 1BJ8A 4IHOB 3IGUA 5KYYA 3DJSA 4QF1B 3EH2A 1FNGA 4XAKE 3MNMA 1F4HA 4N8CL 4NOFA 5IQ7H 3WIFB 3WXVL 1BZ9B 1FWXA 3GM0A 2NUTA 3UBXB 4AMXA 1TZGH 1ZS2A 4KTGA 2OYLA 43C9B 4DPRA 2WYIA 1NMBH 1NCWH 3QNFA 4Z78A 3QEQE 2AK4B 3WNOA 2XETA 3K3QA 5I5JA 2BNUB 2R0ZL 4ODVH 4OF0A 1QKZH 3OXSA 2A9DA 4GQPH 2XIBA 4UQAA 4U4IA 4CW1B 1A3QA 2ATAA 1FL5B 4FJ6A 3BPOC 2I25N 2NZIA 1RU9H 4HUXA 3BUTA 1Q9OA 4ZO8A 4K7FB 4JPKH 3IF1A 3DV4A 5T3ZE 5I6XB 4PWKA 3U4EA 5CAYB 5CZRA 2WBJC 2XDHA 3E8UH 1WGOA 3GMMB 4H20H 3RX5A 3UXFA 4K5PA 5TE4H 1W72H 1D5ZB 3D12B 4U1GB 3UAEA 3TEWA 4FQLL 1T2QH 5DMIL 2DLEA 4WENB 3K2MC 5EEZA 1BW8A 2I26N 3SY0A 1XF2B 1OTUC 4JX0A 2ZONA 1YNTB 2GJZB 1F97A 5GS2H 1QVOB 1S78C 4RFOL 3FCGA 2B59B 1MFEL 2BY2A 2VISB 3PQRA 4QRRB 1PEZA 4RAUA 4U4BA 4UM9B 4TTDD 3IMBA 1KLGB 2IH9A 4XHJC 2EDRA 2K0RA 2V7HA 3FO1B 3I6GA 4LKCB 3OE9A 4JQVA 4NKIL 5CILL 1QBML 4WFEE 4X99B 5GGVY 5HHXH 4BFRA 2X87A 4UDTB 3UTSB 1TPXC 3OSVA 4HLZG 4B9YA 4Z5RB 4NN5C 5AW2B 2A73B 2FLBT 5BZDB 3DSNB 5IF0A 3BAIA 4X80L 4MTMA 4P5TB 3D09A 3TA3B 4L8SB 5JR1L 5L6YH 5ILTH 4E5XA 3NACH 3D69B 4PRDA 2EE9A 4DP9X 4Z23A 2UWEE 3OKNB 4Q52A 2KHAA 5T1JA 2PCFA 3FQYA 3TN0A 3UZAA 1YRKA 3L48A 1IGJA 1JFHA 4XNBA 3QULB 2O6EA 4AITA 3JWDL 3ZL4H 4PYHA 3CZJA 3L1OH 3MV7B 4DJHA 1HXYB 4NN6C 1R0AH 2VN5A 4B0MB 3ENEA 3OGOE 1FDLH 2CO2A 2VR6A 5DYOB 2APWA 2H41A 1C5CH 4Y1AE 5ALBL 3UPCA 2F9BT 3QG7H 2A4ZA 1Q0XH 4N1CA 2YBGA 3S35H 4JFDE 4YO0A 3PWHA 1B4LA 4B9PA 4OGAD 3SDCD 3LHAA 5BS0A 2OR9H 2BCKB 5T3XH 4F37K 5J6HB 1GGYA 4YHML 4QHMA 4YFLI 1W0VA 5T5NG 4UTAL 3L4TA 1B6UA 4RBPH 2EDEA 1EQWA 1T0MB 1MCEA 5AAMA 3BAWA 3VWJA 3BP4A 3M45A 1YPZF 3SPVA 1NCUA 5K59F 1QNIA 4X31A 1RXLA 4NSKB 2P7TA 3BP6B 2AXJA 4YSOA 3CSPA 4NM8H 3MRBA 3DUHA 1SPDA 3EYSH 1U8NB 4E9QA 2ADJB 2BFGA 4G1MA 1D2OA 1XBRA 4GW5B 4UAOC 3UG4A 3QZWB 4LNRA 4GBRA 3AMLA 4N1HB 3UAFA 2G75B 3T4AA 1CO1A 4WK0B 1NOFA 2VERN 4LL9A 1L9SA 4W70A 3UTPD 1XB8A 1IEBB 4GSDL 5MEOB 3HRZC 4K3DL 1JK9A 3S98A 2GK0B 5EN0A 2Y22A 4TUJB 1B6DA 3GPSA 3KYOA 3QDHA 7PAZA 4XPBH 1Z3GL 3BT2L 2X2JA 5FFLA 1P6FA 4LCCC 1ZT7A 2W65B 3FK3A 3VB9A 1QYGH 2V2TA 4KROD 2K8QA 2P5EA 2IOOA 4FTVD 5HHNB 3SJVA 1QFPA 2G3NA 3PV6A 3V4LA 5L2JB 3VXSA 1OAZH 2VAAA 2QV4A 5HYJE 5E8DL 3EYQD 1IL1B 3HJ0A 4FTVA 4NP4L 1BAFH 5CFAA 1FPTL 3VTAA 1AQDA 4NC3A 1J9CT 5IJCC 4QTIL 5C07E 3VGAB 5J06A 3FJTA 4ZXBC 1J88A 1DQLL 5FECA 4MNGA 3WJMA 4G7SB 2OM5A 4Z0BH 4C8XA 2W9EH 3IE4A 1TTBA 1F4ZA 4IM8A 1UZ6E 3QWOA 1ONQA 3PGCA 4MNQE 3LPFA 4W9GC 2DQEH 1A1OA 4PM1A 1PZSA 4FQXA 4FYSA 5CBEA 4BELD 1BQLH 2DL9A 4AV0A 4WI9A 4WNJA 4HEPG 1RSFA 1ODUA 3NG5A 1DDTA 2XZAL 4IRZL 2ARWA 4UT9H 3ZTNL 4AXWB 5IVXA 4ACTA 3K71A 4MXQC 4OZFA 3LDBC 4DEPC 5TE6L 3F12A 4IB4A 2KPWA 1L7TH 3LZPA 4UNVA 4KVCH 4X8JB 1O6SB 5ITFA 1IC5H 1J5IA 2EDMA 1XIWA 2WOBA 4Y19B 4F7MB 4HSAC 3H7LA 1IGYB 3O0RH 3VG9B 5K9KA 2HPYA 4QXTA 2GITB 2GSIB 3TYFB 3PWPA 3UDWC 1WUZA 3QUXD 1G1KA 4QHNA 2F8VA 5FGCE 1S2EA 3G5XA 1E27B 1NOAA 4IBLT 1RZJL 2CKBH 2HX9A 3KPMA 4ZNEE 3GZQA 3NQKA 4G11A 5D7SL 2X0VA 3SDAD 4L35A 4PBDA 4B7IA 4G8GD 2Y02A 4LPUA 4BUGA 2DJUA 3S5LB 3HAPA 1RUQH 1YEIH 3SDAA 1XH0A 1Z6JT 4KMLB 4HT1H 5CD3A 5IHZA 8FABB 1OARL 3QHTC 4P9HH 4G80B 1J5OH 2QSQA 4PJFF 4M4RA 1BD2B 2UX6A 4J4PC 3ZBMA 4FKHA 3B9EA 3ZR6A 4RISH 1GJWA 3BJLA 4Q2ZA 3BAJA 2AJZB 2WXHA 1XR8B 1FBKA 3AACA 4QRUA 2FYVA 4Y16D 4DK5A 1HZHH 4BWBA 2P8LB 4ABQA 3T0DA 5BJTB 4IOFD 3B7RL 1JWMA 1XGRA 1E8WA 2BMKA 3OAYK 4YSDA 5AW7B 1OTSD 3VD1A 5FYJD 1EHNA 3VSQA 3TTSA 4GAFB 2X44D 1M6UA 4PBVC 1XIOA 2JJTC 1PF3A 3P3TA 4PRNB 4RGNC 3AS1A 1KMEA 2ZKYA 2HJLA 3EYFA 4ETQB 1N59A 1TCRA 3B9KC 4KFZC 4AYFB 4F9PC 5I1DB 1HIML 4RA0C 1J8RA 1BECA 3IK2A 4XNZC 4LSTL 4W4OC 1N0LA 1UXWA 1WT5A 3FUFA 4G8IB 4KK9D 3T45A 3OPUA 3IF1B 4N6RB 1QO3A 4Z7QB 1EEYA 4OZ4B 4Q4IA 1Z7JA 4HXBH 1KCUH 5I1AA 2C1OB 3K46A 5IK3B 4CBPA 3VRIB 1N2RA 3HFML 4Y5YC 3ZYIA 3TWCL 1OT1A 1KJVB 2Y3NA 4PJ7A 3ZSTA 4QIRA 4CKVX 5ABDE 3HG2A 5AB2A 4YDNA 1T5WA 1ZHBB 2JIXD 4XPAH 2C9AA 1KJ2A 5MI0C 4B9CA 1M05A 3VW7A 2WKOA 4KDTC 3FQXA 1Z66A 1ACXA 4NDMA 1R34A 2GHWB 3Q43A 4LDOA 4A7GF 4JZOA 1UWXK 4PRDB 4ALAL 4L3EB 5CLXA 1F11A 3SDXE 4H13C 5ELIA 3P77A 2P5WA 3DMMD 3KG5A 1AP2B 4F15C 5E23A 2X38A 2RTTA 3QP3A 2JSFA 3BVDB 4RETB 2CH8A 5FYKH 1CI3M 5I1CH 1E4XL 4QO1B 4GUOA 2OAAA 4IIZA 2SEBA 5C9KA 1QA9A 2ED7A 1SRDA 2WVVB 2E7LA 1J1XL 1CQYA 4WEBL 2AJUL 3FYIB 3IXAB 1CFTB 4JFOA 3TM6A 3SIKA 2P42B 3CVHH 5GIRA 1U8OB 5D6DA 5C7XL 2ZZUT 2VDRL 4YSSA 3CX5K 1DJSA 5GGTH 3ZRFC 5SWSA 4F2ME 3HB3D 3JTSA 5DQDH 3QZBA 5HI3D 1Z5HA 3CMOH 4ATTA 4PTUB 4PWIA 4U1SA 1MAMH 3U4BH 4APQB 1RJYB 5C86A 1ID5I 4JO8A 1M0LA 2JH2A 1FGNL 2X1XR 1JZDC 3IGAA 4E41A 1GMIA 4U1KB 1U2HA 5G5DB 1F4YH 4K3EH 4BSWB 1PG7W 4HKXA 3S4SG 2W80C 3CPLA 3E38A 4NO3A 4NS0A 1A6AA 4MQTA 2NLJB 2XQBL 1DVFC 3QUZC 4X4ZA 1G1OA 2ENPA 3TS8A 2C9XA 4A2HA 2L04A 1M7XA 2DOCA 4XVUC 5IJDC 1SEQH 3H4HA 3HANA 1H0DA 5GRJH 2CLZB 5DC2A 4XVJH 5EU7C 2HJFB 4HETA 2A6IA 2XNAB 3QS2A 1U95A 4H2AA 4FG2A 1P84J 1HS6A 2JK5B 5GGSB 4N3TA 4R90H 4CC4A 1RUAH 3MA9H 4P5MB 1RIUL 1GA2A 3GMLA 3MROA 1ECYA 1NH6A 4FXGC 4KFMA 1T1XA 5K39A 1G9MH 3GSVA 5ICXA 2OL3L 3I9GL 5I16A 1P4BH 3R0NA 1I3RB 2R83A 3VDCA 1OZTG 4XHQA 2RFXB 2H3XC 1FIGL 2WYZA 2H47C 1EXHA 3IDMA 1Z9SB 2C4FU 4IEFA 4I48B 1MI5E 4ZX3A 2C3GA 2JCCB 5CLWA 1SJHB 1EJ8A 1XGYH 3PQYA 4ZJ9A 1DR9A 4NQCD 3ESVF 4DN3L 2EDXA 1W6WA 2K45A 2JQMA 2ZSWB 3NCJL 3U0WL 3G6JF 4J8RA 1KBBA 3QA3A 2IMMA 2J20A 1AGEB 2KSAA 2VR9A 3IDGA 3FSZA 5CBEB 2FX8H 5DJCA 5D1QE 4CN6A 2NNCA 2FBOJ 3DJ9A 4DUVA 4M61B 5DZPA 3H55A 5C0DA 1JDDA 3SPGA 2DICA 3QQDA 5B3SB 1J0HA 2XZCL 3ECQA 1UCQA 2Y07H 4M8UA 3CK0H 3NS0A 5CCHE 3FTZA 4BFIA 4BQ9A 3QI9D 3H1ZA 4O02A 2CO6A 1QATA 5E1HB 1T22A 2I60L 5F8RC 1M53A 3OLIA 4HWZA 4JFPB 1ZHLA 5CIPA 2W81C 2ARJB 4TQEH 2OMWA 4IRJC 3UTZA 5KVEE 4EUPH 4AIZA 3PDSA 3KPMB 4X6FA 2O26U 2VLRA 4OLWL 3PHQB 1BQ5A 4XMXA 4TLUA 4RDQF 3HUJA 1UGKA 5ISZD 3O41B 1X4ZA 4W9FC 2WP3O 3JWNH 1PZ5B 2YAEA 4Y5XC 1MCOL 2C9SA 5DMJB 1NCTA 4R4BB 2DY2A 5I1EH 4KUCD 3P30L 2FX7H 2F53D 1Y6NR 4KTYA 2NTSP 3CFTA 3LN4B 3F7KA 4JANA 1I1AA 5DD5H 4N2IA 5H37H 4M6ML 1TQSA 3BZ5A 4TUKH 2QKSA 4W9KC 1DQIA 3APMA 1QSFB 2P8MA 1KJ3H 3MLTB 1GZPA 4G7YL 4Y4FD 3PNRB 3WFCL 3QRGH 2YAQA 1EMTH 2CK0L 4ZFOL 2CGZA 1MRFL 1E9OA 3LRKA 3ATBA 5CMAB 5JOEA 3ES6A 1XH3A 5TQ0L 2WANA 1ZVSA 1FNLA 1ZRUA 5DZAA 2IBZX 3C2AL 3EDKA 3V52H 2FQFA 5K9JL 4QOKB 1V7NH 4UV7H 2XWZA 3MOQA 5D5MA 3O6FB 3R8QA 2XY2A 5F3FA 2MQCA 2ZX9A 4GUCA 5F21B 4Z7WE 5A3IC 2VDQL 2RQ8A 4U3SB 1OPGL 1DQKA 1QZNA 1BWWA 1AI1H 1VGEL 3V5HB 4MMYB 2X40A 2HG5B 2KYIA 3OE0A 4LSPH 4MSWA 4NKOA 2JKLA 5FWQA 1GGIL 1UOKA 5F0JB 2WLNA 1CUOA 4YZWA 2B9AA 3VXRD 4K94C 4IS6B 2JKNA 2LAGB 1AKPA 5F72S 4PBWD 3KHQA 3UZEC 5B38B 4WSKA 1RZGA 3AAZB 3FSWA 3MLSL 4U3CA 4KZDL 3STLA 2PYEB 3QC6X 1D6EA 5IWLC 4I18C 5KW9L 2EUZA 1GTNA 5F0LB 3US1A 4LIQE 5FYJL 1UXSB 5F1IA 4DQAA 2XTJD 3BPCB 5A45A 1EEZB 1HJBC 1J1OH 3DETD 5AB0A 1EXUB 3TFKD 2G5RA 2ATPA 5LNEA 1ES0B 3FPYA 5E8PB 2EUVA 4PH8A 3VD3A 4BKTC 1UAZA 3S8FB 4JY4B 4P0DA 4X7FC 2OXHB 3D34A 4G70B 2FH6A 3AROA 3VXQB 4AGMA 1KXTB 1WV7T 3WFDL 3DJZA 4HD9A 3DUUB 1KENL 1MFCL 1J05B 3KPSA 1ZTXH 1J5HA 3NCXA 4IOSA 2FGWL 4RIRA 3WNNA 1BX2A 4IW4C 4ENZA 5I15L 1X9QA 3D7PA 4I9XA 4LLQB 1S7TB 3L7EA 3VDBA 4NI6A 3L4CA 1FZOB 1YYLL 2YXFA 1HEJC 4U6HB 2WP3T 3TZVC 2SEBB 4DO5A 5BQ7B 3FMGH 4PLKD 5D1ZB 3WY3A 4MJHA 5L7XH 3RZCD 2X0WA 4BM7A 2YGQA 1P7QD 5AUMA 1DVXA 4YSTA 1N5YL 5AWNH 5GXBB 5G54A 4QTHB 4MA8L 4HUNB 3BKML 3WJLC 4YFEA 2R4SH 4MAYA 5DDHB 1CG9B 3H85A 3MA7B 1YNKL 2Y7QB 3FS9A 3HMWH 4ISVB 4OZGA 4K0OA 3AYNA 5E8EB 3QAKA 3JUZA 2YAPA 2L7JA 3JTSB 4P06A 1RFDL 3GTTA 3H2QA 3I75A 1ZGLA 1UYWL 1KIQB 1MH5B 3TEZA 3WSQL 4WF7A 4U1MA 4PVBA 4WY7L 1RJLB 4V1DB 3SQBB 3HCVB 4M03A 3WFHB 1IAII 2VZ3A 1S8DA 3WJJA 4LAQL 4ADGA 4HKJA 4IQHA 4PLNC 1IBZA 5I1IH 4X6DE 3MO1B 2LLNA 4OIIH 4YHZL 5F7WC 2OTUB 3QJTB 2F7OA 4EI6B 2DBLH 3FZUC 4AZ8B 3B1TA 3BAYA 4MHHI 1T21B 5ACMA 1OTTD 5D6CB 4Z77A 3S36H 2C1PA 4UU9A 1OO2A 3GMQB 1QLRA 1I8UA 1SY6H 3AU1B 1AXTH 1ZVYA 4KXAA 5KVGH 4OZIE 5CKAA 3U9WA 3T6XA 4V2BA 3U7WL 5EC2A 3MUY1 5GGSY 1PZ2A 3VXMD 1U95B 2N59A 5I76B 2LABA 4LDLB 3MKGA 4X6CB 4QGYA 1L5GA 2KZBA 5DEGA 4NUJA 4G9FB 3VTTA 4QWWC 3HPJB 5C9JA 1RP9A 4TXVB 3VUAA 4UQBA 1DN0B 1G5GA 2R2BA 1AO7A 2DTMH 4U6XB 3ZHFA 3MV9A 5F70A 5HYSG 3MCG1 5KSBB 3OLEA 3SPHA 1OAKH 5EFIA 1F4WH 1XZ0A 2F54B 3CDGA 4W93A 1YY8B 2J6WA 4ZZFA 1UA6H 2AJSH 2VN3A 3H0TA 5JPNC 4Q14A 3B2VL 4I0PD 3VFVB 1ZV5A 1P1ZB 4FL4B 5H94A 4TSCL 3ULVL 1MWAL 3FRPB 3QT2A 4JVUA 3PLYA 4V33A 5AYQA 4HOWA 2VDNB 3BGMB 3VSVA 2QPEB 1R5IB 1NOLA 2W07B 3IAPA 4GIPD 4XZUA 3T0WA 4Y4HC 4BE5A 5F6HJ 4YL4A 4UQCA 1DSWA 4UTBL 2B15A 3RPBA 4YOKA 1HINL 2IBBA 1LP9E 1IC7H 1N8ZB 2H7WA 1AC0A 1X9RA 5J6GA 5I2IA 3RPIB 4HLJA 1EVTC 4ZAKC 1TDQA 4DSYA 1CD0A 1PGRB 3VGDA 4EE2A 3IFPB 3BZFA 4KRNA 4FHJA 4YZFF 1V3LA 2NY6D 3N6YA 4TNWK 1A7PH 4KJYA 2ZAGA 1CFQA 2IDUA 4CN4A 3WY1A 3HZ3A 3G5ZA 4DUXA 3DVGA 5AVQB 3CDFA 1OF2B 5ID1A 3MI6A 2CLVA 4KITB 2WQSA 4HGWA 1CFVH 2FWSA 3CZFA 1EIBA 2P47B 4ONGL 4G43B 4POUB 4Q74A 3IBOA 3ZYJA 1LO3L 3JWOC 4LF3B 1HESA 4P23C 2V4LA 4OCSH 1F6AA 3SODB 2FIRT 3T6VA 5BOZG 4JRLA 4GXVH 4H0HB 3L4WA 3K6FA 5HYEA 2H2SC 2VDMH 3EBIA 4JFFD 5EZOH 4BZYA 1PJ9A 4K9JA 4XPFL 5I8KL 2YC1A 3E3QC 2DM4A 1NC2D 4L8DA 4BSJA 4ANKA 3CCHA 3ZT6A 1IEAB 2VE6B 4JKNA 1KUMA 4JDVB 3HAOA 1D9KD 3F84A 4C55A 2X6MA 3P3YA 5ITEA 1IFRA 4YQXH 1CFBA 4UQ9A 4ZQKB 4BRVA 4P46D 5DJZA 3TBVA 1P4LB 3SE4A 4F3FA 3A5VA 3MLZH 3E6FA 2EE3A 4UV4H 1NCOA 4L23A 4KV5E 2VQUA 1S9YA 4YBLB 3T3MB 1KNOB 2WV3A 5EN2A 3VCLA 5DWPA 5DVLA 2Y00A 1TQBC 3LS4L 2NNAA 2EC9U 4L3CB 4MS8C 2EVFA 5D1XA 3SKNB 3A6CH 1D6VL 3HRPA 2DQUH 5JXEC 1AGCA 1JNLL 5ICZB 1HXKA 3QC5X 4FLRA 3ZTJG 1A14H 4B3EA 3L5WA 3C75A 1RUKH 1WTLA 2F58H 4XCCL 4JM4H 3U46A 4EN2A 5E6IB 4IU2A 3TCLB 3T0EE 5DD3L 1E12A 4YSPA 1IUZA 2FIKB 4QPEA 4AMIA 3SGJA 1KPVA 1HT6A 1WFUA 4RAVA 4EBQL 4PY7A 4RMRA 5AVRB 4L29B 3C9LA 1CICD 3H54A 1L3WA 3STLB 3X3FL 2WJKA 2YAHA 2AT9A 5F89A 4N2MA 4Y2DA 1CURA 5F9DC 4JVPA 4MWFB 4AH2A 3RVXC 4DGYL 3F62A 3ARFB 4WJ5A 1TJIL 1VGOA 1NC4A 1VSCA 3EH1A 3MRLB 3NZ8B 1JE6A 4XMUA 25C8H 1INEL 2XXFA 3QDGB 2Q6WB 1B2WL 4RDQG 2GCYA 3T09A 1ICTA 2VKWA 1GYVA 3DX9A 1M1XB 3TP4A 2IH3A 2YS4A 1N64H 3HUJF 1RPKA 1G7HA 1PSKL 1ZS8A 3GWJA 2VQ1A 3CJJA 3H9YA 3PP3H 2AHIA 3QHFL 3GI9L 1P5UB 1YG9A 3MOAL 4XBGA 5KBNC 3MMEB 1FV1A 4XP9L 5DLML 2R29L 3LV3A 4X4MA 1Q0YH 2A6DA 4P2RA 1EFXB 3FCTA 2IFFH 2ZXDA 4MCMA 4YHNA 1QR4A 1OB0A 2BS9A 1ACYH 1YNLL 2HRHA 2CUIA 1HE7A 1RD6A 4L0YA 5IT2H 4DP7X 2BK8A 1W91A 4Z3JA 5IOPA 3T4YA 2D7PA 3WHE1 3ETSA 3KBHE 4LSVH 1A1MA 4IIQC 2E76C 2ZWLT 4M3JA 3AYMA 3NPZB 4LHUB 4DGIL 3BKJH 3WUZA 1VZHA 1W72B 3ERXA 1S7SA 3IWUA 1BZ7B 3A67L 4JRXA 1E4WH 3G5YB 3W56A 2EYTB 1G84A 4DCQB 3CFDA 3EFFA 2J7LA 2EXYD 2RBLA 4FTDA 3VGBA 3TJPA 5D5MF 2V0AA 4HH9B 3E7JA 3EYOB 3PJSB 2BVTA 1O7VA 3LH8A 5T1KB 4EIYA 1LO4H 4JQ6A 2PPFA 4ZTPL 1DL7L 4XN4A 2GKIA 3IDJB 1G6RA 4CBZA 5IB5A 2ZCZA 4HJIA 1E4KC 3MRNA 2HMIC 4PJ9C 5I71C 4CGTA 5AG8A 3IPEA 2J8UA 2OMXB 4DKEH 5DVNA 3IJEB 4JO3L 2ATKA 1KTDB 2X2HA 5EO1A 2BXYA 3BP7B 1DJZA 4KKAD 5D7KE 4Z7VA 4KJQD 1KSRA 1WIUA 3L3JB 3VFGH 1BQRA 4J3UA 2UZYA 5FYLD 1RCYA 1DZ0A 1RZPA 3DOSA 3UH8A 3MLVL 2CA3A 2EIZA 1KYUA 3GBMH 5C0AA 4Z77B 2C7UB 3ZE2B 3GI8H 4NX0A 4HPHA 3OJVC 4NHCH 3FOMB 5KJ7E 5MEQB 1U8JB 2WXKA 4M62H 3GXMA 1A4AA 3VRLF 4DKDC 4PJAB 4TUOB 3ULUH 1ZV9A 3TA4D 5FHBL 2NX5E 2OXGB 5EU6E 3JXAA 2UXGA 4ANWA 3HI1B 3CVHA 5ICYA 2FJHB 3BWUF 3IRCA 1QASA 3WLWC 1JZ6A 2Z6FA 1TQCB 1ZXKA 3SKJH 2R0WH 1ZIAA 3GSXB 4GI6A 4WWKB 5I74C 2WNXA 1OAQL 5GGTA 1MCRA 4OM1L 4NUJB 2BOCA 3L5JA 3CTTA 4NAJA 1LDSA 4A66A 5K9QI 4XNMB 1I82A 3DX6A 3Q8CA 3QNXB 4P4KB 5EZJA 1FN4A 1RZ7H 4WU7A 4B9JA 2EDTA 1Z3RA 4TKWA 3VGGA 3VHZA 2I85A 3FQWA 1PDKA 2NXYD 4JRYD 4P57B 5J13C 2LR4A 1KYAA 2JE8A 1RHHA 3V4PL 4GKZA 4NNPH 1YECL 2G2RA 4KKLD 2OZ4H 4UINH 5FCUH 3GSNH 1XMEB 3ESNA 3Q44A 3UYPA 4E2OA 3PDGA 4ADIA 3U6XS 3ZT7A 1BFVL 1BGXL 3EYUH 3P0YH 4MCZB 2OMTA 4GBXC 4Z7OB 3KLDA 3UO1L 1LYQA 2NY3D 1SF5A 4N8VB 5E2WL 2NOYA 1HKFA 4R97B 3REWB 1RPUA 4UOZA 2MKWA 3C6LB 3II2A 3A7KA 4XMTA 3S3DB 3RVWD 1IAIM 1NFDA 2GBUA 1CLOL 4GRLB 1DLHB 1VADA 5JW4R 4DETA 3HC0A 1U36A 3HA0A 4BK4A 3QWNA 4P5RA 3L3HA 3CQFA 5KYWA 5KG9A 1TO4A 1AFVL 1J9RA 1AD9A 3JQOB 4BUOA 1CFQB 1A8JH 1TZ8A 3QRFM 5CJOH 4L9LB 3RWEA 1NL0L 4NNYA 3DRQB 2F8IA 4B9FA 1BBJA 2VR4A 3IMVA 3MJWA 5HHOB 1AXIB 4JM0A 2ERJC 1I7TA 3G6DH 1MLBB 3IJSA 4LLAA 4D9LH 3LKNB 3DO4A 1QUNA 1AZCA 1NEZB 1NPNA 5DJAA 1QFWH 5I1LA 2YPKB 2APTA 2HRPH 3Q8EA 1A21A 1JK8B 1XX9C 1U8IB 3HBQA 4MD5A 4MXWL 4XMLH 2KI6A 3UTQB 1JGEB 5HHPB 5A2CA 2F6AA 5C3LD 3ZO0A 5D7JB 3SGDH 5IHWA 2YLHA 3D0AA 4XX5A 1NCAL 3LKOA 5AB1A 5LGYA 5D93B 4M1CD 1I9IH 1PIGA 2IH8A 5C08E 3LEXA 4IBUA 2Q3AA 4UM9D 4QRRD 3EFDH 5CUSL 1UWGH 2KQNA 5LDUA 3NJVA 2BSEA 2AV1B 1CFSA 2DBJA 4M6OL 3KLHC 3Q6FB 2YN3A 1U3ZA 3JTTB 4G5ZL 1I75A 4MMZA 3UTSD 4CVXB 3RJOA 2X09A 3VMPA 5DD6A 1OEZW 3U1QA 2XXMB 4HC1H 1ZANH 4P5TD 3TA3D 1XMWA 3CFBA 4EUPA 3DJTA 1M2VB 2CKBB 3ZJAA 3PGDA 4AKOA 1S5HB 3JWDC 3QISA 1J7VR 2DF3A 4X7EC 5BNXD 4WDIA 3MV7D 5IMMB 1J8HB 4TL5A 1ZK9A 3A23A 1PBYA 2DYPB 4MKMA 3I9AA 4ZYKA 3CZEA 1QRNB 1EAPA 1XAKA 3V2YA 5C92A 4NWTH 2PETA 3BLBA 4F1SA 3IETB 3D39A 1NANI 5FXCH 4NQXA 3ETTA 2ZG3A 4WEEA 2TRHA 3MV8A 4K2UL 2X4PA 4ODBD 2MCAA 4J8QA 1BVKB 2VR5A 5A43C 2E86A 3VG0H 1KCVH 3VDAA 2DIAA 3RL2B 4AGOA 1AHMA 4BEYA 3TFBA 4AC2A 4U1LB 4XH2A 2NY2C 4HMDA 5E1AB 5GGVL 1AHWA 2NR6D 4ONOA 5KZCD 2K78A 5IR1B 3G6AA 4FFWC 3FH8A 5I0YA 1BQHA 3EHBB 1Z1WA 1C12B 4XBPA 2F93A 4JCLA 4P2OA 3NIFF 3GBLA 5LBSH 1R3LB 3ALWA 4PMFA 1OOWA 4PY8I 5DJ0A 1ZJAA 5L2KE 3TPUB 3TT3L 3P69A 4DTGL 2BNQB 4LEEA 4OZHB 4WFGD 1RULL 1BBDL 1QTSA 4XWOC 1SMOA 1C8PA 2OSLB 2C3VA 2NY1C 2VXTL 2ZUXA 4LASL 3WN5C 5ID0A 1KGXA 1UQSA 2ZCLL 4UQDA 3FCTB 5C0BE 4XN8A 1QEWA 3WTVA 4PGEA 2A9NL 4HIIA 5FB8B 2J21A 4LEOA 5JUEH 1P5VA 3T0XA 3DX1A 5IV2B 1YEFH 4GIAA 3RUGB 5AVZB 4EZKA 4KNTA 4AEIL 5INDB 5AW4B 3QZOA 4TNWF 3CHRA 1T80A 4FNUA 5CEXB 2CGRH 3NSXA 4IARA 4PSRA 3NEEA 4HYTB 1UURA 2V2WA 3W9EA 1IGCL 5ACLA 3FXIC 4LVEA 3CX2A 1LO2L 1A64A 4BFBD 1J18A 5JIHA 3MCKB 2UUDH 5I73B 5FM4A 1XCQA 3W0WB 1FNEA 2FBRA 3CN2A 5JHDA 3LSOA 1N18A 3UTTA 3VYNA 2ZP9A 4YR6A 2PTTB 1EBAA 2OULB 4PW3A 1NPJA 2D3VA 3CODA 1DANT 1NCCH 4XPHH 8PAZA 3DPBB 1ORSB 5LG1A 4JB9L 3V4VH 5LXVA 4RAHA 3BFWA 3BSZL 3HE6B 4HIEB 3NA9L 5DWUL 4XMKH 2WXMA 5EO0B 4ZZKA 1BLIA 3RFZC 1LD9B 2UY6A 4HMCA 4ENED 4I0CC 3FU6A 2ADIA 4TN9A 5BRZA 1S9VA 2KS9A 1AHKA 4L4JA 5EUKA 4H8VA 1JCKA 1WH0A 4I3GA 2ZWNA 1E50A 4NIYE 2VM9A 1OAXL 1J12A 1NIEA 3CFMA 1XGPB 3N41F 4PJHF 1KGCD 3WELA 2I9LB 4F92B 4D9RE 2EDYA 4Y19D 1J11A 5I18L 3OB0K 3QDAA 3GIZH 1BFTA 4XB7A 5AD0B 2ITCB 3RKDC 5D9SB 3CVIL 5GGQL 4PJEE 5E5LA 1AACA 3SEPA 1KYOJ 4FN0A 4M02A 2DQFB 4WKXA 1H68A 1URIA 1EFQA 1WFNA 1CDGA 4TF4A 5CEZL 5F1KC 2X72A 1RZJC 3LZFH 2E3VA 3OKDB 4RQQB 4KI5C 1DDHA 5F6IC 5CO1A 1Z5YD 1X5HA 4JHAH 4KXZI 5J1AB 2PXYC 3NJIA 3SN6R 1I3GL 5E6UB 3HNSH 3MLPA 5BUAA 2X7LA 1G4MA 4FAAB 4ZFZA 2BIIA 3TNNB 1RQ5A 3QEQB 5B2NA 1ZA6A 4U7KA 4PRPB 3E2HB 1UM5H 3QQ9C 3TESA 3L9BA 4KZCA 3CC5B 5FYLL 4MD1A 1BD2D 3DHUA 5DHVB 4LU5L 4OCRL 5I6MA 5F96H 1JV6A 2VN7A 3KWVA 4IKNA 4OKDA 3V0IA 3WFEL 3OC5A 2FEDD 4M7KH 4JPWH 4ABUA 5EIQA 1NM4A 4XBMA 4NCC2 3BVNA 4JVWA 4BK5A 1DBBL 5IG7A 4OU3A 5IHHA 3FU7A 4V2CB 1MW0A 2ENQA 1GUEA 3L4ZA 4ES8A 5E5RB 1SY6A 3ZYZA 5A40E 3NCBB 4BGLA 2DQIH 4JGMA 1G0DA 3FT2A 2GVYA 5I75B 3N44F 1S9WB 2OYMA 4GRMA 3SCMB 2A9ML 1A7QL 3UC0H 4KKRA 1J9TA 4JZNA 4RZCA 2B4CC 2ESVA 4WO4B 4N86A 2DQJH 2YHGA 3MLWH 4X2UA 4EDWL 3FONB 4QMEA 3QJUB 1WZ1L 2PO6B 4M1DH 1RUML 5EC1A 5FV1L 4XP1H 4AMWA 5H2OA 5IMLB 4ELMA 2UZPA 4I2XB 4PRIE 1ECZA 3IDIB 2J8UF 2FTAA 3GDCA 4A7SA 3FQTA 1NKGA 3ZN6A 3VE0A 1G5AA 1F90L 1OCZB 3NGBB 2EP6A 1YMHA 5F0MB 2Y6TE 5D2LB 3DKHA 2X4QA 4XNQA 3IU4H 3QNYB 3PPEA 5JO5B 4AZUA 4AQ1B 1IBBA 3O4OB 4IMLA 1IC1A 4LE8A 3TPKA 4NRZB 1TMQA 4FHBD 2UWEB 1I1FB 3MRHB 3GJFB 2OTWB 3LZOA 2BH0A 1G7IB 3QNZA 4Y9EA 2F68X 3TBWB 2AKRA 3NFPB 4EI5B 5I0DA 3LEXB 4HK3N 2BOBA 5TDPB 2WXGA 2CXKA 5JIPA 1A1NB 4Z3HA 1QNZL 2E8ZA 4HUUA 4I0KA 1SOKA 5JW3H 5ADOH 5F3HA 2V9UA 5E1IA 5F1SA 3MNWB 4Y1AB 2BSSB 4JPSA 1MNNA 3ME0A 2CR3A 3EYVB 4HXAH 4GPOA 1TETH 1PFCA 4GG8A 5AZUA 4JFDB 3RNQA 5C8JA 3S88H 5ACZB 5BUGA 4ALAC 4L3ED 3FT3B 3G9AB 3JZYA 2AJVL 1CLZH 7CGTA 2VT4A 2HXAA 4PJCA 4XRCA 5DFAA 1ZVNA 4GS7B 1KB5H 3D0LB 3K72B 1ZWIA 1JPGB 4HIJA 4LESA 1NJ9B 2YMXL 3PXJA 3HBZA 3RURA 2P80D 4DUWA 35C8H 4NRXB 4GW4B 2A38A 4AENB 4TTDC 4NT6B 1NMCC 3HLAB 3A24A 1M7IB 3IJ7A 2B1HH 2HVJB 2ZXCA 3I02B 4OF3A 5B6ZA 4S11A 2R0KL 1H3TA 2R23B 2XN2A 2BWDA 2CNZA 3NFSL 2YPVA 4TRPL 3EBAA 4LGPB 4JS7A 5CEYB 4LPTA 1NIBA 1WUNT 3GMOB 4MJ5A 4ZUVA 3MNVA 4BUQA 3PWJB 4BH8A 4ERSL 1KN2L 2EACA 4APQD 4Y9FA 5CINH 2F0CA 3MRJB 5HY9B 2UZXB 1KJMB 3E0GA 4NCC1 1GIGH 2JXMA 5C0JB 3ARGB 4M1GH 5JZ7C 5B1KA 5IJKC 1RIHL 4GAGL 3CVCA 5JJEA 3BRGC 3A6BL 3L2MA 1TO5A 2VMCA 1G9HA 2YGVA 3HC3L 3TBYB 3BN9D 3BW9B 3CLEH 1RK7A 4LARH 1JFPA 5C09E 1IGIH 3F58L 3SN6N 5HYJB 3MFFB 3H6JA 1MREH 4L5FL 6PAZA 2QADD 1FCGA 3MBEB 2F8XC 1HX0A 2CIIA 4LEOB 2MNJB 4R0LA 2BRRH 5DJXA 3VH8A 1FH5L 3WQJA 5DS8A 5C07B 3SDCC 2Z93B 4KK8C 3ZRCC 2YMTA 4P3CL 3MRFA 5KOVC 5AAMC 3ULVE 2WLLA 4L05A 4EO5A 3QE5A 2VLKE 1A6TB 3PIQA 3PP3K 1YEJL 4NWUH 3DNKA 2BFVL 1CR9L 2A0LD 1HWWA 3PFQA 3VW3L 4OLYH 4BD4A 5KVDH 3A4FA 5EF1A 1MCPL 3AU0A 1D7BA 1XL4A 4JO5A 1H5BB 3AB0B 1L6ZA 2YD8A 1PS3A 3L9RB 1A6VL 5CLTA 4Z95L 4YDJB 4ONHB 2Z55A 3ESOA 1MJUL 2GFBA 4G2AA 3CSGA 4N24A 4F58L 1IT9L 5L88H 2YGPA 1SXAA 5EG6C 3KPRE 3NRQA 5TE7H 1U42A 5IM7A 1NCJA 1F58H 5FGCB 4C57C 3MRRA 2K3TA 2WXQA 4CSSA 3TBSA 3FQUA 1T66D 1DVSA 4OUUA 1H8NA 2I1XA 3NN8B 5FHAH 3OXRB 2V5YA 4QLRA 3NPSC 2ICEA 3DXAE 1FGVH 1Y18B 1IGFH 5EUKB 3VD0A 4DAGH 3ZQXA 3IRZA 5LGHH 3BFOA 3NY8A 3F00A 3BEVB 1Q94B 2X4UA 3N5AA 4IAQA 3Q1SL 4ZDHA 1OGAA 3EYQC 4NZJA 2IO5A 3BJ91 3WTTA 2BZDA 2FATL 1JTPA 5HDBE 5TDNB 1UT9A 3DI3B 3GINA 3F83A 4UT7H 5I1HH 1XGUA 4QRSA 3VI4E 5EU5A 2UVEA 5AW6B 3TF4A 4KKCD 4FQPA 3N1PC 4P3DB 4ZPVB 1I85C 1ADQH 5I6PA 4AUYA 1KELH 4XNXL 4HS3A 3V6FB 1UT1A 1HEZB 1V10A 3PWLA 1B0RA 5TFSH 1C8RA 1J0IA 3RGVB 2VB5A 4KO6A 3MRDB 4BKLB 4AJVA 1U6AH 1O0VA 3QG6A 4J1UB 4OJDH 1Y6MR 1GAFL 4EOWL 3ALXA 2H4EA 4AQAB 3X13A 4JFXB 1Z5LB 3R18A 4NUPA 1XIWC 3KWUA 2K9UA 3ARDB 2D4DA 3GK8H 4X8CA 4NO2B 2D7NA 2OX5A 3WKYA 2F53E 2LLLA 1T83A 3F7QA 1TSRA 1UJ3B 4X7SL 1PZDA 1YDPA 2J5LC 1RAMA 1QSFD 3H9SE 3CUPA 4YHPA 3MLYL 3QUMA 3FO9A 1ZDQA 1A47A 3FHAA 1E28A 3QUXC 1RJZB 5J7AA 2WLZA 1JPSL 3RWDA 2Q10A 3LH2L 1WWWX 3MOBH 2ROYA 5DJ2A 4XTRD 2YKLH 4R96A 3SDAC 3GO1H 3FQNA 4HUMB 2PCPB 4QOKD 1MLCA 3GHEH 3O6FD 1JZ3A 3HS0A 1AG0A 5C0IB 1HZXA 3RAJL 1JGLH 3LQAL 1WRFA 3UZQB 2Z35