4N4YB

Structure of recombinant cytochrome ba3 oxidase mutant g232v from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant G232V from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4yB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4n4yB02
2ZIYA 4YSOA 4OV0A 5H2PA 1A4BA 3GXUB 3QBLA 2XV3A 2R4RA 1AS7A 4BXVA 4G70B 2G87A 5G2CA 2DYRB 4MQSA 1QLEB 5ITEA 1SJMA 2OJ1A 4AI7A 2HZHA 4HYXA 1QHQA 3FSAA 1X0SA 1S8JA 2LNLA 2CUAA 3FT0A 3ZDWA 3PPSA 3X1BA 1GW0A 2AFNA 3WNJA 4X4KA 1BRXA 2FJSA 1XB3A 3MX0B 1IC0A 1KCWA 3VVKA 4HHWA 1JFPA 1QKOA 1BXUA 1E5YA 1L9OA 3U25A 2WO2B 1J9TA 5TK2A 5KKHA 2IDTA 4GXFA 3C9LA 2GI0A 3KW8A 1C8RA 4KO9A 5PAZA 4AKQA 5TGZA 3DQBA 1XB8A 3IEAA 1M57B 1WA0X 1L9TA 5C1MA 4YSCA 1PF3A 1SFHA 1WA1X 2I7OA 1L9PA 3X3CA 1E67A 4A2EA 6PCYA 1S8LA 4DPBX 4NERA 3EH3B 5B2NA 4N4YB 1IBYA 2JAFA 1KMEA 3NS0A 1ILSA 4DKLA 1BQRA 1ZIBA 3PLYA 3T6XA 4QLWA 3PWHA 3NJFA 3QPKA 4TL3A 5H2JA 2L6XA 3FQ1A 2AVFA 3FSVA 3NSYA 2FNWA 4BEYA 2IDSA 1NIDA 2BP0B 2YQBA 5I6MA 4FBZA 5G28A 1J9SA 5LWEA 2IDQA 2GC7C 1VJMA 2JAGA 4YVUA 2FQGA 4DPAX 1QM8A 2IWKA 2I35A 4FAAB 2QPEB 1NDTA 3HANA 3HAOA 3FSZA 1A65A 2HRGA 1GY1A 4NAJA 1RCYA 1SDDA 3COCA 3PXLA 2BZ7A 4UAHA 3UADA 2YAQA 4YVNA 2FT8A 2VSKB 2GC4C 3AW5A 1ET8A 2A3TA 2ZONA 2VW7A 1OOWA 3T45A 2GIMA 1ZV2A 2H3XC 3H56A 4HZ1A 4E9YA 3T6WA 1L9RA 2GBAA 2X72A 2XYBA 3CVBA 3FPYA 1U19A 2VMJA 4XT1A 2PPDA 3FQ2A 3OMNB 3SBRA 1QNIA 5I5IA 3VG9A 2H5UA 1FA4A 1CC3A 1MGYA 2I85A 4KNFA 1BRDA 1AG6A 2GSMB 1MG3C 3FU9A 3OD3A 4F2EA 1NZRA 3KW7A 1KCBA 2RACA 3CG8A 1URIA 1PXRA 3AG2B 4BWUA 1AACA 2NRDA 1IW6A 1RZQA 2VT4A 4XXJA 1BQKA 4Q89A 4LDLA 5EHFA 5JJJA 2IWFA 4F7KA 2YXWA 2I1XA 1PZBA 3NY9A 2HLEB 2BO0A 2QT6A 2YAOA 1HAUA 2BP0A 2PLTA 5G36A 2I20A 5B6YA 1DZ0A 2CJ3A 2J57A 2VSMB 3N55A 1NPJA 1JXGA 1OCOB 1TN0A 2KSYA 1ZDQA 4DP6X 4YSQA 2BWDA 5B35A 4IB4A 3P0GA 1N68A 3SN6R 2EINB 3QDCA 2ZFEA 1BYPA 1TEGA 5BR2A 3X1GA 4YSSA 1GS8A 3ASNB 1W8EA 5F7AA 2HX9A 4A68A 1H2SA 2B3IA 2E86A 5B1JA 4W1TA 2OCCB 1FBBA 4QIDA 2P80A 5B0WA 4KNSA 1HZXA 1GR7A 1R2NA 3ZX1A 2KSAA 3TBCA 5AHZA 2DYSB 1C3WA 2Y03A 4QI1A 2HX7A 2PCFA 4MFHA 5I6PA 1AANA 3NJKA 3OAXA 1T5KA 3UAAA 1QHJA 1N70A 3PDSA 3X1NA 2FT6A 1AZUA 2QDWA 5I5MA 1IXFA 1BYOA 3UAEA 5G53A 2HRHA 3QJUB 1NWOA 3NSCA 2JFCA 3HARA 1RKRA 3NJLA 4A2FA 5B3SB 1PAZA 6PAZA 3X1FA 3OE0A 9PCYA 1JXFA 4DP8X 4J4QA 3ZEVA 1A8ZA 2GHZA 4G7QB 4QRYA 5J7AA 2MRYA 1JZEA 1KBWA 2X87A 3QBKA 5I6KA 5AX0A 3S8GB 2N0MA 1L9QA 5EN0A 4BEZA 3AG3B 3FYEB 2ZWNA 1J5DA 4TXVB 1S51A 3IE9A 3V2YA 2KSBA 5H2HA 1ETJA 2YCXA 1M56B 5G2AA 2YAHA 2R7EA 4RH4A 2YCWA 5D4IA 5H2LA 4FA7B 4BWWA 3FQYA 2XXGA 5PCYA 2BRDA 3RFMA 1SHWA 1P8UA 2VM4A 4YSPA 3CDZA 4QKTA 1JOIA 2YAPA 3FSWA 1IBZA 2PEDA 1ID2A 3BQVA 1IW9A 1IKOP 3NYKA 1OCZB 3S3DB 1BM1A 3FS9A 5FC9A 1AZNA 4MQTA 3AG4B 4YSUA 1KG9A 3WG7B 2H47C 1ASPA 5B1BB 3PQRA 2YAEA 5B1JC 3TU6A 2F95A 5G2DA 1JGJA 2KS9A 1V54B 1RZPA 2Z55A 1NICA 1WA2X 3WKPA 1PY0A 4GYBA 1CWQA 1F4ZA 3CODA 1GS7A 2I7SA 3AZUA 1AAJA 5B6XA 3OE9A 4Y9HA 1JVLA 1YLBB 2X88A 1ILUA 2VW6A 4GRVA 4WW3A 3QJRB 3HB3B 2BW4A 1BQ5A 4MD1A 4UF7C 2W88A 3PAUA 5BR5A 1AG0A 2GB2A 1CURA 3MBVA 3QBGA 1ZDSA 4BDVB 2JKWA 1M0LA 3AG1B 3KJ6A 4E9TA 3DIVA 5D4JA 2HXAA 2Q5BA 1KGYE 1AZCA 5IY5B 2XX1A 4K5YA 1W6LA 3UTVA 1FWXA 1L0MA 5ANHA 1NTDA 1P8HA 3ERXA 2YCYA 1JZHA 3FU7A 3UABA 3IBOA 1Q5IA 3GDCA 4PCYA 3FU8A 1X9UA 1L9SA 3PAZA 1M0MA 4LDOA 1PLCA 3WIAA 8PAZA 4L35A 2HX8A 4DP9X 3RZEA 1FFTB 1UATA 5H2MA 4XTOA 5B7EA 4DAJA 3ZIYA 1EHKB 1JXDA 3CAPA 1W6WA 2BP8B 2PPCA 4XT3A 1BXVA 2B08A 3T6ZA 4KO6A 2CAKA 3CDZB 1B3IA 3AYMA 4G7RB 4EA3A 2TSBA 5I6OA 2YDOA 2EIMB 3L45A 1X0K1 1JZGA 3FU7B 1BRRA 1E30A 2PP8A 5AFAA 1R84A 4ZK8A 3FPXA 1KYAA 2RH1A 4KOBA 1MZYA 1GS6X 3ABKB 5B6VA 2IH9A 4PXFA 1O0AA 1NIAA 4GY4A 2XV2A 1HAWA 3H4FA 3ODUA 4GP4B 1X0I1 4AMJA 3C9MA 1SF5A 5F8UA 1PZCA 3QJSB 2YAMA 3OMIB 3ASOB 3OMAB 4W9ZA 1M0KA 1JERA 1AP9A 2WSDA 4UANA 3NYAA 1GU8A 1WS7A 1TN5A 1KG8A 3VGAA 2UXVA 2EILB 4JKNA 1XJIA 2WJKA 4BUOA 1V55B 2DWSA 1MDAA 4A66A 4AZUA 3EH4B 1JZFA 2FQEA 2IH8A 3NSBA 2XVBA 3HAQA 1NWPA 4YSDA 1E5ZA 1SFDA 3DTUB 4L6RA 2QPDB 2Y04A 2PP7A 2Y69B 3ABWA 4YSEA 5D4HA 1MZZA 4N4WA 4BV0A 1NIFA 5B34A 4JQ6A 5AHYA 4M4RB 2IWEA 1E12A 1M9WA 1S52A 5H2KA 4X31A 2ZXWB 4P5SA 3PBLA 5ITCA 1OE3A 1JZJA 4CSZA 1XMEB 1E65A 2CALA 4ENZA 5DHHA 1KV7A 4AX3A 5I5JA 5B7FA 1QKPA 1KGBA 1PLAA 3N2JA 2BW5A 3AM6A 1TU2A 4AKOA 1UAZA 4KNTA 3UZAA 2R7EB 5TK4A 2J5WA 1KBVA 4G71B 5AX1A 1F88A 3X1EA 3AYNA 5I26A 2JXMA 3REYA 4E9XA 2WO3B 4UG2A 2XV0A 1GSKA 3CVDA 3PCYA 4CSPA 2F93A 3UTWA 1V10A 2TSAA 2Y00A 1SHXA 2VW4A 4Q8BA 1P8IA 1GZMA 5B6ZA 4WAVA 4PXKA 2P80D 3NJGA 4E9SA 2XLLA 3D12B 1JZIA 2BHFA 3NJJA 5H2NA 3S3CB 5A7EA 1WS8A 3GYRA 1J5CA 4HCGA 1A3ZA 4AMIA 2IDUA 1PNDA 5B1AB 1ZIAA 3TASA 5I28A 2UX7A 3A7KA 2NTWA 4DP2X 1TEFA 1BEXA 2IDFA 3EHBB 5B1KA 3UTYA 2J55A 2XWZA 4K9JA 4G72B 1NIBA 4JR8A 5AKRA 2W8CA 3X3BA 1SNRA 3UZCA 1F56A 1JVOA 3NJHA 3HAPA 2EIJB 1JV7A 1EZLA 1PZAA 3NP3A 2PPEA 1LN6A 4PAZA 2LLNA 4WKXA 2XXFA 3DKHA 2Y01A 5DHGA 1J9RA 1NIEA 5F7BA 1AR1B 2FT7A 3NT0A 3UGEA 4G7SB 5G54A 3HASA 3QJVB 4HCFA 3NP4A 4DJHA 3ABGA 3EH5B 2WJLA 4N6HA 1ZPUA 1FBKA 4X32A 2VM3A 2PP9A 4E9QA 4XTLA 1C8SA 3ZPQA 2DV6A 4E9WA 1A4AA 1JV6A 2YDVA 1KDIA 3VI0A 1XIOA 1ADWA 4DP4X 5JJNA 2J4YA 3OE6A 1MG2C 4HCIA 4KO5A 4YSTA 1CYXA 2PPAA 5AWZA 4L0PB 3QJQB 3ZPRA 4JHVA 3T6VA 2XX0A 3WNIA 3WQJA 1TKWA 5B6WA 4GP5B 4A67A 1BXAA 4GYCA 3G5WA 1OCRB 1OE2A 1GUEA 1HFUA 2VN3A 3V9CA 2AZAA 2I21A 5H2OA 4AKPA 3NY8A 3VHZA 3QJTB 3UONA 4E9RA 3UTXA 3IN0A 2EI4A 3JT2A 2PCYA 3NSFA 4HWLA 3CZUB 2Y1AA 4UHRA 2J56A 4X1HA 1E0PA 1ET5A 2FWLB 2Y02A 3VW7A 3V2WA 4A4MA 2FQFA 3NSDA 4MBSA 4KOCA 1NINA 4BXSV 4IARA 1A4CA 1CYWA 3UACA 3CVCA 2DWTA 4BWTA 3D4SA 4LDEA 4JKVA 5H2IA 2OV0A 2Z73A 3HEIB 1GYCA 2YAFA 4YL4A 3ZBMA 3QQXA 1AZRA 2FQDA 2R4SA 2UXTA 2NTUA 3T71A 5JJEA 2AT9A 1OV8A 3PAVA 4NB7A 2XUWA 5I6LA 4MD2A 5DYSA 5AZDA 3WKQA 1UCQA 3T9WA 1PY6A 1R1CA 2CBPA 1SF3A 2YCZA 3QAKA 1AT9A 1PCSA 3NJIA 1IUZA 5I6NA 2QDVA 1SDDB 3H4HA 4KLYA 1GY2A 1DYZA 4P5RA 1OF0A 3OQRA 4E9VA 1F50A 4YSRA 1AOZA 2IAAC 1S53A 1XB6A 5AZUA 5E9NA 2CCWA 4DP1X 4A2GA 4BK5C 1PXSA 4EJ4A 1AS8A 4XTNA 1OCCB 4HHGA 3PXOA 3NJMA 4A2HA 1CUOA 1VGOA 2AZUA 1KDJA 4DP7X 3TA4D 1NPNA 5ETZA 4EIYA 1PMYA 1I53A 3OE8A 1ET7A 2HPYA 2ZZLA 2EIKB 3X2QB 4IAQA 2M3GA 3UG9A 3SBQA 4A2DA 1AQ8A 5A44A 3FYIB 4HIPA 1VLXA 3BVDB 1DZEA 1AZBA 4YSAA 3JTBA 3AY2A 4FPDA 3DDLA 1BAWA 1J9QA 2Q9OA 2YARA 3IN2A 1H68A 4HAKA 3ABMB 4JHUA 3S3BB 2UXGA 4M3HA 2YXVA 5A8EA 4GP8B 2MTAA 3SBPA 4BVNA 1PNCA 4F2FA 4KO7A 1X9RA 3NJNA 4BWBA 1ASQA 1OE1A 2ZOOA 4KNUA 3TBBA 5LDUA 4HALA 1Q5JA 4WTQA 5B7MA 4HYJA 5FJGA 4GPOA 2AANA 1PLBA 2FTAA 3QBIA 2BP8A 2XU9A 3RYMA 7PAZA 3OM3B 4DP0X 4GBRA 5A45A 2BZCA 3S8FB 1WAEA 3QAPA 1AS6A 3V9EA 2UX6A 4BDVA 2PPFA 2UXFA 4DP5X 1ASOA 2DY2A 3MBWB 1AIZA 3C75A 3ABLB 4NC3A 1S54A 3EF4A 4N8UA 7PCYA 3WI9A 3SQRA 4EF3A 3EMLA 2BWIA 1L9HA 4DPCX
chains in the Genus database with same CATH superfamily
3APCA 1A21A 1P5UC 4JG9A 4KK5C 1ODAA 2DQFA 1K85A 5L9DH 3VG0H 1CDUA 1EHNA 2KL6A 1QLEB 4WFEE 1CDGA 3OB0H 4LHUG 3CZFB 2LNLA 1FFQA 1MEXL 3QZNA 4EKJA 4N8VB 1OAYL 4X4ZA 4PRIE 4XCCL 3I9GH 2FIKA 3BX7C 4KHXL 3RIFK 5C2UB 4WWNA 1KEGL 5EIIB 5HJBA 2JXMB 1E8ZA 3LKSA 3HA0A 1DQKA 2WNXA 4LIQE 2ZKHL 1WAAF 4JZJC 1WA0X 1ZSDB 3N04A 1FLRH 1PF3A 3UBXG 4Z0BL 3Q2VA 3BGFC 1Z9NA 4HS8H 4P2RD 4UZGA 4D0CA 4DN3L 3NEEA 2WBWB 4OFYD 1KMEA 1T1YA 1ZIBA 4DKLA 2AEPH 2ZYRA 4H0GA 3ISYA 2WOYA 4JPKL 4MBOA 2A6JA 3NPSB 1UFGA 1UKSA 3QFJA 3RTQB 2IDSA 1NUFA 1RVFL 2QVMA 3Q0HA 5G5DA 2MQGA 1QM8A 1G7LB 5H2BA 5HYQB 4X42A 3WIHL 5TQ0L 2CDFB 4B0MM 4WKZA 1RZKC 4YO0B 3TH3T 2XG4B 3CAFA 4PJHA 2HG5A 3ARUA 4JDTH 1VB9A 1LDPH 2O4EA 1O7DC 1PYWA 3OKOB 3EHBC 5EOQH 5C9JB 2I9TA 2UZXA 2XYBA 4NO3A 4IEFA 1U19A 1IQWL 2FJGB 3ARFB 4M6NL 1FQ9C 4Y19E 5AYTA 1XGQB 4Q74A 4V1DD 5I5IA 1I7UB 3LQZA 2D73A 4D8PA 1T5XB 3SPHA 2AMUA 4M5TA 2K6ZA 4AEHH 4RETB 4DEUA 1LEKB 4LVHB 4RGMC 5IJCC 4EJ1C 1TTUA 2EDXA 1URIA 4IYKA 4OSUL 3DVNA 5EZJB 4BSJA 1OB1A 1UENA 3RLSA 4Q89A 4NCC1 4ZUWB 4HBCL 4NT6A 1UA7A 4LDLA 3VFRB 4HUCA 3ARGB 3CX5J 2YXWA 4FHKA 3FB5B 4J8RB 3NY9A 4H88L 1CGSL 3PS6A 3GHEL 5DUML 3C09C 2YAOA 2R2HB 1E3FA 4MWFB 2HT3D 2OJEA 5LLIC 1QTSA 1OD7A 2Z93B 4PJCE 1ZDQA 3V8OA 3Q7JA 1I8LC 1TNNA 3HI1A 3IMUA 4FC3E 1OARH 3T4YA 5HYJD 3DX2A 3ZIMA 4PGEA 5BVPH 1QRNB 4FQJH 4A68A 5ICYA 4PRIB 4D9QD 2B3IA 1N19A 1YYCA 5C70A 4M7LH 4JK0D 3RTQC 1HZXA 1GR7A 3PGCA 5I8EB 1XMWA 4MFHA 4OKVB 5E1AA 5D72H 5EZLB 4LQFH 4U6YB 2WP3O 3LRMA 2NXYC 3UTSB 3WFBL 2O6FA 5I5MA 3GUTB 1YY8B 4I18B 5HI3C 1D6VH 3KPQB 4FERA 4HGKC 5DVLA 4ILDA 4G11A 3KYNB 2FYYA 1TYJA 4JVUA 1BSIA 1A4JB 1RULH 2OR9H 3RPIA 3W0WA 4QCIA 4TQIA 3NJVA 2DDQL 4LASH 4OZGB 4OLEA 2PXYD 2HUEA 2H6UA 4LSSH 1OTSD 4ZFOB 3S8GB 3FFDB 2VAJA 1YEKL 3FYEB 3GC3A 3V2YA 1AD9A 1SGKA 1M56B 4RX4A 5L6YL 4IOFC 5AALA 2E47A 3ZMRA 4H8PA 5FF6A 3BH4A 3VYNA 3VXTA 1SLUA 3V6FA 4Z76B 3ALPA 1H3TA 4X9HA 5C2BH 3O4LD 4YDJB 1QSFA 3AQDA 3CV5A 1X4ZA 3RUGB 1R9FA 4F92B 2W0FB 4PWIA 1SXZA 1J8SA 2VXQH 4OM1L 1PKOA 1U8LB 1A3LL 3U4KA 3RVWD 3SBWC 1YDPA 5CS7A 3H9ZA 4MQXD 4CKQA 3AZUA 3X11B 1FL5B 2VZ3A 4LSDA 4Y9HA 3NIFE 2DD8H 4KQ3H 3O4OC 3D3VB 2B0SH 4X80L 2Y3NA 1NCWL 3NQKA 3EGDB 4UF7C 4MD1A 4CJ1A 3OAUH 3EOYG 1MI5E 1ZLWK 5C0BB 5CKGA 4YBLB 3FU6A 1GOHA 1S7WB 3TL5A 1VEPA 5KS9F 5IG7B 3H9SE 3KAAA 1KCRL 3VI3B 1S9KC 2JB5L 4IEFB 5AKTA 1O9WA 1YEIL 2DLHA 1KGYE 3ZKXB 2HSIA 5C0GB 4ZX5A 2A7BA 5K9OA 4K5YA 1OSPL 4AQOA 4LLMB 5H4YA 2M83A 1JZHA 3MI6A 4TLTA 3C5SB 1Q5IA 3F7KA 1MNUL 4HDIA 2GCYB 1QMUA 4I18C 4XMLH 4UILL 3CFDA 1JYXA 4FF9A 4XN5A 1BREA 2PO6B 1CT8A 3T2NL 4JM2A 5HYQA 3DO3A 4XT3A 2VLRB 2X1PA 3QZLA 3CDZB 2VLJB 1B3IA 5JHDE 4NHCH 4WHTB 4P9HL 3TYGL 2JCCA 5HDOA 1G9NC 1HI6B 5AW6B 2VH5L 5A16A 3KL3A 2RH1A 3QARA 4JRYA 5L2JA 1EVUA 4GKNA 4X83A 2VQTA 3FB6B 3D0VA 4HUMB 3U4EB 3GMMB 2A6KB 5E8NB 2P43B 3EO0B 1P53A 4WI7A 1RLWA 2DH2A 1NMAL 1SMAA 2F7PA 2ZUQB 2PWGA 3OB0K 4NLAA 4XP4L 1M0KA 2QMJA 2EEAA 2WSDA 3MNWB 2ZJSL 4K94L 4P5TB 3BWAA 3O8XA 5DC4B 2Y23A 1KG8A 4JHWL 2WJKA 1T22A 5HHQB 1O6SB 1WG3A 1BZ9A 1XZ0A 1NWPA 4NQDB 4IRSD 1FCGA 3ARGA 2CKNA 1SXAA 3DTUB 4XXWC 1A64A 5KSBE 3PDDA 1TU2B 5EO9A 1FYTE 1AQDA 4XODA 2UZIL 4RFOH 1EO8L 2OJEB 4M4RB 5CGMA 3V6OA 5IB3A 1U93A 4XBGA 1NC2B 4S1SL 1QR1A 3P3TA 4QR7A 4M43L 3E8VA 3S36L 4PJ9A 5I1CH 3JWNC 4Z5RA 5SWZE 1UD3A 2VMFA 2W1NA 4CSZA 2VDRB 3FOMB 3QS2A 5GRVL 2H1LM 3OGCA 3LPFA 4XXCC 5BVPL 2NPLX 5AWNH 3BFQG 5HGAB 3AM6A 5FYJD 2ZX5A 3AT9A 2HLFD 4XC1H 2JLPA 2X6BA 3C6SA 2Z91B 2V2XB 1I1FA 1N0XL 2W65A 4JRYD 3S9DB 2KDGA 1BFVL 5F9DC 3GHEH 2RCSL 3KPSA 1BMGA 4HS6A 3BXNA 2Y00A 4Q8BA 1P8IA 4JQXC 3LN4A 4Y2DC 4POYA 1GGIH 5KN5B 2Y1ZA 4DKTA 3B34A 4LSPL 3U7YL 4Y4HA 2XTJD 2BVPA 2WVUA 1NOAA 4DH2A 2WAHA 3ARBD 4TSBL 3VG9B 3W82A 2IDUA 5ISZB 1JV5B 1PNDA 4X4ME 3V0EA 3A7KA 2EC9U 1DBBL 2AGJL 1R3KA 2VOTA 3QO0B 5MEND 4EBQL 4ZZKA 5EEZA 4WW1B 4XMXA 4B7LA 4F7MB 1SNRA 3D39E 4PJEA 3NJHA 1KXQA 2H41A 2AQ2A 1ZT4A 3VI3E 4AQ1C 1RUAL 1ZWIA 3NP3A 4F2ME 3IVKA 3RX5A 2E27H 4LLQA 4N2OA 5IQ9A 1IGMH 3MRRB 4CC4C 5C0DB 3SYQA 2P4AB 1CR9L 4HG4K 2GKIA 2CIKA 3EH5B 6TAAA 4P2CG 2WWMD 3CFCL 3HR6A 3ZGHA 1SQ2N 3NAAH 2OTWB 1BZ7B 2IDCA 3WE1A 4PS4H 1A3RL 2XTSA 3VGAC 3VI0A 3MLPA 4GQRA 5I15L 5K1NA 4K73A 4XNUH 2P3YA 5IHZB 1QFWH 4GAAA 3F7PC 3B43A 3CPLB 3H9HA 4LHQB 5JIIA 4U6VH 1L3WA 4GP5B 4PJFA 5E5RB 5C0EA 3CFKB 4K0OA 2J8HA 5DUMH 4L4VD 2CCLA 3LQAH 3O11A 5EF2A 2EE2A 4WK0B 4JREB 2VDKL 4PRPE 4HWLA 4XGZB 3OZ9H 1RP8A 2J56A 3NCJH 2Q6WB 4X0NA 5EC2B 1D5BB 5ESVA 2Y02A 2EEBA 4POZD 3I50L 3JUZA 4C59B 4XNZC 2L4OA 4XPBH 1XGRB 1OAYH 4PJIA 2O93L 1XXDC 4PWHA 2F74B 4JRYE 4XVOA 3O4LA 3MO1A 3VFGL 4AQEA 3FUFA 2WXRA 2KYIA 3GJFB 1FZKB 4ABVA 5J57B 4YHYC 5JJEA 2AT9A 2R83A 2CO6B 2YLHA 3FUIA 4I5BA 1UVQA 4MD2A 2V8LA 4NQEE 3CHPA 4C83B 2X53A 4XBGB 1Q38A 2Y7LA 3VGGA 1AT9A 3W57A 1IM9D 2OSYA 4AZ8A 2ZNXA 1Q1JH 3T2LA 2FATH 1MW3A 1CICD 4QRPB 2AV7B 4P2AA 3JWDL 3MUUA 3PABA 3VFPB 5JYLA 4CU8A 4BK5C 4NRZA 3ROLA 4ERSH 3MLUL 1PD1A 5IROD 5KBNC 3U30C 3RPKA 5HHQA 5LN8A 1SZNA 3VM7A 2WUCL 2AZUA 5AOZA 1FORL 2IVFC 1MCKA 3GSXA 1CVSC 1KLFA 3I6LE 1O0VA 1D5XA 1T66C 2PTTB 3NCEB 3KL0A 2X2JA 3RX8A 4EBQH 5K39A 5TE6L 4PTTB 5T3XL 3MBXH 3JWOC 2MOQA 4Z3HA 4K23L 4UAOC 3GSNB 4RGND 2COVD 2YARA 1HESA 4HAKA 1KBBA 1T04B 1MPAL 2ZWSA 1WH0A 3GS4A 4LARH 4MMYB 4JN2B 4PY8J 3SZ6A 4BINA 4BVNA 3WJLC 2DQDL 3G9AB 5ISZA 2LLGA 4WW2A 3NFSL 4IBQA 3ZSTA 4E36A 4XPGH 2CLRA 5DZLA 2QBWA 3RFRA 4PV1C 3UPRA 2JIXD 2BC4A 3MV8B 5ITBL 3VWJD 1PLBA 5HGHB 1E4JA 3ZR6A 4QIRA 4KVNL 4XCCH 4JFVA 5IB2B 4GEIA 4D9LL 2E7HA 1YYLL 1NFDF 3AB0B 1J11A 3MRFB 1I85C 2DY2A 3K6SA 1QNZL 1EMTH 1DP0A 1F45A 4NZJA 4EIGB 1FAIH 4AMWA 4S1DC 5JTWA 1JHKL 1KB9J 1NLBH 1PZ3A 1DJIA 1TQVA 3KWTA 3ZK0A 2XIBA 3W9DA 6FABH 43C9A 3ZDZF 3HS0B 3M45A 1P4LB 2H7WA 3LIZL 1T03L 2Y1VA 2DLIA 2XN9E 4QXWA 5L2KD 3W3BA 1AJ7H 2EC8A 3SGDH 3QUYA 4AYID 4CW1A 1EHLL 1VADB 1HC1A 5ENWA 3H9SD 4FQHA 4L29A 3SJVE 2FJSA 3FL7A 5DHYA 2CJTA 2UUDK 4N1CA 1SLXA 2DQGH 3HLAA 5CMAB 4U3XA 1L9OA 2AABL 2FSEA 4QY8A 3O11B 1FH5L 2CQVA 3H85A 2NY2D 1HSAB 1QSVA 2WWKO 3U82B 3IEAA 3ULVD 2Q6WA 1GKEA 1T03H 4KUZH 2CHXA 2NDFA 3Q8EA 4ZXBB 4A55A 5EBGA 2X4TA 3FB7A 3IXAA 1L9PA 5I1JL 4QRQB 5I1DB 4JNXA 1S8LA 5E4EB 3MNDA 2AXWA 4XNBA 4XO3A 1DQLL 2WTOA 4QXGL 4WHYH 5DQJB 1BJ1J 2E7BA 4D0BA 1KT2A 3IDJB 5GZOA 4XPHL 3TV3H 4BEYA 4JFZH 3PWVA 4DSYA 2XWBB 4Y4KB 5F1IA 2ATKB 3BE1H 5LWEA 2IDQA 5A6IA 1VJMA 3L6FB 2FQGA 3WNKA 3C8KA 2PUQT 1Z0MA 3TNNA 4O02L 4AVHA 3WUWA 1GY1A 5JZ7C 2YUXA 2G9HB 2ZOLA 3PXLA 3KPLA 4PRIA 4AIZA 3ZYZA 1ET8A 4QF1B 1CFNA 1U58A 4RAVB 2D31B 1XIWD 4LARL 4E41D 3RJOA 1EAPB 2E59A 2X72A 3FPYA 5IJVB 2K9UA 2QHRH 1FNLA 1UH4A 4ZX6A 3SGKC 4Z7WE 1FH5H 1YN6B 4I18A 3CBJB 2PTTA 3MRQB 2I85A 3H0TA 4AG4L 2C3WA 2R0ZL 1BVKB 1GIGL 2WIMA 5C3IA 2FEDD 2R9HD 2Z31D 5F96L 2ZOKA 3CQPA 3LHPL 5E9DB 2XZCL 3QFDB 1X5KA 4OBSA 4GW1B 5F44A 4B96A 2V9QA 4ZZFA 1IAKA 2XYCA 2FRGP 2Q7AA 3K0WA 4ISVA 4X8JA 1WWCA 1IM9B 5C09E 2H0JA 3GFUA 4XAWL 4B27A 4RFEB 3BUDA 3PWUB 2A74B 5C0CA 3CN3A 2XVKA 5EC1A 3WEAA 4YHKH 4OJCA 2J88H 1N8ZA 4YSQA 4MKTA 1MEXH 2MEJB 4YDJA 3C5JA 4LOEA 1ZA6A 3BH8A 3H3BC 2RQEA 3O3AB 1K9TA 5L7XH 1H2SA 1DBKH 2NQDA 3GBEA 5B1JA 3KDMB 4YIQA 5BO1H 4E5XA 3WNMA 2IC2A 5CSBA 5T1KD 4G8IA 3KVDD 4LCUA 3MV9A 3GSWB 3MACL 4NKOA 5I6PA 4MB4A 4UTAL 1RSYA 3OPZL 3HRZC 1FDLH 3TIDA 2IANB 2YA0A 3GMRB 5HDBF 4F37F 1MFEL 3NAAL 2DDQH 5EOCJ 3UAEA 3EOBB 1TJMA 4R7DB 3MNVB 5I0YA 3HUJB 3LKNB 4AEFA 1E4XH 3D39D 3N40F 3VWKD 3EAKA 4LHUB 4XWOD 3OE0A 9PCYA 5DRXA 3UMTA 2BMKA 4GG8B 4PHZA 3S98A 1TETL 3V6OC 4G7QB 3WFBH 5FYJH 3PNRB 2D2OA 1YEWA 3OKMA 2NNFA 4I9WE 2OTPA 4K8RC 4MNQD 4A38A 4F8OA 1IQDB 3LKRA 4H26B 5DHVH 1Q94A 1L9QA 5A2IH 5IEKA 2OPCA 1HE8A 3EJYD 4ZS6D 5BRZD 3ZGIA 3QUZA 4AGPA 3N1PC 4GXVH 4O2CB 1NEZB 5BCAA 5IESH 4MS8C 4QHKJ 3BD3A 2KPNA 1SHWA 5KJ4A 2C9XA 2V3DA 2YD8A 3CDZA 5ACMA 1P7QA 4S1QH 4APXB 1IBZA 4JDZA 4NQTA 5HJGA 1RUML 2YOAA 1GJIA 1K8IB 5E2JA 3VGEA 4MQTA 2VXTH 4BA8A 3L54A 4P8QA 1ZKAA 2XWBA 5FHAH 1NICA 4RRPM 1CWQA 3OSVA 5EEUA 1G84A 5GISL 4NO2B 2FIRT 1OAUH 4IOIA 5F9JB 5ISZD 4YDIL 4HC1H 2WUBH 1I85A 2R1WB 5LBGA 4K07A 4Z3IA 3B2MA 3S34H 1NUDA 5FHBH 5C0IA 1A6WL 1E7UA 4FQLH 2W0LA 1CFQB 1CE1L 2GHWB 3DIVA 4JPVH 1UM4H 3AUVA 3OKYA 3UABA 1NTDA 3IDIA 3VXUD 3BDBA 35C8L 3L1EA 1U4FA 1JPTH 3MOAH 5I1GL 2CJSA 2WZAA 3KCWA 4LGRB 1UATA 3L7EA 3MTXA 4PGDA 4P9MH 1A6VH 4MB1A 2PPCA 4U1JB 5TQ2H 3APNA 4WEMB 3LPPA 3DRTA 1QSFE 3Q1EA 4X0KA 2TSBA 2YDOA 1GOGA 2PF6A 1S9XA 4YZFF 2WNWA 4GUQA 3VXNA 1TG8A 1WWBX 3KR3H 1M6OB 3BGAA 2BIMA 3E0GA 3V6OE 4MX7A 4X5XB 4U7MA 4BZ1L 3L4CA 5E8DH 3BSHA 5JXAH 3FJTA 1A7OH 2CKBA 3H4FA 4HMDA 2SEBA 5HYJA 2MCPH 2MFNA 3LXAA 3WJLA 2G75B 4ZFOL 3KGRA 4RMQA 3O6FB 3L3KB 4I48B 2NX5A 2GUYA 3ASOB 2G60H 3O2WH 1BBJA 3UYRL 3HG1E 3V0VA 2F54B 4OGAC 1KGWA 2R69A 3IFLH 3QFDA 1FJ1A 4OB5L 3SYPA 3Q9QA 4JRXA 4M5ZL 3O0RL 4N0CC 4P0DA 1U3HC 2BNRE 4UI2A 3CFMA 3AGVA 3VM5A 3F7VB 3ARPA 2BLFA 3QNFA 4YSEA 2J7LA 4Y1AD 1IU1A 5C7XL 4Y4FC 3AS2A 4ZYKB 4LKCB 3PE9A 4DK3A 1E12A 1Z7JA 3WL9B 3MCLH 1JZ4A 3L4UA 4WNSA 5C0AE 4F9LA 3P4OA 2JCCE 1ZAGA 2J21A 3EYVB 3KPTA 1XMEB 1E65A 3KS0H 5E1HB 3V79C 2YD9A 4NFBA 2VIRA 1Q94B 3CE1A 4Z7WF 1I9RH 3C8HA 3LPOA 4AKOA 3BPLC 2DKUA 4TTDC 3VFMB 4BIKA 3VWKC 1NEZA 3V0IA 2LV4A 1FE8L 4XZUB 2YGPA 1QI3A 4F2MA 4QOKA 5EU3A 1GSKA 4WK2B 2VAAA 4H44C 1DBAH 3EOBA 4CU7A 4HUXB 1V10A 3MMEB 4K7PY 2UYLA 3G5XB 2A6DA 5GRYA 2WQVA 5CKAA 1EBAA 4LP5A 5E8EB 2N4IA 2L7JA 3EG9B 4JE0A 2HMID 1Q0YH 3VTTA 1E5CA 5TD4A 3SBWA 4MXWL 1DVUA 4AL8C 4MD5A 5CEZH 2WLLB 3S5LB 3D3VD 3BAEL 1JPFB 3ESNA 5D55A 1GHFL 1F0LA 3U6XS 1UC6A 2IO5A 1LEKA 1TEFA 4J2QA 3OF6A 2Y2TA 5F3HA 2F7OA 2Y5EA 2FO4A 3BWUC 4K9JA 2UV3A 4AEIL 2N1TE 1MELA 1PY9A 1JVOA 2YIHA 3HHMA 2HTKD 3KLAB 1EZLA 4OIBA 4UDUB 4MD4A 1CF8H 5JUEL 3ZRCC 3G5VB 5F7BA 4BFGA 3U2SB 1NIEA 1IVTA 4XHJC 2FT7A 4PJAE 4M8QA 2X09A 3SO3B 3GPSA 3ABGA 3ARED 1I3UA 3GMQA 5HPMA 1JGVH 2HH0H 2DQEL 2P8MB 4KMQA 4E9QA 4YHKL 5DURD 4XX1E 1JHTB 1P4IH 4WSKA 5BO0D 4XAKD 2I60L 5JJNA 2J4YA 2EDRA 3KLDA 1YEDB 4NO2A 4HCIA 1XBRA 5C09B 4NRXA 4DKEH 3SDAB 1CLZL 1QVOB 1TPXC 1RFDH 4M7LL 4ELMF 3B5TA 3GKWH 4GQ9L 5C0IB 3OKKA 5A3ID 3MX0A 3CFCH 3QDGE 4APQC 4B9YA 1WD9A 1LD9B 1MREH 4ZX4A 1MRDH 1OE2A 4HGMA 4OFIA 3NY8A 2F1AA 2UZIH 3R06B 3V4PB 2IGLA 4JFTA 2DQGL 1H15A 3UTXA 2EADA 1XEUA 3IDXL 2FYYB 1MWAA 1OGTA 4M7ZC 4XWOC 4Z6AT 5GHWL 1UM6L 2Z64C 1E5UI 2WQSA 3HOGA 4I1PA 2J5WA 3NSDA 4XVUC 2IPUK 5ESAA 2IH3B 2NXYB 3PFUA 5DVNA 4LDEA 3T3ME 3ZRFC 2DQIH 4TNFA 1AHMA 1IC7H 3KYMB 4E41A 5IUCA 5FHBL 2YAFA 2EXYC 4TSBH 4XXWA 2FQDA 4P23D 3FT4A 1U33A 2LHAA 3WS6A 4B0MB 4ODXA 3AITA 4M62L 3TA3D 4AK1A 5CCGE 5DCCA 2YCZA 2SEBB 4IRSC 1JPTL 1W72A 3B3IB 3EOAA 3UPAA 4ZPVB 1U8OA 2X0VA 2IAAC 4G9FB 5E8PA 3SDCA 5CN3A 2ITDB 1F6FB 5E9NA 1YMME 4ZTPH 3HR5B 4J23A 4H40A 2DQJL 3SO5A 3BKJH 1VGOA 3D18A 4OCYL 4XI5C 1IC7L 2ICWA 2GABA 1GHFH 2V2XA 2ZUYA 3D3VA 4MHHG 4TOYH 1VADA 3D07A 2KT6A 3KWVA 2CU9A 2UYLB 3G5XA 3GZQA 4HK0B 3GLZA 5C08D 2OYPA 5MEPA 1EK3A 2JB5H 3FC8A 2AW2A 4LEOA 4LLVA 5C0FB 3WNPA 5I8CB 4QYOA 2BS8A 3UBGA 9CGTA 4WNQB 2J44A 3VXSB 2D7NA 5LGKA 1G6RL 4CUCA 1OO2A 3II1A 4UOQA 2VL5A 4XNQB 4Y5XB 3CSGA 3QG6A 3HNVH 3U83A 4EUPB 1FN4A 4P05A 4EI0A 3HS0A 3RYMA 1KTDA 4W70A 1B4RA 2WB1A 3BSZA 4NZ8A 5FOJA 4LLDA 2NY4D 4JCWA 4PV9B 3GPEA 4F7MA 2RB8A 3BYTA 5H37G 2AC0A 3L1OL 1ZS8B 3US9A 1XDTT 1RZJC 1WRFA 2O5XL 4NQVB 5AVYB 1QLFB 4S0HA 5BV7H 2V5YA 4OV0A 1A8JH 1LO0H 4BXVA 5E8NA 2OKMA 3ZTCC 3C5SA 2G9HA 1YYMH 4N1EA 4Z7VB 1KENH 4GQPH 3ZDWA 4AITA 3ZHKA 3OTTA 1GW0A 3DUSA 1UOLA 4G43A 5E23A 4K71C 1DVFD 3OAYK 1LE5B 2B59B 1SMOA 4LSTH 2K9FB 3QO1A 2XQ0A 3DHMA 1V27A 4R8WL 4X6CF 3ZE1E 5BMFH 1KJVB 1HKFA 5FOBA 2O5XH 1BMZA 3GJEA 5DZVA 2WLHA 3P4MB 4MXWH 5AZ2L 2H9GA 3TURA 3OF6D 5CZXD 4L37A 2P8MA 1IBBA 2WIIB 2R8SH 2QV4A 1MOEA 4PR5A 3SDXB 5A43C 2BPBA 3T2QA 2HUHA 2WZ6A 1A3RH 3TF7C 4FNRA 4N4YB 3M8OL 4G5ZH 4WWID 4ZFGH 5KYYA 2F1EA 2YR3A 2DQCL 1N18A 1TLMA 3RY4A 5ELIA 4MDIB 4GKSB 3RWJB 5TPWH 3MO1B 4XBEH 3UMNA 5FYJU 2ZXCA 2ARJB 3WN5A 3BEWA 1NJ9A 3WUWG 3INUL 4R0LA 4F24A 2IWKA 4GMSL 4JPKH 4JPIB 2CMRH 5F2FA 4F91B 1IT9L 2VDLL 3GXFA 1AQDB 1OLLA 4YVNA 4DETA 5GJTH 1CD9B 2OMTA 2RR3A 3RVVC 2EE6A 1XGYH 4KK8D 4MMXC 4PLJD 4TVPD 1OWRM 3DX9A 5I17A 1L9RA 2IANE 3NGBC 4XBMA 5DTFB 2G0LA 43CAA 1PD0A 1MHHA 1VGEH 3OMNB 3OHXC 4ZUVA 3V7AG 2H0FA 3TBWA 3VXMB 5J11C 2BDNH 2XWXA 5DUBA 2NTFB 1FNGA 1OIOA 2A6IB 3FN3A 3VVWA 3IGLA 2E8YA 5DS1A 2ARWA 1KBGL 4AM0B 1IQWH 3IPFA 2XG5B 2R29A 3BP4A 3BN3B 3B2PA 4LRIC 5CGYD 3DETD 1XBDA 1DN2A 3MRBB 2QZ5A 4UV7L 5L4IA 3UTPD 3IMVA 2CKBL 5JNYA 1EVTC 2DS4A 5J13C 4JJ5B 1RZ7H 1ZLVH 2I1XA 1OCWH 1ZANH 2X4RB 3SKMA 3IXTB 5EULV 5DXWA 2YKLH 3SB3A 1DVFB 2Z4QB 1AGEA 3N55A 2VSMB 4BFIB 3MV11 2V3FA 4A39A 5DD6A 1Z2KA 1NKOA 1RZIB 2BWDA 4XO4A 3NK3A 1PPIA 3ESUF 3HUJA 3LKNA 3PAYA 2HRPL 3K71B 1TVDA 5TQ2L 4P2RA 4AYMC 4OUUA 2GTWB 1FBBA 1A7NH 4LU5L 3DX6B 3VUAA 5D1ZA 3A6CL 3B2DC 2JJSC 3U36B 4NSKB 4FXGA 2K3HA 4DTGH 3T3PE 3X1NA 1ES0A 3OHXA 4MLIA 1EJOH 2BIIA 5F0PB 1NGZB 1C5DA 3WFHB 1CGWA 4POZC 5DO2C 2B9BA 2JFCA 3IJYA 4JPVL 4LPCA 2DMBA 4A2FA 4K3DL 5B3SB 4I77L 1NMAH 3MLVL 5I66A 1CCZA 5AB1A 1DSFL 5T33H 4NT6B 5J7AA 3AT8A 3O4LB 4X7TB 1J8KA 1GGIL 4GMTL 4ADIA 2IQAA 1UUNA 2EYSA 3FCSB 5FWQA 3QZWG 4NOBA 5AW3B 3WLBB 5I75C 5D7KD 5JDSA 1WFNA 2YAHA 5I1EL 2JK5B 5ID1B 2NOYA 4FA7B 3MRCB 3QULB 2UWEF 4M29A 2CMRL 2XXGA 3DIFA 3SQBA 1UWGH 1RHHA 3MJWA 4BH8B 4WU7B 5T3XE 1HCFX 2NY0C 2Q7YB 5CZRA 3T4AC 1EFXB 1OAZL 3KWUA 1XEDA 2N3JA 4ZMVA 2A9DA 2JE8A 3W2DH 1E2VA 1I8KA 2J8UB 2AKRA 4OGQC 4XTRC 4TNWF 1LE5A 4FTVD 3UEQA 3FT3A 1MDTA 1WA2X 2Q7NA 1JV2B 1NOLA 3VXME 4FFZH 3K2IA 5HDQH 2GT9B 1KCRH 1YC7A 2ZCZA 1NSNH 1G0DA 3KZ8A 3GUFA 5AAPA 3FH5A 5HHVH 3QUZD 3FO1A 4G8FB 3RGVC 1XIWA 3U30B 5C0RL 1DFBL 1USZA 3AVEA 1ONQA 2JKWA 2ZSVB 4UINL 2WXJA 1JNNL 1P9MC 3ZHNA 1MAKA 2HXAA 1C8PA 1KULA 3I02A 1EAPA 4TSAL 4IBWA 1JFQH 4Z7VF 5IY5B 3K4AA 1OAZH 3Q5TA 4NNYA 3ULVE 3ERXA 5IMMB 3VD9A 2R56L 2JQMA 3BKJL 1MCWM 1AYRA 1A9EB 5D7SL 3QIBC 3I84A 3MJ7A 4U6TA 5DSCB 3RZEA 5KBLA 5H2MA 4X6BB 2P5EE 3LRKA 3CSBA 4KRNA 5HHMB 1B6UA 5D7LD 2F53B 5JMRA 2JKJA 4PFEA 4R4FL 5FECB 5GZOD 1MCDA 4X6DB 2IJ0C 4ETQB 4PJ7E 1IV8A 3O6FA 2Q3AA 4G7RB 4X8CA 1ZT1A 3STLB 1JYVA 4X8GA 5DYOB 3FU7B 3L1OH 4PTTA 1NLDH 3RU8H 3QC5X 1JGEA 1F4YL 3SHSA 2DM4A 5LBVA 2KLRA 3I50H 3RRQA 5T1DH 4AMKL 5AAWA 3GSQA 4UQ3A 4JDEA 5FYKH 3K8LA 3C6LA 1HAWA 4PG9B 4JFYA 4I8DA 1BEYH 2AEWA 4PM1A 3TNMA 1GZQA 1CGXA 3BT2H 5A2JH 5DD3L 5E99L 2UWEB 3DV6B 5K93A 1UEMA 1ZSHA 3ATDA 5FXCH 1BLNB 2J2ZA 2J12B 2V6HA 3VI3A 3AWGA 1Y6MR 3VMNA 3VE0A 3EH4B 1N12A 4JGUA 4LK4A 1S9WA 1OZUA 3HAQA 1QYGL 4X6CA 1F1GA 5MP6L 3IGUA 1IAOB 5F89A 2BOBA 3GXPA 2V7HB 1JPSL 3N1FC 4FXTA 1GZPA 4BV0A 3NIDE 3GBDA 4K94C 2GQHA 5IQNA 5IHUH 5K69A 5FKAB 4OF5A 1MI5A 3D06A 3HPJA 2K7PA 1OE3A 1SXBA 2CWRA 4R83A 4MXQD 5I5JA 3H3PL 2VUOA 3MUGB 3QFJB 1CN4A 2EO1A 3FB6A 2RCSH 1MVYA 2BY3A 3BRFA 4C4UA 4J3SA 1I3GL 3AYNA 5E2WH 3LN9A 5I26A 2Y72A 2IH1B 1GGUA 1OEZW 3X13B 5DI8A 3KPLB 4U1MA 3GMLA 3A24A 2Z65C 5D6DA 1SHXA 4Y1AA 4HG4J 3U4AA 4N0UB 4PPTA 4YBLC 2E7DA 5ALCL 4QRQA 5I1DA 4NNXB 3NUKA 3FT3B 5E8OA 5CCKH 5KEZA 4OJDH 2R2EB 4ZSOA 4FOMA 5D9SB 1YQVL 4FA8A 4MCZA 5H4ZA 1U42A 4MAYB 4PGEB 1QRNA 2EAEA 2VMEA 1KB5H 5C8JB 5DJ6B 4AJ0A 4XVJH 2B16A 3VI4E 1E6JL 2D7MA 1EFXD 2CPUA 1NIBA 1RHHB 3HG2A 2JB6A 3X3BA 4FNSA 4RFNB 4ALAH 1U3HB 4YJZL 5MEQB 1MREL 4LOFA 2ED6A 3Q13A 1XZWA 5D1XC 2BVOB 2ZXEB 4F20A 3FTWA 2PPEA 1LN6A 1URZA 1FNEB 4NUJA 5F6IB 1J88A 2B8OT 3MV7A 4QRAA 3TO2A 2WXQA 2CK0H 2FHBA 4ZMAT 1AR1B 2OX5A 5FB8B 5H35A 3L08A 5C08B 5I0ZA 3ZRSA 2WJLA 2A74A 3L95B 2M2DA 1F4WH 3P0VH 1WWWX 1C8SA 1AFVL 2DWXA 2DV6A 4RGOH 4A7UA 4G6AC 2RFXB 4U1JA 1V05A 4NYLA 1U9KA 2C9UA 4MB3A 1LMIA 3MLRL 4OLZL 3AGWA 1KSRA 2OMBA 4PUBH 4XPBL 1RU9L 4NQXA 5IROA 3S5LG 4WHCA 4GRWF 2WTRB 4JDEB 5B6WA 1U8NA 4BFEA 1QWHA 4GYCA 3QXWA 1FDLL 4GB9A 2NUTA 4AQ8C 4UTAH 1F1DA 5IF0A 2ITEA 1SVCP 3V6FB 1M2VB 5HHMD 1MCQA 5JOPE 3ZZ1A 3CN0A 2X4OA 3RB5A 1DQVA 4XB7A 2E9WA 2H32B 5DLLA 1BECA 1OVZA 4FQ1L 2F53A 2B1AH 4JPWH 3RPIB 1NDGB 5D96C 3F12A 3VD3A 3WBDA 1QRND 1TLKA 3FB8A 3FTGA 3GSNA 4NN5B 1J05B 1Q0YL 3F6LA 3Q8BA 4XWGL 2DWTA 1FIGH 2NXYD 3OL2A 3VFWA 1T0NA 2OV0A 1KJ3H 3II2A 3QDMA 3QUZB 4ZDHB 1Z5LB 1QBBA 3D2UD 4IIZA 1G9NH 1HVXA 4GAGL 5H2BB 5D7LA 4ANVA 3SKNA 1K4CB 1IB5A 4BEIA 3T0ED 2D7TL 2ZWYA 4RSYA 2OSLA 3V5KB 3H4HA 4U1NB 3W38A 5E24E 5CJOH 3V10A 3KPRE 1YEIH 5DK2B 1ZS8A 1F6LL 3VFSA 4ZUTB 4UYQA 3WELA 1PXSA 3CFDB 2FB4H 1EX0A 3FRPA 4HCRH 4XN2A 5LGHL 3QDGD 4BQ6A 1FFOA 5IVZA 1WP6A 4UNIA 5FDWA 1DBBH 2X12A 4B95C 2ZCHH 5D7IF 3P0GB 5JW3L 3BUPA 4W6YB 1ET7A 3BWZA 1P84J 3CN4A 3B9DA 1AQ8A 4NBZB 1VLXA 1BVNT 3GXNA 4R3SB 3NEXA 1E4KC 4HWBA 2N7BA 3HG5A 2WBJA 3QWOB 5LCVH 3MLXL 3UCQA 1FSKB 5AL8A 4NXSA 3U9WA 3QWQB 2UXGA 3MZGB 3BGFB 4I3SH 2A4ZA 4ZAKC 4CMHB 1S78D 2QELA 4MNQB 5IKCA 5FHAL 4HPOL 1OE1A 5FYLD 3WE6B 2WLLA 4J3OG 4JFFB 1Q0XH 3UOAB 2GCYA 3R18A 2PWFA 5AKSA 3HRPA 2C3VA 2VERA 2ICCA 3FCTB 4FLSA 1YEGL 5CU5A 4EN3B 1HJCA 3MRHA 1DN0B 5L9DL 5HYEA 1NBZA 3HS9A 4JEGB 2MKWA 1SOQA 3UTZA 3IU4H 2ZWKA 3TBTA 1YNLL 2H1PL 3LDBB 5J56B 3IMBA 2HG0A 2FO8A 5JOFA 5H35B 5FB8A 3OG4B 4EIUA 3D0AA 5C08A 2BWIA 3AREA 3MZTA 4OLWL 5I16A 4UOJA 4NQCA 4FGMA 3TPUB 3S35L 4EZLA 1DBJL 1SEQL 4Z7WA 2EUXA 5H2PA 1BD2E 5SX4H 3BZFB 5G2CA 1QRNE 1ZLEA 4GI6A 4DN3H 1MW1A 4QRSA 1E42A 1BHGA 2VXVH 2IGTA 3DETC 3MUY1 1Q9LA 1WYJA 1A4JA 2YRZA 4KTYA 3W0WB 4YLBA 2YWYA 2R9HC 4NENB 4BKSC 4KFZC 4OLYH 2H26A 4FQXA 1S7RA 5T3XD 3VFOB 4HKJA 3R8BB 1UWEL 5BPPA 2FK9A 4AWJC 2CNYA 4M5YL 2K70A 1YNLH 1MW0A 2GI0A 2H1PH 3A21A 2R69H 4IK7A 3F7VA 1GGCH 4WI6A 1WZKA 1W0VA 1DDHA 1AD9B 3E6FA 5KVDL 4HWBL 2Q10A 5KANI 2PR9A 4YZFE 4LSUL 4GIAA 1UHVA 3QQ4A 5C1MA 5SWZB 3BP4B 4HEME 5D70H 3HAEA 5CD5D 2JI1A 3IGAB 4OVUA 1QW8A 1JZ5A 1VRSA 4A2EA 4YXLH 2DQUH 4ZODA 5CD3A 1K8DA 1NCAH 2NX5B 1BQRA 1RJYA 4HGWA 4KVNH 3T6XA 1FYTB 1WPCA 1DFXA 4OFVA 3PIQB 1A22B 2QHLA 3PDGA 1KCKA 2CUMA 4NN7C 5AAMA 3S35X 2E5EA 4YVUA 3VWJB 3VXSD 1KGIA 2ESVE 3KMDA 2HKHH 1NDTA 1IARB 2XN1A 5D5MF 5ILTL 3S88H 4LVNC 2W94A 4IRSA 3HC0B 3VGBA 1J0ZA 4GXVL 2OR8A 5HYIA 2ZICA 4GUCA 5GXBB 4D8OA 2WP3T 3D08A 2A4EA 2R0ZH 2F8VA 2YBGA 3ELAT 1NSNL 5LCVA 1NDGA 3VNYA 5C0GA 3QUXD 3MV9B 3MRGA 3PP4L 4WW2F 4GUOA 1A1MA 5FGRA 4ANWA 3VFVA 5J7CC 2GUOA 4HUVB 1ROCA 3HRZA 2HT3C 3WIHH 5CJBA 1T7XA 5AYQA 4E0RA 1FFRA 4JHWH 4M9PA 3V6BR 3FRUB 4NO0A 5CNHA 5AENA 2WBJB 3QWOA 4BWUA 1DO6A 3CPLA 4QRRE 3BP7B 3U48A 4GRWE 3VXUB 2OMXA 1JPGB 5EZIH 2VT4A 1NM4A 4NBXB 1CD1B 3MQIA 3WKML 2AEPL 1N59A 4WO4A 2BCKA 5L7XL 4N2LA 1EUTA 3SYCA 1Z5HA 4F5CE 1DVSA 4UM9A 1IBDA 1MKFA 5B6YA 3IDGA 4FLQA 1DZ0A 1YVLA 2J4WL 3N06B 3OWEA 2QPUA 3K7UA 4OFQA 4K5LA 5D1XB 4DP6X 4IMLB 4U1HA 1NC4A 3CFUA 1WFIA 4GBXC 3X1GA 2YUZA 5TDOB 4IRZL 4O51B 3SPJA 2C9RA 3FBQA 1F3JB 2IG2H 2LU4A 3LNDA 5IREA 3NSXA 2VDOB 1K4DB 2D9CA 4PGJA 3NIFB 4O9HL 1B4JH 2E6PA 4GG6A 3ZX1A 1KPUB 3NZUA 1C3WA 5BJTA 3B2UD 1AANA 1T5KA 2J5LC 2XJLA 1GL4B 1OSEA 2P8PB 4UDTA 5KW9H 4N20A 3E3QE 1NCTA 2X89D 3VXQA 1A0QH 1A7OL 3ZDXF 4RGNC 2C7FA 2YN5A 4L1TA 5I1HL 3L5HA 1ETZB 4GIPD 4LF3A 5TE4H 3HBZA 1L5GA 1SXNA 2Z7WA 2BSRB 3QHZH 3KLHD 1UJ3C 3QZWA 4LVOC 3TBTB 1AGDA 2QTVA 3QNXB 3NCWA 5I6KA 2Y5TB 1A5FL 4LESA 1V7NH 4P46A 2ZCLH 5DURB 3REWA 4YLCA 4IRJC 1MH5A 3DVFA 2EDEA 3AREB 1NFIA 2VXSH 2Z8RA 4IGBA 5FM4A 5CCJA 4Y4FD 5GS0L 5LJYH 4QLRA 2X0WA 2Z93A 1UFUA 3TFKC 2BP5M 3L3JA 3SZKC 5HXMA 2E9IA 4ODUB 4F8TA 5EU6E 4G9FA 4C57C 1BM1A 4L5FE 5FC9A 3RWIA 1DVFC 5IR1B 1UM4L 4UQBA 5T5FL 2YMOA 3QAQA 1CBVL 2OULB 4LCUB 2XNAB 4G6JL 1A6WH 3WN5B 1Y0LA 1T6VN 1VGEL 3KBEA 1YEKH 4GYBA 5GRJH 3WLWD 2QFPA 1ZLUH 2I7SA 3ABZA 1NL0L 4WUKH 5GGSY 3SDDC 1NCDL 3TWYA 2AJSL 2AP2A 3QHFL 4XP9H 3CU7A 4PP2A 2DLFH 3ULUD 3D69B 3E1F1 4MYPA 2X1OA 2GB2A 4EDWH 4Z7UE 2XPZA 1NGXA 4JFZL 1IBFA 1KY6A 1I8MA 3D4GA 2CZNA 4RVBA 2VR3A 1P7QD 3SE9H 3IMWA 4JY6B 4I0PA 4AV0A 4WJG3 5TFSL 4AQAA 4PS7A 3ZDZB 5IHUL 2D3LA 4Y7MA 4KJYB 1FFTB 4G6KL 1AY1H 4ZQKA 5C3LD 2ROYA 1P5VB 2D03L 4NM8H 4P59L 1XF5B 2G0KA 4OZFA 5HI5C 3NFPB 3RWEB 3QIWC 1QYGH 1RLBA 4NIYE 1CFMA 2FECL 2P7TB 1LP9A 2DIAA 4FJZA 1EMTL 1GCYA 2VLME 1NDMA 5D4QA 2X4RA 3SKMB 1MZYA 2VJXA 4IJ3C 2R29L 4PLKC 3HHSB 2XV2A 3ML8A 4KZDL 1YSOA 3FO0H 4K8RH 3QEQA 4GP4B 4WFED 3DO7A 3G6JF 4U1MB 4JZOA 4Q52A 5GRZA 4QRFA 1KXVC 4H4NA 3K74B 3WS3A 1MRFH 2CH8A 4QRRA 3UZVA 3NYAA 2J20A 1L7TL 1KTDB 1P6FA 2CHWA 3ZO0A 3NSJA 4DERA 4BUOA 5FUOL 1KPRA 3BJLA 1MDAA 1G0YR 1DJYA 3BOVA 4AZUA 4XVTH 3O45B 1SY6A 4LAQL 3BHBA 1TQWA 1DR9A 2FX9H 2R1XB 4YSDA 1R3IL 3LZFL 3M46A 3CX2A 3OSKA 2VTFA 3NA4A 2ZP9A 4D9LH 1HNYA 3QYNA 3SKOB 3SE3C 5AHYA 3PDOA 1AMYA 1UGKA 5DS8B 5I15H 3DRTB 3PBLA 4ZMTA 2DYPD 1M1SA 1NUNB 3U46A 4WI2A 2DI9A 3PABB 3VFPA 2EABA 5IB4A 1JFQL 5LWYH 4F58L 3QBTB 1MFVA 2Z0UA 1ED3B 1IEBB 1JUFB 3BWSA 3JVFC 1CDJA 2ARJA 1I1YA 2BW5A 2IPTL 3FZUD 4P2QE 4PRNA 2NNAA 4ZFQA 1TU2A 1QBMH 2X9YA 1UAZA 2WKLA 3UZAA 5TK4A 3T0BA 4PLOB 2EDKA 4PJ9C 2GTQA 2JK5A 4AL8L 2YSSB 4E9XA 4FG6D 1BZDA 2WO3B 5AG8A 1E9PA 3S36X 4MCZB 4XXCA 1MHCA 3IFOB 1A6ZA 4HFWB 4L8BA 5JW3H 1OTUD 1BVLB 3DXAE 1GZHC 1MCPL 3S48A 4URKA 4YMPA 3NJJA 2YO3A 3TYFA 4PWJA 1TSHA 4NUGH 1CGTA 1AGDB 5F97E 3QNXA 5DFVD 4AMIA 2XY2A 5FGSA 1NBVL 3L4WA 1I9RL 1FFPA 2WQXA 1XGPB 1KCSL 4P2QB 2VZTA 1BEXA 2V17L 4QHUB 1BVKA 4DQOH 1TO5A 4G72B 1PIGA 2MPAL 2F7RA 4G9FE 3QORB 4L8CA 1DZBA 4NIKB 2QR0B 3BH9B 1ZCRA 4HYTB 5I1IL 3DKHA 3BISA 3QDMB 1M2OA 1KV3A 1HCZA 4XOAA 4X9GA 3JWNG 2L7UA 4XOBA 4BFNA 4XTLA 5CR1A 4NEHB 4NQDE 2LW3A 3OMZA 5DWUH 4TUKL 4HWZA 2C1PB 1A6UH 4Y16A 5C6WH 2FCBA 5C71A 4BCXA 1ORQA 3G6DH 2E27L 2OSXA 1A7NL 1Z66A 4I0KA 4CDHA 4A67A 3UG4A 4JFDB 4Y4HB 1CICB 2NUPA 4JGJA 4NKOB 3K2UH 5H2OA 2VISA 2O72A 2ZG1A 4P4RB 4X4XB 3LEXA 3MKGA 3X14A 1QWNA 1GTNA 1AJ7L 3MPCA 4J4PC 4P4KD 1O5PA 2FWOA 1AHWA 4X1HA 5C9KA 5FM5O 4LNRB 5FO2A 5CBEB 5JHLL 2OAAA 3SDXE 1KG0A 1PYWB 3OKOA 5AUMB 3R4RA 4XMKL 3TCLB 7TAAA 4MBSA 2I60H 1BZQK 3O45A 3TOPA 2KQNA 2XXCB 1I31A 3A23A 4P59H 3CZSA 4E42B 3CC5A 1GMIA 4JG0H 4DESA 1HCVA 4RRPG 3GLEA 3UG3A 4B7IA 3BRDA 4IOIB 5F9JA 3RVWC 3LKQA 3KBFA 3PAVA 4XNYH 3VFUB 3KCPA 5FA4A 2E46A 5K1JA 3FFCB 3VH8B 1OTTD 4P2OA 5BZWA 1BAFL 5FDWB 4WTWA 3D2UB 1YJDC 5DUJA 2I24N 4NHUB 2MIZA 2YJLA 1XR8A 1Z9OA 3B83A 1NGZA 5DT1H 4PREA 4AUJA 4HUNB 3NFNA 2VR6A 4QRRB 4Y16C 1XB6A 1LO5B 1A7PH 4X4YB 3RZCD 1WHPA 1I7TA 5DFTA 4KRPC 4HV8A 1RJZA 3A6BH 4L1BA 4A2HA 4ZOBA 4DW2H 4F1SA 4GPVA 4RSVA 1NFDB 1KDJA 4PJDF 1AYOA 1HXMB 4XB3A 1PMYA 2EIKB 3G5ZB 5IMOA 3MROB 4JZJB 4J4PA 1T1XA 1XIWB 1K2DB 3LH8A 4YSAA 4NRYB 4HVBA 3JTBA 4KUCD 4KVPA 3TBCA 4JFED 3V4VB 3UTTD 2CRZA 5TDPA 2JJVA 4KXAA 5E1AB 5I19L 1FE8H 2EDLA 1X9RA 1U8PB 5E4EC 1ASQA 3PXJA 4AY0A 4CJ0A 3VMOA 3FO9A 4L3CA 5GS0H 3B2UC 2YFNA 1H8LA 2EVIA 2VDMB 5JW4R 5K39B 3TPUA 2WSPA 3EXLA 1BBJB 2BSSA 5FO7B 3V7AE 2BZCA 3HI1B 4G8GA 4JPWL 4AZ8B 4N6QA 4JKMA 1MHCB 3IFOA 4HFWA 2ZAIA 2CHNA 4KZEH 1UACH 2IALB 2DICA 4HS3B 4NENA 1KZYA 4WW2C 4LFHG 2EH7L 3OJDA 1LHZA 2A77L 2YXFA 4X5XA 3IDUA 4KX8A 4ZFZA 3DOSA 4YXHH 3D18B 3GZPA 3Q2WA 5JYMA 1C7SA 1WVZA 5AVTB 3ZZQA 1AS7A 4FQQA 4LCCC 3T8VA 1HILB 5I23A 1AZVA 1U6AL 5CZVH 5E99H 1CTMA 3QNZB 5JPMA 3EJPA 3ZY7A 1G9MH 1KIRB 2HA1A 3X12A 5IROC 2COQA 4RISH 3RZCC 4HHWA 2EH8H 4Y1SA 3L3OA 3CK0H 1S5IH 5GGVY 1P4LA 2IDTA 4GXFA 2O5ZL 4QOKB 3MCKB 1UACL 3JBG7 4KK6C 2C4FT 2UY6A 4RMRA 3QPQC 5I9QB 5DJZA 3MOBL 2R0WH 4TLUA 4JFYB 1HE7A 1G6RH 3MV7D 5FF6B 4B9JA 4IRSB 3H42H 1YN7A 4DPBX 4HWZB 3RKDD 3T4AA 3NS0A 3ARFD 4Y5XC 5HHNA 4TSCH 5KVGE 4F80A 4OFKA 3MJGX 3B9VA 5D6CB 2R2CA 4JVWA 4GSQA 1DVFA 1CDYA 4OF3A 1TFPA 3PQYE 1QUNA 2XN9B 2WXMA 4FAAB 3HANA 4KTEH 3DPBA 4I9WD 4MA1C 4MNQE 5DA4A 2I9LB 3AM8A 1PTZA 2HFFB 1IM3D 2JJWA 3DUUA 4WHTA 2OSLB 2WQAA 3ZW3A 4JM2F 5AVZB 2F68X 5F7DB 1RIHL 5HHXH 2AK1L 3SDDA 3ISRA 3UTTB 5CJ5A 1Q8MA 1MI5B 4BSVA 1S46A 1EZUA 2OW7A 2BNRA 3WHE1 1EXHA 4KKLC 2QVFB 3RJDA 1KGXA 2OFQA 2AERT 2YQ3A 3OVUB 3Q3GB 3SBRA 2KQMA 3D4CA 3PJSB 1MFMA 3JWNH 4FXGC 2BCKB 4QT5B 4BFOA 1N0XH 3KCPB 5FA4B 4I0PC 2GSMB 4XVSH 3FU9A 2J8UF 4B9ZA 3WMPA 4NM4L 1NZRA 4QJ5B 3L4TA 2Q76A 5ACLA 4S1QL 5JHDD 2OQJA 1BAFH 2DM3A 1T2QL 2YMTA 1MFBL 4F93B 1P5UA 3CFEB 4MA8L 2CGRL 2IWFA 4H8WL 1BYNA 1JPSH 4JCLA 1VAHA 2JV6A 3CSFA 4XR8C 4MX7B 2IQAB 1NJ9B 1FZJA 1J8HE 1SN0A 3Q48A 2J57A 1H19A 1MW2A 3QK0A 5I0DA 4IS6B 5KVDH 1NPJA 2KSYA 4PGZA 3LSOA 3FOLA 1J87A 3MR9B 3TWCH 3NH7H 4UTCA 3ARBA 5F1SA 1F8TL 1G7HB 1K5NB 1WLHA 1YNKL 4UB0L 2FR4B 3HB3C 3MGOA 4LQFL 5KVFE 1CGSH 1U8KA 2HX9A 2OJZL 4PB0L 4ATWA 1YY9D 4WI0B 2E86A 2FYVA 3EO9L 4LNVA 4CKVX 5AVVB 1RMFH 1T2XA 4Z7UF 2CO4A 4ODXB 4XPTH 2MQ0A 1ZA3B 3GMNB 4UNUA 2DEXX 4B60A 5B38B 5DGRA 1KEMH 2FT6A 1N8ZB 2N7AA 4PRPD 1S78C 3WAKA 2XETA 3ZZSA 2O6PA 2ARJQ 3O2VL 2QLVB 1VACB 2YA1A 4ZRGA 1REIA 3NIGF 2F8IA 4KY1H 3KPSE 1JXFA 2WQRA 3DOIA 4P4KC 4ADJA 1KTLA 2PN5A 3DJRA 3QIUA 2ZSVA 3MRBA 5C0CE 1MQKH 5IQLA 1MFBH 3P3YA 3ULSB 1LL1A 5E1GA 3GHBH 4LDEB 5AX0A 4HIXH 5IMMA 3GQFA 4LEXH 2JKSA 2WBKA 1TCRA 2V3EA 4S2SA 4TXVB 2CKBH 2Q86A 3J07A 5D7EA 3E2HC 5EN2B 1I9EA 2CUIA 2OBGA 2DQDH 5D1ZD 3UC0H 5K9QG 5CINL 4RMBA 5D4IA 4BWWA 4YDLB 3PG2A 1RZIA 3FQTA 1OM3L 2BRDA 1T21B 5K33A 4OKDA 2WHVA 4OZFB 1DFBH 5DEFB 1JDDA 1JDCA 5D93B 4JFXA 4OQ1A 4ENED 1B90A 3LKOA 5FKPB 4OZIB 1JK8A 1ITBB 1AZNA 5C0DA 1TSRA 3CIAA 1DLHA 4QO1A 2WGNB 4QXTB 4OGXL 1PDKB 4CGTA 5G2DA 4XNQA 4YL9A 4DIXA 4YNYB 2IAMD 1QATA 3P3RA 4NQCE 1GS7A 1BM3H 1IVLA 1ND0B 1RUKH 2N7SA 2ZCHL 1T0MA 4FJ6A 4N2AA 5CUSH 1IM3A 5GJTL 3U7WL 1N4XH 1YLBB 5F88B 1QO3A 3BVUA 3X3GL 1A6TB 4MMZA 4QTFA 3HB3B 4KJYA 3RWGA 3GTNA 3BLKA 2NXZD 1CGYA 4X99B 5E4IA 4OCSH 3P9MA 1BLNA 3ARGD 5KJ7E 2GJ6D 3RVUC 4E9TA 1E4WH 1E0OB 3T3PF 3H42L 4LLVB 4G2AA 5ANHA 1T5XA 4MNGE 1NEZG 2ZXQA 3KXFB 1EUUA 3Q6FB 3PAZA 5K9JH 1XQ4A 4M8RA 3MAWA 2GI7A 5KANG 1BOGA 3UC0L 2J72A 3NIFF 2J1YA 4K15A 4F9LC 4AYGA 3EYFB 1XTLA 2B08A 4HIEB 3QUHA 4GAYA 2B59A 4PVMA 4PJHB 2FEJA 2NZIA 3AQZA 2OP4H 3EJZD 4ZFFA 1FF5A 5E56A 2VDOL 3EGSA 4FQ1H 2BRRL 2Q8BH 3P4MA 1KIUA 5EO1A 3AQXA 4U49A 1ORSA 1O0AA 4F15C 4XCFL 5IBTH 1AGFA 4ZD3H 3GO1L 4PGDB 4AH2B 1JN6B 3QRBA 3R1GL 1BMWA 3H53A 1I7UA 2ESVA 3O6MH 4HISA 4XMZA 2OYMA 4IDJH 3QUMH 1FNAA 1PKQA 4KBPA 4WTZG 3F2LA 3WIFA 5HHOA 4LL9A 4PGBB 3WN5C 3EBGA 3DGGA 3DPDA 1THAA 3VFOA 1CFQA 3FO0L 2BHUA 2D3JA 3VJ6B 1ZHLA 3UO1L 2XVBA 1SYSB 5J1AA 3A4AA 4M61A 6FABL 3PL6D 3GSXB 2QPDB 3TFKD 1XGPA 2WO4A 3WKMH 1J1XL 5GGQH 4OY9A 5DRZA 4IBVA 1B3JA 5F8RC 4MJ4A 2VLKE 1PFCA 1RUAH 2O26U 3P9LB 3ZUNC 1YJDL 4UT6L 4L23A 1KTLB 4R26H 2VKWA 3CDFA 3DX9B 4JFUA 1AD0B 1RUQL 2PXYA 5I18H 4JM4H 3ILQC 5DJAA 1JF6A 2BOLA 3GWJA 4FMKA 4QRPA 4XNMA 3FSOA 4NI6A 1PX4A 1F11B 4M1CD 5EF1A 1QKPA 3O3DA 2ATPA 1EGJA 2CR3A 3MA9H 5BVJA 1PX8A 1G9MC 3SQOH 4G71B 4Y4FA 2Z35A 4R0LB 4ZS7H 5HI4D 3TM6A 1E9QB 5CP3A 1MJUH 2XV0A 5HI5D 1CXIA 4LSPH 4FX5A 3B1TA 3A6BL 2G75A 4M7ZB 3UJJH 1VACA 1XR9A 3ESMA 3ZKSD 1NCCL 4Z3TA 5LAPA 4RQQB 1JZIA 3B9EA 2YJQA 3ELQA 3F64A 1T4KB 3RHWF 4AIEA 3BVXA 4AQ8A 2FX8L 3R7RA 4YHLL 1Y0LB 4PJGA 2XACC 2R59A 1WCQA 3GMOB 2FE0A 3C9NB 2CO2A 4R4BA 2KH2B 3FO2B 1A6TA 2DAVA 1MHEB 4FQHB 5ETUB 1C1EL 4FLOA 2C34A 1DANT 3P9MB 2WANA 1FSKC 3ECUA 3DSNB 4EZKA 1HN1A 5GSRB 4E5XG 1BZEA 2FD6L 2A2QT 1PZAA 4YBHA 5D5ME 4OCWH 4FXGB 3G3LA 1JL8A 2YPLE 1GSMA 2QQKL 4YR6A 1C12A 3B1UA 3BZDA 3NT0A 4FFYL 4MDRA 3SE4A 3JWDC 4TKWA 3IJYB 4U1GB 3G6AB 2O5YH 5GGRB 1DJZA 4ZTOL 1JHLL 5BQ7A 2DWDB 2M8XA 1KDIA 2WVVA 4LRNL 1ADWA 4YK4C 1UM6H 2HPTA 4UM8B 4DP4X 5I1AB 1MG2C 1QO3B 1YNKH 3IJHB 4UB0H 3SJVD 2FJFA 3UG5A 2ZJSH 1CYXA 1H9VA 2XC8A 1HI6A 3BFOA 4K94H 3QJQB 4NC1E 3WDIA 1INEL 3CVHL 3L5XH 1E5BA 3RAJL 2Y07L 3CHRA 5FCSH 5E8OB 3DROA 4DKFH 2FEEI 2P8PA 3DX4A 3RL2A 4PRPB 5BV7L 3VHZA 5D71H 2A9NH 4YPGA 2V4LA 5DZJA 1FNSH 4KKZA 4RDBA 3OJMB 2EO7A 1IAIM 1QRKA 4M93C 3P77B 5IB5B 3DO7B 1T2QH 1E0PA 5BZWB 2C4FU 4W9HC 2V7NB 2ZT9C 1CT8B 5GGUA 4N2DA 3IWUA 4IMLA 2NSXA 3FB7B 1WGVA 1NC4B 3IXAB 4HWUA 4JM2C 4G7VH 4KRMB 3WGUB 4DJMA 2CRIA 2IQ9L 1I7RB 4IKIA 4BWTA 3DURB 1DTUA 3PWNB 4UNVA 4XAKE 1BWMA 2NXZB 1KIUB 4PB9H 5I6LA 5E9DE 1GJWA 1BP3B 5J6HA 3WKQA 4JQXA 5AOLA 4OJAA 5FS5A 4PJEE 3EOTH 3FFCD 3SDCD 5IEHA 1WCBB 1ZHKB 1MIML 1P0SE 4LRNH 1XHHA 4NYLB 4HULB 1OF0A 2PR4L 3U46B 3DTXA 1IL1A 1Q9OA 4GS7B 4U1SB 2BS9A 2CCWA 3F04A 3QRFM 4WJKB 1B88A 1U8NB 4B53A 3NK4A 4UU9B 1WIPA 5C07B 4N5ED 1H5BA 3D4ZA 2RTTA 5J9PB 1ZMYA 1FHNA 3JWOH 3US1A 4F9PA 3BMWA 4YQXL 1QZNA 1L6PA 5GS1C 4IHBA 5F7YC 1MH5B 1I53A 3OE8A 2CDGB 2WKOA 1WZLA 2O5NA 5AVWB 5IJKA 3GSRA 1DZEA 5C2BL 1B2WH 3ALWA 7CGTA 1KNOB 1XF2B 1X9QA 1M71A 2BJML 3PHAA 4GLRI 4KH9A 1AD0A 2PXYB 2YXVA 4G7VL 4IBSA 1I8UA 3UPCA 4YHIA 1CFSA 3FUKA 5I71B 1T7YA 3E6FB 1K4CA 2DQIL 5DEJA 1NGPL 5T3ZH 2IFFH 4PJ7B 3CMOL 3OM3B 4KKCD 4PJIE 5A45A 4WWKA 1JTPA 4XPFL 4JANB 4PJ5D 4M48L 4MQSB 4B50A 4WFGD 5L4JA 3TV8A 1ML0A 2C9VA 1VGKA 3KBPA 3TPKA 1EO8H 1KB5A 3I6SA 2A6JB 3C75A 3ABLB 3IETA 4O00A 4NWUL 3MODL 4XCYB 4NO5B 2HCZX 1GMEA 2F19L 1QUNB 2J1KA 2PCFB 5C07E 3AWEA 1YO4A 1C5CL 2NNCA 3SE8L 4AQAB 4MQXC 4YOKA 1CLYL 4LLDB 2MNWA 2EIZA 5MHSD 4GQ9H 5CN2A 1HQRB 3DXAD 3E6HA 5DMIH 4JGNA 1U8CA 3X1BA 4KJWC 3TN0D 3MXVH 3K6DA 4LHUA 1EAJA 1XB3A 4ZT1A 3SKUD 3RWCA 2MNUA 1QKOA 1YEHH 5T3ZD 2QQLL 2WO2B 1EEZB 4Z9KB 5JW4N 4O58L 4AKQA 1U8JB 4N0FA 2GEEA 5TGZA 2YEVB 1IAOA 1XB8A 4A63A 1S7VA 4CC4A 4P5TC 3SDCC 1P69B 3ENEA 4HUVA 4AGOA 4ZMWA 1F3DH 3A3YB 3K5RA 5F21B 2KS0A 1F00I 3QUML 3FRUA 1SFHA 3KWWB 4FFZA 1GPOL 1E67A 3MRKA 4HXAL 4WI5A 3BIKA 4YHNB 1T4WA 4R4ND 1IBYA 3MLTB 1IE5A 2HRLA 5F9AC 1VFAA 1BF8A 5DO8A 5IBTL 3FQ1A 2L6XA 2BSTB 4GINA 2NX5E 2NNAB 1VF5C 1FH2A 3LS5L 1V5JA 3TEWA 2Y9RT 5B39G 3U2JA 4RESB 4S1DD 2BDNL 1OSPH 5HI3D 5J4MA 4L3FA 1OSZB 2P5WD 1J8RA 3I6GA 4NFDA 3PJSA 2QVTA 1U3HA 4L8DA 4MHHI 3VGHA 5MEQA 4JQVC 3P77A 4JFEB 2AJZB 3DMMA 3D1MC 1QPXA 2YAQA 1GPOH 2VSKB 4N9OB 1S8DA 1NGQH 3QG7H 3T45A 5AD0B 5GGUB 1RL1A 1AXIB 1T0PB 4U1LB 3UBXI 1H3VA 3MRIA 4OCLC 3GBMH 1EV2E 2EXWC 1H3PH 2ZKXA 4FZEL 1HHHA 3QO1B 2NZ9D 2PPDA 2VMJA 5TE7L 1A6AA 2VXQL 3CLEH 1KTRL 4ETQA 4JHAL 2CDEA 1DEEA 2DIBA 4FQCL 1QSEB 2VL4A 1HXMA 3FONB 3PP3K 4F2EA 4YE4H 2NCEA 3IGAA 2ENJA 1PXRA 3TN0C 4PW3A 3P0YH 4P06A 3KH3A 5E6ZA 3UTOA 2WVSA 4NRYA 4L8CB 2AQ3A 4PBDA 43CAB 4DAGH 2X1QA 2GTZB 1ZLSL 4JFWA 1DDTA 4Q9RL 2W91A 4QXUH 4K5PA 4KRLB 3WEXA 1U8HA 5F1OB 1CB4A 1EZVY 4NO0D 3GIZH 4XNXH 1KY7A 4ES8A 2FLRT 1GC1L 2VT0A 1IGTB 1LQBC 3HMWH 1WDAA 2AK4E 3AXHA 4N3TA 4PB9L 1BPVA 4Q14A 3K4ZA 3QDCA 3I9GL 4YSSA 2GJRA 5DMKA 1TVBA 2OZ4H 5IOPB 2XBZA 5FK9A 3T3MF 1JRHI 4O2EB 3GSRB 4W1TA 1CZ8L 2BVTA 2P9RA 3LVEA 4P5MA 5SWSE 4ZTEA 3OGOE 4H8HA 3VXRD 3L9YA 3RY5A 3V0VB 1M1XA 1VZGA 2NLJA 4IRZH 1N3NB 1CL7H 2NUTB 5I74B 3PDSA 1QFUL 2UZPA 3CCHB 3HCVA 3IU3A 5AW4B 3OR6A 2NY3B 3QUYB 4Q9RH 1LMKA 4J28A 4ZTOH 4JFDD 2VRQA 1MJ7H 3U0WH 3QJUB 1OP3H 1SY6H 1C5BL 3N42F 3HARA 2VC2B 4U3HA 2KZWA 4UM9D 4EN3D 5DRNA 1PAZA 5AUMA 2R0KH 1HHGA 2HT2C 4AYDC 4Z3GA 1WAPA 3TEXA 4PJDA 2MRYA 1JZEA 1L7TH 1ZJAA 3NEOA 1NBVH 4WAFA 2X87A 5C0ND 1A47A 3S5LA 1F6AB 3Q6FA 1FGVL 2F08A 3QIBA 5D5MB 5F7HA 4LEEA 1N6UA 4UIKL 4PY7A 1CICA 2NUPB 3DBXA 4XMVA 3EZ8A 4YNYA 4ZMNA 1L9MA 4LHJB 3D33A 2V5TA 1CE1H 5I8KH 3G04A 2NCMA 5ICZB 3F58H 4OD3H 1MHPL 3CSPA 2ALAA 5ABDE 3S3DB 2JNZA 1VFUA 4FTVA 2CNZA 4JO1L 4OLVL 2JKRM 4TMPA 5E8EA 4HJTA 2Z3FA 3PQRA 2M26A 1ZHNB 2QHRL 5A2LH 5ANMB 2WKOF 3AJ7A 3C6LC 4NN6C 1MCNA 5D9SA 4WO4D 4ZUUB 1TQCB 1N6QL 4PJ8B 2CDFA 2MOVA 3QB7C 1RJCA 1D5IH 3GGWA 3QI9D 3ZQWA 4DGWC 4KK5D 4Z7AA 5C08E 4WW3A 4DKAA 1A7RH 3MU3A 1F41A 3QR1A 4U6XB 5HYFA 3HZYA 1MJ8H 5F71A 4ANUA 4HT1H 5IJVA 2G30A 3VFNB 3O4LE 2TRHA 3PUUA 2LTQB 4BSVB 3NFNB 3B7YA 4G7YH 2VDNL 1WBXA 3NDZE 1W0YT 3B2VH 3H3PH 1A6AB 4PCYA 1X9UA 1KT2B 1L9SA 2GAZB 3D34A 4LDOA 4PHXA 4LCVA 4PYHA 3JZ7A 3M7FB 4K7PX 3FCGA 3GZOA 3LB6D 3JTTB 1ZGLP 3D0VB 2ZXAA 1OAJA 5HDRA 3LZPA 2BP8B 1DCEA 4KY2A 1BG1A 3M86A 2H8PB 5ADOL 5D7HA 2ZCKL 4EA3A 1FLRL 5IB1A 1UXSB 3CNKA 3UTZB 5DVPA 1KXTB 3LQAC 3SPVB 1KYAA 3MLWL 4YDLC 3ABKB 2WBJD 5B6VA 2OMWB 3E2HB 4U1LA 4EQ2A 2Y5QA 1OALA 4XHJD 4MJIA 4FFYH 3H9SA 4ABQA 1X0I1 2P5WB 3K8KA 3NABL 3GNMH 1F97A 1UXMA 1BIIB 4Z0XB 4ZUSB 3HZKB 3OMAB 3ZKND 1CE6A 1K5NA 4M48H 3B6SA 5AKVA 3ZQXA 3VXRA 4HLEA 1NC2A 1QR1B 1DQDL 5C6PB 3KPMA 2ZOKB 2P5EA 4ZMOA 4XCEB 5I1KH 3ETBF 3VCLB 1WBZA 2X2YA 5KVGL 2QPSA 1S5IL 3L4XA 4W9KC 2K8MA 2GFBA 3TF4A 4PJ8C 4JFOA 1LM8V 3SE9L 3FW6A 3SPCA 5BVJB 1XT5A 3GS0A 5D71L 4CVWA 4JQ6A 1O9ZA 4JO3H 4Z7IA 1ZPLA 4I88A 4Q6IA 4Q9CA 1Q9KA 2ZXWB 4P5SA 3LY6A 5D2NA 1NEPA 3QW9A 1GC1H 4ZPTA 4LLQB 1E4WL 3CHSA 1T83A 1KV7A 4OLVH 1J8HD 2YD3A 4LGSB 2CIKB 5F8QC 3RGVA 3HAEH 5LDSA 2VO5A 3X3GH 4KITB 5DF0A 2Y36H 3LAFA 5ERWB 4DFHA 3U7WH 2JXMA 4PP1D 5KBDA 1QTYT 3NCMA 1JV5A 1P7QB 4IBYA 3ZYJA 4APXA 4JDZB 2AVGA 2ADIA 4C56A 4IBZA 5CILH 2E9BA 1MIMH 1A3LH 3QXDA 3NA9L 3KM1A 3DJTA 4DVRL 4S10A 4TF4A 3Q6GH 1ZV5A 3S3CB 5A7EA 4JKLA 4HW6A 3SOBL 4ERSL 1UADC 4FXKB 4U2YA 4QYOB 3WDHA 1J5IA 1XD1A 4WNQA 2NTSP 2YD4A 4NFCA 1HZLA 1H6TA 1HKLH 2Z7UA 3RPBA 3QEQD 4G3YL 4EN3A 3T6QC 2J55A 1QFUH 3DSFH 2ZTBA 5A40E 1TTRA 4UAOB 3SIKA 3ATEA 2GJZB 4Q6IC 3SGEI 3G04B 2G2RB 4OV6F 5B8CB 5HVFB 1JCVA 4PAZA 5IGXH 1CFVL 1S7TB 1CD8A 4HCRA 2RJMA 4J8RA 4KX9A 1HHJB 1FZKA 1N59B 4LASL 1HZHL 3IKCA 5CGYC 5HVWA 3PNWA 4PGCB 4KDVA 4HPYL 3EJZC 3D6GA 1XAKA 1GYVA 1F58H 3D87B 5D1QD 2YC1A 3BI9X 1G7HA 1ZTXH 1BX2B 4EEEA 2VDKH 3UTSE 1YYML 4IRJA 4MASA 1A1NA 2XX0A 2YEZA 3WNIA 2V2WA 3S6CA 5FM8A 4KZEL 3BAJA 5J12C 1BBDH 3FQNB 3ULUL 3VQLA 1WJ3A 5KYUB 4CNIB 3PREA 3SODB 3D48R 3QJTB 3DLQR 1YEHL 2NQ3A 4PP1C 4Y5VB 3RWDB 2EI4A 4X9YA 1JTOA 4Y2DB 5HI4C 1PFOA 3L3JB 1CD0A 1T20B 4QHPA 4L3ED 1VFBA 4PJ7F 3BJ91 5DJ0B 2DBJA 4EN3C 3GXMA 4QCIB 2ICWJ 3L4YA 4QGYA 4P5TA 3GSNL 4HF5H 2Z4TA 4BELD 5D8JH 3KDPB 4OGZA 1KYOK 3VGFA 3VWKA 1VKXA 4ZFOA 4QRPD 4JKVA 1I4FA 4YGAB 5DGQA 2V9TA 2X89A 1NGQL 2ZCKH 3GRBA 5EN3A 3T0EB 2XKSA 5EN2A 1T7VA 5I8EA 2CRMA 5I9QC 2LLLA 4I13B 1R1CA 1R3JA 3RNQB 1QUPA 4WUUD 5DHEA 3P9LA 2EIEA 5E6IC 1MXDA 3DBSA 3POHA 1Q4NX 1Z6JT