4N4YB

Structure of recombinant cytochrome ba3 oxidase mutant g232v from thermus thermophilus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant G232V from Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4n4yB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4n4yB02
1GY1A 1KGYE 3CDZA 4KNTA 4BXSV 1OF0A 4A66A 1WA2X 5JJEA 3WI9A 2BZCA 3X2QB 2PP7A 3OQRA 2IH8A 4MBSA 3AW5A 1L9PA 4BWWA 4LDOA 1ET7A 2DWSA 1R1CA 3SBRA 4DPBX 1OOWA 3NSDA 1NWPA 2EIMB 5B6WA 2FQDA 4F7KA 1N68A 4NC3A 3IBOA 3JTBA 1GW0A 1M0MA 1GY2A 1AACA 2LNLA 1A3ZA 2HRGA 3PCYA 1M56B 4YVUA 2JKWA 2ZONA 3EF4A 1V55B 1X0K1 2VW4A 4DKLA 5ITCA 4JHUA 3PLYA 5B7FA 1PZBA 2JAFA 2L6XA 4LDEA 4BVNA 4NB7A 4X32A 5F8UA 3A7KA 3H4FA 5DYSA 5I28A 3QJSB 1ILUA 1E5ZA 4A2GA 3UG9A 4N8UA 4Q8BA 1F56A 2UXVA 2CUAA 1XB6A 4PAZA 1MDAA 1NIAA 1SDDB 5B2NA 2RACA 9PCYA 3QBKA 4JKNA 1F4ZA 3C9MA 1NIFA 1ZIBA 2YXVA 5B0WA 1AP9A 2ZFEA 5I6KA 1AG6A 2GB2A 3D4SA 4GP8B 3FU7B 3HANA 3OD3A 4E9XA 2MTAA 2FT7A 3UADA 4X1HA 2KS9A 1TKWA 1WAEA 4MD1A 1NPJA 2OCCB 5F7BA 4UANA 2UX7A 3T9WA 7PCYA 1IC0A 2FQEA 1CWQA 3UAEA 1XMEB 1X0I1 4PXKA 1AS6A 1ET8A 1VJMA 3ABMB 4EF3A 1QM8A 1KCBA 4BUOA 2GC7C 2GC4C 3QDCA 2W88A 5B35A 5H2OA 5BR5A 1CUOA 1E5YA 2J57A 2WJKA 4YSQA 5B6VA 4A68A 2UXFA 4DP5X 3UGEA 2Y03A 2XX1A 4Y9HA 1X9RA 2I7OA 2XXGA 4XTLA 1S8JA 2P80A 1E30A 2A3TA 1JOIA 3KW8A 2LLNA 1EHKB 1NWOA 4E9TA 3V2WA 1RCYA 1BXVA 1F88A 1UATA 4QI1A 2OV0A 3JT2A 3PBLA 3X1GA 1GU8A 2VT4A 4WW3A 1L0MA 5AX1A 2FQGA 3NSBA 4A2FA 4DPAX 5H2IA 2MRYA 4AKQA 1JZEA 3QJQB 2DWTA 2XYBA 3ZDWA 5B1BB 2HXAA 3V9EA 5H2MA 5IY5B 4TXVB 2HX9A 2PPAA 3SBQA 2BWIA 2F93A 5ETZA 1AOZA 4IARA 2AT9A 1PLCA 5B3SB 1YLBB 4DP9X 3VG9A 2ZZLA 4TL3A 5EHFA 3OMAB 1EZLA 1OCZB 5A45A 2X88A 4DP8X 1AANA 3T71A 1L9SA 4A2EA 5DHGA 5ANHA 5B1AB 2EILB 1P8HA 4X31A 1ET5A 2XV2A 4L35A 3FPXA 4DP1X 1F50A 3CAPA 3SN6R 4YL4A 3FQ2A 4XTNA 2R4SA 2H47C 3ASOB 4YSCA 2QPEB 4DPCX 4E9WA 1JERA 2FWLB 4MQSA 2FNWA 1BRXA 4G71B 2YAFA 3WNIA 2HLEB 1NICA 1VGOA 1ASPA 3RFMA 5AZUA 1MZYA 2DV6A 2XUWA 4KNFA 1TEFA 1AZRA 3CZUB 3L45A 4DP4X 4UF7C 1AIZA 3CG8A 2PP8A 2QDVA 3QPKA 1JFPA 3HEIB 2KSYA 4E9RA 5I5JA 2HZHA 3UZAA 2UXTA 1QKOA 2P80D 2HPYA 3FYEB 4YSRA 1M0LA 2PPCA 3FU8A 1KBWA 5A8EA 2IWEA 3ASNB 4BWBA 1W6LA 1L9TA 4W9ZA 2AFNA 3DKHA 1QHQA 1GUEA 1GSKA 2IDTA 3P0GA 1J9TA 2AZUA 3FSWA 5DHHA 3U25A 4DJHA 5A44A 3X3BA 1PMYA 1L9HA 3ERXA 2NTWA 4HCIA 1IBYA 3V9CA 5B34A 4WTQA 3ABWA 4XTOA 2EIJB 4G70B 2PEDA 1JVLA 4BWTA 4AZUA 1LN6A 3S8GB 1OCOB 2QPDB 3C9LA 3UAAA 4IB4A 4F2EA 4FBZA 2PPDA 4AKOA 3BVDB 3RYMA 5B6ZA 4G7QB 3HB3B 4A2DA 3HAQA 4CSZA 1SFDA 5AWZA 2IDSA 1ILSA 1QKPA 4BDVA 2WO2B 2I85A 1DZEA 4E9YA 4UAHA 3X1BA 1JV7A 5JJNA 2PLTA 3AG1B 4BWUA 2AZAA 5LDUA 2N0MA 1R84A 2XX0A 1KDJA 3PWHA 3DIVA 1ZV2A 1FFTB 1AR1B 1BYOA 4NERA 2YARA 3QBLA 1SHXA 1PAZA 1BRDA 4HHWA 1JXGA 5D4IA 1Q5IA 3NY8A 3FYIB 2BZ7A 1J5CA 1N70A 4A2HA 3ABKB 2DY2A 2YDVA 1GS6X 4YSDA 2YAHA 4PXFA 4E9SA 1JXFA 3CDZB 1GS8A 1A4BA 5G53A 3T6WA 4KOBA 1KYAA 3KJ6A 3IN0A 5E9NA 5AX0A 3VVKA 1TN0A 5TK4A 3UABA 1W6WA 5I6PA 3KW7A 2YAOA 2KSBA 1RZPA 4HYJA 4MFHA 5TK2A 3TBCA 4KO5A 3ZEVA 4K5YA 1AZBA 1E67A 2CCWA 2BHFA 2I21A 4UHRA 3GDCA 1FWXA 4J4QA 4KNSA 3DDLA 2I20A 4GYCA 1V54B 4DP2X 4EA3A 1H68A 2F95A 4AMIA 4BXVA 2QT6A 1BQKA 4Q89A 3UTVA 1PNDA 1B3IA 1CYXA 2NTUA 4QRYA 1KV7A 3ZIYA 4G72B 3EH3B 2XLLA 1QLEB 1NIDA 3UZCA 2I1XA 3H4HA 1OCCB 5I6OA 3FS9A 1QHJA 4XT1A 1WA1X 2AVFA 4E9QA 1OE1A 1KBVA 3OE8A 3FPYA 1GR7A 4HCFA 2WSDA 3RZEA 1AZUA 1V10A 2IDQA 3MBVA 5J7AA 1NDTA 4GXFA 4N4WA 1URIA 2VMJA 4HYXA 3OE9A 3AG3B 4BV0A 2UX6A 4JKVA 3EHBB 3PAVA 3TA4D 2CJ3A 1BXUA 1PF3A 3UTWA 3EH5B 1U19A 5AHYA 1IUZA 8PAZA 2J5WA 3OM3B 3FSAA 2J55A 1GZMA 3NP3A 5FC9A 1KMEA 1AS8A 2NRDA 4HCGA 2XVBA 4AKPA 4YSEA 1WA0X 1SHWA 1ZPUA 4HWLA 4HZ1A 5B1KA 2VW6A 1C8RA 6PAZA 4HAKA 1CC3A 4DP0X 1BYPA 2QDWA 3QBIA 4GP5B 2YDOA 1JGJA 1X0SA 3NJFA 2Y1AA 5G54A 1XJIA 1AAJA 1M57B 1PXSA 4WAVA 5I5MA 4M4RB 1FBBA 5H2PA 1AT9A 3OMIB 3QBGA 2WO3B 5B1JA 1AS7A 4A4MA 2VW7A 3ZX1A 2WJLA 2EIKB 2EI4A 4MQTA 2XV3A 3WQJA 3GXUB 5I6LA 1H2SA 4YVNA 1SJMA 3HAPA 4G7RB 1ASQA 1ZIAA 2FT8A 1SFHA 2JXMA 2PP9A 4RH4A 4EJ4A 5D4HA 4GBRA 3X1EA 3VHZA 1PY0A 3HASA 5PAZA 3NJNA 1IXFA 1XB8A 2VSMB 1AG0A 3AG2B 2VM3A 1KGBA 2FJSA 1AQ8A 3VI0A 2BP0A 3MX0B 2H3XC 3T45A 1OV8A 4DP6X 2YCWA 1UCQA 5ITEA 1CYWA 4AI7A 2DYSB 1JZJA 2IDFA 1XIOA 2R4RA 1DZ0A 2B3IA 5FJGA 5G2CA 3PXLA 4KLYA 4XT3A 7PAZA 6PCYA 1E12A 2CALA 1JZFA 1FBKA 2Y00A 5G2DA 3GYRA 2YAMA 1PLAA 1IW9A 1BQ5A 3OE0A 2R7EA 5D4JA 2Y02A 5JJJA 3OMNB 3S3DB 1JXDA 4EIYA 4YSUA 1ETJA 5I6NA 1SNRA 2UXGA 3S3CB 3WIAA 2XXFA 1S54A 3NJGA 2VSKB 2TSBA 3AYMA 3NYKA 4GRVA 4NAJA 2Z55A 2M3GA 3COCA 1PLBA 4KNUA 4WKXA 3ZPQA 1UAZA 1GS7A 2Q9OA 2FT6A 3NJIA 1WS8A 2GBAA 1TN5A 2ZXWB 1BRRA 1IW6A 4A67A 4GY4A 3IN2A 3QJTB 2HRHA 5BR2A 5I5IA 3QJVB 5I26A 1OE3A 4HIPA 4CSPA 3FU9A 3NP4A 3NT0A 1FA4A 3AYNA 3S8FB 2GI0A 2W8CA 5H2LA 1NPNA 4HALA 4KO7A 1AZCA 3NJLA 4MD2A 3TBBA 3G5WA 2TSAA 3FU7A 3CVDA 3PAUA 3AZUA 2GIMA 3H56A 2Z73A 3BQVA 1JVOA 3IEAA 3DTUB 5H2KA 2DYRB 2PPEA 3WKPA 3N55A 4QKTA 4QLWA 3PAZA 3T6XA 3HARA 2FQFA 4ZK8A 3PDSA 3WKQA 2FTAA 2R7EB 4JQ6A 3ODUA 5A7EA 3NJKA 2ZIYA 4QIDA 3UTXA 3X3CA 3PPSA 4YSOA 3SQRA 1O0AA 3NSFA 3CODA 5B7MA 4FA7B 2J56A 4BK5C 3WG7B 4K9JA 4L0PB 3C75A 5B6XA 1BQRA 5AHZA 3NJHA 1R2NA 4BDVB 4GYBA 4YSAA 4GP4B 4AMJA 2GSMB 2G87A 2BO0A 3T6VA 5H2JA 2ZOOA 4PCYA 3FT0A 1XB3A 2YAPA 3VW7A 1ID2A 1J9QA 4E9VA 1ZDQA 3NYAA 5AKRA 4DP7X 1HFUA 3OE6A 1NINA 1ZDSA 2IWFA 3UTYA 1JZIA 2CBPA 3SBPA 5LWEA 4N4YB 1SF3A 1P8IA 2IDUA 1Q5JA 1HZXA 2IWKA 4M3HA 1E0PA 1A65A 2BP8A 2XU9A 3N2JA 1A4CA 1QNIA 1J9RA 1S8LA 3AY2A 5EN0A 1MG2C 4JR8A 1MGYA 2XV0A 4XXJA 5PCYA 1PY6A 1JV6A 1I53A 1BAWA 2BWDA 2YXWA 4KOCA 2JFCA 2YAQA 2Y04A 4JHVA 3NSCA 3PXOA 2YCYA 4FPDA 5B1JC 2YCZA 4YSTA 1PNCA 4YSPA 4FAAB 4BEYA 2OJ1A 4F2FA 3OAXA 2Y69B 2EINB 5I6MA 3HAOA 3CVBA 1TU2A 3ABGA 3MBWB 1HAUA 5G28A 4BEZA 1M0KA 1OE2A 4KO6A 1C3WA 3WNJA 3CVCA 2RH1A 3T6ZA 4DAJA 1IBZA 2H5UA 1VLXA 1X9UA 2BW4A 4X4KA 5B7EA 3X1NA 2BW5A 2IH9A 4HHGA 4YSSA 4KO9A 3NY9A 1JZHA 2ZWNA 3FSZA 2J4YA 1BXAA 2BP8B 3NJMA 4OV0A 1PXRA 3V2YA 5KKHA 3NJJA 2YQBA 4GPOA 1DYZA 2JAGA 3S3BB 1PCSA 3AM6A 1GYCA 1S52A 1NZRA 2E86A 3FSVA 1ADWA 3NSYA 2XWZA 1IKOP 3TASA 2CAKA 2YCXA 3X1FA 1ASOA 1S51A 1J5DA 3DQBA 3QJUB 5AZDA 5C1MA 5TGZA 1MZZA 1RKRA 2GHZA 1A8ZA 1RZQA 2HX7A 3ABLB 2I35A 1AZNA 1NTDA 1NIBA 2B08A 5AFAA 3IE9A 5G2AA 1E65A 1L9RA 2X72A 3EMLA 1CURA 1S53A 4UG2A 4P5SA 1KG8A 4L6RA 2PCFA 3NS0A 1OCRB 1J9SA 3AG4B 4AX3A 1KCWA 3EH4B 3ZBMA 1JZGA 1T5KA 3UACA 3REYA 2Y01A 2IAAC 1MG3C 2Q5BA 3FQYA 4LDLA 5H2NA 3VGAA 1PZCA 3FQ1A 5G36A 1PZAA 3QAKA 2YAEA 2BRDA 2HX8A 5F7AA 1KG9A 1SF5A 1C8SA 4IAQA 1NIEA 3TU6A 4P5RA 4ENZA 3UONA 2KSAA 4N6HA 4G7SB 2VM4A 1HAWA 1W8EA 3QQXA 5H2HA 1L9QA 2X87A 1WS7A 2PCYA 3QAPA 3ZPRA 2PPFA 1BM1A 1M9WA 1KDIA 3D12B 5B6YA 4W1TA 1L9OA 2VN3A 2AANA 2I7SA 2BP0B 1BEXA 3PQRA 1TEGA 1A4AA 3QJRB 1P8UA 1SDDA
chains in the Genus database with same CATH superfamily
3ZT5A 3FT3B 1MCRA 4OZ4A 3WL9A 2YGPA 3WY4A 4HGKC 4Z76A 1CICA 3V5KB 1ACYL 1B4JL 2VR4A 1R33A 3QXUA 3MNVB 1QLRB 5AW4B 2DWSA 5CJQL 2DEXX 3JWOC 4FFWD 1Q90A 2YPVH 1IAIM 4F37K 3ARRA 3ZKXC 3L5XH 4X5XA 5FUCE 4L4TE 2FHFA 4LRIA 3PWPB 3DETC 4DS7E 3PLYA 1S5IL 2HT3C 3WFDL 1WITA 1FGVL 1DBBH 4AENA 4Y4KB 2ATPA 4J6IA 1DBMH 1J9CT 2DM4A 2EDEA 2R2EA 2R2BB 3BFOA 1GVIA 4ONOA 3QUZD 5DHVB 2R83A 2BXYA 4LLYA 1NCDL 2XTJE 3F7KA 1RU9L 5B2NA 2H41A 4AV4A 5JO5A 3QBKA 4NCDA 1F4ZA 5EF1A 2JIXA 3GXNA 3VUAA 4XNZC 1IIKA 5AAMA 3DO4A 1ORQA 3WNPA 3SO5A 3U6RA 3E6FA 5MI0B 5DMIH 4TQPA 4ELME 5L0QB 2N7BA 4W4OA 3UBHA 2WZ5A 5HYSA 2C3WA 2H0FA 1AS6A 1ET8A 1HSAA 3WN5B 3FJTA 2CR6A 2GC4C 5A2IH 3ECUA 2W07A 3QDME 4W4NA 3UBFA 2IQAB 4OGQC 5CZKA 5B6VA 3CHQA 4O4YL 4Y9HA 4UDUB 1A14H 4MCNA 3ILQC 1F4XH 1D6EA 5F6HJ 3SBWA 4LSUL 1X6LA 4JG9A 2B4CH 3V2AR 1Q0XL 3O3DA 4IIZA 1FC2D 2XA3A 2FQGA 4UMSA 1X5XA 3RDTD 4UYPA 2XTJB 4X98A 3WCYA 4G59C 1P5UC 2IVFC 5AD0B 3CN4A 3SBQA 4HZLB 4N87A 1E50A 2DQTH 2UUDK 4WZ9A 1N5AB 2X2IA 1IGMH 1XR9A 5CMAA 5DQDL 4J3BA 1UWYA 1AFVL 1SVZA 2H1XA 3HS9A 3ZZSA 3R1GL 5D7JD 1OTTD 1A6AB 4B0MM 4BQBA 2VN7A 2ZF9A 1P8HA 1QLEH 4MZ3A 3LS4L 5TD4A 2A4CA 2ENQA 4L35A 2D3LA 4MAUL 3CAPA 3H2WA 3FQNA 1K5WA 1BJMA 3OC8A 1I4FB 2AABL 3BT0A 5J57B 4NP9A 2B1HH 4KWUA 5EFIB 2OR9H 1YN6B 4LVOB 3G08A 4BE5A 4YS4A 2HJLB 2QKIB 3DDFA 1QVOB 4L29A 4YXHH 3BZEB 4S10A 3GT6A 2HRPL 3MBEA 2GK0A 2YLHA 3O2DL 2CE6A 4AGQA 4EUPG 4E0RA 4KXZI 1WEJL 3CHRA 1L0YA 3B8SA 1JFPA 5A16A 1S7VB 3QR1A 4HKBA 1QKOA 3MGOA 4XODA 3FYEB 1JDCA 4G6AC 1UWEH 1Q0YL 3OLGA 1OAXL 4JAMA 1A0QH 1ESOA 1FAIH 1V3KA 3RWHB 4BQ9A 4JZJC 4FG6C 2Y2WA 3TBTB 1X5MA 1WIOA 1MCPH 1IBYA 3CSYA 2WKOA 4FNSA 3O9WA 1MWAB 1OB1B 1J0KA 2IJ0C 3UCQA 4LMQI 2FVNA 1GGCL 1IO4C 1K6QL 2PPDA 2XWJB 3E2HC 4W9GC 1CIDA 2VLME 2ADGB 3RYMA 4KXZH 3HC4L 4GSDH 3ULUC 4L8SC 4UTBA 3CSGA 1GYVA 1AI1H 4M4PA 2W0PA 2NY7L 3PGCB 3X3GH 1KFAH 3T2NL 1GMEA 2VMDA 1KBGL 2VR9A 2YWZA 4AVHA 4PJIA 2RIKA 2XA8H 3CZGA 1OGTB 1U3HC 3CXDL 2ADIB 4NERA 4TF4A 1U8QB 2R4SH 2B0SL 4YK4C 4N25A 2J2ZB 5ADOL 3QFJA 3VFWA 2WUCH 4W6YB 3VB9A 1QRND 4ENEC 1DP0A 4AWJC 3E9TA 4GLRH 5DUPH 1OTUC 5DLMH 4G6KH 1AHWC 4G6MH 3U0WH 2DQCL 4LKCA 4MDRA 1JPEA 3VGEA 3KM1A 3RTQA 1NFDF 4HJUA 3VWJD 3MRMA 1PQZA 1LVEA 2CIKB 2YRPA 3BIKA 3QI9A 4QEGA 2DLHA 3VCLA 3LZPA 3BWZA 3ZDZE 4FQXB 1RUKH 2DH3A 3CLFH 5DD6B 3WY1A 4WO4A 3UTSD 5C0CB 3QZOA 2F95A 2ARJA 3MLWL 3NCJL 2QT6A 4PSRA 3TXAA 5B39B 3B2VH 4JHBA 3DLQR 5FA3B 2COVD 3GNMH 3FS9A 4WY7H 3RWDB 2Z92A 1T7ZA 1JL8A 3AU0A 1HI6A 3S5LA 1LXMA 1ZAGA 1GR7A 2XXMB 3I6SA 5CN2A 2GT9B 1C5CH 1NCGA 3VXSA 3H1ZA 1RUAL 1CXIA 3B2UC 5IFAL 2OMXB 5JQ6H 3C6SB 5DD1H 1Y07A 2WC7A 4MNGB 3BD5A 5ISZA 5T1KB 3DVNB 1XGYL 1OD7A 3UTWA 1PF3A 2F54D 3K1KC 3MJ9H 4J3OF 4QTIH 4XNXL 2Q10A 2DOCA 2HTKD 3FN0L 3ZYZA 1F6AB 3LMJH 1K9TA 4HUNB 1QR1A 3CFNA 1Y1DA 3L9EA 5B1KA 2WZ6A 5AG8A 1GZQA 4UQIM 4FFYH 4YE4L 5E1HB 2CHXA 3NSXA 3SN6N 1K4CB 3TBSB 4ODHL 3CD4A 2DWDB 1XJIA 5CEXA 1SN5A 3UGXA 4X5LA 5D6DA 3PP3H 4TL5A 2DDQH 1VGEH 2WMPB 3C9NA 3F65A 4G5ZH 4KK6C 1EJOL 2WO3B 4JY4B 2Z8VC 3L16A 3FBQA 3CFEB 5F71A 2H8PA 3P0YH 4LCCB 5H94B 3A4FA 4DQAA 2EI4A 4MQTA 3BE1L 4HHAB 3LCYA 1J8SA 1ACZA 3NIDB 3VGFA 2RJMA 1A4JA 4Z3EA 4G8IB 4TSBH 1R3LA 2FGZA 3AREA 2V17L 1JF1B 2UVFA 4MZIA 5F44A 5CCHE 3VXRA 1I7TA 1DUYA 2EXSA 4Y5YB 3GBNH 4WEBL 4UZGA 4ZFGL 5GZND 1X4ZA 1J05A 1NMBH 1CGVA 2J5LB 5HI5D 3D34A 4OVUA 3JTTB 2AQ3A 3TESA 3FZUC 4FQ1L 5SX4H 3RL2B 4QRFA 5ACZB 2R15A 3EJYC 3ILPA 5EN2A 3VFOA 2HPTA 1IW9A 4F7EB 5DCCA 2R7EA 2XQBH 2CHDA 4U7MA 3DO7A 3F04A 2AQTA 1KY7A 2GCYA 4H26B 4HS8L 4DGYL 2AEOA 3O3UN 3TC9A 2C9UA 2NXZB 2TSBA 4NFBA 1W16A 2AXJA 1ZT4B 4KNUA 4YHPB 3STZA 3QG7H 3AGVA 1JHKL 3KBPA 4U6HA 1YPZF 1UT1A 3QJTB 1GKOA 1S7QB 4AV5A 3ARFB 2N4IA 3QNYA 4HIPA 2XV6B 3JYBA 3RFZB 1WRFA 3D51A 4UZSA 2NY0C 4MQ7A 1FFPA 3NT0A 3QEHB 3KZ8A 4JVWA 3OJVC 3K8KA 3O4OB 4DEPB 2G5BA 4NZ8A 1FVEA 2UY7A 5BUGA 4W4OC 3CVDA 3WGUB 5IBLC 5LDSA 4GBXA 4EKJA 2W59A 5CGMA 2Z31A 4PG9B 5H2KA 3HC3H 2NY4C 4V1DE 3IDNB 4QLWA 4M93C 4XP1H 3IDIA 4Y16D 2RGSA 3CU7A 5C0BD 3BO8A 4DFHA 3MCLH 5JPMB 1IGYA 4QY8A 4MJ4A 1II4E 1M2VB 3RHWK 2KI6A 3UTXA 1IM3D 4R83A 4DWHA 5LXGL 2X10A 4XT1C 4XOBA 5CZXD 1AKJD 4G3YH 4PW9A 2J56A 4MAZA 4BK5C 5HJBA 1NGWB 2WBJD 3C75A 2C3VA 3GMMB 4JKWA 4YSAA 2G87A 2R0KL 1FZOB 3W11C 2YAPA 3O3BB 5GGTL 1PYWB 3IJYB 4G8AC 3EYFA 3VFSA 2HG5A 5CLZA 4OZIF 5H4YA 4YFDB 5E8EA 2YIHA 2PETA 3QO0A 3UTYA 3BRDA 2H0PA 4TYUA 4WI0A 1F11B 4LU5L 5D2NA 1YEEL 1L9NA 2NY6D 1E0PA 3PJNA 4HJIA 4I18C 5DFVC 4KTYA 4WHYG 3JV5A 5HHPB 1HJBC 2JK5A 1A4CA 1QAWA 4OBRA 4EIZC 4FCHA 1MGYA 3LRLA 3WE6A 3I6KA 1F45A 5HD8C 4KOCA 1F00I 4BKLA 4W68A 4I48B 4K71C 1G7QB 1S7UA 5F3HA 3JTSA 3T8XB 2ZUYA 4YOKA 4XN9A 5EZJA 4HV8B 5J5EA 3UC0H 3RWIA 4N3UA 5KVMC 2QHRH 2DH2A 1JWUA 4QTHA 1Q9OA 5TPWL 2XWTB 3OAXA 1UA7A 4RDQF 1PTZA 1VGKB 1NKOA 2PR4H 3MBWB 4Q9RL 1MIEL 1XCQB 3FCUB 3BAXA 3DBXA 1HK6A 5IUSA 4OI7A 3CVCA 1T6VN 2CUMA 5A3IC 4XWOC 2QV2A 3IDJB 3X1NA 5MENA 2EC8A 1N6QH 1KXTA 2OTUA 1RIVL 2YPLA 1UZ6F 3EO0B 2EXTA 4PJ9D 2JKRM 2FAUA 3FFDA 1YNLH 2YPVA 2VDLL 1AXSB 4L9LC 5SWSE 4GUCA 5KKHA 2FJFA 2YQBA 5CSBA 1MFCH 4FQJH 5KSVB 1PCSA 3GSWB 5IQ7L 1BD2E 1TZOA 5I1AA 4K2UL 1YVLA 4JVUA 1TCRA 5CF3A 3ASWA 2CAKA 1MRDH 1WK0A 5DJYA 3T1FA 3N0AA 1IAIL 3OZLA 3CFTA 4M7JL 2PKDA 3FQTA 4XE0A 1AZNA 1GYUA 5HSFA 3SCMD 4Q0XL 3QS3A 2BMKB 5I0XA 1KC5H 2IAMD 3GLAA 4DETA 2DQ6A 4YR6A 3S88L 4UG2A 2QZ5A 2ZUVA 4Y4KC 1KG8A 4MLSA 4AX3A 3IDXL 1JZGA 4D0DA 5DEFA 1N0LA 1W91A 4NUPA 1U3JA 3FQYA 3AC0A 4RBPH 1NL0H 4PJ7F 1KB5B 1QOKA 1KG9A 4JR9L 3BKYL 2K45A 4N6HA 3LY6A 1CTNA 4JK0D 5SWSB 1HAWA 3FB5A 3VMOA 4WWKB 4OLYL 5TE4L 1WS7A 3GSUB 1A7BA 1QUNA 4P2RA 3WFHA 5IIEB 3EIFA 3LNIA 2DD8H 4PY7B 1BD2B 3JVGC 2GTZB 2OYLA 4NPKA 4Y2NA 5FW7A 2VN3A 3COOA 3MV9A 5FGBA 3CSPA 2VXQL 3KBEA 4ZI8A 3TH4T 1DO6A 3K46A 3O4LD 4BRVA 4YGAB 2WYTA 3MYJB 5JDJA 1OIOA 4OV5B 4KH2A 2AV1A 3REVA 4QRPE 5ICUA 2ICWI 4OBSA 4BKTC 4KRPD 1E2WA 3UBXB 2EUWA 5GRWA 4PJAA 5KBKA 1FLRL 3GGWA 1AGFB 2VDML 1BBJB 1BVKA 3A6BH 1UKSA 5F9JB 4MRCA 4NHUB 1FG9C 4ECNA 2FQDA 3BX7C 3QE5A 4NC3A 3FQWA 1GY2A 3EFDH 1DQVA 3AT0A 5IW6A 3KVDD 1KT2B 4GUQA 2HAZA 1JNJA 2ENYA 3V0AC 4Q7DA 1FH5L 4TRPL 3D09A 4C59B 2GJ6A 1ADQL 5G55A 5F0LB 3TPUA 1KOAA 4L3CA 1R5VA 4NB7A 1B90A 3S4SB 5DYSA 3OF6A 3IU3B 4J4PA 2LQRA 1NDGB 4A2GA 3UG9A 3LX9A 1MCIA 4X7FC 3RGVB 4OIIL 2FGWH 1A64A 2VL4A 4Z95H 2P28B 3OPZH 3SQBB 3FK3A 1EVUA 1T0NB 2BSED 2ESVE 3N1FC 3VGGA 1HCVA 2XJLA 2CO7B 3TO4D 4M6OH 4L3ED 3MOAL 4MS6A 3LDBC 2V7NB 3QUHA 5DD0H 2MTAA 1G5AA 2FT7A 1G9MC 4X1HA 2EXYD 3PABA 4RVBA 5EB9A 3D3VB 5KYWA 3CDCA 1IC0A 1BGXH 1HCYA 4M1DH 4ZNEE 1HHKA 1YYCA 2GJRA 4XAWL 3HHSA 1KCBA 4RAVB 3DNKA 4BZ2H 4AL8H 1WFTA 3CQQA 1DVQA 3SKNA 2XX1A 4P23B 2VYRE 1T03H 3LV3B 4JO4L 2JB5H 3K74B 5C7XL 4LDEB 4YHLL 4XXCC 3TS8A 3BUTA 4JQXA 4KJWD 2J73A 4JFWA 2LLNA 2NW3A 3X3FL 5HYEA 1RCYA 1PS3A 2WY3B 1Q4NX 3CQPA 4MXVE 1GU8A 4ZODA 5AW6B 4ERSH 2VDNB 2B1AH 3BGFB 3GLEA 4JFFB 1D7CA 1KCSH 2DWTA 4GKLA 3RKPA 3ZDWA 5J12B 2BSTA 4JBSA 4JRYB 3SB3A 5ETZA 4X6BA 1A47A 5FXCH 4XCEB 1D5RA 4Q56A 1JYXA 4X9YA 3C6LA 4JKLA 5ACMA 3KLHD 1B4RA 1DO5A 1JNHA 1Q9LA 3QA3A 5EOCJ 1HDMB 5FB8A 1KPRA 3TVMA 4B9PA 3ZL4H 4FQ2L 4O51B 4CBZA 2NUTA 2WWMC 4EBQL 4R7NA 1TO4A 4HUXA 1ET5A 1DSFH 2NZ9C 1C5BH 1M9SA 4UQ3A 4XN7A 3QCUH 4IBZA 5FYJE 2R4SA 2ZYIA 4QYAA 2Z1KA 4JFPA 3MRGA 1ETZA 1GIGH 1Y6MR 4XCNA 2WLJA 3UJIL 3QUXB 1EUTA 4E9WA 3WTSA 5FO2A 2LOEA 4EI5C 4DHLA 3BDYL 1AQHA 3JT0A 5T3ZH 3BVWA 5EU3A 1ASPA 3PAYA 4ODXB 2QGEA 2DV6A 3MRIB 2Y2TA 5ESQA 1TEFA 4NO2A 4AQ1B 2KYIA 4DK5A 3HW7A 4AMKL 4PRIE 1LWHA 2UUDH 5JIIA 3QPKA 4NO0A 1QSFA 1DVTA 4UT9L 4PIBA 3IJ8A 3GMRA 1A3RH 5EU6B 3CX5K 4MAYC 3TJHD 3HHRB 1N26A 1NKGA 3V5HA 1FFNB 2F53D 1HVXA 3FU8A 5A8EA 1PZDA 4M7ZB 4FQXC 3LVTA 4P59H 5EMYA 5F6IC 4QR7A 5CNHA 5ESAA 5KVGH 1HNFA 2BK8A 4Z9KB 1MI5E 5JHAA 4GW5B 3D0AA 1U8MB 4JHZA 4XTOA 4PBDA 1X7TA 2GAZB 2PEDA 3CC5A 3MXVH 3SKJL 4QYOB 1Z66A 2D2CC 1YNTB 4AKOA 1HZLA 3ALPA 5D7SH 4PV9B 4J1UA 3HB3B 4M6MH 3NIGF 3RIAF 4KV5F 1BLNB 3EZJB 4K7PX 1O9ZA 5ECGA 4JG0H 2MNWA 4TNGA 3ARGD 5C9JA 4PRIB 5E08H 5DHYB 2V2TB 1QW9A 2ZXQA 4NKOA 1R84A 4K8RD 4EDWL 4YZWA 1FFTB 1TEYA 4DVBB 1BYOA 3OAZK 1MHCA 3OAWA 1T2QL 3QNFA 4HGWB 5BO1L 1EEUA 3R7QA 1PAZA 5DJ8A 4HOZA 2R0LL 3BVXA 3BHBA 4YEFA 1A6VH 1MI5B 1F3DJ 4Z7WA 1TQTA 4QRQA 4YZFE 5JW5B 5E24E 3T2PA 4RMVA 3BP7A 5AOKA 4PLKD 4RMQA 4APQA 1VACA 3GO1H 1A21A 3PPEA 3O3EB 3QZWG 3TBCA 4F7MA 4GKOA 3M6DA 4NAQA 4LCCC 2ZX6A 4O02H 5FYKH 3DDLA 4QDGA 5D1ZC 5HHQB 2IPKA 4ZW8A 3TCLA 2IFFH 5KVFH 4P5TD 2H1PH 2X9XA 1WWCA 4LHQB 5TE6H 5I1IL 1DJIA 2Z6FA 4LCWE 1XF1A 4QMEA 1XCXA 1CYXA 2WXHA 4JDVA 4QRPD 5I6OA 2VC2B 5HJDA 1U8IB 1GGYA 1KNOB 1E40A 3FQUB 1WA1X 3HAEH 1XF2A 2CIIB 1OE1A 2ITEA 1K5NB 3QR2A 3QNXA 4B60A 2RAMA 2J5LC 5F3BB 1U8KA 3D0LA 4N4WA 1P1ZB 25C8L 2VMJA 4P46B 4QRBA 5IJVA 4IRJA 4JRXA 3O11B 1WC7A 4UV7L 3QVAA 1I8AA 3FO1A 3VSTA 3UPAA 2WXFA 1VADB 4NZDA 3GFUA 1TKWB 3QR0A 2AJZB 3L9RA 3N06B 3TCXA 4S1SH 3V0VB 1GZHA 3C5SB 2YGOA 3O6KH 1QFWI 2W0FB 4PY8I 2O5XH 3LRSB 1CC3A 3BCDA 2EYRA 1W8OA 1A6TB 3II2A 4Y8AA 3ZE1F 3SE4A 4HJ0C 4A38A 4CU7A 4HCRL 4PB0L 4IGBA 1XGZA 3QWNA 1KCUL 2G9HB 3QIWA 4YXLH 2FO8A 1FBBA 4U1MA 3GHPA 4YBQC 2FK9A 1UC6A 2FX7H 3CZKA 4G43A 4IIQB 4ZPVB 5EBMB 1E4KC 2A77L 5DEJA 3GXUB 3MN8A 3V4PB 4YVNA 5E94B 1YDPB 2FT8A 2NQ3A 4RH4A 4U1IB 3OSKA 5GJSH 1RULL 4EJ4A 1FSKC 3G6DL 3HC0B 1A5FL 1HHIA 3VD0A 3EOYG 1BDYA 2ITDB 4HK3N 1QMUA 2ZAHA 3EFOA 2QQKH 5AOZA 4HFWB 1I9EA 4F1ZA 5JHDD 2VLLA 1JGUH 4XVUC 3GS7A 2A1WH 3BFWA 4JLRB 5JPMC 4L8CB 5IMMA 2G60H 4FXGC 4NQDE 2H26A 2BVQA 4XNUL 3PV6A 4L8DA 1UA6H 1CYWA 1JGVH 4PP1C 4XPGH 1JZJA 2OTWB 3NA9L 1MJ8H 3PRZA 3QT2A 1EAPA 2FRGP 1LE9A 2XKSA 5HYFA 6PCYA 1J5OH 2CALA 3NPSC 3G7TA 1WF5A 3VVWA 4LARL 5HGGS 1S7SA 4F33B 3OE0A 3ULVC 5D4JA 4KJQC 3KPRD 1P2CA 4YSUA 1JS4A 2WP3O 4YX2H 4ABWA 4OCWH 3IMRA 3BN9D 4R7DA 2X6UA 4H8VA 4FDWA 3MUUA 4P4KD 4J4PC 4XCCH 2VZVA 1CMOA 3HG1A 3ZPQA 3QORC 3CVIL 3U0PB 4IHOB 3PDOB 3IJ7A 3P30H 5HP5A 1S9WB 1AY1H 5BR2A 4GNKB 4DQOH 3H9HA 4EZJA 2V33A 4G7VH 4FX5A 1J1PL 3HBGA 5H2LA 3PJSA 4LO9A 1XF4B 2WCPA 5F7MC 5ITFA 4MD2A 3SYPA 4K4KA 3DJSA 4YDLB 1FDLH 2A9ML 3P0GB 1HWWA 1TJGH 3H56A 4K3JH 3VXMD 1NSNL 4F9PA 1NCBH 4QCIA 5HDRA 3GUTA 3N55A 4OT1L 4LSQH 1NJ9A 4YAQB 1HYSD 4PJXA 2VLJD 4OJDH 4O5LL 1H6UA 3MO1B 5JR1L 3I75B 2QFRA 4QIDA 2F7RA 5LGHH 4JQXC 4HDIB 3CODA 5F88A 5EF2A 5JIHA 1FRGL 4TVSa 3VW3L 4RETB 3J07A 4OR1A 2ZYHA 3AACA 1TQCC 2I07A 3D39B 1DFBL 2OX5B 3S96B 3VW7A 2CJSA 4HXBH 1A1NA 2R4RH 4ODUB 4L23A 4XXWC 3UAJC 1CF8L 4LF3A 4V11A 3SOTA 4YFEA 1JTPA 3D2UB 4FFZL 5E7FA 1LO4H 1HFUA 2XTLA 3F01A 4DP7X 3SBPA 4OAWA 4NRXA 4N4YB 4WRLA 5EU7E 1CXEA 1T89A 2D0FA 2LU5A 3DUSB 4M3HA 1N5YL 5BQDA 2Y1ZA 5AZEL 1MCLA 4Y9FA 4A6YL 1TIUA 5F7NC 5IP4A 1T04B 3QYNA 2GJPA 4DTGH 2Y07H 1TYJA 3FUFA 1RIUL 2JF1A 1ZGLM 3UYRH 1DQIA 3IU4L 3FOMA 1AMXA 4N6QA 3O6LL 3VAEA 3HR6A 3QDGA 1FQ9C 2JB6B 1BPLB 2VN4A 3LKSB 4KK9D 1XH2A 2WW8A 5LO7A 1IARB 3BEWA 2BCMA 3G6JE 1E2VA 5E8DL 3VX0A 3IDUA 3VGHA 5J1AB 1SVCP 1MVUA 4WUUA 1W8NA 3KPQA 4H1LB 4WFGE 5BRZB 3VNYA 5JXEC 3NCXA 5CZRA 1X5KA 3QEGL 2ZCKH 3MREB 4LVEA 4PCTA 3RL1A 5F1NA 3EYUL 3NJMA 3HN3A 5L4IA 3MCKA 3V2YA 1FZKA 1QSEE 4JGNA 1GYCA 1DHKA 1NMAL 1S46A 3FSVA 1A9VA 1J5DA 4B9FA 1FPTL 1ZA6A 1A8ZA 2XCMC 2I35A 4Z7OE 1NTDA 1RZJH 3FN9A 2ZWZA 2VISB 2J8UA 3UROR 1IM9D 3AMKA 3HKFA 1I8IA 2NLJB 3H0TA 1P4LB 3DSFH 2B5IC 2PYEB 4P5SA 3G6JB 1AJ7L 5ID0B 2ICWA 3K0WA 4WFFD 5KVDL 1T5KA 4XNAA 4HWUA 1H6TA 5C07B 3CFJA 1BAGA 4FQLL 1T1XA 4KZDL 1DQDH 2IQ9L 4ZXBD 1L6ZA 3ULUF 5CLYA 2GJZA 4PVBA 2QMJA 4N20A 2DWEB 5E4EB 4G7SB 2XZZA 3KXFE 3MRDB 1HXYA 3RX9A 4GINA 1A3LH 1ICTA 3GMQA 3EW3B 3ZHLA 1EEYA 1NA8A 3PL6D 3G5XB 3VI3A 4LEOA 1QSEB 4K7PL 4NX0A 4O2FB 1M9WA 4ZOBA 3ZKMC 5K9KB 3QRFM 5B6YA 1GOGA 2PWEA 2R69L 1UD2A 1ULVA 3F6JA 4OJYA 4OGYL 5HJGA 3L3HB 4XC1H 5CR8A 1NCCL 2VZ3A 2F58L 2XY2A 1TXKA 3CGTA 4GMSL 4WFED 5TJWK 4GAJL 4AYFB 2BHYA 3EOAB 1F6FB 4HJJH 3TBVA 3MRKB 2DPKA 1MFAH 4DPBX 3F3HA 4LDLB 4U1NA 2VGLM 3CZJA 4YFLF 4F7KA 3JTBA 1Q9WB 4IK6A 4U1HA 1M0MA 3O6FA 3GZQA 2OQJB 4OD1L 2CO1A 5KYXA 4PCSA 4YPGB 1AXTL 2F1AA 4ZW6A 2BNUA 3CFDB 3R0NA 4IOSA 4NSKA 3VWKA 4NRZB 4ZQKA 4ANVA 4NQDD 1RERA 3SDXF 1HTYA 1XSJA 3HG0A 1UM6H 4JHAL 3MCG1 5FAAA 5FOJA 9CGTA 1LE5A 4N8UA 4Q9QH 1GXEA 3ZJAA 1Z3GH 3EGSB 1MHHA 3BQUB 5C3TA 2FL5B 5K9JH 4WF7A 5DMYA 1IQDB 1G43A 2XBTA 4M8QB 3RB5A 3O3AA 3I9AA 5DS8B 4GP8B 2VABA 1Y0LA 2DZEA 2AGJH 5E9AA 4E9XA 4OTXL 2VZOA 4MD1A 1JGEB 1NPJA 2B14A 2H6PB 4PGDA 3F7PC 2XG5A 4KVPA 5AB1A 1X0I1 5D70H 1VJMA 3QISA 1EHAA 4YXKH 3EKCA 1X5IA 1P4UA 4Y7OC 5DT1L 3P3SA 4MHHG 2WGNB 4I0PB 3VG0H 2EO1A 4HK3J 4ZFOL 2G5RA 4XTLA 4XPBL 1CK0L 3MTRA 4P2OC 2VIRB 3QIBA 3TWCH 5CD3A 1JOIA 2V9UA 2X89D 1BQLL 4RZCB 3MA7A 3MV8E 3MJ7B 1MRFL 3A47A 5JW4R 3FB8B 4A2FA 2CKBH 4I89A 5H2IA 2L7UA 2MRYA 5D93B 5C0AD 3X11A 1F1GA 2DTSA 2EYSB 3K91A 1N2RA 5D7HA 1O0VA 7FABL 2NX5D 1CDYA 2YOCA 3B9VA 4NXSA 4APXA 2GITB 1LWJA 3TN0C 1PLCA 5I71B 4QWWD 1ZWIA 5JXAH 1NLBH 4ZPTB 3V7AE 4OB5H 3BP5A 5KTEH 3AUWB 1WZKA 3LEVH 1Q72L 4ONFH 4B7IA 1LO0L 3RILA 1E5CA 5HHMD 5FEBA 4YDJB 3MLSH 1K3IA 3JWNC 2P26A 2Y5TB 2D7PA 2XG4B 4EE2A 3FU6A 1DVFA 2VJ0A 1FO0A 2QPEB 2VDOL 2LVEA 2ZUWA 2FWLB 3CMOL 2X4RA 4TNVF 5T1MB 2DL9A 4ZZKA 5DHXB 3IGFA 1OGAB 2NNRA 2K9FB 3ZDYE 3BP4A 4PJEE 4FFVD 1Y6NR 2HPOA 4HPYL 5E23A 2C4FU 1I9JL 3WKMH 1HNYA 1ZSHA 4UT7L 4FNTA 1AIZA 2R23A 1KJ2L 2ZUUA 2MQCA 1A6UL 1XD1A 4MJIE 4R90L 4X6DA 3VXPB 2HZHA 3WIIH 4ANWA 3SKOA 3PF2A 2VLRE 4O02A 3HRZC 1F3JB 3KNBB 1XTLA 2W9DH 1M0LA 4UMGA 2KZWA 1RHHA 5LVEA 3L4CA 4N8PA 1CFVL 1W6LA 4GRLC 2F74B 5PAZA 3MJWA 5L88L 1GSKA 1FL5B 3UXFA 3ERXA 3P1VA 4HBCH 4ICWA 1XR8A 3HAEA 1O75A 3QZPA 4Y4FB 4NBZB 3TBYB 1PG7L 4ZW3A 3VXNA 1L7TL 2KQMA 3TONA 4N9GB 3W5NA 1GZPA 1SLUA 4GG8B 3ZDYB 2D3JA 4GG6A 4LEXL 3QUZB 3BUQA 1EIBA 1TTAA 5FV1L 1G6RH 1U2CA 1QKPA 1C08B 1I7ZA 2P8MB 2CDGA 2AJVH 3GJFB 3RJDA 1G7IB 4YDIL 4RMRA 5I0VA 2VLRB 1ZV2A 1G7HA 1XGUA 1YHPA 2HFEA 1HHGB 4MQXC 1CBVH 1CG9A 1HIMH 1AKPA 2OMYB 1CYGA 5MEQB 3ZR6A 4F20A 2X9YA 5I1HH 3U2SA 1UD8A 5GGSA 1JUFB 1NGYB 5DD5H 5F7EL 1J5CA 5ES4B 4E5XA 3K72A 4RDQG 3ZUNC 1XF3B 4MB1A 1ZV9A 1A4BA 2VT0A 3TM6A 4JO3L 5KS9A 3P9MA 1OW0C 1HQ4A 3L2MA 5F9WC 3GB7A 3HI5H 1TN0A 4OM1H 5EUOE 4HWZA 5CP7A 2O93L 2YAOA 3CPUA 2KSBA 1BZ8A 3K6NA 1AR1D 5ADPH 1UWGL 2NYYC 3CMGA 1E67A 3LNGA 1P6FA 3NCMA 2CCWA 3ARPA 5GS1C 1NC2D 5JOFB 3RUGA 1JCVA 3CIQA 4JG1L 2C7FA 4HLEA 4DP2X 2Y2YA 3BVNB 1PVHA 3QXTA 5IB4A 4AMIA 3RFRA 3K6SA 4F8PA 4GKZA 5J7CC 3OAZH 5EO9A 2AJUH 4J3OD 2VN6A 1U6AL 4MA8L 3DMMD 3FO9A 5LCVH 1ONQA 4N1EA 5D7JB 4DW2L 4QRUB 1SOKA 2ZE0A 3Q1SH 2IDQA 2JELL 1ZT7B 3NEXA 3ESVF 5EOQH 4K7FA 3I6GA 5CJ8A 4CU6A 2XWBA 3EO1A 3PG2A 4L1DA 4TOYH 3ZIMA 3BKCH 1U93B 4CL7A 5C0JA 1KENL 2WKOF 4JG5A 3HUJB 3VD2A 2XC8A 4TVPD 2PYFA 3MRHB 4KKPA 1YMHA 3CSTA 1BQUA 2ZOLB 5HGAB 1KEML 1OARH 1U21A 5AWNL 3QUMH 4PRBB 4BFGA 3EOBA 3MMEB 3EJCA 4Z0XA 5DEZA 4R4ND 1DN2A 5TF1H 4AIXA 5IOPB 3LEXB 4WWID 4EN3D 3CK0H 1YEJL 5CJOH 1E6OL 3D4ZA 1CFMA 3UPCA 5IJKC 3OMIB 3F5WB 3LZQA 1DANU 2FZ3A 4NKMB 5B1JA 2YA0A 1MHEA 2GUOB 4PJIF 2EVHA 3II1A 3WUWG 1ZS8B 4BQ8A 3AXHA 3WLBB 3T3PB 4F58L 4ELKA 3B1TA 4JO1L 4QRTA 2QQLH 1SFHA 3QH3B 3TWYA 1U8NB 2IH1B 1YY9C 3VHZA 1CQKA 3FCGA 1OGSA 2NR6A 3HR5A 4CBPA 2XN9D 2J6EL 4AOFA 4NGHH 4RQQA 1PZ5A 2RA1A 4HIHA 4ETQB 1F2XK 3DVGA 4LLUB 4TQEH 2HMIC 1ND0B 4PUBL 5D1XE 4XB8A 3T8VA 3KLDA 3HBQA 2NXYD 2J88H 3I02A 3OWRA 4I3SH 1B0RA 2R4RA 3WSQL 4ZMOA 5G2CA 1FF5A 2IH3A 4XCYA 3QQ4A 1Z5LA 1KXVA 5I2IB 1E12A 5LNDA 1JZFA 1FZJA 2P7TA 2PXYD 1FBKA 1R24B 3GZKA 5BZDA 5J6SA 2WZPA 2VDLB 4NWTH 3QJHA 1JXDA 3GSRA 3I50H 5I6NA 1BZ7B 3NCYP 1J0JA 4MCYA 3B1UA 3U7WH 2V8LA 3JWDC 1QRNB 1OAKH 1HYRC 1E4XI 4PREB 3WJMB 3NCWA 5DD3H 1U58A 4MWFB 5JW4M 1AD9A 4NQCE 4WI5A 5GGRB 4OLVL 3L95A 1SBBA 3SEPA 3T2LA 4NPYB 4NYLB 1UVQA 2BNQD 1NOAA 2GI0A 4A63A 4F7CB 4KO7A 5D1XB 3BUBA 1JZ8A 2EE0A 2TSAA 4AZ8A 3ZPDA 5F72S 4X0KA 4DUXA 2O6FA 1JRHI 1JWSA 1M71A 4OZFG 4XNQA 2AV7B 3NUKA 3QJXA 2A6KB 3PAZA 1PX4A 3PDSA 2ALWA 3S36H 4RNRB 4DKDC 1DDHB 4NUQA 3ODUA 1JPSH 2PABA 4YSOA 1EZSA 3SDDD 3ZKNC 1SXCA 1U92A 2MFNA 2DQJL 3ARDD 4LRNL 3T4AB 3TF4A 2RCSL 1R2NA 3B56A 1CT8B 1OM3L 4NQCB 4XO8A 3RVXC 4CU8A 2H32H 3RURA 4XP5L 4TUOA 3MV7E 3PXJA 4LCIH 4ONGL 1DLHA 5GS2D 4PQXA 2J4WH 3HOGA 3NH7L 2VDMB 3EJTA 3L3IB 1HN1A 2D03L 4RGND 5KUMA 1JRHH 4BSVA 5G2NA 1PY4A 2RR3A 5AAWC 1RY7B 2BP8A 2MTPA 2G2RA 4PWKA 2BX5A 1FE8H 1KJVA 2HLFD 1IBFA 4JFHD 5EN0A 2H2PC 2QHLA 1CDHA 4GQQA 5PCYA 3J27A 5I8EA 2ADJB 1CFTA 4BINA 5C71A 3F7YB 2AJYL 5GZOC 4J39A 2ID5A 4FPDA 3PWLB 5DUMH 3H7BB 3MSPA 5IKCB 2JKTM 3FMGH 3G3LA 3L2NA 3GF8A 5HYJB 2APXA 3H9SA 3ZL1A 2JCCA 3Q6FB 5IHLB 2DLFL 3MNWA 1OOAA 4PU2A 5EO1B 2ZUTA 2OL3A 3BJ91 4QOKA 4B0MB 35C8L 1F90L 2WB7A 4NKDB 4DO6A 5KJRL 5DJCA 3WHE1 2E7CA 2OLDA 1PDKA 2NNXA 1KN2L 4C47A 1O7SA 2F5AL 3X14A 5E8OA 1YMMB 2ZWNA 3AS0A 3DROA 4MMZB 4WO0A 1P9MA 3PHQB 5JW4Q 1R3JB 3GJEB 4U1SA 3BWAA 3PY9A 4N86A 3RY6C 3RJQB 4UU9A 3P4OA 4B5ZA 1YC8A 5HPMA 1NZRA 2E86A 2FH6A 4WNQA 3U4EB 2A2QT 4GAGL 2EUVA 2WOBA 2YO3A 1ASOA 3SPVB 3CDGB 4IJTA 4XVSH 1M7XA 1H0DA 2FX9H 3QWQB 2H4EA 5DU7A 5DWPA 4EZMA 3PWNB 4EUPB 3I9PA 1MFBH 1E65A 3V0GA 2X72A 3DJRA 1CURA 1E9OB 4N6RA 1DL7L 4X2UA 2Z8RA 3LQAL 3FF8A 1U8OB 2HJKB 3MNVA 3FQXB 4I3GA 4FZ8H 4J2XA 2CGRL 3Q13A 4KQ3H 5J1SC 1BZOA 2WCGA 3UBGA 3IJSB 2BFVH 3UYPB 3BQUC 5D7IE 4UB0L 3VI4E 1ZE3H 1B6UA 3DJTA 4JFXA 1AD0A 4QHKI 5D1QE 5DXWA 3QQ9C 3VXOB 1PIFA 3LIZH 1X5AA 2O6DA 2EO9A 1PKQE 2LR4A 5GS0C 1KDIA 1J1XH 3DOSA 3LPWA 5DK0B 2WXGA 2R2BA 5C0BB 1J88A 1L9OA 4PJ5E 2FJGA 4B9ZA 5AG9A 3UTSA 5DHVA 4HKJA 2UXVA 5KOMC 3AGWA 3THML 1IM3B 2WWOA 1TQSA 4I0PC 3NA4A 4MA1B 3LH9A 5GGUA 4FS0A 2NY3D 5HGDB 2CKBA 3DRTB 3IGAB 3HS0B 2VDQB 3FOLB 1NWPA 4MKTA 1ZV5A 1N68A 1I75A 1FL6B 4Y9GA 4OGAD 1A3ZA 5D93C 1NANH 4P0DA 3WN5A 2JKWA 1KTKE 1O9VA 3VI4B 4L4TA 1L4IA 2IQAA 1AC0A 1DJGA 3PGFL 4G6JL 3D85D 5E0FA 1WWWX 4OV6F 4UDUA 4WJKB 4XBEL 5D1QB 5I71C 4UQ9A 2CM5A 3FUHA 4RZKA 5F7LB 1HEZB 3RNKB 1KJMB 4N2BA 1PD6A 4K8RH 3SDAB 2A0LD 1I3VA 1NBZB 3G9VA 1FIEA 1F56A 1XB6A 1SDDB 4IRSC 5AD0A 2JQZA 4U1LB 5CLXA 3TF7C 1JYVA 1YYLH 3MXWL 4KFMA 2XWEA 3VFUB 2R0ZL 2JKNA 5I1KL 1NCHA 2NPLX 4LXFA 1G9NC 4R8WL 4ELMA 1W0YT 1WT5A 3M7FB 3BH9B 1QM8A 5DFTA 2GC7C 5SWQA 5JA8B 3MUY1 2X38A 5BR5A 4I77L 1IT9H 4HOMA 4YSQA 4A68A 2UXFA 3QDMA 4QRRB 2EDQA 4KU1A 2OYPA 4NRYB 1YEKH 1X9RA 2XXGA 1OAQH 3MOBH 4OQ1A 1I4FA 1IKFL 2IV9A 4P3WA 2P80A 5E6ZA 2WZAA 2Q3AA 5GZNA 3KW8A 2MCG1 4FFWC 2WWKT 2R2CA 4UM9D 3BZEA 2QKIA 1QVOA 3IXAB 1CI5A 2YA1A 4Z3JA 4MD5B 3GXTA 4AKQA 1P7QD 2X1XR 3QQ3B 1E3XA 4WVRA 3PNWA 4UQBA 4M7KL 2ZG3A 2R29A 1IEAB 3UTPD 4M1CD 5DYFA 4NNYB 4FERA 3CHPA 1TQUA 4AEHH 1QP1A 4FE9A 1S7VA 4CSTA 3B7YA 1BBDH 2QKSA 4DPRA 1I1AB 1EZLA 4AYMC 1S2EA 3Q3GB 5F7FA 4AT6A 2OKMA 4XBPB 4PJAF 1R3IL 3QUZC 1RH8A 2CD0A 3HZKB 5E6YA 3RWHA 2ZOWA 4LOEA 2D2OA 5BUPA 3RPIA 3BRGC 1F1DA 3SN6R 3ATEA 3TBTA 2WAHA 4URTB 2C3HA 4DPCX 3C12A 2VDNH 4IS6B 3FONA 1A2YB 3U4BH 1TJIL 1JPGB 1CLOH 4Q6KA 2XWJA 4ZUTB 1HKLH 2F8XC 5DK3A 2A6JB 2LFGA 1C5DA 3QFDB 1MPAL 1UYWH 3O4LB 1FGNL 3L9BA 4G1MB 1EJ6A 3DOHA 4GW4B 3PGCA 3QPQD 3W0WE 2UZYA 4KNQA 3AT8A 3B9EA 3CC1A 1T0MB 3KL3A 4FABH 5ITBL 4G42A 4AJVA 1HX0A 4H0IA 1U8QA 2VR3A 3MRPB 3VH8A 2AFNA 2J2ZA 3RDTC 3U25A 2ODIA 3DWTA 1D5BA 1IFHH 2ZAIA 1RK0B 1RPKA 3BFQG 4LGRB 3KWTA 5BV7L 1LN6A 3AXLA 3I84A 3V0EA 2C1PB 5EPMB 3DUHA 3Q8BA 4M8RA 3QEQE 4FNUA 1M6UA 5D7JC 2CIKA 1OTTC 3IFNH 3KPLB 4JHWH 1ILSA 1YRKA 2WO2B 5DD6A 3QEUB 4UIKL 1DZEA 1IRAY 2MOGA 3CFQA 3I74A 2HH0H 3TO4B 4L3EB 3TCTA 2QQNL 1INDH 3BAJA 2Y7LA 5C6TH 3UO1H 4Y2OA 3NESA 3L1OH 1PL3A 4B9KC 3QUMA 4HUWB 3WFCL 4ZS7L 5EH1A 4IK7A 3RWDA 1RHFA 2VKXA 3BAYA 1GS6X 1XEDA 1MF2L 4K9EL 3VFTA 2XJKA 3ECWA 5AW2B 2EYTB 3ZMRA 1ZJBA 1CFNA 3CH8A 3ZTEA 4A7GA 1F3RB 2P4AB 3LYRA 5IMLB 3F7QA 1I85C 4IRZL 4LDOB 1T0PB 4TSAH 1AQDA 1BQHA 1MVYA 4HUKB 3DVNA 3ZYJA 3GTTA 4PGBB 4G1EA 1TZAA 1JGLL 1E27B 4PMEA 3TNNA 4HPOH 4OSUH 4LEEA 2VQ1B 4XNMB 3EDEA 4PH8A 3T5WA 3DX8B 3T1WA 2APFA 2P43B 4AYEC 4D9LL 2Q7AA 2DWDA 1Z32X 4GAYB 3N43B 2W9EH 4O00A 5TFSL 3UZCA 4WKZA 1TR7A 1QHJA 2WMPA 4LPUA 2F8OA 4ALAL 1LDPH 2YK1H 3CFEA 2PTTB 2PWDA 5H94A 1MAMH 5LXVA 2E56A 1JZ7A 4WLCA 2V5SA 1BVNP 4HFUL 1VFMA 2EDFA 4YH6A 3AWGA 1UJ3C 4LAQH 4NO5A 4MKMA 3SE8H 1G0XA 1FAKT 1W2KT 4Y5YA 1S9XB 1AP2A 3NBNA 2J55A 2NTFB 1JGIA 4O2EB 1S9YB 3SQOL 4XMVA 1WA0X 2Z8WC 3PDGA 5LQBL 4MJ5A 1Z5HA 2R1YB 3L7FA 3VVVA 3D9AL 4DGIH 4KI5F 2BH0A 3HC2A 5AVTB 4POZC 3WIHA 3CFKA 3KPSD 4LLMA 5DRZB 1IBGL 1PXSA 3RL2A 3EBAA 4G7YH 4MLIA 5I1GL 4M4RB 3VWJC 1I8UA 2E76C 2DQIH 1QPXA 4A6YB 4HH8A 2WN3A 2ZXAA 3CFCL 4H26A 5DMKB 1N9PA 5TDNB 2XXCB 2M8XA 3B4NA 2IDCA 3OR7B 4PY8J 1ZT4A 5FO7B 4YHPA 1DCLA 4DUVA 2M1KA 1ZSDB 4JJ5A 4RX4A 2WIIA 4JPWL 1KGBA 1S7QA 1NOFA 4HIEB 3ARFA 1WIUA 3VI0A 3KE0A 4N2GA 4NQXA 4Z7WF 3RFZA 5I1LB 5A2JH 1XXDC 2BSRB 3NABL 2XZAH 3QEHA 5IROD 5KVDE 4NNPH 4Z8FL 4JFOA 1CFSB 2JJSA 4Q14A 3T4AC 3FHEA 3ARGB 4ODWB 4YBLB 2BDNL 5DURB 1FG2B 2ISDA 4RWYH 1ZT1B 5FUCC 3TH3T 1LO3L 2VNCA 1K72A 3FW6A 2BSEA 3OKEB 4C4KO 2EUXA 3S3DB 4EIYA 3BCFA 4NQVB 2V2WB 3VRLF 3A6CH 3QCTL 2M3GA 1NGWA 3GMMA 4A67A 3NAAH 3QRGH 1BRRA 2FO4B 1QTPA 4PR5A 1NLDH 1WWBX 1FHNA 5I26A 4ODTL 4LPWA 4X5WB 3O3BA 1T0OA 3B2XA 4TNWF 4PJ8B 4TSCH 4W93A 2AXFA 5HVHB 3LH2L 4NKQB 4Y4HD 4BH8B 2UV3A 1JYWA 3HNVH 3W5MA 3ILQD 2EVJA 3B7SA 3G5WA 3UJJL 2EDLA 2ZXEB 1F11A 1WT5C 4ANKA 4CN4A 3OXRB 2PPEA 1IKNA 3CE1A 1ZK9A 4NI6A 5HHPA 3UTTD 1A7PH 4LPVA 1WICA 2G2NA 4V1DA 2FTAA 2J25A 3TL5A 1GW6A 2X1OA 1I82A 4P48A 4JQ6A 1NCAH 3AB0C 3DJZA 3IK2A 4ZOAA 3W0WD 5KSBB 5L8LB 1U0QA 4I48A 2GABA 4NENA 1JZ5A 5GZNC 3NSFA 4UT6A 3SOBH 4R0LB 3T8XA 5DEGB 4HV8A 4H8HA 1LO5B 5HI5C 4LCYA 4XAKE 2IGFH 4XHQA 4XO3A 4PCYA 1VGKA 3TZVA 3MBWA 4NWUL 2F1BA 4OKVA 4CVWA 1XCQA 3CVHB 4JFZH 5GHWL 4HWEH 5CAYB 2HFGH 1EO8L 4U1GB 2IBBA 2UZIL 2IWFA 3BXNB 1GGIH 5HI3D 4ZX5A 3L4UA 1CXLA 3SGDI 1OF2B 2IWKA 3LH8A 3C5JB 3E80A 3EO0A 3QEQD 4J7RA 5IB5B 4UI2A 2WSKA 2VH5H 1QNIA 3K2UH 4NCC2 3IRCA 3AY2A 3MLTB 5GRZA 5KSVA 3GSWA 2GTWB 2NY5L 4MD0B 5E70A 4GI6A 3LKRB 5FLUA 4NQEE 4JDTL 1GC1L 1UB5A 4JM4L 3NSCA 5K9OB 3FU0A 3LIZA 5CLTA 1FNFA 4FXKA 1D5ZB 2QQQA 4F7TA 3QZNA 3OKYA 1ACYH 3LHAA 4DEWA 1SJVA 4JY6A 2WLYA 3CVBA 1CD1B 1K2DB 4FTVE 5CJQH 4HJSA 5GIRB 3QCVH 3TX4A 1R46A 2YRZA 4Y16C 2OMVA 4PS4L 3MUHL 5HYSG 1KB5A 5CZXC 4J2QA 4X9FA 1NUDA 1CZ8L 1S5IH 2WBJC 3G6AB 3C8KB 1MY7A 3GBDA 1DE4B 4P5MA 4Y1AE 4WWKA 5SWSA 3WFDH 3AM6A 2ADFH 2VDPL 3L5WB 1BVZA 3TBWB 5IIEA 1R5IB 1VENA 2VUKA 4BFEA 4PY7A 1BD2A 5EWIL 3BZFB 4ZFOB 4AJYV 1SEBB 4UTAH 2GW5A 1MJ7L 1FN4B 2FD6H 3J7HA 5DJXA 1DQJB 3RIAK 5GSRB 1ZMYA 1RU9H 4Q74A 5HHVH 4PJXF 3OSVA 5CGYD 3JV4A 4PW3A 3HE7D 5MHSE 4OV5A 3LNEA 1WPCA 2NY6C 3HFML 3WHE0 3KEHA 3U9UB 1S53A 2FECL 1TU2B 1QZ1A 5FX3A 1GJUA 4D3CL 3DRQB 1RAMA 1BBJA 3NZUA 3UACA 4ZYKB 1MIMH 3BT2H 5FYJU 4DO4A 1PZCA 1QO3B 2WZ0A 3FQ1A 2W65B 4I4WB 2BRDA 4MXQD 5I8OL 1KT2A 3UONA 1J8HE 1XGPB 3LPPA 3VX1A 2XIBA 1Q0XH 2XQ0A 3S4SA 1GGTA 2J12B 3IU3A 4AH2B 2AANA 2VDOB 2M83A 1BEXA 2ED6A 2Q0ZX 3GMLB 3I2CL 3RGVA 2IADB 3QJRB 4PGEB 2DLTA 1P8UA 3B8YA 3ET9F 1BLIA 4J8RA 3SQBA 4BXSV 5CUSL 3GI9H 1HS6A 1FYTE 1KTDB 2JLLA 3WEXB 3O0RL 2CO7A 3BKML 4K55A 1VEOA 3BSHA 2CJUL 1LM8V 3F6LA 4PJ9C 4QRPA 2V7NA 4HJGB 3WIFB 5LG6A 3QWRD 5JDSA 3R1GH 4XWGL 1GW0A 3B7UX 3VFRB 5EZLB 2HRGA 2Z7UA 1UD3A 3G5YA 2NQCA 1X0K1 1J8HB 3SCMC 2IBZX 3SGJA 1L3WA 3FFOA 4Y2DD 4LIQE 4J5VA 4P23A 2IAMC 4P49A 3LV3A 1HOEA 3PWUB 4KQ4H 4LDEA 1L6PA 4Z7VE 2CRYA 5DVPA 2PWFA 3DPDA 5FYLD 1QKZL 4XCFL 3KYMB 3VDCA 4AC4A 2HRPH 3JWOL 5GRYA 3OGCB 1IX2A 1G5GA 1NAML 2ZFEA 2ESVA 1WEJH 2JTYA 2CXKA 1OANA 4HSAC 2WWKO 3NCEB 3OD3A 2AQNA 2UWEE 2J8UF 4XO5A 5DVLA 4GIAA 4H44C 3O6ML 1HJCA 3SDCA 3FRPG 4LCUB 4ZNEA 2BY1A 3SYAA 3TYFA 3BYYA 3V52H 1E5YA 5CBEB 2ATKA 5EC2B 5I0WA 4NN7B 1L7IH 1PW3A 2CZNA 1CICD 3BSZA 3FQRB 3II3A 4KRPC 5DHMC 2H2SD 4HLZG 4F37F 3WTYA 3QUXA 4DOHE 5GISH 4GKSB 3Q2WA 2VLKE 1QI4A 4BXVA 4CKVX 4EVNB 2WQVA 1RUQL 3ETTA 3OKMB 5AX1A 2H6OA 3HC4H 1A22B 4HXAL 4ODXA 5EV7A 1BOGB 1FNSL 4AQ1A 2X6BA 1XL4A 4TXVB 4HOXA 2NY7H 5D55A 1IM9B 2BWIA 3CLEH 1K8IB 3T2NH 1KBGH 1L5GB 3L4TA 1T4KB 5T3XD 4X4XB 1F8TL 3S7GA 3CXDH 3KLKA 4ILDA 3HPJB 1LD9B 3DO3A 4JRLA 4Z7UE 4P4KA 2IF7A 2B0SH 1EZVY 2Y7NA 4FL4C 4CGUB 4ZXBB 3NPZB 3N3EA 3S5LG 5FUOH 3LNFA 2JIXD 3TO4C 3P3YA 1A7RH 4GW5A 2DQCH 5EZOL 2GTQA 1ZEAL 4EOWL 1KYOK 1ZHLA 3UGUA 1DANT 2X0VA 2EXYC 2VLKB 3RVWD 2OMNA 4MJ6A 2D9QB 4QYOA 2XICA 1NICA 1XXFC 4O9HL 5AZUA 2ZYRA 4HC1L 3WS3B 1YEHL 3CHOA 3G04B 1M3IA 2E9IA 3OL2A 3IJHA 3P9LA 3F12A 4J3WA 1AO7E 2LAGB 3B83A 3FB6A 7TAAA 5E56A 1WTGT 3GMNB 4PRIA 4ADJA 4H2AA 2V2TA 1MSPA 2OPCA 1SHSA 4KJWC 2IXQB 3GEWB 2CLZA 3GRBA 4HGWA 1FUNA 1LILA 3ASNB 2Z35B 5B3JE 3MV11 1QHQA 1GUEA 1XWVA 3F85A 5DMGC 2EVFA 4RISL 3V9CA 1RUAH 1MI5A 1MQKH 1X4YA 5FFOA 4PRPB 1HKFA 1XO8A 4AZUA 1T6BX 3IVKA 3LRHA 3KYNB 1GJWA 1JZ6A 4PJCE 3KLHC 2VXUL 3CX5J 3A3YB 3O3EA 2FO1A 4G7QB 2VAAB 2AMGA 3BZ4B 2HCZX 3HG5A 4XNXH 1SDAB 4JFEE 3FN0H 4WDIA 5JNYA 1RJYB 5AWZA 2NDFA 4JS7A 5FGSA 1AO7B 2AEPL 5TQ0L 4HKZB 4YE4H 3F7VA 3V8OA 4DUWA 4WI8A 4W9IC 4BCZA 4ODHH 1F4WH 2G2PA 2JVUA 3UIYA 2PWHA 2WGXA 2OSWA 2K9UA 1NBCA 1U36A 3RE0A 2YC1B 4GSQA 5I1EL 4JQIH 1EJOH 1RUML 1IAOB 1U8IA 4N0FA 5D7LE 3MBED 5E7BA 2AQRA 2Z93A 4D9QD 2BNRE 2CIIA 3BE1H 4NZTH 4WV1C 4IKIA 4U6VL 1MNUL 4CJ0A 4E9SA 5BVPL 5F3BA 1GGBL 3ULUL 3TIDB 1KYAA 4P46A 1P1ZA 2J1ZA 3V10A 1FJ1B 4A2LA 4ZOEA 2CK2A 3O11A 5F1KC 2OMWB 2V17H 3E8VA 2LABA 4FXKC 4OZHE 5GGSY 4PJCB 5BW7C 3MA9H 1LP9E 4WEBH 2G5UA 2ARJQ 4LLDB 2CH8A 4P4RB 4ZFGH 3GJFH 5C0AB 4FHBD 3WXWL 1CO1A 4DZBA 2W0FA 4S1DC 4Y5VA 4HIIA 3UERA 3B37A 5T5NF 3BESR 2NX5B 1ZGLB 2NNAB 3LRSA 2WLLB 3WJJC 2ADYA 1NBYB 3O9WD 4GQPH 2K0RA 5FKAB 1PZSA 2E9GA 4QRYA 4LCWA 3T77A 4NZRL 2X9WA 4X6DF 1J10A 2DQHL 2G9HA 2TRHA 5L8KB 5BMFH 4DGYH 4HS8H 4E9QA 4IIQA 1UFUA 5EBMA 5TE7L 4NJ9L 2WXJA 5HHMB 1UH4A 4YPJA 5K9QI 5E9DE 3RGHA 4U0RC 3V4PA 2ARWA 2Y5EA 3VFGL 3B9AA 5E94A 1YDPA 1N7MH 3ARGC 3QXDB 1UGKA 4HYXA 1TSHA 2X4TB 2Q7YB 2K6WA 5BNXD 2LV4A 2G9KA 1BXXA 1G7PB 3EHBB 4K8RC 5INCB 1YAZA 2CJ3A 4R26H 4PMFA 3BEVB 1SM3L 4JLRA 4MA3B 3FSAA 4L8CA 4YNYA 3QFJD 4N0RA 3ESNA 2V2XB 5C08E 4HWLA 2LLLA 1S8DB 5IB3A 4XI5D 4DP0X 2OTWA 2WYHA 2DTML 1OAJA 1D5IH 2KLRA 3AQZA 4KBPA 4KY1L 3TT1L 2VXSL 4WAVA 4AVIA 3ARWA 3BH4A 5I5MA 4PLKC 3RTQD 5H2PA 1E8YA 3D0VA 3RIKA 5L2JA 4PPTA 3QI9D 4Y19B 1HCZA 2VW7A 4OQTL 1NBVL 4MXWH 1H2SA 1M7DB 5E9DB 4JPSA 4WO4D 1ZLVK 1KTLA 2ZX5A 3U0PA 1IXFA 3ARBA 2ZXCA 3PDOA 4IHOA 3AG2B 2VAJA 2VM3A 4JN2B 4M5YH 4P5TC 1IJNA 1EPFA 1MVFA 2BP0A 1P4IL 4G9FE 2ZX9A 5F1IB 5GGTH 1MLBA 4PB9L 3QUKB 2W1NA 5CINL 3QAZC 5D2LE 4DP6X 2JCWA 5AZ2H 1SXZA 3ARQA 1MEXH 1UCQA 1XF4A 2QGDA 5C08B 3U46B 2IDFA 4HAGA 2DQEL 3VXSD 4ZMLA 5BCAA 1RMFL 2NY2D 4KPHL 4XT3A 3KGRA 3HN5A 3RUGF 4HX1B 4JM2A 4LOVA 4YAQA 4F91B 5ISZD 5A6LA 3MO1A 5DR5L 2XQYA 4XP4L 2XXFA 1WWAX 2YRLA 5E5LA 1D7FA 4G80B 4NNXB 5E51A 1T66D 4HA1A 3BPCA 4IBQA 1IAII 2EDRA 4R96B 1J18A 1KPUA 1N19A 1BFSA 2PUQT 4HQQL 5J1TC 2E9JA 4K3GA 4ZAKB 4Q9RH 4JANB 1FORL 1MIEH 3D39A 2XN2A 3HI6H 3A0OA 1O5PA 3MCYA 3P11L 2IG2L 1ZOXA 4G9FB 2ZSVB 4MX7B 4ODUA 1P53A 4JGMA 2OS7A 3VNZA 1NPNA 5D2LB 1D7BA 1AZCA 1RIVH 2X53A 4ZDHA 1MLCB 2Z34A 1KWGA 1WSST 3DX7A 1XF5B 4NN5B 1TG8A 2C26A 3DUSA 2A6IA 2VDKL 1S9KC 4M6AA 5EEUA 2QFPA 1FZMB 2RFXB 2VJ8A 2ITFA 1GPOL 5IVXF 3ZE0E 5EOCL 3KR3L 3ARED 1TPXB 4U6YB 3QWOB 5HYIA 1CGSL 1C16B 3NRFA 3VXRD 2GJ6E 1IAIH 1DTUA 4YDMA 2FBRA 3MFFA 1V8HA 3IDGB 5JLZB 3DV6B 3SD2A 3T4YB 3WG7B 4Q0XH 3TYGL 5E1AB 4GQ9H 3FCBA 4BIKA 3T3MF 4AQZA 4FC3E 1V3JA 3S88H 3EDJA 1UZ8A 3OAUL 5LN8A 3IDXH 2Y7QA 3SGKC 3WD5L 3FTGB 4H1LA 3D18A 4XE5B 3NYAA 4CVXB 4B3EA 4E42A 3VFPA 1JFQL 5DJZB 3BRFA 4JR9H 4X7CC 3BKYH 4XRCA 3TNMB 1SF3A 1KEGH 3BPLB 3BN9C 4FG0A 1Q5JA 1UCBL 3HPLB 4P4KC 1J48A 1PD1A 2FWOA 3NN8B 4UNTA 4WI9A 3VO0A 4OLYH 5TE4H 4PTUB 4KTGA 5IEKB 1BCIA 4OZFH 2YRBA 1MG2C 4TNVK 4EN3B 1T1WB 4ZUVA 1QEWA 1PY6A 1I53A 1KIQA 2DB8A 3DX3A 3MLYL 3N44B 3ARXA 3R06B 4WK2B 5JHLH 4UAOB 3ZK0A 2HN7A 3LJ3A 3LPFA 1ZLSL 2D7QA 3JUZA 5IWLC 4W70A 4HEPA 5EO0A 1P4LA 2ITCB 4GBXD 4X7TB 2Z31D 3WXVH 1QQDB 3HBZA 1FLRH 4Z3GA 1HEJC 1ZHKB 2VDMH 3G6JA 3QC6X 5ID0A 1RSYA 1SBSL 3CPLB 1S7XA 1HYSC 3CFIC 3KCPB 2P42B 2PTUA 4GRWF 5E6IA 4ZUWB 1KCVL 4AK2A 4NQSB 5IHZB 3NFNA 3DX6B 1H3WM 2NXYB 1FH5H 3FAWA 4TRPH 2PCPB 4YUEL 2ZKWA 4OCLC 1Y18B 3WEAA 3LZFL 3BWSA 3NJJA 4N2FA 1INEL 4WW1A 1X44A 2J44A 1QSEA 4P05A 4FJ6A 5E4AA 3IRPX 5K9KA 3X13B 2EIDA 1B6DA 1H3UA 4OH2A 5EEWA 2CU9A 2G0LA 3IE9A 5AVSB 3KG5A 1I8KA 2F6AA 2DL2A 4KUZL 2GHWB 4AYFA 1ZY9A 3EOAA 4R9HA 3O2DA 3NS0A 4IW4C 5B4MD 3W3BA 3MRKA 4AE0A 3EH4B 3ZBMA 4NQQA 5L7XH 4LDLA 5H2BB 5K59F 4MNQE 1Q9WA 4XAWH 4OF5A 4HW6A 1C8SA 2OQJA 4I2XE 4ENZA 2ZJSL 2I26N 1EXUB 2EIZA 4KK9C 2C4XA 1NEZA 3QQXA 3FFCE 3KXFA 4JO4H 1D3CA 3AITA 4M43H 2O5NA 4MTMA 4W9JC 2PCYA 3CFDA 5C7XH 3Q9PA 4H8UA 4NRZA 1IIIA 4YHLH 1JPST 1ZXQA 2MNUA 3ZHNA 4UOZA 3GIZH 2D7TL 3REWA 4JL1A 4X6FB 2JI3A 4GSXA 4YHOL 1FFRA 5MEND 1TEGA 4Y5XB 5KSUB 3EGSA 4BCXA 3HZYB 2FL5A 2HVKB 5F7YC 1IQDA 1R17A 3N85H 4I9WE 4M8QA 5J9PB 3OQRA 2Q8AL 4L37B 4R7XA 3UTZB 2B7DT 3AW5A 4QHKJ 1Q9KB 2CBQA 4J3TA 4B9GA 3S98A 2JCCF 5ALCL 1KG0B 3IBOA 3INUL 3T0EE 4CDGC 4CMHB 4ZFFA 1X7QB 5DF0A 4I2XB 1V55B 4RGNB 3NTCL 5GRJH 2AEWA 4MYPA 4NC1C 2EACA 2XZQH 1QD0A 5KSAB 1IC1A 3F58L 2VIRA 5DHDA 3X12B 4IKKA 4LLWB 4F1SA 4K23H 3IB4A 4RZCA 5FDWA 2YD2A 4PAZA 2MH4A 4ZXBC 1CR9L 3L4XA 2VE6B 3ZY7A 1ORSB 1QSZA 1V3LA 2YXVA 3L6FB 2BINA 4OGXH 1KBPA 1TVHB 4AMKH 1E3FA 3L3OB 2VERA 5I74B 1QWNA 2QPUA 5JHBA 4KI1A 1MRCL 4R2GB 2GITA 3PL6C 4O2CA 4P2RD 1YECL 2XIIA 2X4SA 4ZPTA 1E9QB 2HSIA 2EJ1A 5FFLA 4X9HA 1HL5A 4BZ1L 5J11C 4XGZA 1WBZA 5C6WH 1E5BA 3OB8A 3MV9D 4EIUA 3T0EB 3U7YL 1DLFL 5EBWB 4ZFQA 3U30B 5G4NA 4M00A 1TZGL 2E8ZA 2J6WA 5DQ9B 1Z1WA 4FFTA 4KJYA 4OW6A 2FBOJ 3U82B 3MRJB 4PJ7B 2XHNA 1UATA 1BW8A 4JEGB 3IDMB 4A7SA 1P5VB 3MV8A 3AY4C 1JSYA 3MROB 3O8XA 1H3TA 4PTTA 5B1BB 4NUGL 1AOZA 2EDYA 2GJ6D 3BZDA 1TNNA 1XQ4A 4AV0A 4L4JA 4FI6A 3VXPA 3L3GA 3TFKD 4XMPL 3VG9A 3GMPA 4X6CE 1OK0A 5BO1H 1T2QH 3KNBA 1ACXA 4PN6A 3QDJB 3FUKA 3OF6D 4Y0GA 5AYUH 3ARSA 3W9DB 2EILB 2R0LH 2JJVA 2X4QA 3ORJA 4JM2C 4LPYA 2QSCL 3WUWB 5IJCC 3VSVA 2L7JA 3MUJA 3PREA 4R3SB 1JI1A 1WZMA 1FL5A 3RVUD 5IQ9B 4WEEA 4BRJA 3U1PA 1VIWA 4QIRA 3VB8A 4Y4FA 1JGDB 4N0UB 3TBYA 1ZS2A 3D5OF 2FBJL 1MWAL 4GSUA 4N9GA 32C2B 4I88A 1Z9PA 5B38G 2XUWA 5HDQL 4PJEA 3CAFA 2A74C 3BZ5A 1O7DE 3WEBA 1C08A 4KUCF 2EH8L 3US1A 2P8MA 2NY3B 4MJIA 3GJFA 1G7IA 2ZWLT 4X6CB 2VLRA 3EAKA 1RLWA 2Q8BL 4MNHB 2OMYA 5D7KD 5MEQA 2DQDL 2EDJA 3ARDA 3ZTCC 4D7BA 1JUFA 2IDTA 2LVCA 2EEAA 2VDRH 2NTWA 1XF3A 4ELMF 4OCRL 5L4JA 1ZANL 2YR3A 2C7UA 4WTQA 3ABWA 3HJ0A 5MEPB 5BO0D 2FYYB 3C6LD 4CVUA 4QWWC 3M17B 1WZAA 3V95A 3GXIA 4JFYB 3EYQD 5B6ZA 3TVMD 1U30A 1SJEB 2B39A 4IBUA 3BP6B 4LASL 2BIMA 1XDTT 1UTDA 5MEOB 4G6FD 4DKAA 4J3VA 4BE6A 1OT2A 1OSPL 3BVNA 2O61B 3FKUS 4D2NA 3S9DB 1WP6A 1OD9A 2ICCA 3RU8L 3FU3A 4EZLA 5F9OH 4IOFD 4JDEB 4W9HC 4S11A 3IFLL 4FFVC 5GSVA 3D2TA 2NT0A 4QRUA 1MCOH 1OB0A 1YY8B 2VRKA 1OP5K 1RULH 1ZT7A 4LZKA 1KCLA 4AQ8C 4NO0D 1QSFD 5D5ME 4QGTA 2P5WE 3EF7A 1A5FH 2ICEC 5AX0A 1JDDA 3S37X 1M1XB 5JORB 5IUCA 3KW7A 1OWWA 4LL1A 1SJXA 5EUOA 4OLZH 5H35B 4DGVH 5L6YL 4UHRA 4FKKA 2KZKA 2JKIS 1OZUA 2CBTA 3LRKA 3UL4A 4GYCA 4MZ2A 1V54B 1KGCD 3FUEA 5GGTA 1JG9A 3FAXA 4N90E 4L2YA 5HGAA 3K8LA 4PRBA 3Q8CA 4DJMA 4Y7MA 1AMYA 1BV8A 3LEXA 3GSNL 3WYRA 1BFOB 2VUOA 3IETB 4LARH 3ROOB 1OCCB 5EIIB 2CKNA 1EK3A 1TZHB 4B96A 2D4DA 1Z3RA 4NKMA 4X7EC 3ULSB 4KI5D 2AKRA 4JFTA 5C86A 2YQ2A 4P9HH 1ZS8A 3DIFB 3WLBA 5MERB 1D9KB 1QPKA 4YO0B 5FECB 2I5YL 3QH3A 4Z7AA 2W0LA 4ANUA 2IH1A 3H53A 2O6EA 4GEIA 4PJGE 4XN5A 5GRUH 5A43C 1DJHA 4DO5A 1WH0A 2JE8A 3CZLA 1IB5A 1SMOA 3GD1C 5HJ3B 4LLUA 4ZO8A 3OX8A 4JQVC 5IHHA 1U3NA 2ED8A 5AOIA 1KZQA 1ND0A 3ZRCC 2YPVL 4AKPA 2CR0A 3PHAA 2XVBA 2A9BA 2EC9U 1HILB 3M88A 4C54A 4CDHA 1NM9A 3QBIA 1BFTA 1BWMA 3Q2LA 1NSNH 5E00B 2YDOA 5BXFA 1H3VA 3QUYB 5I2IA 3GIVA 3EJQA 2ZZUT 2WANA 4APQD 1DBBL 2MSPA 5DFAA 3K6IA 4O5LH 4HBQA 1M7UA 4QF1A 5JR1H 3Q8EA 1AR1C 3PHOB 4GXVH 1FYHB 2XPGB 15C8H 1M53A 1RLBA 1QX1A 1W15A 4ORGB 1FRGH 4G82A 3DC0A 4KXAA 5I18H 2Q87A 3U6XS 2BVOA 4NN5C 1I8MB 4PREA 4FLRA 1FNEB 1W72B 4NS0A 2QZQA 1KGXA 2AQPA 1JDAA 4KRMB 5ICYB 4BSJA 5KAQG 2V5RA 2M2DA 1IL1A 1CF8H 1QLFB 2DBLL 2WNXA 2WXMA 3MR9B 3Q2NA 3IGUA 3DMMC 4FFZH 1A1OB 4F7CA 2WLIB 5D1XA 4AI7A 3EGXB 5AKVA 4I9XA 1KN4H 4PLOB 3ZDZF 1UT9A 4IRJD 3WNMA 2A6KA 2X12A 1A14L 1RIUH 1F4XL 5IBUB 4JGJA 5AW5B 2UXGA 5SWZB 2VDPB 3O6LH 3H3KA 4PEEA 3O2VL 5F8QC 2VSKB 1ZLVH 5E03A 1E6JH 3BPLC 4C56B 2P8PB 2PW2B 3FUIA 1TN5A 2VXQA 4WI6A 4R4NC 3UP1A 3IN2A 3K80A 4NQCA 4GI9A 4Z78B 2DQTL 4IGBD 3ZTJH 4LPXA 3QIWD 1IGML 2QTVA 2BSDA 2V3FA 4UAOC 1R75A 3ULVL 1RJLA 3L3IA 3QEGH 3FU7A 2O5YH 3H85A 1QLEL 4MMXB 5KN5A 3LD8C 1G1YA 2H3NA 3C5ZB 5TGBB 2NY1B 4AIZB 5LLIC 5B8CB 4S2SA 4ZK8A 4N22A 3MUGA 3W9EB 1RI8A 1N8ZB 2Y0SA 1U8JB 2M26A 1ADQA 1PLGL 5EUKA 3FCSB 5A7EA 3NJKA 3F7YA 4G9DB 1FPTH 3HE6B 3KPNB 3EYVB 1O0AA 5ALBL 3TO2B 1VA9A 3IDYB 5IKCA 2NXYC 3NDZE 3ZE1B 5L2KB 1UHVA 4BDVB 1UZGA 3Q6FA 2H1LM 3HZVB 2ZT9C 3WY2A 5KVDH 2PXYC 5KBDA 5H8DA 3MV7A 3ML9A 2IQ9H 1E4HA 4UINH 4CMMB 3S37H 1NINA 1ZDSA 4D7PA 5IK3B 1UWEL 3FH8A 1FNGB 2AQQA 43CAB 1YMMA 1A0QL 4MMZA 2XTSA 1A65A 3QK0A 4AVJA 2XU9A 2IWGA 2JQMA 4RMWA 3I3EA 5IVZB 3PHQA 1T5XB 3MRNB 3CFBA 3GJEA 2WIMA 1AR2A 3GSQA 2QGCA 4KJPD 5EOTB 4OUUA 4ETYA 4X8JB 2JFCA 3KWWB 5CSZB 5ANMB 5FF6B 1TVDA 1OXYA 1UWFA 3CDGA 2OP4L 4HEME 2ATAA 3U48A 4MB4A 1YEWA 3KDMB 4GSDL 3GEFA 4YSPA 2F58H 5T1LA 2OJ1A 2B3RA 1AI1L 2DM3A 2IPTL 4GAJH 4K07A 4RIRB 4Y1SA 2YZ8A 1E9OA 3HAOA 4ZTPH 3ZKXB 1ZHBA 1LQBC 4C83B 1U8OA 2HJKA 3MACH 5KYUB 3FQXA 1MCCA 4JRWA 2XA8L 2ZCLH 2X7LB 3S5YA 3IJSA 2KUTA 4OD1H 3SDDC 3I6LD 1BXAA 4A7VA 1CD8A 2EECA 3HZMA 5BVJA 1AXTH 2WUCL 4NZUL 3ARDC 3L3JB 1UB6A 4ZUSB 3VXOA 1H6FA 3VU2A 2OMTB 5B