4N53C

Human enterovirus 71 uncoating intermediate captured at atomic resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQTGTIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Human enterovirus 71 uncoating captured at atomic resolution.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n53C00
1RUD1 3CJIA 5FMOL 2RS33 4N43C 5A33A 4YVWA 1FOD1 1EAH3 1B35A 1QJU2 2QQPA 2TBVA 1QJX1 1AYM2 1R1A2 4IV3C 5BNNC 1TMF2 3CJIB 4RR3C 2ZAHA 1C8NA 5A32A 4IV1A 4N53A 5A33B 1PGL1 2HWE3 4CDQA 2BPA2 1ND3C 4YVWB 4CDXC 1RUG2 1VBA3 1B35B 4Q4V1 4RS5C 1EV12 4RHV2 4WM7C 3JBG3 1HQNA 1NCRC 1BEV1 2GSYA 2HWF1 1FPN3 4NWVA 4CEYA 5C4WC 2RM21 4JGZC 4PDWC 4GH4C 3M8LA 4CDWA 1BBT3 2X5IC 2MEV1 5A32B 4IV1B 1H8TC 4N53B 4FTBA 4CDQB 1QJY2 3ZFFA 2RS31 1NOVA 1AR62 3JD72 1EAH1 5K0UA 4CEYB 1RVF2 5FOJB 1VAKA 4CDWB 1AL21 4Y5Z0 4YVSA 2WFF2 3ZFGC 1RUH3 4Q4X3 2RS53 2HWE2 3ZFFB 1FMD2 2WZR3 1VBA2 1COV2 2HWE1 2RS13 3VDDA 4LLFA 5C9AC 1F8VA 1PGW1 5CFDA 5K0UB 2RMU3 3JBG1 1K5MC 1FPN1 4YVSB 1AR82 1BBT1 1C8M1 1F2NA 3VDDB 1X36A 5CFDB 1R083 1VBD3 1E57A 5BNOC 5CFCC 1ASJ1 1AYN3 5J98B 4CDUA 2R072 1NA1A 1OOPA 1CD3G 5JZGC 1RUH1 2ZTNA 5C8CA 4Q4X1 2RS51 1VBE3 3LOBA 2WZR1 2XBO2 4NWWA 2RS11 4QPGA 2HWD2 3J8F2 1NCQA 1AR72 1TME3 2RMU1 1RUJ2 4CDUB 1NA1B 1OOPB 1PO12 1RUE2 5C8CB 4JGYA 3CJIC 1QJU3 1R092 4QPGB 1AYM3 1R1A3 1NCQB 4RFT0 4YVWC 1R081 1VBD1 1B35C 3ZFEA 1AYN1 1TMF3 4AEDA 2HWC2 1VBE2 1RUG3 5L7OA 4JGYB 1VBE1 4IV1C 4N53C 1EV13 4RHV3 4CDQC 4FSJA 2R063 1W39A 3ZFEB 1HXS2 1TME1 1RMU3 4AEDB 4CEYC 1QJY3 1ZBA2 2XPJA 4CDWC 1AR63 5ACA3 3JD73 1MQTA 2BFUL 1QJU1 1QJZA 3ZFFC 1RVF3 1AYM1 1R1A1 1ND2A 4Y4YA 5K0UC 2WFF3 4RQPA 1TMF1 1NG0A 1FMD3 5BNPA 1COV3 1AR92 4YVSC 2IZWA 1RUG1 1MQTB 2R062 1EV11 4RHV1 3VDDC 2R061 1ND2B 5CFDC 1RMU2 1AR83 4GMP3 4RQPB 5DDJ2 1QQP3 1RMU1 5BNPB 1MEC2 1QJY1 5ACA2 1RUC2 1AR61 5ACA1 3JD71 3VBHA 1VBC2 1RVF1 2R073 2WFF1 4CEWA 1FMD1 4CDUC 3VBSA 2ZZQA 2XBO3 1NA1C 1OOPC 1VBA1 1COV1 2PLV2 5C8CC 2HWD3 3J8F3 1AR73 2WWSA 3JB4C 3VBHB 1RUJ3 4QPGC 1NCQC 1HRV2 1QQP2 1PO13 1AR81 1RUE3 4GMP1 4CEWB 3VBSB 1D4M2 1R093 3NAPA 4JGYC 4GH4A 5GKAC 1Z7S2 2BBVA 1RUI2 2HWC3 1PVC2 2R071 3ZFEC 2HWB3 4FTSA 1PO22 4AEDC 1IHMA 3NAPB 2XBO1 2HWD1 3J8F1 1AR71 1HXS3 2RR12 3IDEA 1VRH2 1RUJ1 5J96B 4Q4W2 1PO11 1RUE1 1ZBA3 1HRI3 4WM8A 1NY72 1RHI2 5FMOS 1BMV2 1R091 4GB32 2GH8A 1MQTC 2BFUS 2HWB2 2HWC1 1ND2C 4WM8B 1AR93 1V9U2 1SMVA 4RQPC 1HX6A 4FTEA 5BNPC 4QPIA 2R043 5AC93 1POV3 1HXS1 5DDJ3 2WS92 5L7OB 1HRI2 1MEC3 1RUF3 2BUKA 1ZBA1 3HAGA 1RUC3 4QPIB 5ABJA 3VBOA 1VBC3 2RM23 4GMP0 1RUD2 2MEV3 1GFF2 3VBHC 3VBFA 1FOD2 4Q4Y3 3DPRA 1AR91 3VBUA 2PLV3 1QJX2 4CEWC 5ABJB 3VBSC 3VBOB 2R042 5AC92 1AL23 1HRV3 2R041 5AC91 1POV1 1PGL2 5D8AA 5DDJ1 3VBFB 3VBRA 1RUF2 3DPRB 4Q4V2 1D4M3 1MEC1 3VBUB 1RUF1 1BEV2 2HWF2 1RUC1 2RM22 3JB8A 1Z7S3 3NAPC 4N43A 3TN93 1RUI3 1VBC1 2MEV2 1PVC3 5D8AB 1C8M3 3VBRB 4Q4Y2 2RS32 1PO23 4Q4Y1 4EJRA 1EAH2 4IV3A 5BNNA 2PLV1 1ZBE3 1ASJ3 4RR3A 1M06G 1AL22 1PIV3 2RR13 4N43B 1ND3A 4CDXA 1VBB3 1VRH3 4Q4W3 4RS5A 1HRV1 1QQP1 1RB8G 1AL0G 4WM7A 1NCRA 3ZXAC 1DDLA 1RHI3 1PGW2 4IV3B 2Y26A 5C4WA 1D4M1 5BNNB 2VQ0A 4JGZA 4PDWA 4WM8C 3JBG2 4RR3B 4GB33 2X5IA 1FPN2 1H8TA 3TN92 1ND3B 4CDXB 1Z7S1 5LK7B 1BBT2 4RS5B 1C8M2 1RUI1 3TN91 1PVC1 4WM7B 4Z92B 1NCRB 1V9U3 5C4WB 1PO21 4JGZB 4PDWB 5L7OC 4GH4B 1ZBE2 1ASJ2 2X5IB 3ZFGA 1H8TB 1PIV2 1ZBE1 1OHFA 1VBB2 4QPIC 1PIV1 2RR11 5C9AA 2WS93 1VBB1 1RUH2 1VRH1 4Q4X2 2RS52 1WCDJ 4Q4W1 1CJDA 2WZR2 3FBMA 2WLPA 1NY71 4BCUA 2RS12 1RHI1 1K5MA 1BMV1 3ZFGB 1VB2A 2RMU2 1POV0 4GB31 1RUD3 5ABJC 5C9AB 3VBOC 2FZ1A 1AUYA 1FOD3 2HWB1 1X33A 5BNOA 5CFCA 2DF7A 1K5MB 1QJX3 1V9U1 2FZ2A 3VBFC 1R082 1VBD2 3DPRC 1VB4A 1AYN2 3VBUC 5JZGA 1OPOA 2WS91 5BNOB 4Q4V3 1HRI1 5CFCB 5D8AC 1BEV3 3VBRC 2HWF3 3S6PA 1A6CA 5JZGB 1TME2 4SBVA
chains in the Genus database with same CATH superfamily
2QQLA 4CSWA 1YFYA 1ZA7A 1D2SA 2RS33 3THTA 3KF5A 2JDAA 4N43C 2HEYF 4HVQA 4YVWA 5T55A 3A7QA 4QU2A 2Q1FA 2YROA 1GV9A 1QJU2 4LKSA 2ENRA 4YGCA 3HBKA 3WF1A 1KDKA 4D8MA 3N7JA 3UGFA 3H1MA 1IS4A 2J1UA 2JG8B 1W3VA 3T3YA 2Y38A 2JICA 4ISQA 3H8RA 4E2SA 3M70A 1JU3A 3CJIB 2ZAHA 1IGOA 1W2UA 4IV1A 4CP1A 1W9FA 5I8SA 2BPA2 1ND3C 2HJIA 4CDXC 3VD5A 1H0BA 2EA7A 3WF2A 1B35B 4Q4V1 3RQ0A 3ZMNA 5G05L 1A34A 4NAMA 3JBG3 1BEV1 3QLQA 4AAXA 4E9KA 4DINB 4NWVA 5FJKA 3T1LA 4EV0A 1HQWA 5F5QA 1KJLA 4GH4C 5CZKA 3M8LA 3O5SA 1V6IA 2WT1A 5E6HA 1OKOA 3ZKYA 3RYRA 1XQNA 2Q1ZB 3B00A 5A32B 1OLQA 2VCAA 1QGLA 4M3CA 4J6GA 4XAEA 2RS31 5JMOA 4AL9A 2YFUA 3I49A 2Z42A 4FPKA 2OPKA 1NLQA 4QHZA 1AR62 1F5JA 4PBPA 5DQ0A 4EYUA 4YSFA 3UNPA 3PU8A 4G9SB 5F3IA 3ZYHA 4COYA 3PUHA 2XKOA 3V0BB 4YG3A 5FOJB 5IAXA 2RV9A 1US3A 2VUAA 4KQ7A 4V1PA 5CU1A 2WFF2 1RUH3 4IETA 3AP9A 4Q4X3 3RS6A 1FMD2 1ULPA 4HETA 3O1VA 4YPJA 3VDDA 1JZ4A 1F8VA 1PGW1 3JQWA 3WP3A 2PN5A 3B7MA 4MUVA 1J1LA 3RI9A 5CFDA 4UFLA 3UYJA 5K0UB 1UZWA 1JUHA 3LEIA 3U37A 1GYKA 3NNJA 2WZEA 1V6LA 1PMIA 3JBG1 4AHWA 1SFNA 2ETEA 5I0SA 2WIIB 1FATA 2D6NA 2JG9A 4YVSB 3AMPA 3BIWE 1PNFA 2AH2A 2VZ3A 1DYKA 3GF6A 3PUAA 1CAWA 3N3HA 3ZXDA 1QEXA 4CTEA 2PMWB 4ASLA 2BP6A 1F2NA 4S2HA 5CIRA 4LO6B 1JYVA 2XG3A 4XPVA 2EF6A 2IXCA 4CXXA 3A0KA 1PM7A 4OZXA 5A6QA 3BKZA 4L99A 1F31A 2OQ6A 2IWGB 1GWLA 4IUGA 5T3NA 5FPZA 5CFCC 5FYIA 1NQJA 3POFA 4AE2A 1TNRA 2WZPP 1WUVA 4PIZA 1DZRA 5L9VA 2VW0A 4NHMA 2R072 4YGDA 2OYZA 1OOPA 3MFAA 1CD3G 5JZGC 5GLUA 3N4MA 2GMMA 4LQRA 2BGOA 1RUH1 1G9AA 4AK3A 1UMIA 4Q4X1 4UW3A 3IBMA 4HMZA 4XIKA 2DUOA 4FPGA 4K6BA 3WNMA 3H3LA 3BOPA 1DLLA 4QPGA 2GP3A 1H2NA 2VXJA 3OGRA 3WUDA 3WW3A 1UCXA 2D6KA 1FV2A 3MW2A 4UFHA 3ABZA 4P9IA 5KXCA 4CXYA 3TOJA 4R9DA 2Q0AA 4IE7A 2WO3A 3C8XA 4IEOA 5FQ0A 1PO12 1W6QB 3PJYA 2K9ZA 1UIKA 5F2WA 4F83A 1OI6A 3LPFA 4S2DA 3H7JA 2UYAA 5K8SA 3ZXEA 3H7YA 5IFPA 3EMRA 2BGPA 1PMJX 1F35A 5G04L 1WCSA 5EWSA 3DF0A 5A3TA 1QMJA 3GJAA 3M3QA 3N7KA 2QVSB 2GZWA 1G9DA 1SLLA 5FZAA 1CX1A 2B9VA 5JSOA 4MV2A 3AMQA 1NE4A 4BU2A 4AQSA 4N53C 3AX4A 4FFFA 1H4HA 1KJRA 3AP7A 4DNYA 1W39A 1D0GA 1W6OA 5FV3A 4M3CE 4XDPA 2YV8A 4YGBA 3VUOA 1RMU3 2IFWA 2TNFA 4CUBA 1JYTA 2W46A 5EHDA 5LRRA 3X29B 1HQLA 2WUHA 4JZRA 1ZBA2 2XPJA 3KHCA 1O3TA 1ULCA 1UYZA 2BDRA 2V5YA 2QDRA 2G9GA 5FZKA 2EXHA 1MQTA 2QQIA 3K77A 3ZFFC 5T52A 2HEVF 1OQEA 3LEKA 1DQ5A 1LTEA 3NMBA 4QM8A 1OURA 3VHOA 1SCRA 3PJQA 2MNGA 3SCGA 4Y1YA 4B1LA 2GNBA 2D6LX 2E9QA 2XGXA 5J7MA 2FD8A 3MHZA 4H7MA 4JX0A 5EJ1B 1Y7BA 3AKRA 4HN1A 3ETPA 4KWKA 1O3RA 2BOIA 5FWEA 3HR9A 3Q9OA 1COV3 1UU4A 2XMLA 3WNNA 3PUSA 2WJSA 5LA0A 2HYKA 4Z2AA 2Z79A 1H4GA 2ET1A 2ZGPA 4FP2A 5EQUA 4AQTA 3N9PA 5K7PA 4CPBD 1WLWA 1LB2A 4HT1T 5FP7A 1RMU2 5C3RA 2TUNA 1W6NA 2ZABA 3N9NA 1QQP3 5FPLA 1RMU1 4RFRB 4AQ6A 1Y9QA 1WW7A 3VV1A 1FNZA 4HONA 4R4XA 5BNPB 2K46A 2EICA 4GD4A 4XFHA 3QOPA 3BGAA 1ODNA 1G6NA 3C3VA 3NL1A 4AR2A 5I0TA 3BU0A 2OIIA 5T54A 4JKLA 1RINA 1WLDA 1RUC2 3VDCA 3U75A 2C9KA 3OEBA 1WLCA 1XE7A 2IFRA 1W0PA 3F95A 2Q30A 3GALA 5CEHA 2FDHA 1SLBA 4RN5A 2VOVA 1W9SA 1PHMA 1UZZA 1Q43A 5C6CA 2CAVA 3I97A 3A0NA 1H2LA 1BZWA 1TG7A 4FVVA 4P9XA 5JWPA 1EPZA 3ASIA 4KU7A 3TNPB 4FPOB 5KR7A 1NA1C 1VBA1 4D6QA 1V6MA 1COV1 2ZHNA 2PLV2 1UZ0A 5C8CC 3R4DB 5FZFA 2VBPA 1AR73 2WWSA 2WWUA 4KBZA 1PM4A 2P34A 3SNMA 5A3WA 1GP4A 4AAPA 2OX0A 1RUJ3 2XJVA 4OHZA 1NCQC 1QQP2 3CO2A 3WP4A 2E53A 4AWDA 1XYPA 1ZZ8A 1VAVA 4H3WA 1H6XA 5JSRA 4BMBA 2QCSB 2A3XA 3VBSB 1UX6A 2CGPA 4BPZA 4CP2A 3MUY1 4WZFA 4Q27A 2DBIA 2D40A 2VQAA 3AB0A 1K42A 4BHPA 2EAKA 4Y20B 4CCMA 2DVGA 3TEWA 2D7FA 2B5HA 2R32A 2JDHA 3ST7A 4JGYC 2VD7A 1YO8A 1E5RA 1Z7S2 2XXZA 5LEJA 2HWC3 1DCSA 5FYCA 3UT0A 1CAXA 3ZFEC 2HWB3 4K3UA 2W0XA 1JXNA 1PO22 5FLIA 4AEDC 1YQ2A 1J59A 1PK6A 3C7GA 2UWBA 4ZU7A 1W03A 1S0CA 2HYXA 4BYYA 4QB2A 1Y9MA 4TN7A 4EZ4A 4HKLA 1AR71 1JZ8A 4XBNA 3LA2A 3LEGA 1W8WA 1EYBA 5FZEA 1VRH2 1RUJ1 5FLJA 5BPXA 4MHUA 5I0RA 4WM8A 2K0GA 1HRI3 3VL8A 2ZGNA 1N3PA 2B4KA 1ZRIA 4LKFA 2CAUA 2VMFA 2ADEA 4XUPA 2ZKNA 1FYUA 2RDRA 1BLZA 1CR7A 1S2EA 2GH8A 2D5FA 2DV9A 1OLMA 1MR5A 3Q8BA 1Y43B 2CSGA 1HB1A 3CIHA 2K2SA 4V2VA 3RJ2X 2KXLA 2RDQA 2HWB2 2HWC1 3MBWA 1ND2C 5B2GB 1DQ1A 1AR93 4I2OA 5FYHA 5CBLA 3I3QA 4EQVA 4HSLA 1SMVA 4RQPC 3OGSA 1HKDA 3I2OA 1QY4A 1ULGA 4W50A 5A70A 3RZJA 3FBYA 1DQ6A 1POV3 2VOKA 4ONUA 5AFBA 5DDJ3 5FREA 4LKDA 5LATA 4HK9A 2ZEZA 5H9QA 1HRI2 1MEC3 3E97A 4FQ4A 4PI0A 4BIFA 4BQ5A 2ARAA 5JIUA 4IGPA 2WO2A 2ZOEB 1PZ8A 2ZX2A 4NRPA 4QPIB 2VTFA 1O5LA 2FMYA 1Q8QA 2BWCA 2Y60A 4M4RA 1NUKA 1VBC3 2V5DA 3ECQA 2VTXA 1LCLA 2ZCWA 3J7MA 1LEMA 3OYWA 4GWNA 5T5OA 3ILNA 2G19A 4FT8A 2ZX4A 1E5IA 4NE9A 4ARXA 3KV9A 4Q4Y3 2W52A 3WF0A 4L9BA 1AR91 5IVFA 3VBUA 2Q8EA 5IYYA 2BJSA 2JE7A 1RIRA 3IPVB 3OBZA 2YXSA 3HNMA 4LK6A 4D3WA 5F1RA 3MZHA 3BOWA 5SV5A 2XJSA 2PA7A 5FZOA 1ULEA 2D6MA 1POV1 2Y6JA 3FLPA 4BA6A 4NO4A 5DDJ1 4L97A 2VW1A 2Y6KA 4IEYA 4LOSA 1D4M3 2W47A 1MEC1 4LORA 1PZ9A 4LBKA 4XMIA 3ZYJB 5A3LA 4D69A 2HWF2 1YHFA 3JB8A 1GNYA 3USSA 3WINE 2P4EA 2YBSA 3SXWA 3P6BA 4N43A 2VVEA 3TN93 1RUI3 1VBC1 5C3OA 5I0DA 3D0JA 1PVC3 4QHBA 4GJZA 5A7SA 4Q4Y2 1US2A 2XUEA 1QNWA 1D0HA 2D43A 4B4QA 1UWWA 3AYCA 1QH6A 4LK7A 1GMMA 4Q4Y1 1W9WA 4DRRA 1QOTA 4EJRA 4IEWA 4IEXA 3GXUA 1ZBE3 4DMIA 4KWLA 1ASJ3 4FPHA 2PHTA 2OQ7A 1M06G 4P9WA 5IUQA 1RUOA 1Z0HA 3S5AA 4CU6A 5DMYA 1ND3A 1QDOA 3CMGA 3B02A 4CDXA 4GXLA 2EVXA 3WQ7A 1RB8G 4UF0B 2BTVC 1DDLA 1ENQA 1RHI3 1YQ8A 2V73A 3OUJA 4OUMA 3T2TA 1D4M1 3WQBA 2RVAA 4M00A 4XXPA 1Q3EA 4RR3B 3SLIA 2R7EB 3D0SA 4GB33 1WA4A 3VL9A 1FPN2 1OQDA 1OD3A 3TN92 2PHLA 2DVBA 3L2YA 2ZBJA 5F8PA 5LK7B 3TN91 1RUI1 5IVVA 1PNGA 1W2OA 1PVC1 2W87A 3RWNA 5IVCA 3CEWA 4AVSA 2EIBA 2VTXJ 3ZMOA 4KL1A 1JTZX 3NV1A 3I3BA 3LAGA 5C4WB 3WCSA 4A2UA 3PURA 5DUXA 4LHSA 4PDWB 1KD7A 1ZBE2 1GZTA 1ASJ2 1N47A 2WNUB 2X5IB 3PVBB 3WCRA 3WNKA 1OVPA 5B4NA 1ZBE1 2R49A 4AFAA 1CVNA 1X9TA 1DHKB 4QKDA 4XQ4A 3DGTA 3CU7A 3UGHA 3MGUA 5ANQA 2FCVA 4KG8A 2NZ9A 4FFHA 4UW5A 1CJDA 2WZR2 4BQ4A 4TSVA 2W1SA 1NY71 3I3EA 2RS12 4MO3M 4BCUA 1O91A 1BKZA 1RHI1 3ZN6A 4Y1XA 4DOUA 1BMV1 2QJVA 1JMUB 2ZGKA 1KRIA 1OQ1A 1C1LA 1JBCA 1CX4A 1OPMA 1WBFA 2LUWA 4GB31 1Q56A 1RUD3 3NNGA 2XONA 4NHKA 3EYPA 5J3UA 5ABJC 4OHWA 3SH5A 4XYXA 4AI9A 4QQLA 3WLUA 2FZ1A 2VGDA 4KG0A 2ZGRA 1AUYA 1U0AA 2Q1MA 3HPNA 2J1VA 4NHXA 3POIA 5CFCA 2DF7A 3FX3A 2FZ2A 4SLIA 3U11A 3VBFC 5A1LA 1R082 3VB9A 1VBD2 3DPRC 4CZSA 3I4IA 1W8HA 1VB4A 4I3GA 4E4DX 3KGZA 5JZGA 1C1FA 3NVCA 1JYCA 5EFUA 4CYDA 5FYTA 3I2JA 4UW4A 3E6BA 1DFQA 1LHNA 5HXMA 4BQXA 1OPOA 1OXCA 3WF3A 1SPPB 1W0OA 2B7YA 4HLTA 5JUVA 2OUJA 4NOTA 4MGIE 4YFWA 2Y6HA 4CE8A 2ARBA 3LFMA 2LALA 4P5YA 1DU3D 2XLFA 3H3UA 1HIXA 1QIQA 3W20A 1TME2 4LIUA 5D21A 5FZGA 4UXAA 2XR4A 3RNSA 1RUD1 2GMPA 1S0GA 3KM5A 4RGGA 4J1XA 4E27A 5C5UA 2B39A 2OZ6A 1GU3A 4IE0A 1Q8VA 1XSQA 5FY0A 5GZDA 5A33A 4EE2A 5J48A 1AXZA 4LULA 5FYYA 2TBVA 4IEZA 3MYXA 4YZ5A 3JZVA 1O3QA 3B01A 2VW2A 3JU9A 1KDMA 4IV3C 5FY8A 1AVBA 2ZGMA 4IE5A 4YG0A 3H0OA 3T4VA 5BNNC 5LW9A 1DZQA 1TMF2 3ZSJA 2GP5A 2ZGQA 3MW3A 2VZTA 3MPBA 1GQGA 1GZ9A 1LODA 4FPLA 2AREA 2GMEA 2HWE3 2QNKA 4LUKA 4N53A 4OHVA 1LOEA 1KGYA 1OFSA 1S0EA 2B9UA 2CWSA 4OMCA 4PJYA 1MS1A 4RS5C 3VKOA 4E8CA 1JZ3A 3LGRA 5F3CA 1LENA 2H0VA 4P9LA 4RHV2 1Q5OA 4QX7A 3E6CC 1HQNA 1NCRC 2F17A 4M0NA 1GZWA 2HEWF 5EYYA 1ZX5A 4ZU5A 5FP9A 2RM21 4G3YC 4JGZC 5DAQA 4Z2WA 1BBT3 2MEV1 5K4LA 4IV1B 4QGLA 3ZX7A 4FTBA 5A3NA 1QJY2 1L7RA 3ZFFA 2ORZA 5FDBA 3RZHA 4TZDA 3H1WA 3WDVA 1MVEA 1WMFA 3M7AA 2Y0OA 3JD72 1JOBA 3O1OA 4XUOA 5CNAA 1VMFA 1CPMA 3HEIA 4OCTA 4YW4A 1RVF2 4BMEA 4GWMA 2LS6A 4YZ3A 3B9CA 1VAKA 1L7QA 3OBTA 2W68A 3AL5A 2J1TA 4U2AA 2RS53 2HWE2 3PL0A 4M3CB 5CB7A 4CCJA 1N1YA 2F4PA 2HWE1 4XJUA 5KHHA 5C9AC 5IVJA 1KS5A 4LBQD 2IC1A 3T08A 5L36A 1DGWX 4COWA 2RMU3 1OH3A 2PHFA 4QGNA 3SCHA 2V4VA 3KT4A 1LJ7A 1IPSA 1N3OA 1V6OA 2CV6A 4ZY9A 3UL2A 1FI2A 1QJEA 4HVRA 1BBT1 3AYEA 4XBLA 4OUSA 3VDDB 1X36A 4BE3A 5KXEA 3TBDA 1GOHA 5CFDB 1I3HA 3A21A 1JH5A 2VH9A 3DL3A 5H9SA 3HJRA 5JXHA 3TEZA 3KT1A 2QZ3A 3VLBB 1Y3TA 1ZRCA 2NLRA 4MZUA 2JG9B 5A7OA 2XKPA 3RZMA 1EPWA 3FE5A 1BK0A 2QDNA 2QZ2A 1NA1A 1ODMA 1CAWB 3AFGA 3IAQA 4IE4A 4K21A 4YW6A 1W8NA 3AVSA 3KVAA 2ZTNA 1JN2P 1WW4A 4YM3A 5C8CA 2RS51 1VBE3 4ZZ5A 4P9JA 2XBO2 5FY4A 1POQA 1C5IA 2PAEA 4NROA 4NWWA 2VQUA 3PVOA 2D97A 2VZRA 2HWD2 4AGGA 3J8F2 1NCQA 4DXRA 1CONA 5C5TA 4L8QA 3WUCA 2E51A 2OZJA 4ES8A 1AZDA 1C5HA 2GNTA 2O14A 3HQRA 4O65A 1MS9A 2RMU1 3RI8A 2A73B 3W5NA 3O1UA 1OOPB 1XJAA 4XHBA 4ATEA 1XE8A 2WL1A 1H9PA 1QH7A 3LDRA 5BXXA 4AEKA 4JGYA 3VZOA 1FNYA 1QJU3 4NUBA 1R092 3KT7A 3MW4A 4QPGB 3I2DA 2ZGLA 2ARXA 3CJXA 3N9LA 2Y6FA 2GN7A 3D3AA 4XDQA 2YUEA 3ZFEA 2WRAA 2JE9A 5DG2A 4E2GA 3THCA 3WD5A 5FQ0B 4AEDA 3NV3A 5LZ6A 3MEPA 5EP9A 3K2OA 3AZVA 1CAVA 5FUPA 1VBE2 1VE0A 1I9RA 4BH9A 4C1WA 4ES9A 4FFIA 4MXWA 3THDA 1APNA 3C7EA 1VBE1 2YB7A 3ALQA 2GC1A 4CDQC 4AFMA 4C0BA 3E5UA 4FSJA 3T2QA 1AJKA 3I7DA 4KH9A 1GQPA 1MZ6A 1W04A 4QDSA 1PVXA 1S0BA 2BGCA 2WAAA 5JOYA 5FZLA 2DFBA 1HXS2 3PTYA 1UW8A 4NPRA 5IJRA 4XETA 3OD4A 1SLAA 1Z78A 4K1YA 1VJ2A 2Y8KA 3JUUA 5FXWA 4CEYC 3H8OA 1W2TA 4X6RB 1S0JA 3MV11 1JHNA 1MS3A 3WR0A 4CDWC 1WMEA 2WABA 5FP8A 4GAZA 1CGPA 1AR63 5ACA3 1J84A 5LK5A 5FZCA 5HCHA 5FZBA 2D98A 1QJU1 5F2SA 5T5LA 1W6OB 1STMA 3UGGA 1I6XA 4JTOA 2HBTA 3BPSA 1ND2A 4BQYA 1D7PM 3W59A 2GU9A 5E16A 2VCCA 2WFF3 4LPLA 4XTMA 4RQPA 2IXLA 1FMD3 2VVDA 1O7FA 1UKRA 5AFEA 2IZWA 1S0DA 1ULDA 2A6WA 2VZ1A 4QDRA 3KV4A 3OOXA 1MQTB 2A6YA 4UBHA 3AK0A 1ALYA 1J58A 3E6DA 3DCQA 1CQ9A 1GANA 2NMNA 5JOZA 1O8SA 3LF7A 3RRDA 5CVRA 4A45A 2X09A 5FZ8A 3MF9A 1XYNA 4GWIA 4MLOA 2G9FA 4OHXA 3WT3A 4GIQA 1OA3A 5FY7A 2AENA 4PI2A 5ACA2 1JYIA 2LROA 3NV4A 4EWAA 3BI3A 4XILA 1MS5A 1AR61 5ACA1 1MS4A 1V6NA 2VMCA 2JE8A 4CCLA 5CADA 1RJ8A 1XBFA 3VN4A 2WLQA 1YFXA 3UJQA 1W6NB 1Y9GA 2R073 3K48A 1ZYBA 4Y5SA 2EXKA 1LNSA 2WFF1 3CKHA 4BK4A 3Q8EA 5CA6A 1XNBA 2UU8A 1FMD1 2LRPA 4W4ZA 4CDUC 1NX9A 1G7YA 3IDBB 1T6GC 4DEVA 5JXGA 3K4DA 4Q0PA 2JEMA 3UV9A 3M4FA 3U4XA 3AL6A 1W2NA 3DXUA 3H8UA 3V64A 1A3KA 1H2MA 4AYUA 4COVA 4HPKA 1TZOA 1UY1A 1UYYA 4JDMA 4LTAA 4K40A 5EV7A 1HRV2 2OKXA 2VMHA 1PO13 4UWDA 5F5CA 1LHWA 1GUIA 3MIEA 3VHPA 2AR6A 1QNYA 4Q5OA 4HFSA 3NWKA 1JYNA 2DYCA 2WYSA 2Q5TA 3GM8A 3LSEA 1UN1A 3URFA 4QXKA 5C3SA 3WHTA 3I3DA 4XVHA 2AZ5A 3ZXJA 5GKAC 1B09A 1RXGA 2P17A 4Q2FA 1KS4A 4AEMA 4U36A 5I91A 1YI9A 2WN3A 2R071 5BYNA 1W28A 1QXPA 4FTSA 4AXOA 2A5ZA 3OY8A 5FO8B 3AZXA 5F39A 2UURA 5A7WA 1W90A 3IAPA 1JYXA 3CF6E 2Z5WA 4FOYA 5CKQA 4AI2A 2IXIA 4QM9A 4BOWA 4XJWA 1XNCA 2E63A 2RR12 4CP0A 3IDEA 5GM0A 2H6CA 1EUTA 4TLFA 5IVBA 1CAXB 4YM2A 2YG0A 1AF9A 5J96B 4Q4W2 1PO11 1ZBA3 1O4TA 3ACIA 4B7EA 3N35A 1PK6B 4Y26A 1UZVA 1A78A 2YFZA 5I8YA 4UFIA 1LHVA 1DGLA 4CU7A 4LBMA 5KBFA 2UWCA 5IVYA 4AI3A 4IEUA 3G7DA 1MPXA 2BV4A 3H1YA 5L73A 4XFFA 2GH2A 4CRQA 3GYDA 4LBOA 2YPDA 3U14A 2QKDA 4DPNA 4WM8B 5JPNB 2QQMA 3LDBA 3KV6A 4DZGA 2VUJA 1V9U2 1W6MA 4QWNA 1HX6A 3UETA 5HCAA 2XJUA 3VZJA 4FTEA 3ACFA 4YM0A 3VKMA 3Q8CA 4N7UA 4YLZA 4YM1A 5IAVA 4J25A 2YC2A 3U78A 1H6YA 1PX3A 1AHSA 1UF2C 1X50A 4JDNA 3TEXA 2P1BA 1I1EA 1IZ3A 4NIDA 2WS92 5L7OB 3GBFA 4YW3A 5FMDA 1UY2A 4MSVA 4R4ZA 2A3WA 4ITCA 3AKQA 2ZHKA 2GC0A 1ZBA1 3HAGA 1DQ4A 1RUC3 2A6XA 2ZX3A 4FPEA 3ZLIA 4TTGA 4H7LA 5ABJA 3GZUC 4QB6A 3WF4A 2WT2A 3E5XA 5FRAA 1GICA 1SFPA 4CP9A 2XUMA 2ZXQA 4H14A 2RE9A 3IB3A 1E5SA 1OA4A 3FJSA 1XXNA 1GFF2 3VBHC 1SFYA 1VALA 4W8JA 2QBXA 3QACA 5DAPA 1FOD2 5LB6A 1CN1A 2DCKA 1RITA 3DPRA 3HQXA 3KV5A 4GJYA 4HG6B 2PLV3 2VMIA 1QJX2 3P1IA 4UOJA 5GLVA 1CZSA 3CDZB 4CEWC 3O0VA 2X29A 1CZTA 2V09A 3OYWB 5FYZA 1UOJA 2VE1A 3IDCB 4A7YA 3ZPOA 3BIEA 1AL23 3WVJA 3PIJA 1ZM1A 1CWPA 1ZNPA 4XZUG 2P3KA 4CCNA 4IEPA 5DXDA 1PGL2 1J3QA 1FV3A 1SLTA 3M3CA 4OLLA 5EPAA 3VBUB 3W21A 4JHZA 3N7MA 2GAUA 1Q8SA 1RUC1 4NVPA 5A3OA 2OW4A 3RZGA 3MIFA 1Z7S3 3ON7A 5FZOB 3NAPC 2P3YA 2BOJA 4C0HA 4RGAA 4M3CF 1S1AA 3JXSA 1C8M3 3NRUA 4FP3A 3H8XA 1IS5A 3J26N 1PO23 4BQ2A 1ZZ7A 3WZ1A 4XFAA 4DXSA 1EAH2 5FZIA 4IV3A 4E4SA 3TYJA 5BNNA 1UD1A 2PLV1 3PMEA 3KS7A 3EJKA 3EBRA 5KC6A 1GNHA 2PHRA 3DKWA 3OBAA 1AL22 1OA2A 3KQRA 4N43B 1OSGA 4MH0E 4PHZA 4LBQA 3WDTA 3OB8A 1VRH3 3VD3A 4I01A 3WHUA 1SDWA 3RMYA 3THPA 4RS5A 1QQP1 1OC1A 4WVMA 4XFIA 3B5LB 4NHYA 2R16A 1AL0G 1NCRA 1ZA4A 3ZXAC 1GOFA 2Z2SB 1UYXA 2XLAA 1XB9A 5FY9A 3ZIWA 4EROA 3VGIA 5DG1A 4JGZA 4QQPA 2J1RA 2WFPA 3DYOA 2OPWA 2A6ZA 4XF4A 4QB1A 5HPOA 4YFZA 5JR2A 1ND3B 3PNAA 5A80A 4CDXB 2E31A 1Z7S1 5DZEA 3BTYA 1C8M2 3SEEA 1H9WA 4PF5A 4O9EA 5FZ6A 1L7LA 4AHXA 1SCSA 1PO21 1W8TA 3JQXA 4I30A 2VUDA 4YGEA 2E32A 3LKJA 4GH4B 4YZ4A 3IN9A 3VZKA 2JECA 4NRMA 2VZOA 1LR5A 1PGSA 3I8TA 3PIGA 1UU5A 4P9GA 4KNCA 5APAA 4GKXA 1A8MA 2CL2A 1YI7A 2L9LA 4CCDA 3S5QA 5C9AA 2ZHLA 1VRH1 4A3XA 3GZAA 5IW0A 4N7IA 3FBMA 5JI7A 4UYBA 5HV4A 4EN9B 1WBLA 5FK8A 4UT5A 2A71A 5FOBB 1UOGA 3POBA 2C0ZA 2XB6C 3FL7A 2FDJA 5FCCA 5FUNA 2PFWA 3HN1A 3OUHA 3ZXFA 1SHWB 5C8WA 5GLZA 3RG0A 3WW4A 1F15A 1O4YA 3GBWA 3KCCA 3VBOC 5LEKA 3NNLA 4UAPA 3G6JB 1UXZA 1YNAA 2HWB1 4XIOA 5D2AA 5T50A 3WW1A 5B4XA 1O59A 2QE3A 3ZN6B 1SZBA 3I54A 1G9BA 1F9KA 1N1TA 1DF0A 3RZKA 2P3JA 4KGGA 4D6SA 1DP0A 2B45X 2KA3A 3MLLA 3PVNA 4J1WA 1AYN2 4L92A 2BBAA 4XC9A 4BISA 1HJGA 4IGQA 5FPAA 3GJBA 1MZFA 2NM1A 2QQJA 2ZEYA 3PUQA 4QT6A 4WV8A 1ACCA 1HRI1 2VBBA 3QH7A 5CFCB 4URTA 2JIJA 3LIGA 4R8HA 1XNTA 5D8AC 3VBRC 4E2QA 2HWF3 2VZVA 2C6SA 3NQHA 2GDFA 3S6PA 1A6CA 1YQCA 1JZ5A 4R9AA 5A3UA 5JZGB 2JKXA 1FT9A 4BXFA 1YUDA 3AP6A 2DVFA 4SBVA 1W9YA 3N36A 1EY2A 1KITA 3D6EA 5FMOL 1UAIA 2AACA 3WXPA 1UOFA 1S4CA 1VP6A 4S2GA 4ZS2A 1PZ7A 1QOSA 2BYVE 1NXD1 2EIGA 4PCRA 4N9HA 3LCPA 5A1FA 3T2PA 4XUNA 3HQUA 2RJKA 3CLPA 1AYM2 4IGOA 1R1A2 2TEPA 5FBJA 3SEPA 2C26A 3D5OA 4XF1A 3GNEA 4ZU4A 3BYWA 2VL4A 1VMHA 3AP4A 3S30A 2XQXA 4Y3OA 2VPVA 3EQEA 2PAMA 4QXBA 1WCUA 2DVDA 5A33B 5IHRA 5H9RA 1GP5A 4CDQA 5H9PA 1W06A 1RUG2 4CUAA 1ZZBA 3TEYA 2FQPA 1EV12 4WM7C 3AYAA 3J7LA 5FFOC 4QD2A 2HWF1 1FPN3 3FMGA 4CEYA 2XVKA 4IESA 1U5XA 3PU3A 2W1WA 2QQKA 2XDVA 4CDWA 1PMHX 4D7TA 2WNVC 1O8PA 2VBDA 4N53B 1H8TC 5KC5A 5TSWA 2YGLA 4AF9A 1GKBA 1XRUA 3B3QE 1XE0A 2R1BA 3BN6A 5FJHA 3F2ZA 1NOVA 3ZXLA 2DVAA 3R4UA 4HN0A 4L2NA 3T09A 3ZN5A 1BHGA 2ERFA 1GZWB 3ILRA 1AX2A 1G8WA 1NXMA 4K20A 2ZMNA 5EXOA 3NNMA 2VOXA 4Y5Z0 3WDUA 3ZFGC 3R4SA 1X8MA 1OLME 5E8AA 3HOBA 3VKLA 3ZFFB 2WZR3 4WZCA 4PLMA 5F9TA 3SMHA 1I5PA 1BCXA 2PHDA 1LOAA 2RS13 2ZGTA 2MHFA 3GHNA 3MDPA 4NR1A 5F7UA 3LDKA 1DYPA 2WN2A 3HIFA 1KQRA 4AVTA 2N7GA 1D4VB 3KCYA 4A4AA 1PX4A 4Y20A 4L0PA 2AEYA 1HN0A 4AOCA 2QUOA 1K5MC 4UI9L 5FYVA 1FPN1 3R0RA 3TRSB 3CZJA 4QX5A 4TWTA 1AR82 2J7MA 4ET7A 1QKQA 2ZMLA 3RSJA 1CESA 3J7NA 3NKTA 4XUTA 5DUUA 2VCMA 4DEQA 3I2HA 5L9RA 3RVHA 3KB5A 1R083 1VBD3 3OSDA 5BNOC 2A70A 2QQNA 1ASJ1 2PYTA 4OHYA 3ZIXA 3AMMA 2XJQA 2VZSA 5J98B 4BM8A 4HK8A 5A3MA 4CDUA 5LY1A 2JDMA 3DKQA 1AX1A 2C1FA 3HD8B 5EZWA 4OYUA 5FP4A 1IPKA 5CAZA 3FWEA 1UMHA 3KQ4B 2QQWA 1Y4WA 1U12A 2WZR1 4UFKA 2PELA 3C2UA 1DBNA 1RTVA 2RS11 2VC9A 4W6WA 3U1XA 4XTPA 3UESA 3P5BA 5HBAA 2RDSA 2JWPA 4Z1VA 3W5MA 5GZCA 3U0ZA 1SBEA 5FLHA 1TME3 3RZLA 2EIDA 2IUWA 3VZMA 4CUGA 2WQ8A 1C4RA 4IW3A 1K45A 1IPJA 1NA1B 2JG8C 2C4XA 1RUE2 1L3JA 5C8CB 1UIJA 1JW6A 4INDA 2A75A 5JXJA 1UNBA 2C24A 1UQXA 3CJIC 4XF3A 4YWAA 3O1MA 5I8TA 2CYFA 4YW5A 4AHYA 1W8UA 3ELNA 3NJVA 4R9CA 1NCQB 2P6HA 4COZA 4OUEA 1R081 1C57A 1VBD1 1WKYA 2O8OA 4QX8A 3RFRA 1B35C 4AGVA 3FUOA 2WYFA 4LO7A 4AQ2A 2YGMA 3WDXA 1J1TA 1TMF3 3FC0A 2CNAA 4FO9A 1VRBA 3L9JT 3OJBA 4LXLA 4QKFA 3T30A 4NIHA 3ACHA 3T0AA 4XF0A 1P8JA 5FZDA 4JGYB 4LA3A 4CCEA 2Y33A 3HBZA 4NN0A 2VR4A 4RHV3 3WX5A 1WCQA 3TWIA 4AVVA 4AFCA 2R063 2GN3A 4AG4A 4CA9A 4UW6A 1RYYA 3ME2A 3ZFEB 3KHBA 4RSUA 4AVBA 1SDDB 1TME1 3DN7A 4AEDB 1IG0A 2KM2A 1GQHA 3L2HA 2ID4A 1W05A 1OF3A 1CAVB 1QJY3 3IMMA 2YMZA 5F6KA 3OPWA 3MLJA 4MXWB 4NAOA 2QQOA 3MI8A 3JD73 3M3IA 4XF9A 1QJZA 3LSDA 5FAXA 3Q8FA 5F32A 4MGZE 3IPVA 3WV6A 1RVF3 3OEAA 4K8FA 4LOTA 5LBFA 4ISRA 4QDQA 2PQSA 1J3RA 5K0UC 5FZ4A 4D94A 2OXBA 1IQDC 1TMF1 2VU9A 3AMNA 1U5YA 3RPQA 3RWKX 3FHIB 4M4PA 3ZYFA 1JU4A 4RD7A 4YVSC 2BNNA 1N1SA 2DCYA 2V72A 3AJYA 3MIHA 4TLGA 1S0IA 3AKTA 3MIBA 4Y1VA 1LESA 2R062 3RJRA 3AZYA 4A6SA 2WC2A 4I09A 2ZGSA 4RHV1 2WO7A 4EWEA 3LFIA 1X8EA 3DYPA 2R061 1ND2B 4QQOA 1UPSA 4META 4BLJA 4LITA 2J42A 4RQPB 1BVVA 3VKNA 1ZRRA 5T5JA 4QKBA 3ZR5A 3N9OA 3RMXA 1H30A 2B8MA 1J83A 1QJY1 1R64A 4YW1A 3S7IA 2DUQA 2XL9A 1VIWB 2CDPA 4S2FA 4BQWA 2BERA 4E4ZA 1ZRFA 2WAOA 3T1MA 4MGTA 3JD71 4AVAA 3WP5A 4C90A 1CPNA 4A6OA 3VBHA 2D5HA 2LTNA 1RVF1 1GZCA 1Q8OA 3AXDA 2JDYA 2YU2A 3J7HA 4OZOA 5DABA 4HKOA 4DUXA 4LT5A 1NAEA 3WG3A 1UYPA 3I3MA 1WMDA 2WA3A 1MZ5A 1UX7A 1G86A 3WNPA 4Q8KA 2P6CA 3AXEA 1AXKA 4CEWA 1XNAA 4XW3A 4JC1A 2XBO3 1OKQA 2XL7A 4ZS3A 1FXZA 5DAXA 1W8FA 1W8OA 1TNFA 2HWD3 3J8F3 5JVVA 1MACA 2W9XA 3WP6A 3ATGA 2PQQA 4LA2A 3WY6A 5IATA 3FN9A 2D44A 3FLTA 3ZVXA 4XEZA 2Y6GA 2Y6LA 2JDKA 1KFXL 1MVQA 2GC3A 3ENRA 4JVAA 1R093 3A23A 2RJLA 3ZYRA 5KHIA 3NAPA 1ZRDA 4LO4B 2PXJA 1CZVA 2D3SA 3SITA 4HPKB 1LAJA 2ORXA 2FCUA 2ZPXA 2BBVA 1QXRA 4NMIA 2KR2A 2BEOA 4LE3A 5FP3A 2JENA 5FXXA 5FZ0A 4ARYA 4ORFA 1K3IA 1LOFC 1YJKA 4IDZA 1HV0A 2E6VA 2AYHA 3DECA 3E5QA 4NPMA 4H2AA 4JAAA 4QXHA 2XBO1 2FCTA 5ANNA 1IG3A 1SG3A 4FAHA 3WNOA 2HWD1 2R1DA 3J8F1 3PTRB 4HZFA 4N8MA 1LGNA 4I0BA 1HXS3 3USUA 5FPVA 4D7YA 5EIYB 2ZJCA 2ZACA 2X8KA 3KGLA 3OPTA 4PBOA 3A4UA 3CBNA 3HMYA 4ATFA 3O1RA 2SBAA 1U5IA 2O1QA 2W92A 3C7FA 3OY8B 1OBNA 1ST8A 3T0DA 2ZKLA 2C5DA 3K4AA 2Q4SA 5A6YA 1BJQA 2P3IA 3VZNA 5A7WB 1CAUA 1UU6A 1R091 5JCTA 3I2KA 4DY3A 5E88A 1TEIA 1KXGA 4ZHNA 2XH6A 3ES1A 1WWYA 2DFCA 2C9AA 4QKNA 2EALA 4DUVA 2VNOA 3VHNA 3TAYA 3KVBA 2YY1A 4AFDA 5EJ3A 2PHUA 2LW8A 2JXAA 3AJZA 4JQRA 4AEJA 3K4ZA 4NIIA 3MIDA 1JS9A 2WKKA 3VBFA 4Q0QA 1QXJA 4Z8BA 3CZUA 5BNPC 1I5ZA 2JJ6A 1DLCA 1UY0A 4E8DA 1LU2A 2BZDA 1G9FA 4Y1ZA 1JYWA 2BW8A 2DUPA 3IWZA 3TB0A 2R043 1XNDA 5FK7A 1XU2A 5FXVA 2J1EA 3IIAA 5FZHA 3MPPG 3V65A 3PMSA 4CXWA 3ETQA 1HXS1 5CKMA 3LOIA 4UFMA 3ZR6A 2JDZA 4XE9A 4DIQA 1BQPA 2Z4FA 5A7NA 1W6MB 1RXFA 3EO6A 4FXKB 2PHXA 4PQQA 5IWFA 4FI9A 1GP6A 3SKVA 2EIEA 4MYEA 3VBOA 5ISLA 2HLEA 4QAWA 3AFKA 4GMP0 3QCWA 3U07A 1OH4A 2WA4A 2A6VA 2E7QA 3KLSA 1BXHA 2IXHA 3WQ0A 1JOPA 2H0BA 4JTNA 2LM3A 3MF6A 3LE0A 3HVDA 5BY5A 3N7LA 4MOAA 4XJZA 5KHGA 4G4FA 5IK7A 5ABJB 2JDUA 3VBSC 1W6PA 2R042 3MV01 4CP9B 3K46A 1TQ5A 1LOCA 3VD4A 1HRV3 2R041 4XOGA 4WVVA 4XJ9A 1HW5A 3KSCA 5D8AA 3VBFB 3VBRA 5FYUA 3DPRB 3P3PA 3ES4A 3O12A 4Q4V2 1IKQA 3BODA 4Y33A 3IIIA 2XVGA 1BEV2 1DGRA 3NO8A 3NJXA 2FDKA 2W1QA 2ARCA 4ZZ8A 5DZFA 1O5UA 4A44A 3AZZA 5FKBA 4BIOA 4CCKA 4OFGA 3IDAA 3H9AA 4FAGA 4ZKTB 3ZYBA 2RS32 2UY8A 2VZUA 3INAA 4I0AA 3IMNA 2R6QA 4Y5TA 2E33A 3W58A 2VNGA 1ULFA 3MO4A 5GZGA 2VVFA 2EXIA 1AJOA 4OI2A 1CIYA 2J1SA 1IKPA 1PIV3 2RR13 4MGSA 4P9YA 4Q0UA 3BTXA 1W99A 2BNMA 1YEWA 4Q4W3 5FKCA 1HB4A 1HRV1 2ZEXA 1GWMA 3POSA 3BPZA 2XJPA 4WM7A 4LLOA 1G9CA 1PGW2 1H8VA 4Y22A 2ET7A 3NV2A 1IS6A 2WT0A 4IV3B 4ZONA 4DO0A 5DZGA 4BWOA 2A1XA 2VQ0A 2WZ8A 3DEMA 5BNNB 4MG2A 5J36A 3JBG2 4GULA 4BJ0A 1LOBA 1MS0A 1VPHA 2WNVA 3I2IA 2RJ2A 2NP0A 1K12A 1ENSA 1H8TA 4E4HA 2MPFA 3DYMA 4LBQB 5FWJA 2I45A 4EN6B 1LGBA 4LBLA 4RS5B 4WVWA 4WVMB 4YNIA 2ILMA 3RZZA 4NRQA 1NCRB 2F6BA 3V0AA 1V9U3 3FFQA 2VMEA 5BNQA 1DYOA 4B4RA 4XACA 1SLIA 4JGZB 5AVPA 5A1AA 1YQ6A 3IZOA 5E1RA 1GR3A 4ZXKA 1WW5A 1UKGA 3BCWA 4IQPA 4AFBA 5GLWA 3ZFGA 1JZ2A 1PIV2 2ZS6B 4FCAA 5DAVA 1C28A 5HCBA 1WCKA 5JLVA 4GALA 5J1XA 3NJYA 5KHKA 4QPIC 5J37A 4XBQA 1PIV1 2RR11 3I59A 5LY2A 3W9AA 2J22A 2WS93 1RUH2 1YC61 2NYYA 2VY0A 4Q4X2 5FPXA 1WCDJ 4Q4W1 4MX3A 3Q8AA 4XMAA 5E89A 2WLPA 3SHRA 4B7KA 3C7OA 1ZREA 1K5MA 3ZYPA 2P37A 4COUA 2BRTA 2P2KA 1KEXA 3POWA 3KCXA 3LZZA 1VB2A 1AXYA 4KWJA 3SISA 2QQVA 3OGVA 2ZX0A 1LOGA 4ZPIA 1HN1A 2W3JA 1LECA 5C9AB 4GZ9A 4AW7A 3C7HA 4RL7A 1FOD3 3A22A 4Y4RA 5CKNA 2VCBA 3S0MA 4B8EA 3FLRA 3GCWA 1X33A 5BNOA 4NPLA 4BQ3A 4X8NA 5C71A 1QJX3 1V9U1 1ZZ9A 3PHMA 3WDWA 4A7KA 3POEA 4DB5A 5C7GA 3WOGA 2CDOA 2D6PA 1VMJA 2BVVA 4RYDA 2WR9A 3D82A 2A7AA 4EZHA 1ZZ6A 1WW6A 1SQ4A 5FTTC 3ZKUA 1QDCA 3KD4A 4FOVA 5C33A 1F4AA 3ACLA 3POJA 5I0UA 5F37A 3SH4A 4K1ZA 3UKVA 1YYNA 2WS91 5HXVA 2FDIA 1LEDA 4IL7A 2RHPA 2P5BA 3HNBM 2VXRA 4BB3A 4GA9A 3OG2A 5FO7B 5FZ9A 5IK5A 2FHRA 1ZVFA 2WSUA 1NLSA 3EB7A 1XSRA 2JG8A 4CCOA 3K3NA 1XNKA 2CHHA 1GSLA 3OUIA 3RGBA 4PLOA 3CJIA 4R9BA 5FYMA 1UOBA 2CWMA 3M3EA 4PIYA 4YG6A 1FOD1 1RUNA 1EAH3 1YFWA 4FPFA 1B35A 1OT5A 1V6JA 2QQPA 1BVP1 4HXCA 4B29A 5M0TA 1QJX1 4DRVA 4LKEA 4RGKA 1MS8A 4FPYA 1UXXX 5AVAA 5DN2A 3LA7A 4QQHA 4RR3C 2G4IA 1C8NA 4D7SA 4DXTA 5A32A 1NQDA 1PGL1 2DTWA 1JHJA 3E1F1 3KF3A 1VBA3 4XAAA 4QX3A 5F6LB 4D0QA 4QX0A 4ZXEA 4JKKA 2XHKA 1QF3A 2E7AA 2GSYA 1WGPA 1R1ZA 1ULOA 1NLRA 5C4WC 4OMDA 4L11A 3V0BA 4PDWC 2E7TA 2DWRA 2WNUC 2X5IC 4K9SA 1NZCA 1WZXA 4CDQB 4Y1UA 3B94A 3RYPA 4QU1A 1RJ7A 4OQ9A 4IEVA 3GDBA 1OVSA 4Q29A 1RC6A 1EAH1 2PHWA 4BXSV 4JHTA 3CQOA 2VNVA 5K0UA 4DUWA 5LWBA 4CEYB 3J9SA 4UFJA 3NJZA 4LUMA 1JODA 2BQPA 4TYSA 1AL21 4XUQA 5EYXA 4CDWB 1LGCA 3O7OA 4YVSA 3N9MA 1YWKA 5C3QA 1SEFA 2VJXA 2R0HA 1FX5A 1SBFA 1LKNA 1VBA2 5HI0A 1COV2 2XVLA 4LLFA 4O7XA 4XDOA 4A42A 2CU5A 4XFGA 2UWAA 4ASMB 1JZ7A 4XQDA 2VECA 4LE4A 2YDEA 2GC2A 1OUXA 2OT7A 4YW7A 2YPJA 1GBGA 2YBPA 4RA0A 4CU9A 2DCTA 2XHNA 4YW2A 1GWKA 5LRSA 2Q8OA 1HV1A 3ZDSA 4HBNA 5I93A 4IEQA 1HDKA 1QJFA 5FY1A 3U4SA 2Y0IA 1C8M1 4AGRA 3T2OA 4XABA 2OUHA 2VNRA 2ZZJA 3VZLA 3VHRA 1NE6A 2H6BA 3ROUA 1F4HA 2NMOA 3AVRA 1E57A 3QBQA 3N9QA 1SLCA 2Q8CA 3VKFC 4KGQA 1WMXA 1AYN3 3U10A 3VDBA 2I74A 5FO9B 1FAYA 4F3JA 1JI6A 4IERA 4YARA 5GLTA 4N90A 5LBBA 2D3RA 2JKBA 4HKWA 2W95A 1W6QA 2X10A 2XLGA 3O0XA 5K9YA 3LOBA 4NIAA 4H55A 4O9GA 3SQOA 1X82A 2W08A 5CISA 1VAMA 3BALA 1DQ0A 4QX1A 1AR72 1URXA 5LBCA 3KMHA 5BUVA 1GOGA 4DQAA 1RUJ2 2XWBB 3AZWA 4CDUB 1AX0A 1VR3A 3K75B 2VZPA 4KI5M 2JDNA 5JXIA 1YRZA 3WSOA 4C91A 5JI9A 4MGQA 1UL9A 1HB2A 2E26A 3S7EA 5D1IA 3KWVA 3ZDVA 5FPUA 3H42B 4LO8A 3OBRA 5FYSA 2YZ4A 2O0OA 1AYM3 1R1A3 4RFT0 4YVWC 4A7ZA 4NJ4A 4QX2A 2ADDA 4TXWA 4AI1A 3ZSLA 5HV0A 5IT6A 1V70A 2YC4A 4W6YA 4NIGA 5FZMA 3AYDA 4DXZA 1AYN1 1LOFA 3POGA 4R52A 4QQ2A 2HWC2 5C3PA 3PLQA 4PQ9A 5CG8A 4JRAA 1D2QA 1UPIA 4C8DA 1RUG3 5L7OA 5A6ZA 2GALA 1UO9A 4CU8A 2WINB 4IV1C 1UMZA 1EV13 3LQCA 2WDBA 5JSPA 2WNOA 1NYWA 1HB3A 1IOAA 2AUYA 4LHKA 3QD6A 4UBGA 3IKWA 4ASKA 4M0HA 2VM9A 4FBFA 1H1MA 2BU9A 3ZSMA 3HT1A 2JIGA 1BYHA 3ZPYA 4YYOA 2R0FA 5GZEA 5JAXA 2DCZA 3I2GA 3V56A 2BFUL 4BLIA 4O61A 3ZXGA 1AYM1 5J09A 1R1A1 3ACGA 1REEA 1U5ZA 4HVOA 4Y4YA 4DY5A 3AC0A 4LJHA 4LBNA 3RYKA 2YHJA 4BZ4A 1NG0A 1W9TA 1EP0A 2G9ZA 3WEZA 1CIWA 5FR3A 4OQ8A 5BNPA 3CNAA 1AR92 5IK8A 1RUG1 1S0FA 3FHQA 1OLRA 4P5HA 2CGNA 3BUCA 1EV11 3GZTB 2FBEA 3VDDC 3B69A 3ZN4A 3LA3A 2YC0A 4JRLA 5CFDC 5KHJA 1AR83 1HJFA 2VMDA 1VLNA 4FPJA 4GMP3 3PUIA 5F5AA 2RDNA 5L19A 1X9PA 5DDJ2 3ZYIB 1NZIA 1E5HA 1GNZA 1IQAA 5LBEA 2NQYA 1O6UA 1MEC2 2VG9A 2AEZA 2JG9C 3POYA 4V2WA 4FFGA 3EHKA 4MVTA 4OULA 3UK9A 4LIVA 5FUIA 4B1MA 1S55A 1VBC2 1OMIA 1ENXA 1YFUA 5BV6A 2VUCA 5FBZA 1QHDA 4LMFA 2A3YA 4Q1PA 4JCKA 4D6RA 5KXBA 2DURA 2HKXA 2DU0A 3ZXKA 3T0BA 1YCIA 4MADA 3ZYGA 2OA2A 4DS0A 3VBSA 2ZZQA 1OOPC 2DTYA 4NHLA 5FYBA 4W6XA 2Q8DA 4XJAA 3VD7A 1RGSA 5GJ6A 4QGMA 3GGLA 3NNFA 1LHOA 2YYOA 3JB4C 3K51A 5LA9A 3VBHB 1EUUA 3MIGA 4K8RB 2JB4A 2WSVA 1NT0A 4QPGC 2I2SA 2CTVA 1XPWA 2QQUA 1RUE3 1AR81 2W91A 2ZEWA 3HWJA 1ZZCA 4GMP1 3WNXA 3GZEA 4M01A 4CEWB 5DAWA 2KD7A 2NPIA 4FQZA 1YQ5A 4Q0SA 1TVGA 3O14A 1D4M2 1DG6A 4YZ1A 4OI1A 1OUSA 1DIWA 1XC6A 3I2FA 3ITQA 3APBA 3LPGA 1DGRN 1SBDA 1SACA 3DV8A 3LD8A 5LASA 1REFA 4GH4A 5SV8A 2RG4A 3QH6A 4QXCA 3DXTA 1QWRA 2QTWB 2W2IA 4LNVA 3VD9A 2FDGA 4PT6A 1RUI2 3OPZA 2WO1A 4DFSA 1PVC2 3FZ3A 1YXWA 2XJTA 2D6OX 3ZM8A 2EXJA 2DBNA 3B9IA 2IVJA 3NKGA 2F4LA 2HH9A 1IHMA 4HSJA 4OI4A 1V00A 3NAPB 4QPWA 1KFUL 1C3HA 1WLTA 2BVBA 4MXVA 4OI0A 1N1VA 1S2KA 2UYBA 2VAUA 1XYOA 3UJOA 4I0WB 2W39A 4I3PA 1QU0A 5IVEA 1MZEA 3BU7A 3P3NA 3LWCA 3ZSEA 2VQTA 1RUE1 4C1XA 1F5FA 1NY72 4Q1RA 1RHI2 4MGYE 4WBBA 5CYYA 5A7QA 5FMOS 4XFBA 3WDYA 1BMV2 2NN8A 1RL3A 3LEMA 4A41A 1JOJA 4Q8LA 2WNEA 1W0NA 3GCXA 4XURA 4GB32 3K3OA 4LBJA 4CCCA 3USUB 1MQTC 2ATFA 1V6KA 2BFUS 4Q0VA 5A6XA 2VZQA 4JV4A 2WQZC 2XJRA 2VULA 4URAA 2UY9A 3UKNA 1OFNA 3BTZA 1CAUB 3AP5A 5F5IA 3PVEA 1H1IA 4XJ8A 2JB8A 2PTMA 4QPIA 5JR7B 5JPMB 2ZX1A 4EWDA 2GNDA 3PDQA 1H2KA 4CVUA 5FZ3A 4YZ2A 1J3PA 4LO5B 5AC93 3DUIA 3M2MA 3EXUA 3SH3A 2B46X 5FIXA 3M1HA 2JD9A 3NW4A 4XCAA 1RUF3 2IXJA 4P14A 2BUKA 2O8QA 4QPYA 5F3GA 3VDAA 2XOMA 4AZZA 4Q26A 3LIHA 5F3EA 3MLKA 2IXKA 3B93A 4XZPA 1Q8PA 2RM23 2CY6A 2G1MA 2JX9A 4IXLA 4JQTA 2Y34A 1RUD2 4MGKE 3OCPA 4KMQA 4GKYA 5A3PA 2X05A 4AVCA 2MEV3 2VMGA 4GWJA 4I02A 2WWJA 3BVCA 3NSTA 3WG4A 5KXDA 4WVZA 3CHXA 1XU1A 2XQRA 1T6BX 2VO5A 3R05A 1W2AX 5EJZB 1ONAA 4PLNA 3VBOB 2BNOA 5AC92 1OF4A 3AKSA 1UY4A 4P02B 1YLLA 5AC91 2IVIB 5ERLA 5JOWA 1QOOA 2I07B 1RUF2 3OGGA 3R6SA 4CPBA 1X7NA 4XXAA 1JUIA 1RUF1 2V4AA 3WW2A 1H1AA 5IFTA 2WBKA 3HT2A 3AMHA 4XQWA 4B3NA 5FXZA 5DPNA 5FMBA 2J1AA 3OF1A 1W6PB 4IE6A 2RM22 1O4ZA 3IM0A 4LEJA 1UZYA 4N9IA 3ORJA 3O1SA 5KWRA 3AM2A 2MEV2 4XFCA 2JDPA 5D8AB 1HLCA 3VBRB 4UF0A 2ZMKA 4HANA 4F8AA 1ENRA 4X6QB 4OVEA 4BQ1A 5FZ7A 2FMDA 2ZAAA 4P00B 4EN7B 1DGWA 1TE1B 3SCFA 2ZGOA 2VOWA 4LHLA 4AI0A 2Z69A 4FXGB 4BK5A 3J4UH 1JZ6A 4RR3A 3ZOIA 2CGOA 2D93A 3MUZ1 1PK6C 3UKTA 5JIAA 1LULA 4Z82A 3M3OA 1BK1A 5LCWL 1VBB3 4FOQA 4MHRA 4EN0A 3MFCA 4KWUA 3WNLA 5GZFA 4LR4A 4QHOA 3SC7X 3O1TA 2ES3A 5JOXA 3HNYM 4JDOA 2Y26A 3WG1A 1NKGA 5C4WA 5C70A 1W8ZA 4PF1A 4PDWA 4FPCA 4WM8C 4EN8B 5A7PA 3OGJA 2WNUA 3FHAA 3FUQA 5FZ1A 2X5IA 4KU8A 1LHUA 1WD3A 4GQ7A 4F7ZA 2ZA9A 3D4KA 2W94A 5L9BA 5LA2A 3HN3A 1BBT2 2GNMA 3KZ4C 3SKJE 1YIFA 5DUVA 4LHNA 4WM7B 2JD4A 2AC1A 2XWJB 4Z92B 4Y22B 2DU1A 3AKPA 3D8CA 2SLIA 4A3ZA 4B4PA 4W65A 4XCBA 4Y24A 5L7OC 4AI8A 3CL1A 4QMAA 2Y64A 5CG9A 4KBBA 3ZSKA 1YJLA 2WNVB 1W3XA 3GHMA 3FFZA 2R30A 2VOTA 1H8TB 3MICA 2BWAA 3OD0A 3TNQA 3WQ1A 5JMCA 1OHFA 1VBB2 2DDUA 2ZHMA 1DZTA 3BTAA 2QFEA 5IK4A 5GALA 1VBB1 2FDFA 3GBGA 2RS52 4X8PA 3T4HB 3V0AB 1XOYA 1T2XA 2OVUA 3ZO0B 4YRDA 2DCJA 4HOOA 1WD4A 4Z07A 1LU1A 5LA1A 4P08A 1IS3A 4YVWB 3ZFGB 4BDVB 1O3SA 4AHZA 2RMU2 1POV0 2ZGUA 2EAAA 2D3PA 5HCFA 3I59B 5JDBA 2X53S 1OD5A 4JKMA 1V0AA 1CJPA 1SPPA 3OTFA 3O1PA 1YIPA 2B42B 2W5FA 3WG2A 2PAKA 1K5MB 1GLHA 1M4WA 3H50A 4FOWA 3RDIA 2WQ4A 3IT8A 3VBUC 1UY3A 1DQ2A 5FY5A 3ILFA 1K5JA 1A8DA 1WA6X 2AGSA 3BB6A 4HL0A 5BNOB 4Q4V3 5DUWA 5FMCA 3O0WA 2YU1A 2YBKA 2OS2A 3H3ZA 5FPBA 1BEV3 1S2BA 3JCIA 3S57A 4XHXA 3LB9A 2HBUA 1LRHA 1REDA 4CUCA 4K7JA 1N3QA 2W1UA 4PIXA 5T5PA
chains in the Genus database with same CATH topology
1YFYA 1D2SA 2RS33 3THTA 4N43C 2HEYF 4HVQA 4YVWA 5T55A 4QU2A 2YROA 1GV9A 1QJU2 2ENRA 4YGCA 1KDKA 3N7JA 3H1MA 1IS4A 2JG8B 2Y38A 2JICA 4ISQA 4E2SA 3M70A 3CJIB 2ZAHA 1IGOA 1W2UA 4IV1A 4CP1A 5I8SA 2BPA2 1ND3C 2HJIA 4CDXC 1H0BA 2EA7A 1B35B 4Q4V1 3RQ0A 3ZMNA 3JBG3 1BEV1 3QLQA 4E9KA 4DINB 4NWVA 3T1LA 4EV0A 1HQWA 5F5QA 1KJLA 4GH4C 3M8LA 3O5SA 1V6IA 2WT1A 3RYRA 1XQNA 2Q1ZB 3B00A 5A32B 1OLQA 1QGLA 4M3CA 4J6GA 2RS31 2Z42A 4FPKA 2OPKA 1AR62 1F5JA 4PBPA 4YSFA 4G9SB 4COYA 2XKOA 3V0BB 4YG3A 5FOJB 2VUAA 4KQ7A 4V1PA 5CU1A 2WFF2 1RUH3 4IETA 3AP9A 4Q4X3 3RS6A 1FMD2 4HETA 3VDDA 1F8VA 1PGW1 3JQWA 3WP3A 2PN5A 3B7MA 4MUVA 1J1LA 3RI9A 5CFDA 5K0UB 1JUHA 1GYKA 4AHWA 1V6LA 1PMIA 3JBG1 1SFNA 2ETEA 5I0SA 2WIIB 1FATA 2D6NA 2JG9A 4YVSB 3AMPA 3BIWE 1PNFA 2AH2A 3GF6A 1DYKA 3ZXDA 4CTEA 1CAWA 3N3HA 4ASLA 4S2HA 1F2NA 5CIRA 4LO6B 2XG3A 4XPVA 2EF6A 2IXCA 3A0KA 1PM7A 4OZXA 4L99A 1F31A 5T3NA 2IWGB 5FPZA 5CFCC 4AE2A 1NQJA 1TNRA 2WZPP 1WUVA 4PIZA 1DZRA 2VW0A 4NHMA 2R072 4YGDA 2OYZA 1OOPA 3MFAA 1CD3G 5JZGC 5GLUA 3N4MA 2GMMA 1RUH1 1G9AA 4AK3A 4Q4X1 4UW3A 3IBMA 4HMZA 4XIKA 2DUOA 4FPGA 4K6BA 3BOPA 1DLLA 4QPGA 1H2NA 3WUDA 3WW3A 1UCXA 2D6KA 1FV2A 3MW2A 4P9IA 5KXCA 3TOJA 4R9DA 2Q0AA 4IEOA 5FQ0A 1PO12 1W6QB 3PJYA 2K9ZA 1UIKA 4F83A 1OI6A 4S2DA 3H7JA 2UYAA 5K8SA 3ZXEA 3H7YA 1WCSA 5EWSA 3DF0A 1QMJA 3M3QA 3N7KA 1G9DA 2QVSB 2GZWA 1SLLA 5JSOA 4MV2A 3AMQA 1NE4A 4AQSA 4N53C 3AX4A 4DNYA 1H4HA 1KJRA 3AP7A 1W39A 1D0GA 1W6OA 4M3CE 2YV8A 4YGBA 3VUOA 1RMU3 2IFWA 2TNFA 5LRRA 3X29B 1HQLA 1ZBA2 2XPJA 1O3TA 1ULCA 2V5YA 2QDRA 2G9GA 2EXHA 1MQTA 3ZFFC 5T52A 2HEVF 1OQEA 1DQ5A 1LTEA 4QM8A 3VHOA 1SCRA 3PJQA 2MNGA 3SCGA 4Y1YA 2GNBA 2D6LX 2E9QA 2XGXA 5J7MA 4H7MA 1Y7BA 3AKRA 4HN1A 4KWKA 1O3RA 3HR9A 3Q9OA 1COV3 1UU4A 2WJSA 2HYKA 2Z79A 1H4GA 2ET1A 2ZGPA 4FP2A 1LB2A 4AQTA 5K7PA 1WLWA 4HT1T 1RMU2 2TUNA 1W6NA 2ZABA 1QQP3 1RMU1 4AQ6A 1Y9QA 1WW7A 3VV1A 1FNZA 5BNPB 4R4XA 4XFHA 3QOPA 1G6NA 3C3VA 3NL1A 5I0TA 2OIIA 5T54A 1RINA 1WLDA 1RUC2 1WLCA 1XE7A 2IFRA 1W0PA 2Q30A 3GALA 1SLBA 2VOVA 1PHMA 1UZZA 1Q43A 5C6CA 2CAVA 3A0NA 1H2LA 1BZWA 4FVVA 4P9XA 5JWPA 1EPZA 3ASIA 4KU7A 3TNPB 4FPOB 1NA1C 1VBA1 1V6MA 1COV1 2ZHNA 2PLV2 5C8CC 3R4DB 1AR73 2WWSA 2P34A 3SNMA 1RUJ3 2XJVA 4OHZA 1NCQC 1QQP2 3CO2A 3WP4A 2E53A 4AWDA 1XYPA 1ZZ8A 1VAVA 4H3WA 5JSRA 4BMBA 2QCSB 2A3XA 3VBSB 1UX6A 2CGPA 4BPZA 4CP2A 4WZFA 4Q27A 2D40A 2VQAA 3AB0A 4BHPA 2EAKA 4Y20B 2DVGA 2D7FA 2B5HA 2R32A 3ST7A 4JGYC 1YO8A 1Z7S2 5LEJA 2HWC3 1CAXA 3ZFEC 2HWB3 4K3UA 2W0XA 1JXNA 1PO22 5FLIA 4AEDC 1J59A 1PK6A 2UWBA 4ZU7A 1S0CA 4BYYA 4HKLA 1AR71 4XBNA 3LA2A 1EYBA 1VRH2 1RUJ1 5FLJA 5BPXA 5I0RA 4WM8A 2K0GA 1HRI3 3VL8A 2ZGNA 1N3PA 2CAUA 2ZKNA 1FYUA 1CR7A 2GH8A 2D5FA 2DV9A 1MR5A 1Y43B 3RJ2X 2K2SA 2KXLA 2HWB2 2HWC1 1ND2C 5B2GB 1DQ1A 1AR93 4I2OA 5CBLA 4HSLA 1SMVA 4RQPC 1HKDA 1QY4A 1ULGA 3FBYA 1DQ6A 1POV3 2VOKA 4ONUA 5AFBA 5DDJ3 5FREA 4HK9A 5H9QA 1HRI2 1MEC3 3E97A 4FQ4A 4BIFA 5JIUA 2ZOEB 1PZ8A 2ZX2A 4QPIB 1O5LA 2FMYA 1Q8QA 2BWCA 1VBC3 3ECQA 3OYWA 1LCLA 2ZCWA 1LEMA 4GWNA 5T5OA 3ILNA 4FT8A 2ZX4A 4Q4Y3 2W52A 4L9BA 1AR91 3VBUA 2JE7A 1RIRA 3IPVB 5F1RA 2YXSA 4D3WA 3MZHA 3BOWA 5SV5A 2XJSA 2PA7A 1ULEA 2D6MA 1POV1 3FLPA 4BA6A 4NO4A 5DDJ1 4L97A 2VW1A 4IEYA 1D4M3 1MEC1 4XMIA 1PZ9A 4LBKA 3ZYJB 5A3LA 4D69A 2HWF2 1YHFA 3JB8A 3USSA 3WINE 3SXWA 4N43A 2VVEA 3TN93 1RUI3 1VBC1 3D0JA 1PVC3 4QHBA 4Q4Y2 1QNWA 1D0HA 2D43A 4B4QA 3AYCA 1QH6A 4Q4Y1 4EJRA 4DRRA 1QOTA 4IEWA 4IEXA 1ZBE3 4KWLA 1ASJ3 4FPHA 2PHTA 1M06G 4P9WA 5IUQA 1RUOA 1Z0HA 1ND3A 1QDOA 4CDXA 3B02A 4GXLA 2EVXA 3WQ7A 1RB8G 2BTVC 1DDLA 1ENQA 1RHI3 2V73A 4OUMA 3T2TA 1D4M1 4M00A 4XXPA 1Q3EA 4RR3B 3SLIA 3D0SA 4GB33 1WA4A 3VL9A 1FPN2 1OQDA 3TN92 2PHLA 2DVBA 3L2YA 2ZBJA 5LK7B 3TN91 1RUI1 1PNGA 1PVC1 3RWNA 3CEWA 4AVSA 3ZMOA 4KL1A 1JTZX 3NV1A 3LAGA 5C4WB 3WCSA 4A2UA 5DUXA 4PDWB 1KD7A 1ZBE2 2WNUB 1ASJ2 1N47A 2X5IB 3PVBB 3WCRA 1ZBE1 2R49A 4AFAA 1CVNA 4XQ4A 1DHKB 3DGTA 3CU7A 3MGUA 4KG8A 2NZ9A 4UW5A 1CJDA 2WZR2 4TSVA 1NY71 4BCUA 2RS12 4DOUA 1O91A 1BKZA 1RHI1 3ZN6A 4Y1XA 1BMV1 2QJVA 2ZGKA 1KRIA 1OQ1A 1C1LA 1JBCA 1CX4A 1OPMA 1WBFA 2LUWA 4GB31 1Q56A 1RUD3 4NHKA 5J3UA 5ABJC 4OHWA 3SH5A 4XYXA 4QQLA 3WLUA 2FZ1A 2VGDA 4KG0A 2ZGRA 1AUYA 1U0AA 2Q1MA 5CFCA 2DF7A 3FX3A 2FZ2A 4SLIA 3U11A 3VBFC 1R082 1VBD2 3DPRC 4CZSA 3I4IA 1VB4A 4I3GA 4E4DX 3KGZA 5JZGA 1C1FA 3NVCA 1JYCA 4CYDA 4UW4A 3E6BA 1DFQA 1LHNA 1OPOA 1W0OA 2B7YA 4HLTA 2OUJA 4NOTA 4MGIE 4YFWA 2ARBA 2LALA 1DU3D 2XLFA 3H3UA 1HIXA 1TME2 4UXAA 3RNSA 1RUD1 2GMPA 1S0GA 3KM5A 4RGGA 4J1XA 4E27A 2B39A 2OZ6A 5A33A 1Q8VA 5GZDA 5J48A 1AXZA 4LULA 2TBVA 4IEZA 3MYXA 4YZ5A 3JZVA 1O3QA 3B01A 2VW2A 3JU9A 1KDMA 4IV3C 1AVBA 2ZGMA 4YG0A 3H0OA 5BNNC 1DZQA 1TMF2 3ZSJA 2ZGQA 3MW3A 3MPBA 1GQGA 1GZ9A 1LODA 4FPLA 2AREA 2GMEA 2HWE3 2QNKA 4LUKA 4N53A 4OHVA 1LOEA 1S0EA 1OFSA 2B9UA 2CWSA 4PJYA 4YVWB 1MS1A 4RS5C 3VKOA 3LGRA 1LENA 2H0VA 4P9LA 4RHV2 1Q5OA 3E6CC 1HQNA 1NCRC 4M0NA 1GZWA 2HEWF 5EYYA 1ZX5A 4ZU5A 2RM21 4G3YC 4JGZC 4Z2WA 1BBT3 2MEV1 4IV1B 4QGLA 3ZX7A 4FTBA 1QJY2 3ZFFA 5FDBA 4TZDA 3H1WA 3WDVA 1MVEA 1WMFA 3M7AA 2Y0OA 3JD72 5CNAA 1CPMA 4YW4A 1RVF2 4BMEA 4GWMA 4YZ3A 3B9CA 1VAKA 3OBTA 2W68A 4U2AA 2RS53 2HWE2 4M3CB 5CB7A 1N1YA 2F4PA 2HWE1 4XJUA 5KHHA 5C9AC 1KS5A 4LBQD 2IC1A 5L36A 1DGWX 4COWA 2RMU3 2PHFA 4QGNA 3SCHA 3KT4A 1LJ7A 1N3OA 1V6OA 2CV6A 3UL2A 1FI2A 4HVRA 1BBT1 3AYEA 4XBLA 4OUSA 3VDDB 1X36A 4BE3A 5KXEA 3TBDA 5CFDB 1I3HA 1JH5A 2VH9A 3DL3A 5H9SA 3KT1A 2QZ3A 3VLBB 1Y3TA 1ZRCA 2NLRA 4MZUA 2JG9B 2XKPA 1EPWA 3FE5A 2QZ2A 2QDNA 3AFGA 1NA1A 3POYA 1CAWB 4K21A 2ZTNA 1JN2P 1WW4A 4YM3A 5C8CA 2RS51 1VBE3 4P9JA 2XBO2 4NWWA 1C5IA 2PAEA 3PVOA 2D97A 4AGGA 2HWD2 3J8F2 1NCQA 1CONA 4L8QA 3WUCA 2E51A 2OZJA 4ES8A 1AZDA 1C5HA 2GNTA 1MS9A 2RMU1 3RI8A 2A73B 1OOPB 4XHBA 4ATEA 1XE8A 2WL1A 1H9PA 1QH7A 5BXXA 4AEKA 4JGYA 3VZOA 1FNYA 1QJU3 1R092 3KT7A 3MW4A 4QPGB 3I2DA 2ZGLA 2ARXA 3CJXA 2GN7A 4XDQA 2YUEA 3ZFEA 2JE9A 5DG2A 4E2GA 3WD5A 5FQ0B 4AEDA 3NV3A 3MEPA 3AZVA 1CAVA 1VBE2 1I9RA 4BH9A 4C1WA 4ES9A 4MXWA 1APNA 1VBE1 3ALQA 2GC1A 4CDQC 4AFMA 4C0BA 3E5UA 4FSJA 1AJKA 3I7DA 4KH9A 1MZ6A 5JOYA 1PVXA 1S0BA 2BGCA 2DFBA 1HXS2 3PTYA 1UW8A 4NPRA 4XETA 3OD4A 1SLAA 1Z78A 4K1YA 1VJ2A 3JUUA 4CEYC 4X6RB 1S0JA 1JHNA 1MS3A 3WR0A 4CDWC 1WMEA 1CGPA 1AR63 5ACA3 5LK5A 2D98A 1QJU1 5T5LA 1W6OB 1I6XA 4JTOA 1ND2A 3W59A 2GU9A 5E16A 2WFF3 4XTMA 4RQPA 2IXLA 1FMD3 2VVDA 1O7FA 1UKRA 5AFEA 2IZWA 1S0DA 1ULDA 2A6WA 4EWAA 1MQTB 2A6YA 4UBHA 3AK0A 1ALYA 1J58A 3E6DA 1CQ9A 1GANA 2NMNA 5JOZA 3RRDA 5CVRA 3MF9A 1XYNA 4MLOA 2G9FA 4OHXA 3WT3A 4GIQA 1OA3A 2AENA 5ACA2 1JYIA 3NV4A 4XILA 1MS5A 1AR61 5ACA1 1MS4A 1V6NA 5CADA 1RJ8A 3VN4A 2WLQA 1YFXA 3UJQA 1W6NB 2R073 3K48A 1ZYBA 2EXKA 2WFF1 5CA6A 1XNBA 2UU8A 1FMD1 4CDUC 1G7YA 3IDBB 1T6GC 4Q0PA 2JEMA 3UV9A 3M4FA 3U4XA 3H8UA 3V64A 4AYUA 1A3KA 1H2MA 4COVA 4HPKA 4JDMA 4LTAA 4K40A 5EV7A 1HRV2 2VMHA 1PO13 1LHWA 3MIEA 3VHPA 2AR6A 1QNYA 4HFSA 3NWKA 2DYCA 2Q5TA 3LSEA 1UN1A 3URFA 4QXKA 3WHTA 3ZXJA 2AZ5A 5GKAC 1B09A 2P17A 4Q2FA 1KS4A 4AEMA 4U36A 5I91A 1YI9A 2R071 5BYNA 1QXPA 4FTSA 4AXOA 2A5ZA 3OY8A 5FO8B 3AZXA 2UURA 3CF6E 2Z5WA 4FOYA 4AI2A 2IXIA 4QM9A 4BOWA 4XJWA 1XNCA 2E63A 2RR12 4CP0A 3IDEA 5GM0A 2H6CA 4TLFA 1CAXB 4YM2A 1AF9A 5J96B 4Q4W2 1PO11 1ZBA3 1O4TA 4B7EA 3N35A 1PK6B 4Y26A 1A78A 5I8YA 1LHVA 1DGLA 5KBFA 4LBMA 2UWCA 4AI3A 4IEUA 3G7DA 3H1YA 5L73A 4XFFA 2GH2A 4CRQA 3GYDA 4LBOA 2QKDA 4DPNA 4WM8B 5JPNB 4DZGA 2VUJA 1V9U2 1W6MA 1HX6A 5HCAA 2XJUA 3VZJA 4FTEA 4YM0A 3VKMA 4N7UA 4YLZA 4YM1A 1AHSA 1UF2C 1X50A 4JDNA 1I1EA 1IZ3A 2WS92 5L7OB 3GBFA 4YW3A 4MSVA 4R4ZA 2A3WA 4ITCA 3AKQA 2ZHKA 2GC0A 1ZBA1 3HAGA 1DQ4A 1RUC3 2A6XA 2ZX3A 4FPEA 4H7LA 5ABJA 3GZUC 2WT2A 3E5XA 5FRAA 1GICA 2XUMA 4H14A 2RE9A 1OA4A 3FJSA 1XXNA 1GFF2 3VBHC 1SFYA 1VALA 3QACA 3VBFA 1FOD2 1CN1A 2DCKA 1RITA 3DPRA 3HQXA 2PLV3 2VMIA 1QJX2 5GLVA 4CEWC 3O0VA 2X29A 2V09A 3OYWB 3IDCB 4A7YA 1AL23 3WVJA 1ZM1A 1ZNPA 2P3KA 1PGL2 4IEPA 5DXDA 1J3QA 1FV3A 1SLTA 3M3CA 4OLLA 3VBUB 3N7MA 2GAUA 1Q8SA 1RUC1 4NVPA 2OW4A 3MIFA 1Z7S3 3NAPC 4C0HA 4RGAA 4M3CF 1S1AA 1C8M3 4FP3A 1IS5A 3J26N 1PO23 1ZZ7A 3WZ1A 4XFAA 4E4SA 1EAH2 4IV3A 3TYJA 5BNNA 1UD1A 2PLV1 3PMEA 3KS7A 3EJKA 3EBRA 5KC6A 1GNHA 2PHRA 3DKWA 1AL22 1OA2A 3KQRA 4N43B 1OSGA 4MH0E 4LBQA 3WDTA 1VRH3 4I01A 3WHUA 1SDWA 3RMYA 3THPA 4RS5A 1QQP1 4XFIA 4WVMA 3B5LB 2R16A 1AL0G 1NCRA 1ZA4A 3ZXAC 2Z2SB 2XLAA 4EROA 3ZIWA 3VGIA 5DG1A 4JGZA 4QQPA 2WFPA 2A6ZA 4XF4A 4YFZA 1ND3B 3PNAA 4CDXB 1Z7S1 5DZEA 1C8M2 1H9WA 4PF5A 4O9EA 4AHXA 1SCSA 1PO21 4I30A 3JQXA 4YGEA 3LKJA 4GH4B 4YZ4A 3IN9A 3VZKA 2JECA 1LR5A 1PGSA 3I8TA 4P9GA 1UU5A 4KNCA 4GKXA 1A8MA 2CL2A 1YI7A 5C9AA 2ZHLA 1VRH1 4A3XA 3GZAA 4N7IA 3FBMA 5JI7A 4EN9B 1WBLA 2A71A 5FOBB 2C0ZA 2XB6C 5FCCA 2PFWA 3HN1A 3ZXFA 5C8WA 5GLZA 3RG0A 3WW4A 1O4YA 3KCCA 3GBWA 3VBOC 5LEKA 3G6JB 4XIOA 1YNAA 2HWB1 5T50A 3WW1A 2QE3A 3ZN6B 3I54A 1G9BA 1F9KA 1N1TA 1DF0A 2P3JA 4KGGA 2B45X 2KA3A 3MLLA 3PVNA 4J1WA 1AYN2 4L92A 1MZFA 2NM1A 4QT6A 4WV8A 1HRI1 3QH7A 5CFCB 4URTA 5D8AC 4R8HA 3VBRC 4E2QA 2HWF3 2GDFA 3S6PA 1A6CA 4R9AA 5JZGB 1FT9A 1YUDA 3AP6A 2DVFA 4SBVA 3N36A 1EY2A 1KITA 3D6EA 5FMOL 1UAIA 3WXPA 1VP6A 4S2GA 1PZ7A 1QOSA 2BYVE 1NXD1 2EIGA 4PCRA 4N9HA 3LCPA 2RJKA 3CLPA 1AYM2 1R1A2 2TEPA 3D5OA 4XF1A 3GNEA 4ZU4A 3AP4A 3S30A 2VPVA 3EQEA 2PAMA 2DVDA 5A33B 5H9RA 4CDQA 5H9PA 1RUG2 1ZZBA 2FQPA 1EV12 4WM7C 3AYAA 5FFOC 4QD2A 2HWF1 1FPN3 3FMGA 4CEYA 2XVKA 4IESA 1U5XA 4CDWA 4D7TA 2WNVC 4N53B 1H8TC 5KC5A 5TSWA 2YGLA 4AF9A 1GKBA 1XRUA 3B3QE 2R1BA 1NOVA 3ZXLA 2DVAA 3R4UA 4HN0A 4L2NA 3ZN5A 2ERFA 1GZWB 3ILRA 1AX2A 1G8WA 1NXMA 4K20A 2ZMNA 5EXOA 2VOXA 4Y5Z0 3WDUA 3ZFGC 3R4SA 1X8MA 3ZFFB 5E8AA 3VKLA 2WZR3 4WZCA 4PLMA 5F9TA 3SMHA 2PHDA 1BCXA 2ZGTA 1LOAA 2RS13 3GHNA 2MHFA 3MDPA 4NR1A 1DYPA 3HIFA 1KQRA 4AVTA 2N7GA 1D4VB 3KCYA 4Y20A 2QUOA 1K5MC 1FPN1 3R0RA 3TRSB 4QX5A 4TWTA 1AR82 1QKQA 2ZMLA 3RSJA 1CESA 3NKTA 5DUUA 3KB5A 1R083 1VBD3 5BNOC 2A70A 1ASJ1 2PYTA 4OHYA 3ZIXA 3AMMA 2XJQA 5J98B 4BM8A 4HK8A 5A3MA 4CDUA 1AX1A 2C1FA 3HD8B 5EZWA 1IPKA 5CAZA 3FWEA 2WZR1 1U12A 2PELA 3C2UA 1DBNA 1RTVA 2RS11 4W6WA 4DMIA 4XTPA 5HBAA 4Z1VA 5GZCA 3U0ZA 1SBEA 5FLHA 1TME3 3VZMA 1C4RA 1IPJA 1NA1B 2JG8C 1RUE2 1L3JA 5C8CB 1UIJA 1JW6A 4INDA 2A75A 3CJIC 4XF3A 5I8TA 2CYFA 4YW5A 4AHYA 3ELNA 4R9CA 1NCQB 4COZA 1R081 1C57A 1VBD1 2O8OA 4AGVA 1B35C 3FUOA 4LO7A 4AQ2A 2YGMA 3WDXA 1J1TA 1TMF3 3FC0A 2CNAA 4FO9A 3L9JT 3OJBA 4XF0A 4JGYB 4LA3A 3HBZA 4NN0A 4RHV3 3WX5A 3TWIA 4AVVA 4AFCA 2R063 2GN3A 4AG4A 4UW6A