4N53C

Human enterovirus 71 uncoating intermediate captured at atomic resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRSGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMQLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Human enterovirus 71 uncoating captured at atomic resolution.
pubmed doi rcsb
molecule tags Virus
total genus 38
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n53C00
3VBOA 4GMP1 2HWB1 2MEV3 2WLPA 3JBG3 2BBVA 4CEYA 4GB32 1SMVA 1RUI2 4QPIC 4Z92B 1AR83 1QJZA 5K0UA 1PO21 1AR73 4RHV2 1RVF1 1HX6A 3J8F1 4EJRA 1RUC1 1BBT3 5BNOA 3ZFFC 1R083 1D4M2 2WS91 5C4WB 2PLV3 2R071 1HXS3 1RB8G 1VRH1 1TMF2 1BEV2 1NCRA 1Z7S2 2RS53 4CDWA 2RMU3 2R063 4WM8A 5L7OB 4IV3A 2VQ0A 1RMU3 3CJIB 4CDXC 2HWE1 3VBHB 4Q4V1 1HRI3 1TME3 2Y26A 3JBG2 4QPIA 1ND2C 4AEDB 4LLFA 2R041 3VBUB 1AR82 1MEC1 1VBB2 5FMOS 1AR72 1PVC3 1AR62 2RM21 5C8CC 1COV1 3VBFB 1B35C 5BNPB 1R093 4QPGB 1AYM1 3ZFFA 4RQPB 1VBD1 1HQNA 1RUJ1 5DDJ1 4YVWB 4RS5B 1C8M3 5D8AB 1HXS2 2RS13 5CFCB 1ND3C 1H8TC 1MQTC 1QJY1 1V9U3 5J96B 2RS52 2RMU2 2RS31 2R062 3ZFGB 1RUD1 4CDXA 4Q4X3 1F2NA 1FMD1 4CDQC 3JD73 4NWWA 2BFUS 1HRI2 4N53C 4GH4C 3VBRC 1ND2A 1NA1B 1VBE1 1FOD2 5ABJB 1EAH1 1NG0A 4BCUA 2RR11 2ZTNA 4IV1B 4JGYC 2ZZQA 1EV13 5AC91 3HAGA 1PVC2 5C8CA 5C9AC 4RHV3 1B35A 4Q4Y1 3VBSA 1R092 4WM7B 1VB4A 1PIV1 4GB31 1RUI1 1D4M3 1QJU1 1C8M2 1POV1 1ND3A 2RS12 1OOPC 1RHI3 1H8TA 5ACA2 1PO11 1MQTA 1AR93 1RUE3 4PDWC 2HWF3 1ZBE1 1ASJ2 5A32B 4Q4X2 4CDQA 4N53A 4GH4A 1X33A 3VBRA 5J98B 4CEWC 1A6CA 4JGYA 5L7OC 1NCQC 1QJX1 3CJIC 1VBB3 1R1A2 3VBHC 5C9AA 1EV12 3VDDB 1AR63 1PGW2 2TBVA 3IDEA 4CDUB 1BMV2 2MEV1 3JBG1 3VBUC 1CJDA 4FTEA 4YVSB 1AYN3 1M06G 1OOPA 3VBFC 1RHI2 4QPGC 4PDWA 4RR3B 1AR92 1RUF2 1RUE2 1RUG2 4RQPC 3DPRB 2WS93 2HWF2 2WWSA 3ZFEC 1F8VA 2R073 3TN92 1BBT1 1VRH3 1R081 4YVWC 1FPN3 2BPA2 5CFCC 2PLV1 4CEWA 2DF7A 1RUH2 3LOBA 1VBA3 2WZR3 2XBO2 1FOD3 5L7OA 1NCQA 3ZFGC 2HWE3 3CJIA 4CDWB 4WM8B 3VBHA 2GH8A 4IV3B 2HWB2 1AL21 1WCDJ 3JB8A 1RMU1 1PGL1 1NA1C 1TME1 5ABJC 2QQPA 3VBUA 1MEC3 4QPIB 5FMOL 2RM23 5BNNB 4Q4W1 1RVF2 1E57A 3VBFA 1AYN2 2HWD1 4QPGA 2WFF3 1AYM3 4JGZB 4FTSA 4RQPA 5ACA3 4WM7C 5CFDB 3ZFEA 1RUJ3 5DDJ3 2WS92 3ZFFB 2R072 4YVWA 1VRH2 1ASJ3 1FPN2 5CFCA 2FZ1A 1C8M1 2RS33 4N43B 1RUD3 1VBA2 2WZR2 1X36A 3ZFGA 2IZWA 1V9U1 2HWE2 1NY71 2BFUL 1K5MB 3M8LA 4Q4V2 1R1A3 4Q4X1 5LK7B 1NA1A 1EAH3 5ABJA 3JD71 2R042 2BUKA 2RR13 2X5IB 1HRV3 1MEC2 1VBC3 1GFF2 4NWVA 2RM22 1COV2 1EV11 4CDUC 5C8CB 1ZBA3 3S6PA 1VAKA 1AYM2 2WFF2 4RHV1 4WM7A 1QQP3 3NAPB 3VBSB 1RUF3 1RUG3 1RUJ2 1QJU3 5DDJ2 3TN93 4YVSC 1D4M1 5C4WC 5JZGB 1QJY2 4RR3C 1H8TB 2HWC3 1RHI1 1RUH3 2RS32 3DPRC 1TMF1 1BEV1 1RUD2 1ZBE3 2XBO3 5A33B 1Z7S1 1FMD2 5A32A 5FOJB 4GMP3 2HWB3 4GH4B 3ZXAC 1EAH2 3VBOB 2RR12 1QJX3 1HRV2 4AEDC 4GMP0 1PO23 1VBC2 4CEYB 5AC92 1AR81 1RVF3 4CDUA 5K0UB 5C9AB 1VBB1 3J8F3 4Q4Y2 1AR71 1RUC3 4JGYB 1AR61 1ZBA2 1PIV2 1QQP2 5BNPC 3VDDA 1QJU2 5BNNC 4YVSA 5BNOB 5C4WA 1PO12 4RS5C 4RR3A 5D8AC 1OOPB 1AYN1 4JGZC 3DPRA 5CFDC 1HXS1 4PDWB 2HWC2 1NCRB 1ZBE2 2ZAHA 1DDLA 2RS51 4Q4V3 2RMU1 2R061 1FPN1 4CEWB 4N43C 2R043 1HRI1 4AEDA 1QJX2 1VBA1 2WZR1 1AL23 1K5MC 1FOD1 1NCQB 1PO22 4SBVA 4IV1C 4Y5Z0 1W39A 1COV3 3J8F2 2X5IC 2MEV2 1RUC2 1PVC1 5BNPA 3FBMA 1VBD3 4Q4W3 5BNNA 2XPJA 1R091 2HWD3 4Y4YA 4RS5A 5D8AA 4JGZA 5CFDA 3NAPC 1QJY3 2WFF1 3VBSC 2RS11 1BBT2 5ACA1 1R082 3ZFEB 1OPOA 1FMD3 2PLV2 5JZGC 4CDXB 1ASJ1 1VBE3 4N43A 1C8NA 1OHFA 1K5MA 1ND2B 4IV1A 4FSJA 1AL22 5AC93 1RMU2 1PGL2 1AL0G 1TME2 2FZ2A 3VDDC 2X5IA 3VBOC 1R1A1 4Q4Y3 1PIV3 4GB33 1PGW1 1B35B 5GKAC 1RUI3 1VBD2 1BMV1 1HRV1 1IHMA 2GSYA 4Q4W2 4CEYC 1VBC1 5K0UC 2HWD2 1POV3 1PO13 3NAPA 1NOVA 1ZBA1 1ND3B 3JB4C 4FTBA 1QQP1 1MQTB 1POV0 1AR91 4RFT0 1RUF1 1RUE1 1RUG1 5BNOC 2HWF1 5JZGA 1AUYA 3TN91 4CDQB 1TMF3 1VB2A 1BEV3 4N53B 1VBE2 1Z7S3 5A33A 3VBRB 1NCRC 1V9U2 1NY72 2HWC1 1RUH1 2XBO1 4CDWC 4WM8C 1CD3G 3JD72 4IV3C
chains in the Genus database with same CATH superfamily
1CJPA 5JI9A 2VXRA 2KA3A 1CAXA 2HWB1 2HYKA 2VUAA 2ZCWA 5L19A 2MEV3 1IS4A 1GZTA 2BBVA 3WF4A 4GB32 1UY0A 1SMVA 3VHNA 3GJAA 3JCIA 4YW1A 3SH4A 4AK3A 1QJZA 5FLIA 3UKVA 2YU2A 2W68A 2NMOA 4LO5B 1XNBA 1AR73 4QXHA 1JUHA 4RYDA 1AHSA 4NRPA 4LBLA 1APNA 2R16A 3OCPA 3CLPA 2IXLA 4AW7A 4EJRA 4GWMA 1YHFA 3RI9A 3SCGA 1RUC1 1XYNA 1NE4A 4CSWA 4ES9A 4HVQA 3AMPA 5BNOA 3OB8A 2NPIA 2OA2A 2YUEA 5HPOA 1VJ2A 3THPA 4CTEA 2W3JA 2Y34A 4DPNA 5CKNA 2D6OX 1I5PA 2X10A 2PLV3 1PMIA 1IG3A 2QDNA 2XDVA 2ZAAA 4ZONA 1BEV2 3OGSA 3RJ2X 1ZRDA 1Z7S2 3LQCA 4IERA 1DYOA 3OYWA 4UFJA 4IE4A 3OSDA 3O1TA 4BQ4A 4HPKB 4YZ3A 5EYXA 3CBNA 3OY8A 4WM8A 3VKNA 2Y38A 5L7OB 1Q3EA 2VZTA 3FLPA 4YM3A 3N7KA 1RMU3 1QGLA 3WW1A 4FI9A 5FZBA 3TEWA 3URFA 3VBHB 1HRI3 2QQJA 3MFCA 1XOYA 4XETA 2UWCA 3LZZA 5F3CA 4D6RA 4JDNA 5FV3A 3HT2A 1ND2C 4W6YA 5A3WA 3UJOA 4AEDB 1HV1A 3NQHA 2H0BA 2JG8A 3I54A 3P6BA 3AKRA 4GQ7A 4L9BA 4CXYA 1AR82 1F15A 2HH9A 4ZXKA 1VBB2 2EF6A 3NRUA 2V72A 4KH9A 4HZFA 4KQ7A 5LK5A 5A3TA 2XG3A 3WVJA 5C8CC 1Y43B 1B35C 2J1EA 2FDGA 1R1ZA 4BB3A 2PQSA 1ZZ8A 4GWIA 1F4HA 3ZX7A 1OA3A 1W6OA 2GC0A 3HD8B 1WZXA 5FY7A 1HQNA 5A3UA 5FWJA 5C71A 1RUJ1 2ZMKA 1V6IA 2Y0OA 4OLLA 4RS5B 1HB1A 4JC1A 1MACA 4P14A 1HXS2 5D8AB 4XJUA 4BQ3A 1KRIA 4Q29A 4XXAA 2B5HA 5FZ3A 5CFCB 1ND3C 2YBPA 5FZ8A 4MX3A 3SEEA 4AE2A 2VU9A 3N9MA 1C1LA 3POEA 4XFBA 4GZ9A 3GCWA 1TZOA 2GNBA 5FFOC 4KWKA 4OQ9A 4PQQA 5DAXA 3J26N 2R062 4CXWA 2BU9A 4BWOA 2YFUA 3FHAA 1AJKA 4CDQC 2VVDA 2BFUS 2A3YA 4GWJA 5LCWL 4CU8A 3AP7A 3GZEA 2QDRA 2WINB 5FRAA 1QDCA 2XJSA 5FZOB 1L7LA 2PHUA 5CAZA 2BNMA 4AQ2A 2GH2A 2RR11 1MVEA 2QQOA 1YRZA 1UF2C 3RWKX 2ZTNA 1JZ8A 2P4EA 2HLEA 2KXLA 2ZHNA 3SITA 1LCLA 3ORJA 1W6QB 4X8NA 3RRDA 4LORA 4AI8A 2Q1ZB 2VVFA 1UL9A 1BVP1 2YROA 1QNWA 5FPZA 3W20A 4X8PA 2D6PA 4F3JA 5C3RA 3RVHA 3H3LA 2Q30A 2W52A 2XVKA 4QXBA 1BKZA 5C3PA 4C0HA 3CZUA 1BYHA 4WZCA 1ULPA 4WM7B 5GZGA 4OVEA 2Y60A 5KHIA 3L2YA 3MIDA 5IYYA 1KEXA 3KV9A 5LBBA 1LR5A 4A3ZA 3H1YA 3AFKA 1PGSA 4UAPA 3KF5A 4LTAA 3WZ1A 1YIPA 1MZFA 2RS12 2VTXA 5LZ6A 4IGOA 5ACA2 4XPVA 1MS4A 4FVVA 3I2IA 4QX0A 4PDWC 2BERA 1G9BA 1ZNPA 1LAJA 3O0VA 3WV6A 4CCMA 3QH7A 5F32A 1LHOA 1S0GA 1ZBE1 4LA3A 4Q4X2 3E97A 2I74A 4GH4A 4QGNA 4XAAA 5FXWA 5HXVA 4QHBA 4KL1A 3AYEA 3FLRA 4YZ4A 5J98B 1OFNA 3K51A 1OXCA 3ZXEA 4E4DX 2ZX3A 4CEWC 1DLCA 3MICA 2GP5A 4AF9A 3WNMA 1XNDA 1WLCA 3DKWA 3DKQA 3VD3A 3MIGA 3OEAA 4K9SA 4LO8A 2C6SA 1V00A 2WN2A 3BPZA 1GANA 2CWMA 5C9AA 2TBVA 3IDEA 4CDUB 2BNOA 2OPWA 4TTGA 2ZGLA 4XZPA 1ZVFA 1YQCA 2J1TA 5KR7A 3V0BA 3KHCA 1J59A 2J1SA 3KT4A 4FP2A 3JBG1 4XIKA 1OQDA 3VBUC 3K75B 2B9UA 2CDOA 2TNFA 4LEJA 1CX1A 1H2NA 1W2AX 5FBZA 2AUYA 4HG6B 4J6GA 1H9WA 5FAXA 3UGGA 4HONA 5L36A 2JDAA 4FTEA 1M06G 1OOPA 1ZRRA 4JQRA 1WD3A 3VBFC 3OG2A 3TNPB 1UYZA 4Q0PA 4QPGC 4AGGA 1GP4A 4RGKA 1J3RA 3NV3A 1MS9A 1RUF2 1RUE2 3U07A 3ZFEC 3WF1A 3VZJA 1BBT1 4RL7A 1UPSA 3ZYHA 4ZXEA 3A23A 4QPWA 5GZCA 2BPA2 3U37A 4A44A 1JXNA 3DXUA 5J3UA 3ZXJA 2ZZJA 1RUH2 1W99A 1VBA3 2AEZA 4B7KA 1JH5A 4EN9B 2E63A 2ET1A 5L7OA 5A1LA 3ZFGC 2YHJA 1W3VA 1PM4A 4CCCA 3VBHA 5J7MA 2DCYA 3IBMA 5L9VA 1L3JA 1JYCA 1SFPA 1WCDJ 3JB8A 1PNGA 1A8DA 5F3IA 3GHMA 4KWUA 3MO4A 4PQ9A 2W08A 3RZZA 2EA7A 1LOFC 3ON7A 1EP0A 5FZ1A 5ABJC 2TEPA 3J9SA 3WW2A 4CUGA 3K3OA 4AAPA 1CN1A 1XNCA 4AVAA 3E5UA 4Q4W1 5BNNB 1OQ1A 3TEXA 3LGRA 1ZZ9A 4HK9A 3MFAA 3LCPA 5HV0A 1UZWA 4Y1VA 5JXIA 2HWD1 4QDRA 1NYWA 4A7ZA 3C3VA 3KQRA 2D5FA 4LO6B 3OBTA 1RUJ3 4INDA 1A8MA 2GNMA 3H3UA 3PMSA 4JX0A 5DAWA 3ZFFB 1GLHA 4UFHA 4JDMA 1IGOA 2SBAA 5CFCA 1FNZA 2VAUA 4H7LA 2VW0A 3PVBB 1BJQA 3ZYGA 2H6CA 5T52A 1H6YA 2EVXA 2WDBA 4TYSA 3EB7A 3I3EA 2VMDA 4FPCA 5A7OA 3T2PA 2WNVB 5FUNA 3RQ0A 3NNMA 3BPSA 2A6XA 3M8LA 1UY2A 2J1VA 4UXAA 5F2SA 4XILA 3VGIA 1PX4A 2A6VA 5JCTA 2WA4A 4Y1YA 5FZOA 2Y6KA 3AMNA 2RR13 3J4UH 5FY1A 1HRV3 3ACIA 2LTNA 1UU5A 1AF9A 3IPVB 1GFF2 2IXHA 3I7DA 4OI2A 2P37A 4YW7A 3CIHA 4NIAA 2FD8A 4M3CB 2PHRA 2JEMA 3I2DA 4DUVA 5FYSA 3BI3A 1O3RA 3BIWE 1EV11 1X7NA 2WQ4A 4UF0B 3WP3A 1U5ZA 2VZ1A 3Q8EA 1AYM2 3O1MA 4WM7A 2KR2A 3O1VA 1PZ8A 1IQDC 5DG1A 3K46A 4XMIA 4W8JA 2Z2SB 5DZFA 4Q1RA 3M4FA 4J1WA 1LOEA 3GZTB 5JOZA 1DZTA 5JOWA 4YVSC 1CIYA 3WXPA 1HN1A 2EIEA 3JXSA 3NJVA 3WG3A 4EWEA 1LOBA 2XJRA 2HWC3 4H3WA 3WR0A 2VMGA 2RS32 4HN0A 1GZWB 1BEV1 2NYYA 1RUD2 1ZBE3 4FO9A 4NVPA 5A33B 1Z7S1 2GMPA 4HKLA 4P9YA 2F17A 4L92A 3ZDVA 4BQXA 2QTWB 5SV5A 4GMP3 4I2OA 1UWWA 4LOSA 2RDRA 1JI6A 1EAH2 2BDRA 2PA7A 2AC1A 3RG0A 1GICA 5FIXA 5FZ0A 4HSJA 5IWFA 4BDVB 3RSJA 3WT3A 2D98A 4AEDC 4OCTA 1MVQA 1QXRA 3I2KA 5FZGA 5CZKA 1CAWB 1AR81 1IQAA 1RVF3 3WG2A 2VBBA 2VNRA 3R05A 1VBB1 3J8F3 3VLBB 1C1FA 2QNKA 4K6BA 4LE4A 4MGIE 3ILNA 5FYVA 2ADEA 1ZBA2 5FYZA 1FT9A 1PIV2 3MW2A 5DAQA 2XJQA 3HMYA 1C3HA 3RPQA 5FY9A 1O8SA 2VCMA 4B4RA 2G1MA 3ZSJA 1QJU2 2JXAA 1WW5A 3DECA 3E6DA 3OD4A 4NIHA 1CZTA 3VD5A 5FXVA 4DO0A 3D4KA 1GWLA 4CU6A 2ZKLA 3AFGA 4RS5C 2JE8A 5D8AC 4QQOA 1DU3D 4MHRA 2ZGMA 4CXXA 4ZU7A 1W2UA 1W28A 1HXS1 3ALQA 1F5JA 4OUSA 1SLCA 2Z42A 1NCRB 1H1IA 3EYPA 4URTA 1OUXA 2W46A 1F35A 3KV5A 1AX0A 4S2HA 4I0WB 1DDLA 2IXCA 3AMHA 2R061 1TEIA 1PK6B 4A7YA 1D0HA 1FPN1 3NKGA 5IFPA 3LWCA 2R30A 2R043 3PJYA 2K0GA 4Y4RA 2GZWA 1PNFA 3VKFC 3WNNA 3ZPYA 5GLTA 3FE5A 2WRAA 2OQ6A 2WZR1 2WO2A 1NCQB 1Q8SA 4WVWA 3ZSMA 4G9SB 2CSGA 4N9IA 3B94A 5GJ6A 2GC3A 2RV9A 1I6XA 2JJ6A 3GBWA 1CAUB 2JB8A 2JD9A 1ENQA 2ARXA 3A21A 2LM3A 2X5IC 3ASIA 1RUC2 2XGXA 3ENRA 3U1XA 3TEZA 5CVRA 1HJFA 3HT1A 1VBD3 4FFGA 3EBRA 4Q4W3 2DFCA 3LB9A 1EPZA 5BNNA 1JMUB 2W1QA 4FCAA 4PF5A 3WD5A 4TZDA 3S7EA 2HWD3 4QGLA 4Y4YA 1E5IA 2RHPA 4LNVA 2Z5WA 5HXMA 1KQRA 4Y20B 2ZX4A 3OGJA 2OYZA 1KS5A 4EE2A 1GZCA 5FPUA 2ZACA 4QU1A 1BK1A 2DCTA 3VBSC 1UOBA 2RS11 1J3QA 1QH7A 4IEVA 1PMHX 5ACA1 3UGFA 4XFIA 4NIDA 1R64A 2QJVA 4ORFA 1NT0A 1FMD3 1S0JA 3BTZA 1DGWX 3DGTA 3ZR6A 4KU8A 4META 1BZWA 1YQ2A 2WIIB 2YV8A 3I59B 4I0AA 1IS6A 3B5LB 2OXBA 5FP8A 5JDBA 3R4DB 2WNVA 1QXJA 4J1XA 2E7QA 2VH9A 2XMLA 3KSCA 1ND2B 2GC2A 3T0AA 1FAYA 2WABA 3HIFA 4IV1A 4LE3A 1AL22 1WMFA 4UFMA 5A3OA 4D69A 5AC93 4IEWA 2CGOA 1NQJA 4YGEA 3ZOIA 2EAKA 2VOTA 1QMJA 5H9PA 1F5FA 1VRBA 2Y8KA 1W04A 3SC7X 5KWRA 4QQLA 3IPVA 5H9QA 4LKFA 1ZZCA 4GB33 5FYTA 5FQ0B 1B35B 4XBLA 1BMV1 3T09A 2BWAA 2ZMLA 5J48A 3HNMA 4CRQA 5KHKA 3VHOA 4UF0A 1IG0A 5K0UC 1POV3 4Q0VA 2BNNA 3KM5A 5KXBA 3DV8A 4XFHA 2VUDA 4DQAA 3LEIA 3AYAA 3I2JA 2ENRA 1BCXA 1ND3B 1QOSA 2PFWA 1S2BA 4DRVA 2R32A 2KM2A 2ZBJA 4M0HA 5A80A 4CUAA 1YFXA 1RUF1 1RUE1 4P5HA 4XZUG 2VXJA 3H8XA 3PURA 1GR3A 2O8QA 2X05A 3ZYJB 5BPXA 1CPNA 1J1TA 4QKBA 4OHYA 1OLRA 4CDQB 4OHVA 1BEV3 1TNFA 1D0GA 1GZWA 1YQ8A 1Z7S3 5T5LA 2ZKNA 1PZ7A 5A33A 1V9U2 1U5IA 3KQ4B 1TVGA 2OVUA 2WN3A 5K4LA 3NV4A 3ZMNA 4C90A 1RUH1 3IDAA 5C70A 1J84A 4B1LA 3GCXA 3ACGA 1Q8OA 2OIIA 3FUOA 2GAUA 2WNUA 4DMIA 3IMMA 2EICA 2YGLA 4XW3A 2YMZA 5EJ3A 3O1OA 4BQWA 3K2OA 4FQ4A 4YW5A 1CAVB 1AR83 2XR4A 3NJZA 1CAWA 3KCYA 1PO21 4Y5SA 1JYWA 4RHV2 3RWNA 1Z78A 1HX6A 1SDDB 2CYFA 2VCAA 3D82A 2XUEA 3WP4A 2ZGQA 2CGPA 3O7OA 2VQAA 4XE9A 3ZFFC 1R083 5IK4A 3E6BA 2ZEXA 2QQIA 4FOQA 3FC0A 4JKKA 5E16A 5CA6A 4JHTA 5C4WB 1HXS3 1N47A 1RB8G 2CNAA 1X50A 3LD8A 1TMF2 1A3KA 4FXGB 3U4SA 5KXEA 1NCRA 3OGRA 4YYOA 4COYA 3M3IA 1K5JA 3OF1A 3TEYA 1TQ5A 1DQ6A 1C5IA 4DUXA 4CDWA 1XRUA 2A7AA 1UXZA 2R063 3B01A 4MADA 1PK6A 4IV3A 2VQ0A 5EYYA 3VKOA 2JECA 1NKGA 4Y22B 1SFNA 4EROA 3SLIA 1KITA 1TME3 1LB2A 2FDFA 2AR6A 2BOJA 4J25A 4QB2A 4GWNA 4S2GA 1ZZ6A 3JBG2 4NJ4A 4AG4A 4LLFA 4GALA 1NLSA 5FKBA 4K21A 4YGCA 1BHGA 1YC61 2ET7A 3VBUB 3H0OA 3IZOA 2VNOA 3B9IA 4W6WA 3OUHA 2XQRA 3NW4A 2P17A 5KBFA 4XFAA 3SCFA 3PHMA 4MSVA 1UOGA 4R4ZA 5ERLA 3M3CA 4BMBA 3IAPA 3WQBA 4YLZA 3VBFB 1K3IA 1KXGA 5BNPB 4QPGB 5HBAA 2E31A 1UMZA 2A73B 3LSDA 1AYM1 5J37A 5DUUA 1YWKA 4CP1A 4QU2A 4NHLA 1PMJX 1QJEA 4YW3A 2VJXA 3KHBA 4Y20A 1NUKA 4A4AA 3N9QA 4QX2A 2ZMNA 2JDKA 2RS13 4L0PA 1OVPA 2YB7A 4OUMA 1JW6A 2A6ZA 3OJBA 1MQTC 1MZ6A 3JZVA 4DY5A 2JX9A 3KCCA 4NRQA 1QEXA 2RS31 3ZFGB 2WAOA 1RUD1 5FOBB 1SDWA 1V6OA 2DTWA 4GJZA 4P00B 4Q4X3 3I59A 2EIDA 3I3DA 5H9SA 1OSGA 3WDTA 2R49A 3JD73 4NWWA 5M0TA 2WNOA 2VOVA 1XJAA 1YJKA 3M1HA 4FPOB 1L7QA 4YNIA 2UYBA 1IPSA 1ND2A 3GF6A 1P8JA 1XQNA 3WF2A 4K8RB 1A34A 2E32A 5ABJB 5FZ6A 1EAH1 1LECA 1NG0A 2QZ3A 2RJLA 1W8ZA 2HEVF 3KGLA 4ONUA 5GALA 1WD4A 4BCUA 4BISA 3I49A 2ZPXA 3WG4A 4KG0A 2A6WA 4NIIA 1FV2A 1H1AA 2DUPA 3VDCA 3ZYPA 4BMEA 1PZ9A 2DCJA 2QQVA 5C8CA 5FDBA 5FQ0A 1B35A 1Q56A 2IXIA 3B00A 4R8HA 4IEUA 1WBLA 1PIV1 4V2WA 2A5ZA 2R1BA 3ZSLA 5A7QA 1DHKB 1D4M3 3K4AA 4UW3A 1S0CA 3UESA 5IVCA 1NLRA 5FY4A 1QJU1 4GKXA 3USSA 3W9AA 4E8DA 3IM0A 2YG0A 1ND3A 4IGPA 4XF3A 1W8NA 2Q8DA 1QIQA 2ETEA 3POIA 3ZXLA 1N1TA 4C0BA 1O7FA 1WLWA 1RUE3 1W90A 3D5OA 3LSEA 3U0ZA 2ATFA 4MGKE 3IWZA 4ET7A 4IW3A 5FJKA 4KNCA 4TLGA 4C1XA 4NAOA 5J09A 1ASJ2 4CDQA 1OBNA 4FOYA 1SZBA 4LBQA 5CBLA 1OURA 4OI4A 4KGQA 3I2OA 1LRHA 1X33A 3MF9A 1DBNA 4Q8KA 4MG2A 1DGRA 1X9PA 1A6CA 2X8KA 3A22A 2WUHA 3HPNA 3PIJA 4AZZA 4FAHA 1NCQC 1JYXA 1IKPA 1UIJA 1W0PA 2C5DA 2B46X 1HQWA 4RSUA 1R1A2 5FP7A 4ARXA 5CB7A 1EV12 4IEYA 3VDDB 3S5QA 1AR63 2BEOA 2J42A 1PGW2 4QX8A 4Q2FA 3WLUA 2OT7A 2SLIA 4AEJA 4BJ0A 5L73A 3JUUA 4EWDA 5A3NA 5C3OA 3S0MA 1CAVA 3FMGA 3VDBA 3LDKA 2UURA 4MGZE 1V6NA 1WA4A 1JYNA 3H50A 1U5YA 5FO9B 4I09A 2W2IA 2YGMA 4BQ5A 1CJDA 4YVSB 3U10A 5A7NA 3CEWA 1YYNA 1ZZ7A 4NUBA 1QOOA 3AKTA 1G9AA 2JIGA 4LXLA 5KHJA 2QUOA 3NNLA 3POGA 4PDWA 5C3SA 3AXDA 3OPWA 4RQPC 3ZXGA 4CYDA 4FT8A 5F3EA 4IESA 4S2DA 3TN92 1OF4A 1YUDA 3A4UA 1FNYA 3ZSKA 2JWPA 4YVWC 4EN7B 1G6NA 2V4VA 4QQPA 4UI9L 3PTRB 1VE0A 1H4GA 4JKLA 3R4SA 1YCIA 4CEWA 4JRAA 5KHGA 1WKYA 3LA2A 2VW2A 2VBPA 3H3ZA 3LOBA 4P9LA 1H9PA 1GYKA 2PAKA 1FOD3 1WBFA 2HBTA 3F95A 2VZ3A 4XDQA 3V56A 4QKDA 4Y22A 3KMHA 2JB4A 4L2NA 5FREA 2GH8A 4BPZA 1AL21 3QD6A 4H14A 4L8QA 1POQA 4DS0A 2WSVA 4GA9A 5J36A 3D6EA 4IE0A 2JDZA 1XPWA 3VBUA 2BTVC 2Z4FA 3HQXA 3LFMA 4QPIB 4L11A 5LB6A 1XE7A 1E5RA 2DTYA 2PHFA 2ES3A 3KV4A 2JG9C 4QGMA 3O14A 1E57A 1WMEA 3N9NA 1VMHA 3VBFA 2OUJA 3GDBA 4G3YC 1CGPA 4QPGA 1AYM3 3HVDA 4P9WA 3N35A 4FTSA 3H8RA 5JXHA 2VC9A 5D2AA 3ZFEA 4BOWA 3HR9A 3Q8CA 4XUTA 1UN1A 1JZ7A 3HQUA 3M3OA 4R9DA 2K9ZA 1S0EA 1WGPA 4CUBA 3POBA 5C33A 1H2KA 3OD0A 4D94A 2YC0A 1VALA 2ZS6B 2FBEA 1FPN2 1UX6A 2FZ1A 4FAGA 3NWKA 1CX4A 4IQPA 1EPWA 1C8M1 1JS9A 3EMRA 3HOBA 4EZ4A 2RS33 2PHTA 1RUD3 2UY8A 2D44A 2WZR2 3ZFGA 1MZEA 2XWJB 4D7YA 5EP9A 4AI1A 1V9U1 2HWE2 2BFUL 1W0OA 4Q4V2 4ISQA 4PJYA 2VD7A 2GMMA 5LK7B 3IDCB 4UFIA 1EAH3 2DUQA 5LATA 3ZO0B 5ABJA 1LOFA 3CNAA 2VUJA 3HNYM 2BUKA 2E9QA 2V5DA 3ZN6B 2X5IB 4ZZ5A 2NP0A 2BQPA 1WCSA 4W50A 2A3WA 2FCTA 3WDWA 4LO7A 5LY2A 2QQWA 2QQUA 3CU7A 1CWPA 1JOBA 2K2SA 5HCHA 1EY2A 2EIBA 4M4PA 2JKBA 5E6HA 1JHJA 3POFA 2DU1A 1COV2 5FYIA 4FPJA 5F5IA 2EIGA 3AM2A 2XHNA 4QDSA 1ZBA3 1ONAA 3S6PA 4RHV1 3AX4A 4ZU4A 1IPKA 1GNZA 5DAVA 3AVSA 5CNAA 3VBSB 3O12A 2D6MA 3NNJA 5JI7A 2DBIA 1RUG3 3VHRA 1QJU3 5LBEA 3S30A 4CU9A 3BB6A 4XJAA 3RZLA 4BZ4A 2UU8A 2PMWB 4PHZA 4W6XA 4NO4A 4EN6B 5C4WC 1OH3A 1BLZA 1PM7A 1QJY2 4FQZA 4UYBA 4N8MA 1H8TB 5FJHA 2VMHA 2WZPP 4E9KA 1RHI1 5FUPA 2GN3A 1TMF1 2UYAA 4LULA 2A70A 2VCCA 2VNGA 2XBO3 5AFBA 1ZRIA 5JOXA 5FYHA 1TE1B 2B8MA 2IWGB 1CVNA 3TYJA 5FOJB 1SCSA 3I2GA 1LNSA 1IS3A 2HWB3 2HEYF 5LEJA 4YM2A 5F5CA 1VAMA 3MGUA 3N7LA 3ZR5A 4XF0A 3J7NA 3VV1A 4CU7A 2W1SA 4AI9A 2E53A 2V09A 2VUCA 4CCLA 5I0SA 3MW4A 2FDJA 2QQNA 3ABZA 3LIHA 3WDUA 5KC5A 3RDIA 3AXEA 5K0UB 5FO8B 1YNAA 2XJPA 1UMIA 4Q4Y2 2CHHA 1CZSA 1RUC3 3JQXA 1G7YA 1UY4A 1AX2A 5JOYA 1J83A 4LBJA 5BNPC 5A6XA 4XABA 2BGPA 4BIOA 2VVEA 4YVSA 2Y64A 1WWYA 1XU1A 3WDYA 5F8PA 5FY0A 1G8WA 1PO12 3G7DA 2C9AA 4E4ZA 3MPPG 3ZYIB 1AYN1 4M00A 2X53S 5CYYA 5CFDC 1UO9A 2RDSA 4FBFA 1OC1A 4HPKA 3QACA 3C7HA 4BQ2A 1OH4A 2WAAA 2AGSA 2WO1A 4CPBD 3AZWA 4Q27A 2D6NA 1LEDA 2CY6A 2PHDA 4LMFA 2VZPA 4SLIA 5T50A 2W91A 1SLIA 2W9XA 4F83A 3RYPA 1GSLA 2WT0A 5HI0A 4N43C 5FZDA 5BUVA 3QCWA 3WUCA 4AEDA 1QJX2 3UL2A 5C8WA 3AB0A 4AHYA 1U0AA 2WO7A 3BOPA 3P3NA 1WUVA 5A7WB 1AL23 1K5MC 1PO22 1UCXA 4ZKTB 3AP6A 4D7TA 1W2TA 3M7AA 2I45A 2QCSB 4Y5Z0 2E7TA 4PBOA 4AHWA 3NVCA 2YPDA 1HKDA 3AKQA 5DQ0A 1MPXA 3ZPOA 4XCBA 3R0RA 2MEV2 5FZAA 2VGDA 3SH5A 5E1RA 2G9GA 2P3YA 3SISA 1WMDA 1O5LA 4XDPA 2HKXA 2WT2A 2XUMA 5FMBA 1FI2A 4DXSA 2W39A 5FLHA 4YW6A 5CADA 4LO4B 2ZGPA 4XVHA 4RS5A 3L9JT 5D8AA 3UYJA 2ARBA 2PAEA 5JIUA 1ALYA 4CA9A 1RINA 3O0WA 1HN0A 2G4IA 3NAPC 5FZMA 4OZOA 2WFF1 4Z2WA 2A75A 1H0BA 4UFKA 5JMOA 2BV4A 4D6QA 3U78A 5CG9A 2WQZC 4TN7A 1OPOA 4AQ6A 4P9GA 4P08A 4YM0A 3U14A 3NV2A 2PLV2 2XHKA 5JZGC 2CAVA 3LIGA 1XXNA 1ASJ1 2I2SA 1X8EA 1GWMA 5JIAA 3WDXA 5FZHA 3I3BA 5IVEA 1LHVA 5A6QA 4JRLA 2P6CA 3OBAA 1C8NA 2GP3A 1OHFA 4RGAA 4YPJA 4A42A 1G9FA 1ULEA 4UT5A 1RMU2 1W6QA 3N3HA 5C7GA 4FPEA 1PGL2 4CCKA 1CONA 3KT1A 3ZN6A 3VDDC 2X5IA 2XH6A 3VB9A 5IVBA 3VBOC 1R1A1 3LPFA 4HLTA 1GU3A 2G9FA 2YY1A 4B7EA 3SCHA 4BYYA 2AZ5A 1O5UA 1YI7A 1VP6A 3W21A 4C91A 1PGW1 2PTMA 5LA0A 4CEYC 1IHMA 1YFYA 3N4MA 4K40A 2PXJA 1VBC1 1WW7A 4A7KA 1ODNA 1XBFA 2DVBA 4QX3A 3ZYBA 2QQLA 3HWJA 4EYUA 1XE0A 2DYCA 1O4ZA 1W2NA 1DQ4A 4OFGA 1OI6A 3HBKA 3TB0A 4FTBA 4ASLA 5JMCA 1QQP1 2VPVA 1MQTB 2XOMA 3WHUA 1V0AA 2ZX2A 3T1MA 4AVTA 1GNYA 1SPPB 1EUUA 2VZUA 1AUYA 1W6NB 3MLKA 2NQYA 4HL0A 3TN91 4O9GA 4JQTA 3RZGA 1OUSA 2BBAA 1IPJA 1TMF3 4MGQA 5GLVA 1UQXA 1RJ8A 3R6SA 2F6BA 4AQTA 4Q0QA 3QLQA 2Q0AA 4PBPA 1D7PM 4IEXA 4ZPIA 4IV3C 3RJRA 1SFYA 3ACHA 4MO3M 1CD3G 2VE1A 4ATEA 1UW8A 1WLTA 5FPBA 1HLCA 2RG4A 1GKBA 1O59A 1ULOA 4HT1T 2WLPA 3JBG3 3FUQA 4KGGA 2VY0A 1YFWA 4A6OA 5IJRA 2D40A 4QPIC 3VDAA 3WP5A 3KVBA 1EYBA 4Z92B 2OKXA 2ZOEB 5K0UA 4TSVA 2BGCA 3H1WA 1BK0A 4CP9B 4DOUA 1J3PA 3CJXA 1OPMA 5KXDA 2QE3A 2ORXA 3UT0A 3I4IA 4HVOA 3GBGA 2DCKA 5A70A 1DCSA 4UOJA 1BBT3 3L2HA 2PAMA 4AR2A 2VQUA 3MV11 2EXHA 3WUDA 2IFWA 4LBOA 5BV6A 2OS2A 3PVEA 2QQMA 2ZXQA 3HNBM 1STMA 1I3HA 4JKMA 4XBNA 4HXCA 4QXKA 5F2WA 4AHZA 4CCEA 4A2UA 1LJ7A 1GZ9A 4XFGA 1QF3A 1KD7A 5FP4A 4LA2A 3W5MA 1W6PB 2Z69A 2Z79A 4CDXC 1HB4A 2HWE1 4GXLA 4Q4V1 1M4WA 5EIYB 1CPMA 4AGVA 1YO8A 3D3AA 1W0NA 2W0XA 2R6QA 2Q5TA 4K1ZA 3VL8A 3SEPA 5A7WA 2Y26A 5LRSA 2D93A 4EV0A 3TOJA 4XDOA 1A78A 3VHPA 4M3CF 2B7YA 3H8OA 1REDA 2YBKA 3EXUA 1OVSA 1W3XA 5AVPA 5FMOS 4PCRA 3HBZA 3N36A 4TWTA 1HW5A 2WSUA 2Q8OA 2WO3A 4LBMA 1RUNA 1COV1 2VR4A 4AXOA 2FDHA 2VMIA 2D6KA 2A6YA 4Y26A 2JDPA 5LBCA 3ZFFA 2ZA9A 4RQPB 3PMEA 2OQ7A 3GHNA 2Y6LA 4BXFA 1Y7BA 4IGQA 2CV6A 2BWCA 4YVWB 1QHDA 4F8AA 4JTNA 5DABA 2CWSA 5T5JA 4NHMA 1H8TC 3AL5A 1UOJA 1QJY1 4KBBA 5LA2A 1H4HA 2RS52 4W65A 4MH0E 4HKWA 3V65A 2RMU2 1T2XA 4D0QA 3BVCA 4LR4A 4BK5A 2ZX1A 5EXOA 4HANA 3C8XA 3LOIA 3J7HA 2ZJCA 4I30A 4N53C 4BK4A 4JV4A 2Y6HA 1QOTA 3D0JA 2VOWA 1C28A 3J7MA 3K48A 1VBE1 4YG3A 5IAVA 3VBRC 5F9TA 3AZZA 4E8CA 1W9WA 2K46A 1UYXA 2JDYA 4M3CA 4JGYC 1JZ2A 2ZZQA 2DFBA 4AVVA 2JG9B 2FMYA 3PVOA 1EV13 4MZUA 3HAGA 3VN4A 1Q8QA 2P1BA 1PVC2 1W8UA 5FY8A 2E7AA 3FFZA 3TWIA 4MV2A 2P6HA 5EJ1B 2WWJA 3WF0A 3H1MA 3SKVA 4Q4Y1 5C5TA 1R092 1KJLA 1GQPA 2IFRA 1VB4A 4QAWA 3ILRA 2RJKA 1RUI1 4BM8A 1ZREA 4BQ1A 4EQVA 3B69A 1X8MA 2GALA 2YDEA 4DEQA 1KGYA 5DUXA 5ANQA 1G9DA 2PHLA 5FZCA 4B3NA 1C8M2 1G9CA 1JYIA 1PO11 1MQTA 5KC6A 3K77A 4ZS3A 1W8TA 2ZHMA 4R4XA 1H2MA 4CCNA 2GU9A 3SH3A 3AP4A 2O14A 1RYYA 1W6NA 1FXZA 1LODA 4MUVA 3MI8A 3T1LA 1XYOA 5A32B 5I93A 4CUCA 4XYXA 4QKNA 3S7IA 1QH6A 1AZDA 3LF7A 3PDQA 2QZ2A 2MHFA 1DYKA 4XXPA 3THCA 2YC4A 4BIFA 4JCKA 1YQ6A 2VZQA 1RUOA 2WYSA 5IT6A 3FHQA 4MXWB 3T0BA 1N3OA 1ULDA 4R9CA 4E2SA 4AFAA 1UU6A 4WZFA 1QJX1 4PLNA 3CJIC 5BXXA 1VBB3 2XL7A 3MBWA 4TXWA 1S55A 4QB6A 4BLJA 2J7MA 2ARCA 2VMEA 2JDUA 2XWBB 3GZUC 1CAXB 1MS1A 5I0UA 3WEZA 5HV4A 1MS3A 3AZYA 3AP5A 3IN9A 5DN2A 2MEV1 2C0ZA 5F5QA 2PHXA 4O61A 4E4SA 2W47A 4K8FA 4YG0A 1QWRA 5D21A 2DVFA 4N7UA 3IMNA 4XMAA 3ZVXA 1XE8A 1ZZBA 4D3WA 1REEA 5I8SA 1RHI2 5F1RA 3ZKYA 1SCRA 3FL7A 5JAXA 1AR92 4F7ZA 3I3MA 4GULA 2HWF2 2DVDA 4XJ9A 2WQ8A 5FO7B 5DZEA 2ZGOA 3WNLA 1FPN3 2C9KA 4HK8A 1BXHA 3CF6E 2PLV1 2DF7A 4BE3A 5LY1A 1Q5OA 1VIWB 2WZR3 2P3IA 3ACFA 3K4ZA 4CVUA 1W6PA 5DUWA 1NCQA 5DXDA 2HWE3 5IK7A 1YQ5A 4WM8B 2WC2A 4ATFA 4LITA 1NQDA 3NMBA 4UW4A 1GOHA 4COWA 1CAUA 4NIGA 4AVCA 1W8WA 2B39A 3PUHA 3MLJA 1RMU1 4WVMB 2WNEA 4HOOA 1PGL1 4LPLA 4O9EA 1NA1C 1H8VA 2PN5A 5FXXA 5CG8A 4U2AA 4XIOA 1ZRFA 1SQ4A 3K3NA 1UOFA 4BU2A 2N7GA 2VZSA 4Y33A 4BA6A 4H2AA 2PQQA 1US2A 4PLOA 3OPTA 2A3XA 1RVF2 4HBNA 4XJZA 5FKCA 4DUWA 2FCVA 2R7EB 1AYN2 5CISA 3C7FA 4M3CE 3SMHA 1NXD1 1UZ0A 4URAA 4IEPA 5IVFA 4Y1XA 4OI1A 4XTPA 4Q0UA 3CDZB 4RQPA 5EZWA 5ACA3 5CFDB 5FPVA 3I97A 3C7EA 4WBBA 2WS92 1XSRA 3N7JA 2R072 4YVWA 4XJ8A 2O1QA 2JE9A 3X29B 4XC9A 4D7SA 1VRH2 2XJUA 3W59A 1UKGA 1S0FA 2V73A 1GOGA 4YGBA 4XFFA 4LUKA 4HKOA 2VM9A 4LKDA 4N43B 3HQRA 3FWEA 1JU3A 1K5MB 4W4ZA 3AC0A 3GXUA 3GYDA 3TNQA 3IIAA 3H42B 1Q8PA 4BHPA 1DLLA 2X09A 3N7MA 4DRRA 2R042 2VBDA 4ITCA 3F2ZA 5GZDA 4ZY9A 4AYUA 3RNSA 2FHRA 3B7MA 5GLUA 4DEVA 1LULA 1MEC2 2AENA 2XVGA 4NROA 4XJWA 4PIXA 3R4UA 2JG9A 3GZAA 2QKDA 5L9BA 4Z8BA 2A1XA 4KWJA 4EZHA 2RM22 1V70A 4PT6A 3POJA 2P3JA 2XQXA 2O8OA 3ILFA 4NRMA 4YWAA 3N9PA 3M2MA 4COUA 3AK0A 2DVGA 5FTTC 4BQYA 2XONA 2YZ4A 1TG7A 1V6MA 2WFF2 3GBFA 5FYMA 3UKTA 3NAPB 4Z07A 1GBGA 3USUB 5B2GB 2CGNA 3RFRA 1RUF3 2TUNA 2R0HA 4RGGA 3JU9A 3Q8BA 4GJYA 5DDJ2 4AOCA 3QBQA 1W6MB 3MIBA 2WFPA 3H7JA 3PIGA 2FDIA 4A45A 1JBCA 3KZ4C 4XBQA 4Z2AA 5JZGB 5F6KA 4Y1UA 4RR3C 4HFSA 2I07B 4OHZA 4PIYA 5A6ZA 1V6LA 5JXJA 1RUH3 3DPRC 1AX1A 1HQLA 5EQUA 5IATA 1RXFA 4P9IA 1PX3A 1AXZA 1FMD2 2OX0A 4FPFA 4RN5A 4WVVA 5A32A 2EALA 5FZ7A 3GGLA 3MV01 2JENA 4FPKA 4R9AA 4MXWA 4GH4B 5E8AA 4B4PA 1S0IA 5K7PA 1NE6A 3PUAA 1MS0A 4Q0SA 5FUIA 3H8UA 3VBOB 2W87A 3D8CA 3Q8AA 1QJX3 1URXA 1EUTA 5FMCA 4MXVA 3C7GA 4GMP0 2B9VA 1PO23 1VBC2 2IVJA 2XL9A 4CEYB 2WZEA 3KV6A 5AC92 1LENA 2DDUA 1JYTA 1O3QA 2YXSA 3O0XA 4UBGA 5C9AB 2ZGSA 5F39A 1DIWA 5FYYA 4CP0A 4AVSA 4ZU5A 2Q8CA 3TAYA 1QQP2 3ACLA 3V0BB 1LOGA 5CIRA 1E5SA 4IE7A 3WDVA 4BLIA 2XKOA 4L97A 1CZVA 2QFEA 5JUVA 5C4WA 4GAZA 4YW2A 3I2FA 1VLNA 2KD7A 2ZGKA 1OOPB 1C57A 4JGZC 1B09A 2JKXA 3RZHA 5B4XA 2HEWF 3WOGA 5A3MA 4IXLA 4OMDA 2XLGA 3BN6A 1QU0A 1ZM1A 2AREA 3ZN5A 3VUOA 2YYOA 2RS51 3O1SA 3OGGA 2RMU1 4NOTA 2VTXJ 4UW5A 3S5AA 3ECQA 5JSOA 1JYVA 3KD4A 1S2EA 2VMCA 4DINB 2EXKA 1JHNA 3ZN4A 3AZXA 1VBA1 5LRRA 1TNRA 4SBVA 2XLAA 3CO2A 4WVMA 4AFDA 4XAEA 1SLTA 2QQPA 3ZM8A 5HCFA 1I9RA 1PVC1 3A7QA 4A6SA 5BNPA 4LLOA 1S4CA 2QBXA 3FBMA 4NPLA 5IK8A 1ENXA 2CAUA 3GJBA 5EHDA 3WNKA 2XPJA 1R091 2BVBA 3POWA 3NO8A 5T54A 1CIWA 1YLLA 3LDBA 4ISRA 4LBNA 2VW1A 4ARYA 4QT6A 1CR7A 3KGZA 4LOTA 5CFDA 4LHLA 3RZJA 4E4HA 2JD4A 1LGBA 1WMXA 4E27A 2VULA 1R082 1VMFA 5IVYA 2LS6A 2CU5A 3NNFA 1ULFA 3ATGA 1DP0A 4CDXB 1OKQA 3KF3A 4I3GA 3FZ3A 4P9JA 4E2GA 4N43A 3AYCA 5A1AA 2D97A 5CKQA 4IL7A 3U11A 2Y33A 1DQ5A 3ELNA 4XF1A 3ETQA 2FMDA 1K5MA 3MZHA 1W06A 3RGBA 1ODMA 2B4KA 3ZIXA 2P2KA 3W58A 2PHWA 4A41A 4YZ2A 1OF3A 2XVLA 4UFLA 1UYPA 1AL0G 1TME2 3PUQA 5IK5A 1J1LA 1LGNA 4EN8B 5K8SA 4UBHA 3RYRA 2RVAA 3LEKA 5FBJA 1PIV3 1Y4WA 3AJYA 4QDQA 5CKMA 5GKAC 1UY3A 1OD5A 1HRV1 2BOIA 2GSYA 4PLMA 4GIQA 4MOAA 4UW6A 1FX5A 2WLQA 5FMDA 3T4HB 1FATA 3C7OA 1F9KA 5E89A 5LASA 2YBSA 3UJQA 2NMNA 3OGVA 3MF6A 4NR1A 3NAPA 3USUA 1U5XA 1WCUA 1S0BA 2RE9A 2V5YA 2W1WA 1AVBA 3AVRA 4M01A 3JB4C 1FYUA 4XF4A 1LHWA 3ZLIA 4DXRA 1POV0 1W6MA 1JUIA 1RGSA 1SBDA 1AR91 4RFT0 4RA0A 1QY4A 5BNOC 1ULCA 2HWF1 3WCRA 4CDUA 5JSPA 5JZGA 2XJVA 1LTEA 2Q1FA 3G6JB 3S57A 4OYUA 2WKKA 4N53B 1VBE2 5JVVA 3VZNA 2PYTA 1HIXA 1QDOA 3VBRB 2AEYA 3KLSA 3WG1A 1NY72 3OOXA 2HWC1 5JPMB 3I3QA 1OA4A 2WL1A 1DGWA 3CL1A 2MNGA 3CZJA 2FQPA 3KCXA 4V1PA 1UZZA 2CDPA 2J1RA 4JGYB 5GZEA 3AZVA 3JD72 4IE6A 3VDDA 3O1PA 3VBOA 4NAMA 1LEMA 2ID4A 4GMP1 4LHNA 4LKSA 1IS5A 4CEYA 4DXZA 2WZ8A 1DYPA 1RUI2 1O3TA 2JG8C 4Y5TA 3ME2A 1BMV2 4AVBA 4Z1VA 2ORZA 1OLMA 1RVF1 1W8OA 3PTYA 3J8F1 2ZEWA 1IKQA 4XFCA 1UZVA 5LBFA 5BYNA 5HCAA 1KFXL 1BQPA 3AMQA 2ZGRA 2XJTA 2DV9A 1CESA 3EQEA 4Y3OA 3VL9A 4B29A 1D4M2 5KXCA 3EJKA 2H0VA 1LHUA 2WS91 4XCAA 2R071 3GM8A 4YM1A 4LBKA 2OW4A 3W5NA 2R1DA 1VRH1 2VNVA 2E51A 3IDBB 3V64A 3PUIA 1L7RA 2L9LA 1DFQA 2VOXA 3J7LA 4U36A 5JLVA 4P5YA 3AKPA 5JXGA 3FJSA 5FZFA 2RS53 1LU2A 4LBQD 4BXSV 3LDRA 4Q1PA 2RMU3 2X29A 3PU3A 1PVXA 3BTXA 1QJFA 5LA1A 3CJIB 3EHKA 3U4XA 1DQ1A 2W92A 3ZMOA 4P02B 3WCSA 4FFIA 4GD4A 3E5QA 4XUQA 3GALA 4AFCA 4QPIA 4XOGA 4QX5A 3PJQA 1H30A 1ENSA 2R041 4R9BA 4YSFA 2VO5A 3T2OA 2JDNA 1MEC1 3KT7A 5IVJA 4PIZA 3E6CC 1AR72 1PVC3 2RDNA 1AR62 3VZMA 2RM21 1Y9MA 2ZHLA 3DL3A 3DUIA 5GLZA 4QKFA 1YXWA 3K4DA 1OLQA 2NLRA 1R093 3C2UA 2EAAA 5FZIA 1F4AA 5T5OA 5A7SA 2GNDA 4DZGA 1VBD1 5KHHA 1CQ9A 2C1FA 5DUVA 1UAIA 3SXWA 4CCDA 3KS7A 4JTOA 3AP9A 4AEMA 5F7UA 5DDJ1 5ANNA 2IC1A 3NL1A 1C8M3 2GN7A 3WQ7A 4ASMB 4WM8C 4NHKA 4PI2A 3ZDSA 4N7IA 4NHYA 2GC1A 2ZGTA 4AI3A 5I8YA 3BTYA 1UXXX 1V9U3 3RS6A 3BTAA 5J96B 1GOFA 2WT1A 4QPYA 2EXIA 2F4PA 5FWEA 2LW8A 1W8FA 4CDXA 3AJZA 1F2NA 1FMD1 3SQOA 5GZFA 1MR5A 1HRI2 4GH4C 5F5AA 2VTFA 3NV1A 4OHXA 1ZA7A 3FN9A 4XQDA 5SV8A 1NA1B 3WP6A 3WINE 2HJIA 4CE8A 1FOD2 3KB5A 4YFWA 3UV9A 2Q1MA 3TBDA 4FPYA 4IV1B 2BVVA 4RD7A 3ZXKA 1RTVA 3TRSB 3ZYFA 1H6XA 4QD2A 5I0TA 5AC91 3MIEA 2BJSA 1S2KA 3Q9OA 5C9AC 4RHV3 3IIIA 2E26A 2VECA 3KWVA 2NM1A 5FZ9A 2MPFA 3VBSA 3WNOA 4H7MA 4E2QA 5EFUA 3O1UA 4GB31 4FFFA 4ZHNA 3POYA 1OA2A 4AL9A 3WW3A 1O3SA 1UD1A 4K1YA 1I1EA 3MPBA 1C4RA 5FZ4A 2CTVA 3WQ0A 3DN7A 3QOPA 4AFMA 5I91A 1QKQA 1POV1 4P9XA 1OOPC 1RHI3 1H8TA 2ZHKA 5F3GA 2VOKA 2VL4A 1K42A 2VQTA 1AR93 5GLWA 1WCQA 1OLME 4YW4A 1Q8VA 3LEGA 3BCWA 2HWF3 1G86A 2R0FA 1SBFA 4C8DA 4YZ1A 4QB1A 3UGHA 5C3QA 3FBYA 3VZOA 3UK9A 3A0NA 4N53A 4NN0A 1H2LA 2B42B 3VBRA 3ITQA 1RIRA 1UYYA 1KDMA 1ZYBA 2OZ6A 4XQWA 1X82A 4BH9A 2XXZA 1LU1A 4YG6A 2VMFA 5I0RA 4JGYA 5L7OC 1S0DA 3RMXA 1DQ0A 4FP3A 2LRPA 3N9OA 3HN1A 4OHWA 4LHKA 3VBHC 1KJRA 3M3QA 4NE9A 4N90A 1N1VA 2WNUB 3LPGA 4QQ2A 4XUOA 5F37A 5IAXA 1JU4A 4IETA 5LW9A 1REFA 5BNNC 4AHXA 4ES8A 1N3QA 2GDFA 3B9CA 4NHXA 3V0AB 1H1MA 2Y6GA 3SHRA 5EJZB 2GMEA 3QH6A 3WX5A 1KS4A 2CL2A 2IXKA 2WWUA 3WNPA 1RXGA 2W94A 2YPJA 3IB3A 4DFSA 3O1RA 4QM8A 1AYN3 1JTZX 3KVAA 4R52A 4X6RB 5FCCA 1ZX5A 1DZQA 3CKHA 3PLQA 2D6LX 3MUY1 3LA7A 3LE0A 4I02A 4KBZA 2YU1A 4RR3B 5CEHA 1K45A 3EO6A 1GV9A 1XB9A 1RUG2 5DG2A 3DPRB 2WS93 4YRDA 2WWSA 1F8VA 2P3KA 2R073 2JE7A 3OUJA 2OUHA 4QX7A 1VRH3 1R081 1RJ7A 1N1SA 2P34A 2VZOA 4RFRB 3B3QE 4A3XA 1UPIA 5CFCC 5TSWA 1LHNA 2DCZA 2D5HA 3DEMA 3FFQA 4JVAA 3VKLA 5FZLA 3ROUA 1GUIA 2FCUA 2XBO2 3BALA 3M3EA 3ZKUA 2FDKA 5LWBA 2C24A 3M70A 2BZDA 4CP2A 3CJIA 5T55A 4CDWB 4DB5A 1O4YA 4YZ5A 3MEPA 2H6BA 1DG6A 4IV3B 2HWB2 4MYEA 4XUNA 2J1AA 4KWLA 4Q5OA 2JDMA 3AMMA 4AI0A 5EV7A 2W95A 1YJLA 5FYUA 1TME1 3H7YA 2JDHA 4FFHA 3BOWA 5IUQA 4EWAA 2WBKA 1MEC3 1F31A 2XKPA 3MLLA 3INAA 5FMOL 3T4VA 2DVAA 3IAQA 1SLLA 1WW4A 2RM23 4HETA 1U12A 4YGDA 1C5HA 4OUEA 3MIHA 2ZEYA 1UZYA 5FPXA 1GP6A 2QVSB 4DNYA 3MUZ1 1JZ6A 2WFF3 4KMQA 5AFEA 4JGZB 4O65A 4WM7C 5GM0A 1BVVA 5DDJ3 2GNTA 5BY5A 5JWPA 1NXMA 3MIFA 4AAXA 3ZXDA 4IEQA 1O91A 2D7FA 2Y6FA 1K12A 1XC6A 4CCOA 1WLDA 3BYWA 4AI2A 3Q8FA 3VD9A 5FY5A 4JZRA 4LK7A 4FPGA 2WA3A 1ASJ3 4Y24A 3WY6A 1HB3A 1RITA 1PHMA 4IUGA 5B4NA 3WW4A 4ZS2A 5DAPA 4O7XA 2Q4SA 4OULA 5EPAA 1GQHA 1VBA2 1X36A 2BW8A 1AXYA 4HN1A 2IZWA 3CMGA 1NY71 3RYKA 1KFUL 4QMAA 1YI9A 5FP9A 1MZ5A 1R1A3 2D3PA 2ERFA 1O6UA 4Q4X1 4QWNA 1NA1A 3RZMA 4N9HA 3P3PA 3JD71 4LK6A 2Q8EA 3LEMA 3T08A 4WV8A 5FYCA 1SG3A 1VBC3 2IXJA 4NWVA 2RDQA 1UU4A 3ES1A 1IZ3A 4FOWA 4XHXA 4OQ8A 4MHUA 3WNXA 2AYHA 1Y9GA 2YC2A 4I0BA 4LT5A 3T2TA 1GWKA 2P5BA 3PUSA 2JIJA 4MVTA 4CDUC 5C8CB 1AJOA 3PNAA 5E88A 4QM9A 1VAKA 5FXZA 5L9RA 5F6LB 1QQP3 4L99A 4QQHA 1LOAA 2OPKA 3OBRA 3T3YA 1VR3A 1SLAA 3N9LA 3UKNA 1RUJ2 4LUMA 1ENRA 4QHZA 1DGLA 1SPPA 3OBZA 1SEFA 2ADDA 5FLJA 3TN93 2D43A 2EXJA 3ST7A 1JN2P 4B1MA 2W5FA 1WCKA 1D4M1 3B93A 3P5BA 4B8EA 3NJXA 3DYMA 4C1WA 1MS5A 3DYPA 4YFZA 2WR9A 3U75A 5I8TA 1D4VB 1GP5A 1NLQA 2BYVE 1DZRA 3NKTA 1VMJA 3AL6A 3PL0A 1SBEA 1UX7A 4S2FA 2F4LA 5HCBA 4XHBA 3I8TA 5IFTA 5T5PA 1Y3TA 2Y0IA 1Y9QA 5JR7B 3OEBA 1W2OA 4LBQB 1YIFA 4TLFA 2IVIB 1ZRCA 4Q26A 2V4AA 3ZXAC 2W1UA 1KDKA 3AYDA 5G05L 2RR12 5G04L 2BGOA 3DCQA 1HRV2 1W9FA 3APBA 3VD7A 3SNMA 1O8PA 1WA6X 1QNYA 2ZGNA 1JOJA 4I3PA 3THDA 2D3SA 3P1IA 4MGYE 4H55A 1HV0A 2UY9A 4QX1A 4CP9A 5FK8A 2YFZA 1GQGA 4EN0A 3HJRA 4MGSA 4AEKA 1US3A 3V0AA 2B45X 1J58A 1AR71 1ZA4A 1AR61 4KU7A 2O0OA 4XEZA 3BKZA 4M0NA 5A3LA 1OQEA 1V6KA 2HBUA 5APAA 2LUWA 3DF0A 3LFIA 4K7JA 2JICA 4PI0A 1GMMA 1DQ2A 2D3RA 2VZRA 3BGAA 4V2VA 4DIQA 4ZZ8A 2QQKA 4JDOA 5FPAA 3DXTA 4GKYA 5BNOB 3VD4A 2DBNA 2G9ZA 1JODA 4RR3A 4LJHA 4OMCA 1JZ5A 1RC6A 1Z0HA 2OZJA 1W9TA 2J1UA 4WVZA 5DZGA 3DPRA 4ASKA 2BP6A 2HWC2 4PDWB 4HSLA 4B4QA 3D0SA 2NZ9A 3IKWA 3SKJE 3UETA 2A71A 1ZBE2 2ZAHA 3BODA 3OYWB 4FPHA 5JSRA 5FP3A 1D2QA 3A0KA 3THTA 4JHZA 4MGTA 5FPLA 3OPZA 1OFSA 3OY8B 3E1F1 4LIVA 4IDZA 4Q4V3 2ZGUA 4X6QB 1YEWA 3HN3A 1LESA 3BU0A 3RZKA 1ULGA 4K3UA 2PELA 1T6GC 2WJSA 4IEZA 4XUPA 4CEWB 1LGCA 5IW0A 3IT8A 5T3NA 1JZ3A 1HRI1 4COZA 3T2QA 1DGRN 2WNVC 3FHIB 4IEOA 1OD3A 2XLFA 3BU7A 4KI5M 1GNHA 2ZABA 5JR2A 1FOD1 1OMIA 1W8HA 3NJYA 4QXCA 4IV1C 1NX9A 2JG8B 3CHXA 4M4RA 3T30A 4UWDA 1NAEA 1W39A 1WW6A 4DXTA 3B02A 2NN8A 1COV3 1E5HA 4XF9A 4HMZA 3J8F2 2DUOA 2ZEZA 2J22A 3ZSEA 4AFBA 1XNTA 5BNQA 2VG9A 4JAAA 5FZEA 1NZCA 4XURA 2DU0A 3MW3A 1SHWB 4HVRA 3BUCA 2ILMA 5D1IA 5A3PA 4Z82A 4LQRA 4NPRA 5A1FA 1W6OB 4FXKB 1LKNA 3O5SA 2DWRA 3WHTA 4JGZA 4MLOA 4YARA 5FR3A 4OI0A 2AACA 2VZVA 3ES4A 1QJY3 4LIUA 1LOCA 1W9SA 2IUWA 5DPNA 3PU8A 5ISLA 1BBT2 1MS8A 4IE5A 5AVAA 4OZXA 3ZFEB 4COVA 2ZX0A 3WSOA 4I01A 3FLTA 1W9YA 5A7PA 1XU2A 1SACA 3H9AA 4D6SA 5LEKA 1XYPA 1N3PA 1RL3A 5LA9A 4CZSA 1XSQA 2C4XA 1VBE3 3VZKA 5C6CA 2RJ2A 4DY3A 3ZXFA 1NZIA 5I0DA 4KG8A 1UNBA 5CU1A 3POSA 1QXPA 2WYFA 4AQSA 1W05A 1YFUA 3ZIWA 4FSJA 1DF0A 1Q43A 4PF1A 5H9RA 3ZYRA 1JOPA 1XNKA 2G19A 1HB2A 3VZLA 3HEIA 2FZ2A 1O4TA 2WNUC 3LAGA 1OT5A 4Q4Y3 3MDPA 5EWSA 4AWDA 5JPNB 1UY1A 3FX3A 3LKJA 5DMYA 4FOVA 1AXKA 1IOAA 1RUI3 1VBD2 4XTMA 2LALA 3MYXA 4Q4W2 4D8MA 2C26A 3NSTA 5A6YA 1S1AA 1FV3A 1UKRA 2HYXA 3RMYA 3WF3A 1XNAA 4QHOA 1W03A 2HWD2 5K9YA 4XACA 1HJGA 2UWAA 3UNPA 4NMIA 3DYOA 3LA3A 1PO13 2DURA 3RI8A 1I5ZA 3I2HA 2E6VA 1NOVA 1ZBA1 1VPHA 1UMHA 3E5XA 3PVNA 4FPLA 4Q8LA 5FYBA 3JQWA 5FZKA 1ACCA 4XQ4A 1X9TA 3AKSA 3ETPA 2BRTA 1RUG1 3MHZA 4LHSA 5J1XA 4LKEA 1OKOA 1ST8A 2AH2A 2XB6C 3T0DA 4NPMA 2LROA 5IHRA 2UWBA 1VAVA 1SLBA 2VCBA 4CPBA 1VB2A 2Y6JA 1HDKA 1UIKA 1V6JA 3GNEA 3NNGA 5IVVA 1NCRC 3VKMA 3OUIA 4AGRA 4CCJA 1JZ4A 4G4FA 1D2SA 3BIEA 2XBO1 2E33A 1T6BX 4CDWC 1N1YA 3CQOA 4K20A 5FK7A 3WQ1A 5C5UA 4Y1ZA 3OTFA 1PK6C 2ARAA
chains in the Genus database with same CATH topology
1CJPA 5JI9A 2VXRA 2KA3A 1CAXA 2HWB1 2HYKA 2VUAA 2ZCWA 5L19A 2MEV3 1IS4A 2BBVA 4GB32 1SMVA 3VHNA 3JCIA 4YW1A 3SH4A 4AK3A 1QJZA 5FLIA 3UKVA 2W68A 2NMOA 4LO5B 1XNBA 1AR73 1JUHA 1AHSA 4LBLA 1APNA 2R16A 3OCPA 3CLPA 2IXLA 4AW7A 4EJRA 4GWMA 1YHFA 3RI9A 3SCGA 1RUC1 1XYNA 1NE4A 4ES9A 4HVQA 3AMPA 5BNOA 2NPIA 2OA2A 2YUEA 1VJ2A 3THPA 4CTEA 4DPNA 2D6OX 2PLV3 1PMIA 2QDNA 2ZAAA 1BEV2 3RJ2X 1ZRDA 1Z7S2 4IERA 3OYWA 4HPKB 4YZ3A 5EYXA 3OY8A 4WM8A 3VKNA 2Y38A 5L7OB 1Q3EA 3FLPA 4YM3A 3N7KA 1RMU3 1QGLA 3WW1A 3URFA 3VBHB 1HRI3 3MFCA 4XETA 2UWCA 3LZZA 4JDNA 3UJOA 3HT2A 1ND2C 4W6YA 4AEDB 1HV1A 4GQ7A 2H0BA 2JG8A 3I54A 4L9BA 3AKRA 1AR82 4ZXKA 1VBB2 2EF6A 4KH9A 4HZFA 4KQ7A 5LK5A 2XG3A 3WVJA 5C8CC 1Y43B 1B35C 1R1ZA 1ZZ8A 3ZX7A 1OA3A 1W6OA 2GC0A 3HD8B 1HQNA 1RUJ1 2ZMKA 1V6IA 2Y0OA 4OLLA 4RS5B 4JC1A 5D8AB 1MACA 4P14A 1HXS2 1KRIA 4XJUA 4Q29A 4XXAA 2B5HA 5CFCB 1ND3C 4AE2A 4MX3A 2VU9A 1C1LA 4XFBA 5FFOC 2GNBA 4KWKA 3J26N 2R062 4BWOA 1AJKA 4CDQC 2VVDA 2BFUS 2A3YA 3AP7A 2QDRA 2WINB 5FRAA 1QDCA 2XJSA 5CAZA 2PHUA 2BNMA 4AQ2A 2GH2A 2RR11 1MVEA 1YRZA 1UF2C 2ZTNA 2ZHNA 2KXLA 3SITA 1LCLA 1W6QB 4X8NA 3RRDA 4AI8A 2Q1ZB 2VVFA 1UL9A 1BVP1 2YROA 1QNWA 5FPZA 4F3JA 4X8PA 2D6PA 2Q30A 2W52A 2XVKA 1BKZA 4C0HA 1BYHA 4WZCA 4WM7B 5GZGA 4OVEA 5KHIA 3L2YA 3MIDA 1LR5A 3H1YA 3AFKA 1PGSA 4LTAA 3WZ1A 1YIPA 1MZFA 2RS12 5ACA2 4XPVA 1MS4A 4FVVA 4PDWC 1G9BA 1ZNPA 3O0VA 3WV6A 3QH7A 1LHOA 1S0GA 1ZBE1 4LA3A 4Q4X2 3E97A 2I74A 4GH4A 4QGNA 5HXVA 4QHBA 4KL1A 3AYEA 3FLRA 4YZ4A 5J98B 1OFNA 3K51A 3ZXEA 4E4DX 4CEWC 2ZX3A 3MICA 4AF9A 1XNDA 1WLCA 3DKWA 3MIGA 4K9SA 4LO8A 3BPZA 1V00A 5C9AA 1GANA 2CWMA 2TBVA 3IDEA 4CDUB 2BNOA 1BMV2 2ZGLA 4XZPA 1ZVFA 3V0BA 1J59A 3KT4A 4FP2A 3JBG1 4XIKA 1OQDA 3VBUC 4LEJA 2B9UA 2TNFA 1H2NA 5FBZA 2AUYA 5FAXA 4J6GA 1H9WA 5L36A 4FTEA 1M06G 1OOPA 1ZRRA 4JQRA 1WD3A 3VBFC 3TNPB 4Q0PA 4QPGC 4AGGA 1J3RA 3NV3A 1MS9A 1RUF2 1RUE2 3U07A 3ZFEC 3VZJA 1BBT1 4RL7A 1UPSA 5GZCA 2BPA2 1JXNA 5J3UA 3ZXJA 2ZZJA 1RUH2 1VBA3 4B7KA 1JH5A 4EN9B 2E63A 2ET1A 5L7OA 3ZFGC 2YHJA 3VBHA 5J7MA 2DCYA 3IBMA 1L3JA 1JYCA 1WCDJ 3JB8A 1PNGA 1A8DA 3GHMA 4PQ9A 2W08A 3RZZA 2EA7A 1LOFC 5ABJC 1EP0A 2TEPA 3J9SA 3WW2A 1CN1A 1XNCA 4AVAA 3E5UA 4Q4W1 5BNNB 1OQ1A 3LGRA 1ZZ9A 4HK9A 3MFAA 3LCPA 4Y1VA 2HWD1 1NYWA 4A7ZA 3C3VA 3KQRA 2D5FA 4LO6B 3OBTA 1RUJ3 4INDA 1A8MA 2GNMA 3H3UA 3PMSA 3ZFFB 1GLHA 4JDMA 1IGOA 2SBAA 5CFCA 1FNZA 4H7LA 2VW0A 3PVBB 1BJQA 3ZYGA 2H6CA 5T52A 2EVXA 4TYSA 4FPCA 2WNVB 3RQ0A 2A6XA 3M8LA 4UXAA 3VGIA 4XILA 2A6VA 5JCTA 2WA4A 4Y1YA 3AMNA 2RR13 3J4UH 1HRV3 2LTNA 1UU5A 1AF9A 3IPVB 1GFF2 2IXHA 3I7DA 4OI2A 2P37A 4M3CB 2PHRA 2JEMA 3I2DA 1O3RA 3BIWE 1EV11 1X7NA 2WQ4A 3WP3A 1U5ZA 1AYM2 4WM7A 1PZ8A 5DG1A 4XMIA 2Z2SB 5DZFA 4Q1RA 3M4FA 4J1WA 1LOEA 3GZTB 5JOZA 1DZTA 5JOWA 4YVSC 3WXPA 3WG3A 4EWEA 1LOBA 2XJRA 2HWC3 4H3WA 3WR0A 2VMGA 2RS32 4HN0A 1GZWB 1BEV1 2NYYA 1RUD2 1ZBE3 4FO9A 4NVPA 5A33B 1Z7S1 2GMPA 4HKLA 4P9YA 4L92A 5SV5A 4GMP3 4I2OA 1EAH2 2PA7A 3RG0A 1GICA 4HSJA 3RSJA 3WT3A 2D98A 4AEDC 1MVQA 1QXRA 1CAWB 1AR81 1IQAA 1RVF3 3WG2A 2VNRA 4CDUA 3R05A 1VBB1 3J8F3 3VLBB 1C1FA 2QNKA 4K6BA 4LE4A 4MGIE 3ILNA 1ZBA2 1FT9A 1PIV2 3MW2A 2XJQA 3HMYA 1C3HA 3RPQA 4B4RA 3ZSJA 1QJU2 2JXAA 1WW5A 3OD4A 3E6DA 3D4KA 2ZKLA 3AFGA 4RS5C 5D8AC 4QQOA 1DU3D 2ZGMA 4ZU7A 1W2UA 1HXS1 3ALQA 1F5JA 4OUSA 1SLCA 2Z42A 1NCRB 1H1IA 4URTA 1AX0A 4S2HA 4I0WB 1DDLA 2IXCA 3AMHA 2R061 1TEIA 1PK6B 4A7YA 1D0HA 1FPN1 3NKGA 3LWCA 2R30A 2R043 3PJYA 2K0GA 2GZWA 1PNFA 3VKFC 3ZPYA 5GLTA 3FE5A 2WZR1 1NCQB 1Q8SA 4WVWA 3ZSMA 4G9SB 4N9IA 3B94A 5GJ6A 2GC3A 1I6XA 2JJ6A 3GBWA 1CAUB 1ENQA 2ARXA 2LM3A 2X5IC 3ASIA 1RUC2 2XGXA 3ENRA 5CVRA 3HT1A 1VBD3 3EBRA 4Q4W3 2DFCA 3LB9A 1EPZA 5BNNA 4FCAA 4PF5A 3WD5A 4TZDA 3S7EA 2HWD3 4QGLA 4Y4YA 2RHPA 4LNVA 2Z5WA 1KQRA 4Y20B 2ZX4A 3OGJA 2OYZA 1KS5A 1GZCA 2ZACA 1BK1A 2DCTA 3VBSC 2RS11 1J3QA 1QH7A 4IEVA 5ACA1 4XFIA 2QJVA 4ORFA 1FMD3 1S0JA 1DGWX 3DGTA 4KU8A 4META 1BZWA 2YV8A 2WIIB 3I59B 4I0AA 1IS6A 3B5LB 5JDBA 3R4DB 2WNVA 1QXJA 4J1XA 2E7QA 2VH9A 3KSCA 1ND2B 2GC2A 1FAYA 3HIFA 4IV1A 4D69A 4LE3A 1AL22 1WMFA 5AC93 4IEWA 2CGOA 1NQJA 4YGEA 2EAKA 1QMJA 5H9PA 1F5FA 5KWRA 4QQLA 3IPVA 5H9QA 1ZZCA 4GB33 5FQ0B 1B35B 4XBLA 1BMV1 2BWAA 2ZMLA 5J48A 4CRQA 5KHKA 3VHOA 5K0UC 1POV3 4Q0VA 2BNNA 3KM5A 5KXBA 3DV8A 4XFHA 4DQAA 3AYAA 2ENRA 1BCXA 2PFWA 1ND3B 1QOSA 1S2BA 4DRVA 2R32A 2KM2A 2ZBJA 4M0HA 1YFXA 1RUF1 1RUE1 4P5HA 3ZYJB 1GR3A 2O8QA 5BPXA 1CPNA 1J1TA 4OHYA 1OLRA 4CDQB 4OHVA 1BEV3 1TNFA 1D0GA 1GZWA 1Z7S3 5T5LA 2ZKNA 1PZ7A 5A33A 1V9U2 1U5IA 2OVUA 3ZMNA 3NV4A 1RUH1 1Q8OA 2OIIA 3FUOA 2GAUA 2WNUA 4DMIA 2YGLA 4XW3A 2YMZA 5EJ3A 4FQ4A 4YW5A 1CAVB 1AR83 3NJZA 1CAWA 3KCYA 1PO21 4RHV2 3RWNA 1Z78A 1HX6A 2CYFA 3D82A 3WP4A 2ZGQA 2CGPA 3O7OA 2VQAA 4XE9A 3ZFFC 1R083 5IK4A 3E6BA 4FOQA 3FC0A 5E16A 5CA6A 5C4WB 1HXS3 1N47A 1RB8G 2CNAA 1X50A 1TMF2 1A3KA 4FXGB 5KXEA 1NCRA 4YYOA 4COYA 3M3IA 3OF1A 1TQ5A 1DQ6A 1C5IA 4CDWA 1XRUA 2A7AA 2R063 3B01A 1PK6A 4IV3A 2VQ0A 5EYYA 3VKOA 2JECA 4Y22B 4EROA 1SFNA 3SLIA 1KITA 1TME3 1LB2A 2AR6A 4GWNA 4S2GA 1ZZ6A 3JBG2 4AG4A 4LLFA 4GALA 1NLSA 4K21A 4YGCA 2ET7A 3VBUB 3H0OA 4W6WA 2VNOA 3B9IA 3NW4A 5KBFA 2P17A 4XFAA 3SCFA 3PHMA 4MSVA 4R4ZA 3M3CA 4BMBA 4YLZA 3VBFB 5BNPB 1KXGA 4QPGB 5HBAA 1UMZA 2A73B 3LSDA 1AYM1 5J37A 5DUUA 1YWKA 4CP1A 4QU2A 4NHLA 4YW3A 4Y20A 2ZMNA 2RS13 4OUMA 1JW6A 2A6ZA 3OJBA 1MQTC 1MZ6A 3JZVA 4DY5A 2JX9A 3KCCA 2RS31 3ZFGB 1RUD1 5FOBB 1SDWA 1V6OA 2DTWA 4Q4X3 3WDTA 3I59A 5H9SA 1OSGA 2R49A 3JD73 4NWWA 2VOVA 1YJKA 3M1HA 4FPOB 4BMEA 4YNIA 2UYBA 3GF6A 1ND2A 1XQNA 5ABJB 1EAH1 1LECA 1NG0A 2QZ3A 2RJLA 2HEVF 3KGLA 4ONUA 5GALA 3ZXLA 1WD4A 4BCUA 2ZPXA 3WG4A 4KG0A 2A6WA 1FV2A 1H1AA 2DUPA 3ZYPA 1PZ9A 2DCJA 5C8CA 5FDBA 5FQ0A 1B35A 1Q56A 2IXIA 3B00A 4R8HA 4IEUA 1WBLA 1PIV1 2A5ZA 2R1BA 3ZSLA 1DHKB 1D4M3 4UW3A 1S0CA 1NLRA 1QJU1 4GKXA 3USSA 3W9AA 3IM0A 1ND3A 4XF3A 2ETEA 1N1TA 4C0BA 1O7FA 1WLWA 1RUE3 3D5OA 3LSEA 3U0ZA 2ATFA 4MGKE 3IWZA 4KNCA 4C1XA 5J09A 1ASJ2 4CDQA 4FOYA 4LBQA 5CBLA 4OI4A 4KGQA 1LRHA 1X33A 3MF9A 1DBNA 4Q8KA 1DGRA 1A6CA 2X8KA 4FAHA 1NCQC 1IKPA 1UIJA 1W0PA 2C5DA 2B46X 1HQWA 4RSUA 1R1A2 4C90A 5CB7A 1EV12 4IEYA 3VDDB 1AR63 2BEOA 1PGW2 4Q2FA 3WLUA 3S0MA 2SLIA 4AEJA 4EWDA 5L73A 3JUUA 1CAVA 3FMGA 4MGZE 2UURA 1V6NA 1WA4A 3H50A 1U5YA 5FO9B 4I09A 2YGMA 1CJDA 4YVSB 3U10A 3CEWA 1YYNA 1ZZ7A 1QOOA 3AKTA 1G9AA 5KHJA 2QUOA 4PDWA 3AXDA 4RQPC 3ZXGA 4CYDA 4FT8A 4IESA 4S2DA 3TN92 3A4UA 1YUDA 1FNYA 3ZSKA 4YVWC 4EN7B 1G6NA 4QQPA 1H4GA 3R4SA 1YCIA 4CEWA 4JRAA 5KHGA 3LA2A 2VW2A 3H3ZA 3LOBA 4P9LA 1H9PA 1GYKA 2PAKA 1FOD3 1WBFA 4XDQA 3V56A 4Y22A 3KMHA 4L2NA 5FREA 2GH8A 4BPZA 1AL21 3QD6A 4H14A 4L8QA 4DS0A 2WSVA 4GA9A 5J36A 3D6EA 2JDZA 3VBUA 2BTVC 3HQXA 4QPIB 4L11A 1XE7A 2PHFA 2DTYA 2ES3A 2JG9C 4QGMA 3O14A 1E57A 1WMEA 3VBFA 2OUJA 4G3YC 1CGPA 4QPGA 1AYM3 4P9WA 3N35A 4FTSA 4BOWA 3ZFEA 3HR9A 1UN1A 3M3OA 4R9DA 2K9ZA 1S0EA 1WGPA 5C33A 1H2KA 3OD0A 4D94A 2YC0A 1VALA 2ZS6B 1FPN2 2FBEA 1UX6A 2FZ1A 4FAGA 3NWKA 1CX4A 4IQPA 1EPWA 1C8M1 2RS33 2PHTA 1RUD3 2UY8A 2D44A 2WZR2 3ZFGA 1MZEA 2XWJB 4D7YA 4AI1A 1V9U1 2HWE2 2BFUL 1W0OA 4Q4V2 4ISQA 4PJYA 2GMMA 5LK7B 3IDCB 1EAH3 2DUQA 3ZO0B 5ABJA 1LOFA 3CNAA 2VUJA 2BUKA 2E9QA 3ZN6B 2X5IB 2NP0A 2BQPA 1WCSA 2A3WA 3WDWA 4LO7A 3CU7A 2K2SA 1EY2A 2JKBA 2DU1A 1COV2 4FPJA 2EIGA 3AM2A 1ZBA3 1ONAA 3S6PA 4RHV1 3AX4A 4ZU4A 1IPKA 1GNZA 5CNAA 3VBSB 3O12A 2D6MA 5JI7A 1RUG3 3VHRA 1QJU3 3S30A 3BB6A 4XJAA 4BZ4A 2UU8A 4W6XA 4NO4A 4EN6B 5C4WC 1PM7A 1QJY2 4FQZA 1H8TB 2WZPP 2VMHA 4E9KA 1RHI1 2GN3A 1TMF1 2UYAA 4LULA 2A70A 2XBO3 2VNGA 5AFBA 5JOXA 1TE1B 2B8MA 2IWGB 1CVNA 3TYJA 5FOJB 1SCSA 1IS3A 2HWB3 2HEYF 5LEJA 4YM2A 1VAMA 3MGUA 3N7LA 4XF0A 3VV1A 2E53A 2V09A 5I0SA 3MW4A 3WDUA 5KC5A 3RDIA 3AXEA 5K0UB 5FO8B 1YNAA 2XJPA 4Q4Y2 1RUC3 3JQXA 1G7YA 5JOYA 1AX2A 4LBJA 5BNPC 4BIOA 2VVEA 4YVSA 1XU1A 3WDYA 1G8WA 1PO12 3G7DA 2C9AA 4E4ZA 3MPPG 3ZYIB 1AYN1 4M00A 2X53S 5CFDC 4FBFA 4HPKA 3QACA 2AGSA 3AZWA 4Q27A 2D6NA 1LEDA 2CY6A 2PHDA 4SLIA 5T50A 1SLIA 4F83A 3RYPA 1GSLA 2WT0A 5HI0A 4N43C 5BUVA 3QCWA 3WUCA 4AEDA 1QJX2 3UL2A 5C8WA 3AB0A 4AHYA 1U0AA 3P3NA 3BOPA 1WUVA 1AL23 1K5MC 1PO22 1UCXA 4ZKTB 3AP6A 4D7TA 3M7AA 2I45A 2QCSB 4Y5Z0 2E7TA 4PBOA 4AHWA 3NVCA 1HKDA 3AKQA 3R0RA 2MEV2 2VGDA 3SH5A 5E1RA 2G9GA 3SISA 1WMDA 1O5LA 2HKXA 2WT2A 2XUMA 1FI2A 2W39A 5FLHA 5CADA 4LO4B 2ZGPA 4RS5A 3L9JT 5D8AA 2ARBA 2PAEA 5JIUA 1ALYA 1RINA 3O0WA 3NAPC 2G4IA 2WFF1 4Z2WA 2A75A 1H0BA 5CG9A 2WQZC 1OPOA 4AQ6A 4P9GA 4YM0A 3NV2A 2PLV2 2XHKA 5JZGC 2CAVA 1XXNA 1ASJ1 2I2SA 1X8EA 5JIAA 3WDXA 1LHVA 4JRLA 1C8NA 1OHFA 4RGAA 1G9FA 1ULEA 1RMU2 1W6QA 3N3HA 4FPEA 1PGL2 1CONA 3KT1A 3ZN6A 3VDDC 2X5IA 2XH6A 3VBOC 1R1A1 4B7EA 4HLTA 2G9FA 2YY1A 4BYYA 3SCHA 2AZ5A 1O5UA 1YI7A 1VP6A 4C91A 1PGW1 2PTMA 4CEYC 1IHMA 1YFYA 3N4MA 4K40A 1VBC1 1WW7A 4A7KA 2DVBA 3HWJA 2DYCA 1O4ZA 1DQ4A 4OFGA 4FTBA 1OI6A 3TB0A 4ASLA 5JMCA 2VPVA 1QQP1 1MQTB 3WHUA 2ZX2A 3T1MA 4AVTA 3MLKA 1AUYA 1W6NB 4HL0A 2NQYA 3TN91 4O9GA 1IPJA 1TMF3 5GLVA 1RJ8A 3R6SA 2F6BA 4AQTA 4Q0QA 3QLQA 2Q0AA 4PBPA 4IEXA 3RJRA 1SFYA 1CD3G 4ATEA 1UW8A 1WLTA 1HLCA 1GKBA 4HT1T 2WLPA 3JBG3 3FUQA 4KGGA 2VY0A 1YFWA 2D40A 4QPIC 3WP5A 4Z92B 1EYBA 2ZOEB 5K0UA 4TSVA 2BGCA 3H1WA 4DOUA 1J3PA 3CJXA 1OPMA 5KXDA 2QE3A 3I4IA 4HVOA 3GBGA 2DCKA 1BBT3 3L2HA 2PAMA 2EXHA 3WUDA 2IFWA 4LBOA 5BV6A 3PVEA 1I3HA 4XBNA 4QXKA 4AHZA 4A2UA 1LJ7A 1GZ9A 4XFGA 1QF3A 1KD7A 4LA2A 1W6PB 2Z69A 2Z79A 4CDXC 2HWE1 4GXLA 4Q4V1 1M4WA 1CPMA 4AGVA 1YO8A 2W0XA 2R6QA 2Q5TA 4K1ZA 3VL8A 5LRSA 2Y26A 2D93A 4EV0A 3TOJA 1A78A 3VHPA 4M3CF 2B7YA 1REDA 3EXUA 5AVPA 5FMOS 4PCRA 3HBZA 3N36A 4TWTA 1HW5A 2WSUA 2Q8OA 1RUNA 4LBMA 1COV1 4AXOA 2VMIA 2D6KA 2A6YA 4Y26A 3ZFFA 2ZA9A 4RQPB 3PMEA 3GHNA 1Y7BA 2CV6A 2BWCA 4YVWB 1QHDA 4F8AA 4JTNA 2CWSA 5T5JA 4NHMA 1H8TC 1QJY1 4KBBA 1H4HA 2RS52 4W65A 4MH0E 4HKWA 3V65A 2RMU2 4LR4A 2ZX1A 5EXOA 4HANA 3LOIA 4I30A 2ZJCA 4N53C 4JV4A 3D0JA 1QOTA 3K48A 2VOWA 1C28A 4YG3A 3VBRC 1VBE1 5F9TA 3AZZA 4M3CA 4JGYC 2ZZQA 2DFBA 4AVVA 2JG9B 2FMYA 3PVOA 1EV13 4MZUA 3HAGA 3VN4A 1Q8QA 1PVC2 3TWIA 2E7AA 3FFZA 4MV2A 3H1MA 4Q4Y1 1R092 1KJLA 2IFRA 1VB4A 3ILRA 2RJKA 1RUI1 4BM8A 1ZREA 4BQ1A 3B69A 1X8MA 2GALA 2YDEA 5DUXA 1G9DA 2PHLA 4B3NA 1C8M2 1G9CA 1JYIA 1PO11 1MQTA 5KC6A 2ZHMA 4R4XA 1H2MA 2GU9A 3SH3A 3AP4A 1W6NA 1FXZA 1LODA 4MUVA 3MI8A 3T1LA 1XYOA 5A32B 5I93A 4XYXA 3S7IA 1QH6A 1AZDA 2QZ2A 2MHFA 1DYKA 4XXPA 4BIFA 4JCKA 1RUOA 5IT6A 4MXWB 1N3OA 1ULDA 4R9CA 4E2SA 4AFAA 1UU6A 4WZFA 1QJX1 4PLNA 3CJIC 5BXXA 1VBB3